4PRNA

Crystal structure of a hla-b*35:01-hpvg-a4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prnA01
3K81A 4XWGL 1MFCH 4DCQA 2R0LH 4XCCH 3VFTA 4EI5C 1F90L 2Z91B 1CDGA 3KYOB 2D0GA 4P2OA 4R3SB 2GJJA 1ZHLB 5L88H 3SE8H 3NH7L 4N0CD 1CGXA 3WFDH 3BUYA 3ILPA 4K23H 5JW4M 1HHKB 2PTTB 2V5MA 2E7LC 4YFLF 4CVXB 4YX2L 2V6HA 2NW3B 2EDQA 4R4NC 2J8UA 1QQDA 5MERA 2JJWA 1HEZB 3MC0A 4G3YL 1JYWA 2EC8A 4HF5H 4HS6A 1FO0L 4W70A 2H3NA 2I07B 4Q9QL 3FQRB 5IKCA 1E4WL 1KCLA 4KXZH 3QDGE 4NKDB 12E8L 2QSCH 3FN0H 3KYKL 1FRGH 2EDFA 4M9PA 1MJJB 1YEIH 3D0LA 4MCYB 4XCYB 3E2HB 5D93C 3HUJA 4X5WA 5ITFB 1NLBH 1T6VN 3EO9L 3UAJD 4P5TD 5MENA 1LDSA 1XR8A 3MQIA 3QWQB 1U92B 3OKKA 1WFTA 2XI9A 4ESKA 1YEDA 4AEFA 1NCWH 2YBRB 43CAA 4JO1L 3KPPB 1N5AB 3OR6A 1UM4L 1CD1B 3QNZB 2OR9L 3CVIL 1ZT7A 2ARJA 4X6BA 4N0CC 5HYJA 3EYQD 4RWHA 2NY1B 1T2XA 5C7XL 1AKJD 1PZ5B 3BZ4A 2PYEB 5I18H 5JA8B 5K9JL 5KSUB 4JHWH 1CD9B 2RIKA 3RHWK 4GW5A 1T0MB 5C0RL 5L7XL 2E7HA 3S96B 4HC1L 4KROD 1UB5A 4JRXE 5JLZA 1QBLH 1QSED 1T22B 3AY4C 4ZOAA 3LDBC 4JRYE 1BZ7A 3RPIA 3L3HA 1T21A 1TCRA 2RCSL 1YYML 3G6JF 5I30L 1ACZA 1D5MB 4PJ7B 4QRTA 3OJDA 4ZD3H 3MV8B 3P9LB 5DWUH 1TJGL 2E7LA 4Z7VE 3WNLA 2O5ZL 4XBGA 2P5WD 1L7IL 4PGCA 5D6DC 3HCVB 4TSAH 3UAJC 3UJTH 4P5TC 5LXGL 3V6ZB 3QHFH 1KLUA 3OKNA 1R6VA 4NM4L 4QXWA 1ZEAL 2BFVH 3Q1SL 4JG1L 1RK1B 1PG7H 2CRIA 5CP7A 2NYYD 3U83A 1MFAH 3TT1H 1IT9H 5IV2A 1N0XH 1A9BB 4UTAH 2VISB 4RNRA 4JPIB 4B5EA 4LIQE 3SGEI 5IB1B 1YEHH 4HS3B 3QNYB 1NUGA 1X5YA 2HJFA 3EYQC 4QRRD 4L8CB 3M1BA 4JHAL 5M7QA 3UBXG 1AE6H 2V7HB 3QDME 3DRQA 4HMDA 1CGVA 4X9BA 2LU3A 5K93A 1DQLL 5LGHL 4G6AD 3S36L 3IDJB 5BMFH 3KPSD 1ZLSH 4GXVL 3SGDI 2I9LA 4R96B 1CLYL 1DANT 4KROC 1T89A 3ZMRA 4TSBH 5DK3A 1JRHI 3BGAA 3H7LA 32C2A 1RZ7H 1IGTB 2XZAH 5FYJL 2IALA 1RJZB 3MXVL 4L29A 4N0CA 5JW3L 3N1GC 3ARYA 1FIEA 3QFDB 4KKLD 4Z7UB 2Q6WB 1CFBA 3FQXA 2V17L 3MRRB 1IJ9A 1QFHA 3P3YA 3PQYB 3TPUA 1U2HA 1DEDA 3S6CA 5HHOB 2VDOL 3MMEB 3V4UH 2VNCA 2Z31B 5LGKA 4PJ5E 2W1NA 3ZDYE 1ZS8B 2NYYC 5ACMA 5CZXD 5FFLA 2DKSA 4G8IB 4PJCB 3AY4A 1KJ2H 4P2RE 3MREB 1MF2H 3RHWF 3TVMC 4JZJA 4M61B 5CZVH 3KXFB 2BNQE 3QZWB 4LLQA 3IU3B 1A3LH 4RWYH 3RIAK 4K3EH 3SJVD 5D1XA 1GOFA 4UIKH 1QBAA 1G6RL 1RUMH 2PKDA 4OLYL 1I7ZB 4P3DA 1S9KC 2WW8A 4Q2ZB 3PDOA 5D6DA 4WJ5B 1G7IA 4J3XA 1G7QA 1LEIB 1L9MA 4XPAL 4GAFB 3MJGX 3HE7D 4NCC1 1XGUA 3AC0A 4Y1AE 2AP2A 3X11A 5D70H 1JYXA 2WINA 1HQ4A 4LRNL 1BOGB 1RIVH 2FGZA 2P46B 2XKNA 5C0AE 3MV01 4P9ML 5AG9A 5FYKD 4Z76B 5CGYD 4LEXH 2WQ8A 2R0KH 1F2XK 5CBAB 4G7YH 2DLFL 2OP4H 3PXJA 1A6AA 5HHVL 4KKLC 2O5XH 1QFUH 1OTSC 3CFEB 4WNQB 4ZAKB 1B9ZA 2XRAL 3GMMB 2D0HA 3KPTA 3L3GB 5DMJB 5SWSA 4DVRH 3ES6A 1RI8A 3HS0B 4S2SB 1A1OA 4R0LA 5T1DH 3TIEB 4NWTL 3BGMB 3CJJA 5DSCB 4X6CE 4X99A 1X6LA 3ARSA 3OKOB 2BRRL 1V7ML 1NC4A 1CR9L 5D71L 5CSZB 3TV3L 2NY2B 1TLKA 4KV5F 5BO1L 1XZ0A 1URLA 4XVTH 1I8KB 4POZD 1UWGL 2P5WA 3IJSB 3MV9E 2EH8H 5EULV 3V5KA 4LSQH 1KJ3L 5LGJB 1FAKT 5GGTH 1N4XL 3HE7C 3UDWC 4BSVA 5B22A 5J56B 5DJ8A 5T3XL 4WV1A 5L2KE 5EU3A 4ODSH 1HH6A 1EBPA 1IAIH 1A4JA 3EYFA 3GHBH 4QHNB 1J8KA 3VXSB 4L3EA 1I9RL 3TVMA 4HK3N 4PGZA 5CGYC 5J1TC 3BKYH 1W0WA 1X7QA 3QAZB 1CFNB 2X1WL 2G5BA 3LN4B 4PJAB 5DI8A 3UBXA 3MRHB 5TDOA 5KANG 3FN9A 1OF2B 3C87A 3LKSA 4W68A 2FD6H 4Y8AA 5HY9A 3PWUA 3RIAF 4X4YA 3QXWA 1XIWA 3QQ4A 4OM0L 1DFBH 1ZHKB 1ZA6A 3KYMB 25C8H 1EHAA 5DRWB 3JV4A 5LG1A 1DBKL 4ODTH 2J6EA 4A2MA 2NY1D 1H3VA 3O2DL 3LQAH 2PYED 1EEYB 3ESVF 5DK2B 3GO1L 1FNAA 4NKOA 2DLIA 4KZEL 4XPGL 1NANH 2AXFA 4NQVA 1HOCB 4N1EA 1NQBA 2DWDB 4POZC 4LLMA 2EKSA 2CLZA 3O4OB 3TNNB 4PRNB 3TO4B 3AMKA 3OAZH 3FB6A 1JWSA 1NGPH 2X70B 4GRWB 5TJWK 1VDGA 4Y5YB 1OTTD 4KI5F 3UTOA 1X5XA 3Q6GL 2MPAH 4KU1A 4NM8H 4X4XA 1IC7L 3JWOC 3MV8D 4NRZB 1DLFH 3D3VA 2APFA 3WV0A 2Y7QA 2ZUQC 3QO1A 1RZIA 1N8ZA 2APBA 3PGCA 3SJVA 1RK0B 3GJFA 1JF1B 1DBJL 1NLDL 1S7UB 4KRMB 4APQC 4QHKJ 4KVNL 4LRIA 4U1HA 1B4RA 4XB8A 1NBVH 4KMLB 5TDNB 3JWDC 2COQA 1JP5A 3O8XA 4KVCL 1J1XH 1MHCA 3P4MA 4NN7B 3GSQB 5HGDB 2R0LL 4XCCL 3F7QA 4XNXL 5BXFA 5D9SB 2B4CH 3ZYJA 1H3XA 1UZ6F 2NY1C 1ORSB 3SDDA 3AS0A 3GMOB 3HC4H 4YO0A 2PO6A 4YHOH 3SY0B 2FIKA 5L88L 5BVPH 1KEGH 1FL3A 3WFDL 3G6JE 5I1HH 1I3VA 4K23L 2UZIH 5F93C 4UTBL 5DZOA 5EBGA 4Y19B 4MB5A 4M5ZH 5EZIH 5JPNA 2EIZB 4D8PB 2BY2A 4OI7A 3BAEH 1YPZF 4UT9H 4N9GA 1U8HB 4IRSC 1JPGA 5TF0A 1DR9A 1TVBB 3GSNA 3SKUD 3MRMA 2EO1A 2GITA 3E6FA 2CR3A 2XZCH 1JVKA 2QSCL 3FN0L 4GOSA 4PY8I 2DD8L 1FRGL 3BKMH 3PQYD 3SDCD 1ES0B 3DO7A 5HHOD 2YUWA 1P4LB 4PD4K 4OM1H 5DEGA 5IB4A 3VA2C 3MJ8B 3PGDB 5GSVA 4X7FC 3G6DH 3H9SA 1P84K 4QTHB 4MZ3A 1ITCA 4QF1B 3QDJA 2VLME 5ESVB 2N4IA 5C0BA 4CAGA 1IM3B 4XMPH 5I8KH 4F9PC 1QZ1A 1ADQH 3MV7E 3DIFB 4F7TB 4XC1H 3LD8B 1M4KA 2QBWA 4APQA 5C0GB 3WLWC 3L6FB 4JHWL 3D2UB 3OGCB 1KLGB 3DPBA 4WGVB 2G75B 1K8DA 3KPPA 5T3ZE 4DUXA 1JWMB 2C5DC 1QBLL 15C8H 5CP3H 4TNVK 3DETD 2P5EB 3U7AA 4BELD 5HPOA 3UO1H 4N8VG 3GHEH 4YZFF 4P57B 3P11H 2QQKH 1KF9B 5EFIB 3KWWB 2AK4B 4ZAKD 5FKAB 4ZD3L 3SDCC 5DWUL 3S36X 4FFEX 3NCJH 2CSPA 2DQGH 1MH5B 4TSAL 3UJTL 5JXEA 3S34H 5IEKB 3QHFL 2RGSA 5INDA 2I9TB 4IRSA 2BFVL 1T22A 1TITA 1PG7L 2ZG2A 1DL7L 1IT9L 1N0XL 1GZPA 4UTAL 4PJ7A 2NY2D 3T3MF 5CS7A 4OZIB 3MV8A 5FM5M 4WDIB 1JZ2A 2BOBA 4IRZH 1YEHL 4QCIA 1DQTA 3LKQA 3HR5A 2RB8A 4OLUL 7CGTA 1M1SA 1UJ3B 2GUOA 1AE6L 4FFWC 4HUUB 1QR1B 3H3PH 3SQOH 3PHOB 4GS7C 4J1UA 3SOBH 4OAWA 1ZLSL 1PFCA 5BMFL 5GRWA 3BFOA 3I84A 5DMKA 2OMBA 2QQLH 5T5FH 4GMTH 1A9BA 3VXSD 2F54A 1WBYB 1S5HA 1O5DT 2VISA 4D0DA 4TSBL 5ERWA 3RTQB 3DTXA 1NEZG 5MEOB 1RZ7L 3DETC 1OSZB 4L8CA 3KLAB 3C09B 4U6XB 5E7FA 5E5RB 4F9PA 1EAJA 4F57H 3IJYB 2AEWA 4ZAKC 1F4HA 5CZKA 5EZOL 3WHE1 3GSVB 2WIIA 1M7DA 4KMTH 3BZDA 3RU8H 3V4UL 4Z77A 1GCFA 1SJXA 2A9MH 3QXAB 3BIAX 2NY0B 1T1WA 1T1YB 2NY6C 5D4QA 4RMSA 2CLVA 1CBVH 5B38B 3T0VA 2HRPH 3HAEG 5IFJB 1JFMA 1RJZA 1U3JA 1FAIH 1KJ2L 3DV6B 1MF2L 4X6EA 3CH1B 4ZUTA 5CZVL 2NY2C 3UTSA 4AH2A 4UBDC 1NGZB 3MRRA 3VFWA 1A3LL 4RWYL 4MQ7B 5DA4A 3DX9B 3I50H 3LV3A 3SDCA 4LEOB 1U95B 5FECB 1UGNA 4UIKL 3MMEA 5ISZD 3AVEA 4OCXH 5A16A 1RUML 2EDDA 3TO4D 4TNVF 1JIBA 1ZANL 5E4IA 1WCBB 4XNQB 3C60B 2AABL 4OF8A 2N56A 3P30H 2X4UA 5BRZE 1CZ8L 1TZGH 1B0WA 4ODBD 1AP2B 4MYWB 2H6PA 5D70L 4ZYKA 1RIVL 3QAZC 3UYRH 5AUMA 4LEXL 3K1KC 2J6EH 4XP1H 3MNWA 2R0KL 1KUMA 1I7ZA 3VFGH 2ESVE 4PRHE 4G7YL 5JW5B 2OP4L 3K1DA 2O5XL 2UY6A 2ZKHL 2C3VB 4G42B 5B8CB 4OUOA 5IHZB 1QFUL 2C9AA 2HKFH 3L5WB 1N2RB 4I0KA 4Q9RL 3VE0A 2V7NA 2D2OA 2KZ1B 4D9LH 4DVRL 4YPJA 3VXNB 3T77A 3VGDA 5T1DL 4TRPL 1UENA 1DQQB 3VXQB 3BT2H 4LAJH 4R9HA 4N8VA 5KAQF 3ISWA 1EO8H 3BVNA 3CFEA 4TULH 4Y19D 1L8JA 4ZAKA 3TO2B 3RWGA 3O4OC 1WFOA 4Y1AD 4ELKA 4XVTL 1I1RA 4XGZB 1J8HE 1K3IA 1KC5H 2XFXA 2WQRA 2UUDK 1YY9D 4S2SA 4HAFA 5B39G 3CLFH 4LSQL 1FZJA 1IAKA 3GJFH 4KJWC 4MSWB 5GGTL 4Y5YC 3TIEA 3VXTB 5DUMH 3BXNB 1GSMA 3SKOB 1MI5B 1KT2B 4ODSL 3TIDA 1IAIL 2NTFB 3GHBL 4M1CD 1W72B 2C26A 5HTSA 5J11C 3KPMA 1UZ6E 2AK1L 2ZUWA 4HBCH 5IBTH 1CICB 2VAJA 1AGEB 5CJ5A 3MACH 1EHNA 4MQTB 5BCAA 4KGLA 4UIMB 2HN7A 3IJSA 5FYKH 1ZTXH 3FO0H 4PJXB 4GMSL 4E41E 1HILA 2PN5A 3SDXB 1XF2B 4HUXB 3NBNA 4UAOB 1IAIM 2GTWA 4NN7C 2DTSA 3E8UH 5DFWH 4YIQB 4X6DF 4XP4H 1YPZE 25C8L 4ALAH 3L3JA 5HI3D 1NFIB 3S35H 1KENH 4ODTL 3U7YL 1TPXB 3B4NA 1NEZA 3DVGA 5I8EA 4Z7VA 3GSNH 4I48B 3LN4A 1F13A 4NFCA 2RFXB 4C55A 5CFHA 4JFXA 4KRNA 3QEQB 3MRHA 4X9IA 4P2YA 1RUKL 4Q58C 3RNQB 3WO3B 3D2UD 1OF2A 1S7WB 3VW3H 3LS4L 2E5EA 1UC6A 5ENWB 2YPLE 3DUSA 5SX4H 1U58A 1IE5A 2X1QA 4Z7WB 2YKLH 1ZHKA 4DZ8A 3C5SA 4PGBA 2AI0H 1YY9C 1RUQH 4XPHH 3FT2A 4L9DA 1NGPL 3PABB 1WWAX 3W9EA 2P5ED 4KWUA 3TFKD 3U9PH 2FR4A 1XGYH 3BJ91 3HAEA 4UDUA 2MPAL 4UNTA 4ZS7H 1BAFH 4NM8L 4M1CC 2AK4D 3BKJH 1R3HB 2IJ0C 5DK2A 3HLAA 3FCTB 3TCLB 3CGTA 2B2XH 5TGBB 4NO0A 1DLFL 2GJ6B 3JWOH 3WN5A 4CJ0A 5ISZA 2YD5A 4BFIA 5FA3B 3SGJA 2EC9U 4JREB 3NFNA 1J0JA 4D94A 3RL1B 4DUVA 3O3DA 4BJLA 2VO5A 2HWZH 2OTUA 3NFSH 1D5XB 3F7YA 5IG7B 1J1XL 5HI3C 1JUFA 4NRZA 4XRCA 1BJ8A 2VH5H 3HC4L 2M8XA 4YHOL 1MCIA 2VWEE 3WXVL 4I18B 5BVPL 5I1HL 5CJBA 2PR4H 4S1SH 1JF1A 2UZIL 1O7SA 4PJ5A 1O0VA 4J3WA 1IGYA 1F4AA 5JZ7D 3U7WH 2QR0B 2HLAB 4M5ZL 2Q76A 3K8KA 4YGVA 4ETQB 4ZUVB 1J88A 1OARL 3BAEL 4KFZC 2Y6SD 3BP6B 3HNSH 2ATPB 5HGGS 3RTQD 4YBQD 3ZKXB 2ZSVA 2AXJA 3GMOA 1FNEB 3SY0A 3TFKC 2BNQA 1B0RA 1CTNA 1SYVA 2YWYA 2XZCL 4X7DC 3HZKB 1SJEB 4B41A 2NY5C 3BKML 2VQTA 1TZIB 4ODWB 3CZFB 3MR9A 2FX8H 3U0TA 2Z8RA 3MZTA 1C1EH 4N0FB 4OM1L 1VEMA 4HS8H 1OGAE 3UTPE 4D8PA 4KY1H 4Y1AA 3RUGF 3ECBB 1R3JB 2H9GA 5IK3B 4I1NB 3UTQA 2X4NA 3G6DL 5B39A 4F7PA 2AVGA 1AR1D 4LU5H 4ODUA 1G9MC 3GMNB 5EZJB 5C0AA 4MNQD 5EO1A 1K2DB 3BZFB 3C08H 3C9NB 1I3GH 4CVZB 4HUWA 4MJ6B 4XT1C 5DRXB 4AIZA 1ES0A 1VGKA 1ZHBA 3IETB 3UPRB 1P4LA 1UJ3C 4K7FB 1MCSA 3HZVB 4XMPL 5I8KL 5I0ZA 1F8TL 4F7CB 2BDNL 1DDHA 1HDMB 1WLHA 3PGDA 1BVZA 4CU8A 2E3VA 4XC1L 4G8GB 4U6TA 4WUUE 5MEQA 4R7NB 5JZ7C 4KPHH 3CK0H 1ITBB 1PG7X 1IEBB 2NW2B 3IKCB 3MOAL 4X6CA 1Q9WA 3OKYA 4OZHB 4M62H 3RTQC 4YBQC 3DVNB 4PJIF 1F45A 4HKBA 15C8L 2WZPD 1IM3A 4XCNA 2VRAA 3GHEL 5KSBF 3P4LA 4G9FB 2QQKL 2XXMB 4OGYL 3MV9A 3AB0B 1CDUA 4PJEE 4TUOB 2X4QB 5IVZA 3D2UA 4ERSL 3NCJL 5IVXE 1I1YB 1BIHA 4OI9A 1XGQA 5ALBH 1NBQA 1HSBB 1FBIL 4PJDF 1I3RA 5L2KA 2VLMD 1XH3B 5IQ7H 1AR1C 4X8XA 4F37F 2K7PA 1BZQK 2DWEB 5TFSL 4UQ3A 2IQAA 1Q94B 3GMRB 3LEXA 2Q86A 4JAMA 1A64A 3BWUC 1U93A 4ORZC 3PHSA 3EHBD 1JGVH 3MA9H 3MV7D 2YPVH 2AK4A 4P3CH 4IRZL 1G9NL 5DMYA 5J4MA 1AIFB 1S9YA 1CGYA 4MDIB 5DF0A 3S9DB 1OT1A 4QXGH 3H3PL 3SQOL 5CBEA 3SOBL 1KN4H 1MI5D 1KTLB 2WBWB 3WCYA 3IDIB 2BSSB 2GJZA 5T5FL 3GRWH 4ZO7A 4CW1A 1I85C 1BREA 3I6GB 4PB0H 4FFVD 2XG5A 3ARUA 5C9KA 3NMEA 2DS4A 4HUUA 5B8CC 3W39B 4N90D 1WSST 1WIOA 3EUUA 1E0OB 4OGXL 3REWA 4XNMB 1LVEA 3QCUL 4KMTL 4AENA 1JK8A 3RU8L 5DLMH 2JCCF 5DJ2A 1V7NH 5T1KA 4IBLT 1MCOH 5EOCL 2VLKD 2A9ML 5DEFB 5GGRA 1F3JB 3RTQA 4JFFE 3GBMH 2F53E 1II4E 3VWKB 1OSZA 3U0WL 4AT6B 1CDBA 3CDYA 1OOAA 1G1CA 4LCCB 3HNTH 1FAIL 4NQUA 3QEQD 2ICWI 4HIEB 4ZPTB 5DT1L 5I8CB 4HKJB 1LK3L 1R3LB 3FB5B 3WFEH 4LSTH 3WJLA 2YA1A 2GK0A 4TN9A 3I50L 3OKDB 3QI9B 2OSLB 3SDAB 4OCXL 1FE8H 4PBWD 1NKRA 2IFGA 4HIIB 1H9VA 2DQCH 1PEZA 3FFDA 4KJYB 1FN4B 5DD6B 3B83A 3P30L 5CHNA 4NO3B 4XPFH 5H2BA 4QKXB 3MRQB 1T1XA 4MNQA 5CJOH 1S7TB 1TZGL 1MQ8A 3DV6A 2DQHH 1J0YA 4OV5A 4JDVB 4LPCA 3G6JA 1T1ZA 5F6HJ 2GJ6D 3X14A 4GG6F 4XPTH 4MQ7A 3UYRL 3F6LA 3BD5A 1YEJH 2XXCB 1FYTB 2J6EL 4XP1L 2A6DB 4QHMA 3VFGL 2IPTH 1EFXA 1MRDL 2ZPKH 4UAOC 5F72S 1VESA 4R97B 2HKFL 1AO7E 1Z2KA 3ZO0A 1CL7I 2L7JA 4D9LL 2D7TH 3E0GA 5L2JB 4RFOH 1AP2A 1TPXC 1VFUA 4RFNB 2ADIB 3BT2L 4PLKD 4EQ2A 2B39A 5KN5B 3ZTNH 5JW5A 4OF7A 2GFBB 2OL3A 2LTQC 4LIQH 4X98B 2ZNWA 5F3HB 1XF3A 3HAEH 4PRBA 4S0TD 1J1OL 3MUJA 3L3DB 4OTXH 4FABH 3IXTA 1MFNA 5CEZD 1WFNA 2VITB 2RQ8A 1KC5L 3TH3T 1LO3H 4K94C 1R24B 4HUNB 4FQJH 4QNPF 3GBNL 1NFKA 1DQQA 4L8SC 1HHIA 4P4KC 3QIBA 4YPGA 2DBJA 2DLGA 3G5XA 4TOYH 3VMOA 4F9LC 4NZRH 4PRAB 1EHXA 4R90H 3HI1B 4LMQE 3GMQB 4HBCL 4JKWA 3MV7A 5IBTL 5C0IA 4XHQA 3TN0A 5SV3A 3MACL 2WBKA 2BVOB 5C0FB 4XGZA 3VXRB 4JREC 4MLSA 1BFOA 4LQFH 4H8WH 2BOCB 3VGAB 1ZTXL 1AXSA 3FO0L 4PJBB 1Y6NR 4MSWA 1WVZA 4RBPK 4O51A 1HINH 5GGSA 1P4BH 1KT2A 3HHRB 3E8UL 5ADPL 5C8JB 3GSWB 5GXBB 1CXIA 4XP4L 1B4JH 4GKSB 1WK0A 1U8QB 4ZO8A 1FL6B 3S35L 1KENL 4XB7A 1XGRA 4KK5D 1UB6B 4W4OA 3T0EB 4KQ3H 3V8CA 1B0GA 4PLKC 3R06B 3X12B 4PRIB 5F8RC 2UWEB 3GSNL 3JWNC 5HHNA 4G8GD 1I9JH 1INEL 4HJGB 3SDXA 3MLRH 1XF2A 1YMME 3TM6A 3VW3L 3QIWC 5C0JB 3RWCA 1DUZA 3C6SB 3H2WA 2YKLL 4V3EB 3ZKXC 3RUGE 2FBOJ 4I4WB 3D5OF 4MD4A 3U1SH 2AI0L 1R5IA 1RUQL 1NFIA 2GSGB 3MYJA 4XPHL 3B9AA 1QLEH 2VLKA 5GS2D 3KPRE 4Y88A 3S97C 5FGCE 1MJ8L 3U9PL 1XGYL 1CFTB 1T5XB 5HD8D 3IFOB 4ZS7L 4FP8H 4G9FD 5F1KC 2B2XL 3BDXA 1XGPA 1S7WA 3QNXB 2Q87A 1A7QH 2G60H 5D6CA 3CFBA 4XNUH 5I1JH 4MQSB 3FFCE 4GAYA 3W9DA 1MCWM 3FOMB 1KEMH 2EYSB 2R23A 3LIZH 1JNNH 3MRCB 2HVKA 2PNDA 2K7QA 4L8SA 1I1FB 2HWZL 4P4KA 1CG9B 3NFSL 1UKTA 1SBSH 2ADFH 3C8DA 1VERA 4PJIE 1I4FA 3ARWA 4KK5C 4F9LA 5TGBA 3H3KA 4LLUB 2VH5L 5FGSA 2OMNA 4PJHE 2GJ6A 2C7UA 4Y4KA 3GMLA 5I66B 1DZBA 4YUEL 5KSBE 2PR4L 4KKCD 4S1SL 1CGUA 2FLRT 1S7QB 4TPRH 3PWVB 3D18A 4HG4J 3WS6C 5HHME 2H8PB 3V6OE 2DICA 1HE7A 1CDHA 3PF2A 4YFDB 1JWUB 4L1DA 3U7WL 4ZFOB 4MNHB 5LKNA 5IG7A 1ZLVH 2R4RH 5GRUH 2VLRE 4XXDB 3TBWA 4PJDE 2XQYG 2YXMA 3HRZA 2B5IB 1SYSA 1HK6A 1E4XL 5HGHB 1KNOB 43C9A 2W65B 4PREA 5HD8C 1FZKA 1RZGB 5E95B 5C9JB 4WI8A 3ILQC 5EIIB 1L9NA 2G9HB 2Y25A 4XH2A 2ZJSH 5L8JB 1KTDB 1C1EL 1OAUH 4X80L 5IMOB 3QIWA 2NY5H 4AG4L 4HS8L 2VDNH 4KY1L 5I16A 5BRZA 5D2NE 3VWKD 3MRBA 4LU5L 2R29L 2GT9B 4J4PA 1A9EB 3ROOB 1UA6H 1LE5A 3EZ8A 1G9MH 1RJYB 3RVUD 3F7VB 2ESVA 4PRHA 1H5BB 4F3FA 3SDAD 3DGGA 1HHJA 1A7RH 3PGFH 2VDKH 3QUYB 4O2FA 4KKCC 4ZO9A 4PGDB 4J8RB 4P59H 3MBXL 1VFOA 4PJGB 1J18A 4V1DB 4N0RA 2AV7B 4MA1B 1FVEB 4XZUB 3B9EA 4JM2B 4KPHL 5E94B 3CK0L 5KVGH 3KPLA 3GNMH 5IROA 3U4EA 1HHGB 4CVZA 3LZFH 5C0CB 5HYFA 1WUNT 1S9XA 1FYTD 5HDLA 4P2QB 4N0YH 4EN3D 4IJ3B 4PRPB 5F7MC 3HZVA 5SWZE 3SO3B 2VERN 4ZUWB 3RZWA 4ZQKB 3TZVD 5KW9H 4HIJA 1J8HA 2CK2A 5CD3B 2BNUB 2ICCA 3WS6A 2XWJB 3U0PA 4ONHB 1UWEL 3TYGH 2VIRB 3WIHA 1YN6A 3EOAB 3DVNA 4GRLA 3CFJB 4XAKD 4JRYB 1H3WM 1JI1A 4LCCC 1VSCA 3CU7A 3ALPA 4NN6B 4NQDB 4ZUUA 1I7TA 4X9FA 1P9MC 4GKZB 3GI9H 1P2CB 3NN8B 5IR1B 3U4BH 5C3TA 3QFJE 1LWRA 1Q9OB 3I75B 1N64L 3RVUC 1JGVL 3ZYOA 4X9HA 3ARRA 3MA9L 5HI4D 4GG6E 3SDAC 4P3CL 4GKOA 4J3UA 1RQ5A 1I1YA 3CXHJ 5IMKB 3O2VH 5I1LA 4ZFGH 3FHQA 4QXGL 1F11A 1XH3A 4JFEE 1MFDH 3CDCA 1YPZA 1KN4L 2DWEA 1QR4A 3MRKB 3TBVA 1SY6A 4Y4HA 4W81A 1T66C 5F1OB 4QT5B 3ARPA 1TZHA 4EN3C 2C3GA 4GW4A 2CDEA 4FXKA 3VXRD 1NL0H 3QDMB 4YXHL 2ADJA 4MNGE 3ZKQD 2QTEA 3TZVC 2YPLA 4QRUB 4R97C 1RJLB 2OL3H 5CSBA 2WMPA 3FONA 3IXAB 5BJTA 1G7LB 3X3FH 5DLML 4RFNC 1V7NL 4GAJH 1MCOL 4U1GB 4M6AA 4HHAA 4QNPE 3VRIB 3GBML 4DW2H 2XPGB 1PW3A 1UEYA 3FQUA 4PRID 4RGNB 5ITBL 3EYVB 5ABDE 5JW4Q 3HNTL 2R1XB 4F80A 1IAOB 2WK2A 5HI4C 3K74B 1P1ZA 2QSQA 4XNMA 4D9RD 4LSTL 4OUUA 1C5BL 1FE8L 3W5NA 5IJKC 5FYKU 4M4PA 1AI1H 1CGTA 5DEFA 3SN6N 2DQCL 1FZOA 4X7TA 1E6OH 3CCHA 4MAYD 3A6CH 4JO4H 4YDIH 3VFPB 5T3ZH 4XPFL 3BJLA 2DQJH 4FTVB 3U79A 1MPAH 4ZPTA 2DQHL 1HSAA 1P9MA 5KAQG 2PW1A 4QY8A 4YEEA 3T2QA 3FO2A 4P9HC 4WU5B 2F8XC 5I74C 2AJZB 1ZV5A 1YEJL 1ZSDB 5FYLD 1FYHB 3B9KB 1I7UA 2IPTL 4TNWK 4U4BA 4NQEB 2P47B 4WWKB 2ILLA 2ZPKL 3CMOH 3ZYZA 4NO3A 2OI9B 4PG9B 4LP5A 1KCSH 2EDWA 3E6HA 4ZOBA 2W60A 1U3ZA 1MWAB 1PX3A 3BUTA 1MHEA 2D9QB 4CGTA 1T2QH 4J3VA 2AEQL 4BH7A 1Y0LA 2KDGA 2AKRA 2WUCH 1A6WH 1CE6B 3KR3L 4EN3A 5D7SH 3IDNA 1AD0A 2DL9A 4F7EB 5GS0H 2VUYA 3ZTNL 1I8MB 4LIQL 5ICYA 2IPKA 2R1YB 1AGCB 1UEMA 4KZDH 1OGAA 2ZUTA 3TZVA 1S7XB 5K9QI 3MJ6A 5C2BH 2MKWA 4LDLB 4OTXL 4N5ED 1LEGB 4ELMB 2BCKA 4F8QA 4FABL 3AS2A 1JN6B 4PGEB 3V0WH 1MCNA 3BHBB 1BJ1J 4MA7L 2NY3B 1LO3L 4XC3H 4FQJL 2R39A 3S35X 2UZXB 4MAYC 1IC1A 4AEEA 5ICZA 4DN4L 4LQ1A 3PWJA 4LHJB 2V2TB 4LBEB 2GSIB 4K94H 3L7FB 4XP6H 2GFBA 3B5HA 4TOYL 2NXYB 3F7PC 4NZRL 5EZLA 3FMGH 5E5MA 3G6AB 5FOBA 2XICA 2C4XA 5C07E 4G43B 3L3DA 3IDGA 3O9WA 4LNRB 1UXWB 1HCFX 5EUKB 1H0DB 1YQVH 1PYWB 4LQFL 4H8WL 1EJ6A 4K07A 5T5NF 1Q9LA 5IJKA 1JNLH 1HINL 2N7AA 1P4BL 3IS1X 5FKPB 2XWTA 5I73B 1TTGA 1X5IA 2EYRB 3RIFK 3D25A 4C4KT 3QEUA 1P7QA 1D5IH 5GRJL 3MXWH 4KQ3L 5KOVC 1MUJA 3QUYD 1SM3H 4HKXA 2J12B 4PJEA 1MAKA 2BVOA 3VXRA 2Y36L 3IKKA 1KB9J 4V1DD 2BOCA 5IVXA 5CIPB 1TTUA 1I9JL 4ZG1A 3MLRL 1A7NH 5I1AB 4JM2D 5E8OA 2A6KB 1JZ8A 4EOWH 5CMAB 5HHXL 3BEVB 2ADGA 4N5EC 1S9WB 3WIFB 1KJMB 2DQTH 1C12B 5C0CD 2X1OA 2B5IC 3IF1A 5E8NB 1NCTA 3TJEH 3DYMA 4TNWF 5I19H 4P2QD 1QLEL 5CEZH 5KG9B 1UB6A 4Z7OF 4PRPD 2ERJB 3IDMB 1WZMA 3ZE2F 2AV1B 3R06A 5JHLH 3BPLB 3I3BA 4X0KA 1SBBA 2FATH 4PJ8B 3CDGA 2IBZY 3DRTB 1E27B 6FABH 1F3DJ 4JN2A 5C0JA 2BHUA 5K59E 1A7QL 3GB7A 2NX5E 4XNUL 5I1JL 5JMOC 2PETA 3DUHA 4U7MA 4I4WA 1LD9B 4L8DA 3TESA 1KEML 2EDLA 3QSKB 3S5LG 4I8DA 3LIZL 1JNNL 5IESH 1NMCC 5KVDH 3K0WA 4YHIB 4NQDD 2P49B 4MAYA 2QKIB 3F12B 5DHVB 5KSAB 3PNWB 1H5BC 2ADFL 2WSKA 3B2UD 4OZGB 1TJIL 2ZG3A 1PKOA 3QUYC 4PJFE 1AHWB 1OAQL 2VXSL 1N5YH 5EO0B 1ZVHA 3WLBA 2PUQT 3FOMA 2V2WB 5CD5D 1MFEH 4MA1C 1T7YA 1Z9SA 5HJ3B 5E9DE 1HXYA 2Y06H 4JM2C 3OAZK 2X1PA 4MGXA 2Z92A 1UCTA 3VFRA 2I5YH 1MHHB 1I1FA 5C0ND 2F53A 1AGFA 2VE6B 3FQNB 5FHAL 2R4RL 3V9FA 3WHE0 2VLLA 4OZ4B 4MHHI 3NIDF 4H1LB 4C83A 2JF1A 4IJ3C 4X4MA 1DBAH 4LARL 4LLUA 3ZDZE 3SO3C 1A6ZB 5I66A 4G80A 5EA0H 1F6AA 4OQ1A 1PKQB 5CEYB 1JZ6A 3PV6B 5HYSG 2ID5A 3RIFF 2JELH 3LN5B 3IGAB 2ZJSL 3S3JA 4JZNB 1OAUL 4C4KO 2NY5L 1FFNA 2VDNL 5C0EA 3MCLH 5AZ2H 5C92A 5HGHA 4GKNA 4RGND 1KNOA 1N26A 1JE6A 5A1AA 3OPZH 3VCLB 4BA8A 3JV0A 4YR6B 2YEZA 3DGCR 2EH7H 5GRYA 1RZGA 1K3ZA 4HXAH 2I26N 3RP1A 2HLFD 2HJLB 1GGIH 2CKBB 1UA6L 3B2UC 3FQTA 4BQ9A 1G9ML 3W81A 1CFVL 1NSNL 3OX8B 2G9HA 1Q1JH 3NCMA 1KTDA 3MRLB 4WU7A 2FB4H 4MS8D 1EH9A 4NGHH 1A7RL 1KGCD 2VDKL 2H26B 5D72H 3SDYL 5CD5C 1AO7A 4CRPA 1FCCA 4P59L 2OJEB 1GC1C 2FIRT 1D5ZA 3SBWA 4FTVD 1YDPA 5KVGL 3PL6B 5C0NC 1CLOL 3LZFL 4KRPD 2HFTA 3CMGA 3REVB 4EUPB 2J8UF 1A1NA 4L8BA 5F7KC 5FDYA 4N0YL 5IJVB 3B9KD 3EYOA 3G5ZB 3HI6H 3QUYA 4NQED 1N3NA 3EOBA 4J8RA 2W92A 4M6OL 3OF6D 4FQQB 4WWKD 5KW9L 4HPYH 5DJCA 3HI5H 1FVEA 2GIYA 2X09A 5DXWA 2FCBA 4H0HB 4H25B 5F9JB 4MLIA 4Y0GA 1XMWA 1N59B 2WNGA 5KVMC 4U1GC 1OP9A 1OWRM 2Y5EA 3B8YA 3VFUA 5INCB 2WANA 4JZOA 4RISH 1UQSB 3M17B 4RGNC 3F62A 4PY8J 2FWOA 4TQEH 1N6QH 4P2QA 1OSPH 4JG0H 4NHUE 3KS0J 3VG0L 5C09B 2HLFC 3GI9L 3ZL4H 2HG5B 1NEUA 5D5ME 2BERA 1T0PB 3V6OC 4MS8C 4RFEB 4XHJD 3AREB 1KXTB 5AEAA 2NY3D 3O2VL 1NGXA 3BEWA 4ZFGL 3Q5YA 4U7SA 3G5VA 3CFJA 5IM7B 4OKVB 3S5LA 3TYFB 1RUPL 4HWZA 3C6LB 4NQDA 3V0VA 2NXYD 4GKZA 4KRPC 5JQHC 1FLTX 3MUHL 1BEYH 3DROB 4MXWL 3I75A 1JGLH 4UNUA 1BD2B 4JFQB 4R4BA 1DSFL 1J12A 1IQDA 3B9KC 1NL0L 1YMMA 5IMKA 3TT3H 2ITCB 4RAVA 4WWKC 3HG1E 4NO2A 1YEKH 4EEEA 2AERT 1A0QH 3RUGA 2OL3L 2OI9C 5IB3A 1XF4B 3EJJX 4NQCE 3L5IA 2ED8A 3KPRA 5D7IF 4MJ2A 3X3FL 1N0LA 5E8DH 2P4AB 5EB9A 2VDRH 1K6QH 1RIUH 4JJ5A 1KCGC 4DW2L 1PQZB 2FL5A 1NBYA 4HDIA 5FO9B 5IMLB 4Q0XL 5D7JB 1FZMA 2F8OA 4QRUA 5FM8A 2KQNA 3FFCA 4XP9L 2LVEA 3O0RH 5HYSA 3QUMB 5BV7B 2ZOLB 4LLYB 5TE4H 3OJMB 4XHJC 2XN9E 3QDHA 3EJZC 2NY3C 3WHXB 1MIEH 2YD7A 3LH2H 1AI1L 2A6JB 5F1SA 5B21A 1E6OL 3QUZB 3A6CL 4JO4L 2XPGA 4YDIL 5T3ZL 5F7DB 4RX4D 4PJ8D 2DQJL 1MPAL 1WISA 4PJHA 4XP5H 2F74A 1S7RA 3RNKA 3IS0X 1ZVSA 2P8MB 1PVHA 4HGWB 3SPVB 2IANE 5HHMA 3V6OA 4MS8A 4P9HH 5GPRA 1TMCB 2VLRA 4PJDA 4FMKA 2KBGA 1X5ZA 3CMOL 3JZ7A 3QXDB 1CFQB 5K9KA 5KSAD 3RX5A 2MCPH 4HX1B 1KCSL 4KXZI 2VLJB 3PWNA 2H2SD 1A6UH 1FC1A 1KB5B 1T2QL 1RJCA 1GGCH 3VFMA 5EPMB 4WU5A 2WUCL 3ZE2E 2R4SL 4NUJA 2QHLA 4HQQH 2AS5M 5CLWA 4J2XA 3BSZL 5D7SL 4DGVH 1AQDA 5GS0L 5BW7C 5C0DB 1MREL 3DXAB 5C2BL 1C5DA 4JFDE 1BFVH 1JYNA 4NOFA 3QG6B 5D2NA 1BLNB 3V0WL 1RY7B 1Z0MA 3VMNA 3KPOA 2WUBH 4H5SA 4WI3A 3OTTA 4XC3L 1CLCA 3NCCB 5E8EA 1U8IA 3DBXA 1KCKA 2E8YA 3BPLC 3Q3GB 4LKCA 4GBXA 4NQXB 3N9GH 4UILH 1FORH 3MBEB 4K94L 3I3DA 1UVQA 4PJ8C 4F7EA 3T08A 4QHUB 1AGCA 4CADA 2XTLA 3FMGL 3VXPB 3ARFD 4QOKE 4ZOCA 2CR6A 2Y5TB 1HKLL 3CNKA 2C3XA 1CS6A 3BP4B 3NFPA 3WE6A 1WT5C 1A1MB 3DV4B 3KPQB 5FDWB 5GGSY 2WAHA 1J05A 5FO8B 5FUOH 1JI2A 5FYLH 3ARDB 2GQHA 4I2XE 3NABH 1S8DB 1KXQE 1WAAA 1JNLL 4NZJA 4ZTPL 4BKLA 4C59B 3MLYL 2H2SC 3NIDE 4MXQD 1CDIA 4WRLA 4NWUH 1Q9KB 5JDSA 1D5IL 3MXWL 3DSNA 4WTZG 1KACB 1SM3L 2X2YA 3V4VH 2BMKA 2YC1A 1UXWA 4R8WL 4OCSH 3I3EA 4ODXB 4UU9B 3DX6A 3VFOB 5HDQH 4Q97A 1QSFE 1T20B 3PL6D 2W59A 3BH9A 1D5BB 3U82B 4AQOA 4CDHA 4FQXD 1JYVA 2R56H 2DQTL 3MGTB 3KHQA 3WNPA 4G8FB 5DJYA 3NCBB 4ZSOB 5CEXB 3TJEL 4KH2A 3MUGB 4L3AA 2J4WH 5I19L 1NH6A 5CEZL 3MRNB 3QFJA 3MLSH 5FGBC 1X5HA 2R0WH 5HHPB 5H8DA 3SGDH 1AGDA 2W38A 3FT3A 5JHLL 4OCWH 2XTJB 1K4DB 3DOSA 5J1SC 3QXUA 4IMLB 3ARFC 4JDZB 4OZFB 1YMHB 5BW7A 4Z8FH 6FABL 4DKDC 1JRHH 4JFEA 3MROB 1S9WA 3WIFA 5JOEA 1C12A 4LCWB 1UKQA 4LASH 4M6NH 2DYPA 3JTTB 5E8NA 4NC1C 1CI5A 4D0BA 3OMZA 2GCYB 3H7BA 1T04A 5IESL 5KG9A 4BUHA 5KVDL 3P0YH 2Z8WC 1QBML 3CFIC 5C09D 3G04B 4EXKA 3VU2A 4RX4A 5FF6B 3G9VA 4PJ8A 4MXQC 3HPLA 2J8UE 4MNGA 1B6UA 2BVEA 2QQNH 5DGRA 1I8LC 2R2BB 3ARED 3K8MA 1N5YL 1DUYB 2M1KA 1FH5L 2CIIB 3OKLA 3V5HA 5J12B 4M7LH 4J3OC 1CDCA 4NPYA 1I1CA 3VRLE 1CXHA 4S1DD 3C6LD 4M43H 4PP2B 2OTWB 3PL6C 4GQ9H 3VGGA 4ZTOL 3O4LE 4W6XB 5JO5B 4NQSB 4FQXC 1UXSA 3ARBD 5DD5H 1U8PB 3HTLX 3EDKA 2KUTA 3DVIA 3PNWA 4BZYA 2YD6A 3MNVB 4UT6H 2HT4D 2CRZA 2W9EH 1BD2D 1QLFA 4OZGA 3VDCA 3WIHL 3PIQB 1XT5A 1DBAL 3O41A 2P8PB 4W6YB 1LO5B 4OFYD 1YECH 2CXGA 4HJJH 1ZLWK 4XVUD 1DN0A 1MAMH 1W0YT 2DTML 1I1AB 3SGKC 1DE4B 2JELL 2XYCA 3AAZB 3HC3H 3STLB 1ETZB 2X05A 3FZUC 4HWUA 4XMKH 4DFIA 3ZT7A 1BX2B 4F2MA 3MCLL 1BZ9A 4JQXC 4OD2B 3RVXD 1VFAA 3P73B 3OPZL 2Q8BH 3NACH 1W8NA 5D7JD 2X4OB 4ZPVB 2DLTA 4HXAL 1GGIL 3CFDB 4O2EB 2FZ3B 4RGMB 1SY6L 2B1HH 1NBZA 1Q1JL 1YJDC 3GUTB 2R1WA 3AREC 4JANB 4YE4H 3ARFA 5C08B 4GSDH 5E1HB 2FB4L 1XGTA 4R7DA 1U8NA 4M8VA 2WWKT 2ICWB 4NGHL 5FM5O 5D72L 2KZWA 2X5PA 4XBEH 4UUJB 5I1IH 5EC1A 3QUZD 4S1DC 3C6LC 3O3AA 4IIQB 4RCAA 5IHBA 1CTOA 3U4AA 5DUPH 3ZKMD 5GGVH 4YR6A 3ARBC 5D7IE 3VXMB 1GAFH 1P6AB 2VQ1B 8CGTA 1GC1H 2HT4C 2E7LE 1NJ9B 4GUPB 2EZ0D 2OR8A 3V7AE 3VRJB 1CGWA 1HI6B 1I8LA 4XVUC 3HI6L 2H26A 3MV11 2WM0A 5IIEB 1X5FA 5FOJA 35C8H 4HPYL 4MDJA 2DQUH 3JV6A 1OTUD 2P48B 3HI5L 1DLHB 4ZDHA 1CWVA 3P9WB 3UJJH 3GSUB 5H35B 2VLJD 5F9AC 3GSRB 4WFED 5KS9B 1EHLH 4X4ZA 3HC0B 4FQXA 4HLZG 2YWZA 3REVA 2OM5A 4K2UH 1AFVH 4DOHE 4RISL 3RVXC 1IAII 3OXRB 4UV4H 4NC0B 1RZFH 1N6QL 4TQEL 2CXKA 3O6KH 1VEOA 4NRXB 1OSPL 4GT7A 4JG0L 4YQXL 4CN1A 5D7JC 5C07A 3MO1B 3ZL4L 2ZCKH 3DXAD 3T65B 5BV7C 3QPXH 2BVQB 1FVCB 4HFUH 5DRNB 3F5WB 3SGKA 4H25A 3AMLA 5D7LB 2AW2A 1WC7A 3LMJL 7FABH 3KNBB 1CXEA 2VL5A 2HVJA 4S1RH 4KI5D 3QUZC 4N0UB 1UQSA 3M17A 4KK9D 2X4SB 3VD3A 5IHLB 4JQXA 1XCTB 3MBED 3ZKMC 4EI6A 2MWCA 1ZGLB 3RZCD 5ACZA 1INQB 2DN7A 4UZGA 1BEYL 4EVNB 1JGLL 2A6IB 2A83A 2IWGA 3LQZA 5IB2A 3NVQA 2CIKB 3UTZB 4X83A 3WUZA 5E2JA 3TT3L 3UZQA 5I76B 4F33B 3VG9B 1MCCA 1ZA3B 5GJSL 1YEKL 1U8MA 1OTUC 1INDH 4OKVA 3F8UB 1ONQA 2WP3T 4NUGH 3C6LA 4X8JA 1HIML 2PXYB 3FB7B 4CMHC 3IDUA 1IEHA 2OQJB 3ARBA 2VDRL 3I02A 3CD4A 4HFWB 1K6QL 2ARJQ 5DD1H 5E6IA 4ZFFA 3U2SB 5IBUB 3D85B 3OXSA 4U31A 4OFYA 4XBPB 5DK0A 2AEPH 4LGSB 2NX5A 5IEHB 2ZCLL 3TBYA 4EBQL 5A2FA 5TE4L 2J8HA 4IOSD 3EO1A 4PJ7F 3P77B 4HBQA 1JL8A 1RZJL 2HTLC 5EU6B 5E2UL 5DJ6A 3NAAH 1MIEL 5F89B 4KK9C 4LPVA 4YBHA 4CN4A 2GAZA 3MBEC 3MFFA 3MA7B 4RRPG 3STZA 1AJ7H 1PQZA 2JB6B 4CVUA 2XTJD 3RZCC 4PJFA 5IMLA 1D6EA 4OLZH 1YYLH 5IW6B 4WWID 1KCUH 2C1OB 3MJ7B 4PY7A 2WLZA 1VKXA 3FB8A 4JFOA 3ULUD 3WS3B 4CKVX 3RBSA 4LCWD 2EDXA 3HR6A 1L6ZA 4P9HL 1CCZA 3T8XB 4FQHB 4RQQA 5DJZA 1UYWH 1QSEE 2AJ3B 1X4XA 3KS0H 5E08H 2BZDA 5DR5H 3EFFB 1QPPA 4X6DB 2X40A 4DUWA 3H0TA 4JN1L 5I17B 2YOCA 2BSTA 4Z7NF 1NCBH 3T4YB 2ORBH 1GGCL 2P8MA 3QQ9D 4HGWA 4K3DL 1DBBH 1MCJA 3U46B 2ZNXA 3UTTB 3B3IA 4HQQL 1FJ1A 5ETUB 1U8JB 4DGVL 3AUVA 4HUVB 5I1KH 5E8PA 1G7PB 3VJ6A 3BESR 4HIHB 1A7OH 4L3CB 5CIPH 3RWHA 5HYQA 2YHGA 1J10A 1BFVL 1L0QA 4WUKH 1S7SB 4I3GA 3MPCA 5IOPA 3TA3B 1F4XH 5CUSH 3CLEL 5HHQA 4HWEH 5H94A 2ICWJ 4JY4B 3MOBH 5EPMA 4ODHL 4O02L 2IF7A 4CDGC 1YUHA 4QRRE 5JIKA 2XTJC 2AQ2A 3N9GL 2YD1A 3ARGB 1I1AD 5DUBB 3DX8A 1X5LA 5C0DA 4L5FH 4ENED 4XXCC 3KPSE 3EOTH 5JOFB 3EBAA 3ULUC 3CSYA 4BM7A 1SEBA 4L4TB 1QRNB 1MOEA 3WUWB 1G7JB 2VMFA 3HMXA 1K85A 4ORGA 4Y16B 4WTWA 5EO9B 1T4KB 5JIHA 4YJZL 5FUOL 3RFZC 1A6TB 3OJ2C 5M94B 1H15B 1U6AL 4NYLB 3NABL 2P24A 4TVPD 2H45A 3Q3GA 1FNFA 1ERNA 4UQ2B 4QEGA 3MBEA 2H32B 4FZEH 1KPRA 4C58B 1L6XA 1IGIH 2Q3AA 3RZCA 1EUTA 2JJSC 5DHVH 3AXLB 2DI8A 3QQ9C 5C08D 4NWUL 5D96B 4KKAD 4A6YA 4PUBH 4U6HA 5SWQB 2VUOA 3LKPB 3V4VL 5J12C 3OHXA 5DJ0A 2HJKB 4BZ2L 4OCSL 3BPCA 4OCMC 4G8EB 1S8DA 5HDQL 4LVNB 3VXMD 4J3TA 4OF6A 2R56L 1KTRL 4MD5A 2APXA 3BO8B 3GIZL 5F6HI 4NHUA 2PCPB 3ZTJH 1BBJB 1UH2A 2J4WL 1Q9KA 4YAQB 3MLSL 3SJVE 2HT2D 1YC8A 4H1LH 2R0WL 5CILH 3RWJA 5DRZB 1MNUH 4LPTA 1I1AC 5D5MA 1JPFA 2D7PA 3SE9H 3D0VA 4U1NB 3WJJA 1EEZA 3VFOA 2SEBB 3QA3A 5JORB 4PV8A 1JRHL 1D5BA 4Q74A 1HH9B 5TH2B 1A7PH 5BZDA 1PD6A 4P23B 4M6NL 3IDXL 4XAWH 1KFAH 2D3VA 3PP3K 3MGAA 1NCAH 5FYKE 1LP9B 2IADB 3P0YL 1JHTB 1A8JH 4RRPA 4RGMC 3WXWL 2ZOKA 1MJUH 1JHKH 2CKBH 2QQNL 2UVEA 1OM3H 2A9NH 4KKAC 5J13B 2HFFB 3HG1A 4NNXB 5GSRB 1QNZH 5HPMA 5HVFB 4PYHA 4ACPA 4NQCA 2JIXB 5I75C 2JK5B 1HZHH 4MAUH 4F7MA 4IIQC 2HT3D 3OKMA 4I3RL 4M43L 4GQ9L 3O3EB 4Z7VF 1M05A 4PJAF 2PTUA 5DD5L 2E27L 3BPOC 4MMXC 2W9EL 2AJYH 2UYLA 3SKNB 4F58H 2EE3A 1AXIB 3PWPB 4MJIB 5EBLA 1Q0XH 4ZNEA 1YECL 4HJJL 4Z0XB 3RWDA 2BC4B 1DUYA 2BXYA 1MAML 1KG0B 2XN9A 3KLHD 2YPKA 1K5NA 3QO0A 3SKMB 4JFZH 1U8KA 3VXUB 3TBTB 2FYYB 3HC3L 4QRPB 3L3IB 1MLCB 3JTSA 4JY5L 3UBXI 1FNGB 1T3FB 4JY6B 1N6UA 3HZMA 2ARWA 1NAKL 1A2YB 4XMKL 3UXFA 4Y4FA 5ESQB 1QSVA 2Q7NA 5A2JH 4HH8A 3OG6B 3D85D 1RHHB 1UCBH 4HKZA 4JO3H 3VMPA 1S9VB 3X13B 1M7IB 4UDTB 5F6IB 4HD9A 5AAMA 2Q8BL 3NACL 4JB9H 3MRJA 3O6FB 1PZUB 4LCUA 2B1HL 4E0RA 4IDLA 4YHLH 5LBSH 1NFDB 4NZUH 4JLRA 4YE4L 4GSDL 5E00B 5EU6D 2DQDH 3O4LD 4N9OB 2CRYA 4O2CB 3KDMB 4OSUH 5F9OH 4LLWB 4HSQA 1YJDH 3N1QC 2D7QA 1WWCA 4XBEL 4KQ4H 5I1IL 3ULSB 4I0CC 4R26H 1JZ3A 3NZ8A 1WEJH 3BQUB 1EV2E 1OAXH 5DUPL 5GGVL 2J5LC 1GAFL 1HYRC 2PYEE 2ZP0T 5J8OA 3T3PE 5ILTH 3MX0A 4JFPB 3P4NA 3WFHB 3TJHC 5EUOB 3DHMA 3ZDYF 3L9RB 3BDBA 3VG9C 4JFDA 1LK2B 5FIEA 5T1MA 3KLHC 3V95A 2WBJA 3FOLB 2LE9A 5DQJA 2DQUL 1VFBB 4RDQG 1FFPB 4IIQA 3UJJL 4U49A 4WHTA 2JCCB 2GYSA 4PJ7E 4XTRD 3VXMA 1EHLL 1JPSH 4M4RA 5H37G 3MV8E 5T1LB 1NJ9A 4K2UL 4TTDD 1AFVL 4HIXL 4WW2B 3ELAT 1TTFA 4UV4L 1FO0B 1RZFL 4Y2DD 1BQUA 2VKWA 1CYGA 4QOKA 2F5AL 1W0VB 2GY5A 3NTCH 1QOKA 4D9QD 4NIKB 3GGWA 4BK5A 1IKFH 2ZCKL 1SVCP 3QPXL 1RURH 4BSWB 1EO7A 1RZ8A 3CUPB 3KJ6H 1Z6JT 3MRGA 3VA6A 3TA3D 3GSUA 3GMPB 4I2XA 4NN5B 5BV7H 5TDPB 7FABL 1IZKA 3DMMA 3BDYH 5J6HA 4OGAC 4FHBD 1F4WH 2RBLA 3OXRA 2VZOA 4JQIL 8FABA 3ARGD 5DJAA 4NRXA 5JQ6L 3S4SG 4HWNA 5D1QA 4IRJB 1A6VH 4FQ1H 3L7EB 4JFHD 4YHYB 4Z7NE 3W5MA 2A0LD 5ESAA 4GG6B 5IVOA 4NDMA 4KDWA 1U3YA 3QHTC 3T0XA 4Q7DA 5DRNA 3DX7B 1NC2B 1FFOB 4L4TD 2ED7A 1QRND 5GGVY 4BFBD 4TSCL 1QSFA 4Y16D 3O11A 2VN7A 4ZUSB 3BWAB 3CSBA 1INDL 3NPZB 5FK9B 1WICA 4G9DA 4NUGL 4XTRC 3C8KA 4Z5RB 2JJUA 2DBLH 1ZGLA 3MUZ1 3RL2A 1Z0NA 1ZT4B 4PJ9A 3PQYE 2E9BA 4YC2C 4TTDC 3R4DA 5DFTA 1QFWI 1A14H 2OLDA 4Y2DC 5F71A 2EDEA 5HHOE 5MEPB 1OP3K 3RWFB 3U6RA 2AJUH 4HLZH 4YDVB 3TJHA 5GGUB 3U9UA 5CGTA 1EVUA 3W11D 2AEPL 2NR6D 1NMAL 5GRZA 3V5DB 3IVKB 2EYTA 2VKXA 1C5CH 4PJCE 1Z3GH 3GIVB 4CNIA 4UI2A 2W0FA 1NDMA 3KXFE 4U6VL 1OAKH 2OYPA 2OQJA 3D39B 1VPOH 1TVHB 1OCWH 3NAAL 5KANI 1G7MA 1QVOB 3RWEB 3HMXH 3U30B 4M02A 3MOQA 3D85A 4L4VB 1KYOJ 2DRUA 4PV9A 1NDGB 4Y7MA 1YY8A 4PS4H 4OLZL 3RY6C 4DAGL 2A0LC 1GVIA 1YYLL 4RZCB 5ECJE 1KCUL 2FSEA 5I1CH 1NGYB 1BPVA 2BVUA 4P23D 1U91B 4CU7A 4M1DH 1CT8B 9CGTA 1WZ1H 3QWRD 4LSRH 4Y16C 5EU6A 4A6YH 3NIFE 4OZIF 3O4LA 3DI3B 2C4FT 4XPBH 4KUCF 1V3JA 3MLUL 5E2VH 5L8KB 1UYWL 3N06B 3O45B 3CX2A 5AAWA 3QQ3A 1E4XI 1X5AA 1DANU 2MFNA 5MHSD 3TNMB 1QPXA 1SJHB 5F88B 4BH8B 3LKOB 1T5WB 1I8IA 5D96C 3WFBL 3CIQA 5DHXB 5IFAH 1T0NB 3QXTA 2ORBL 3QH3A 3QULB 3F65A 2NY7H 3UJIH 3WS3A 5LVEA 3VWJB 2IAMC 2YD3A 2JIXD 3W11C 2NR6C 5EORH 5JNYB 1OWWA 5I1KL 3MRIA 3DHJA 1JGDB 2DLHA 4LVNC 1U42A 1A7OL 2AJ3A 3PHQA 5DS8B 4WUKL 1F4XL 1RUAH 2A74A 2FHBA 4NFDA 4BQ6A 5CUSL 3PWPD 4HWEL 4P5MB 3MOBL 5F3BB 4WHYH 3U46A 4Y2DA 4GO6B 3WSQH 3GSXA 1DTUA 4HUVA 3VXUD 3CFCH 4L5FL 4I5BA 2DJUA 4HIHA 1IGCH 4L3CA 3RWIB 4QRPD 4NRYA 4EI5A 3CFKA 3DO3A 3IFPA 4P23C 4ZS6D 5KSVA 3VXSE 3GSOA 1IFHH 1G6RB 1XEDA 5J9PB 5HI5D 2P7TA 1QP1A 3ULUH 4U1SA 5TQ0H 5D7IA 4YHZH 5DHYA 1SQ2N 1WITA 2NNAB 1CN4A 3O6FD 4PJAE 4NT6A 4C56B 1B2WH 4FZEL 5DUBA 5LCVH 1PLGH 3L3OA 1I9EA 5EOTA 3S4SA 1IGIL 5K9OB 2E7BA 2V2XA 3B5GA 3R8QA 4UINL 2PW2B 3SQBA 4PUBL 1JTTA 4L4TA 1J11A 3VH8G 1QRNA 5KTEH 3ZT5A 5EO9A 1QO3B 3BQUD 2Y72A 1A6TA 1H15A 3ALWA 1JV5B 2FJGB 2H32A 4J23A 4OCNC 1XF5B 5EU4B 2CDFA 2VAAB 5A3ID 3QJHB 4U1LB 4MQXD 3V52H 5ISZE 4OIIL 3UYPA 3LKPA 1MNUL 3EO0B 1NCDH 5ANMB 3QPQD 1CVSC 4DTGH 2IAMA 4GFTB 4GRWE 3DURA 3SE9L 2Z35B 3LKRB 4QXTB 4ZS6C 3LSOB 5JA9A 4MD0A 1ADQA 3FO1B 4FFZH 1XR9B 1A7PL 1S7VB 2AXGA 5T1LD 3BO8A 5HI5C 4WFHD 5E2TH 2FHCA 1KFAL 4MA3B 1EERB 1D9KB 1AD9A 1NCAL 3KVQA 4YAQA 3L95B 3VGBA 5ID1B 3O6FC 3CC5B 4HV8B 5J6GA 3TC9A 4TVPH 1K4CB 1BQHB 4FQLH 4U1NA 5FB8A 1MJUL 5DDHB 5CP3A 1JHKL 1OM3L 4DQOL 3WNKA 2A9NL 2DDQL 4YH6A 3MRFA 4YK4B 4M5YH 4Q6IB 1HH9A 1ORQB 1I7RB 5F8QC 2EECA 2YMXH 4P23A 3MLWH 2VJXA 3QYCA 4MAUL 1HZHL 3OG4B 2Q7YB 3KYNB 5EG6C 1JNHB 4WFGD 2XIDA 4IRJD 2ICEB 4PJXF 3SDXF 2CH8A 3CVHA 4P5TA 2IH1A 5A3IC 2AJYL 4G6AC 3IRPX 4RIRA 1R5VB 1LNUA 4Y19E 4F58L 4MQXC 1Q0XL 1QA9A 5GSRA 1R5WB 4UB0H 3MLPA 5C2UB 3QPQC 2YN5A 4GW1B 3F6IA 4TUJB 2JK5A 5E9DB 4JFZL 5IW1B 1Q72H 5JTWA 1KIQB 1OY3B 2C1PA 3UYOD 4U3CA 1G7HA 5EH1A 4WCYH 4WW2C 5DQ9B 4QHLA 3E1F1 2ITDA 2ZCHH 1AKJA 1LEKB 3PWPA 4JO3L 3VD7A 1DN2A 4JB9L 1KG0A 4IHOB 1CL7H 5EN2B 1G0DA 1WBXB 1EXUB 4I77H 1KPVA 1UM5H 5LBSL 4NN5C 3TBTA 4YHLL 4PTTB 4NZUL 1IL1A 1NGWB 5CZXC 3L3IA 1QSEA 1C16B 2DQDL 3D39D 3BYTA 4JY6A 4OSUL 5F9OL 1YJDL 3BP5B 1X5KA 1X4ZA 5ESQA 4KQ4L 5BZWA 1ZHNB 4R26L 4XCEA 1WEJL 1F58L 4L4VD 2CMRH 4ZMAT 4IRJC 1RMFH 1EAPB 4YHNA 5I1DA 3EW3B 5LAXB 3VD4A 3MLZH 4OLVH 4YHPB 4NP4H 5ILTL 4CN6A 3BP7A 5HVWA 1YC7A 1NFDA 2ZUUA 1G9EA 2Z93A 4MWFA 1PG7W 1R3IH 4KAQL 5HGAB 4JPWH 3VH8A 1R0AL 2BNRB 3FRUB 1VCAA 2GTZA 4DZBA 2P5EE 4Y5XB 5FHBH 1DVFB 1GPOH 4FXGA 1DQMH 2XWBB 4HZLA 4QRRA 2R2EB 2AK4E 5J1AA 3S37H 1BVKB 1JJUA 3D87B 3H9HA 3TH2T 4AL8H 3AU1B 2EIEA 3OB0K 4BFEA 3T4AA 2FJHA 3AS1A 3TBSB 5FYJD 3VWJD 3ZSSA 1P4IH 1IEAB 2LAGB 3BIKB 3KPSA 3L9RA 4LSSH 3LRSB 1F6FB 3NTCL 4QRSB 4H0IA 3GJEA 1OPGH 4R4FL 1IKFL 4LKXA 3VXOB 1R3KB 5ID0B 3QWOA 3MLTB 1RURL 1KV3A 3BPNB 3KJ6L 4NKMB 4WEBH 3QRGH 4OZIE 2VXQH 3ALXA 3BDYL 3RGHA 3BMVA 4RAUB 5I0DA 3D48R 1F4WL 3LKNA 3QUXB 1ZWIA 2VOTA 5BOPA 5BQ7B 2DKUA 1MVUB 1OB1A 2O61B 3FTGA 2XQYK 1QHPA 2Y07H 1A6VL 1ED3B 4FQ1L 4MCZA 3ORJA 1X5JA 1RULL 4JFYB 4P4RA 4E42B 3CPLA 4BSWA 3UP1A 3KPNA 2YSSB 1E4JA 3MTRA 4LF3B 4LK4A 5L6YH 2XZQL 3EGSB 4L9LB 4AM0B 2NXZB 1MLBB 1FVDB 3E2HC 5EU5A 4C56D 4D0CA 4LLVA 1AGBB 1DBML 3VFNA 1IGMH 1TJHH 4MMZC 1Q38A 1VA9A 1YNTA 3JUYA 1IC5H 3Q6FB 3LOWA 4HG4K 5JPMB 3VFVA 1A14L 3DX7A 1RVFH 5EBMB 5H37H 3W82A 3VWJC 4ZFZA 5ALCH 1EO5A 3HE7A 3O3BA 1J0ZA 3UDWA 2K9UA 4OZHF 5IF0B 1P7KB 1MFCL 1J0HA 4U1JA 1Z3GL 3EYUH 4MNQE 3SE8L 2EEBA 2ATKB 4W4NA 1LQVA 1FV1B 3RDTB 2FHFA 4M7JH 4XMLH 5JMRA 1JGEA 1OAKL 1OCWL 2MHAA 1Y18A 3OSKA 2BVPB 3HMXL 4F15B 1QFPA 2E6PA 3WEXB 1OAYH 4PS4L 1K9TA 3EDEA 4MXVE 4R3SA 2Z91A 1HQRB 3KYOA 4HF5L 2D31B 5I1CL 3C5JB 1ZHLA 2F5BH 1OTTC 3NZHH 4IS6B 1WZ1L 1UFUA 4A6YL 1HHKA 4NSKB 1P6FA 3D39A 2PTTA 1TVHA 1FG2B 1D9KD 5CGMA 1P69B 5E2VL 5C6TH 4CVXA 3FT4B 3I2CH 1YEIL 4LSVH 3RWEA 4HH9B 2NW3A 5AWNH 4PFEA 2HFGH 5T3XD 4UV7H 2X4PB 1HEZA 4YXKH 1NLBL 2Z31D 5GIRB 3FQWB 2H32H 3GKWH 4RZCA 5IFAL 3IFLH 2I07A 2X7LB 3WD5H 4GRMB 3FQRA 1PX4A 2NY7L 3UJIL 5IB5B 1NCWL 4NKDA 1VB9A 3KXFD 1FL5B 5EORL 4RMWA 4FG6D 2CDGB 4YFLI 3HZYB 3QZWG 3CX5J 1MJJA 5CAYB 4MCYA 2BHZA 3O45A 4MVBD 5JHDB 4XCYA 3E2HA 1H3TA 4DGYH 5ITFA 2BY0A 5GQBA 1RUAL 1SJHA 4M93B 5HHQB 4DKFH 4AEIH 1U92A 3B6SB 3QP3A 1DQJB 5I18L 2YBRA 5AZEH 3L5HA 3AM8C 3SCMB 1KIRB 4OF5A 3BW9B 1KJ2B 1N5AA 2FO4B 5B4MD 1CD1A 5EBWB 3CFCL 1NCUA 2I60H 3QNZA 4QGTA 1IGCL 1MI5E 5F7FA 1IFHL 2J8OA 1D9KC 5TQ0L 4YHZL 1PZ5A 2PYEA 4Z0BH 2DL2A 4YNYB 5KSUA 4ZNCD 4G5ZH 2F19H 3CXHK 4PJXE 2Z31C 1ND0B 1B2WL 3IAGC 1T0MA 3DUUB 4N90E 5HGBB 3SDXE 1OGTB 1PLGL 5LCVL 4FZ8H 3S96A 4U33A 4M8QB 1DCLA 4PRDB 4WI9A 4Q6IC 3CVHH 3NCEB 1WTLA 2EE9A 4P46B 5CJ8A 2I25N 1EMTH 1MFAL 3TT1L 4JKPH 1D6VH 2CLRB 5JR1H 3L5XH 5DYOB 1IQWH 2VLKE 1CVRA 5KTEL 1D5MA 4FG6C 5EU7E 5GRVK 2JLLA 2X89D 4MVBC 5SV4A 3P9LA 5IMMB 5BVJB 4OIAA 4C56A 2X41A 3H42H 3QEQE 4QRQB 3HCVA 1C8PA 3V6ZA 5DVMA 3K4DA 2F58H 2GW5A 1RK1A 3V52L 4IOFD 3W0WB 2I24N 3UZEA 2DKMA 1NCDL 2BNRD 2FJFB 3P4OB 1E28B 5B4MC 4DTGL 3SHSA 1QO3A 1DVFD 2XKUA 4JPIA 1LMKA 4OGZA 5IB1A 4HS3A 3FN3A 4XWOD 3QNYA 3IJHB 1JF6A 2XZAL 4FFZL 1HHHB 1CXFA 2V7HA 5E2TL 4E5XB 3QEGH 2GJ6E 4ONOA 3IDJA 3ROLB 1Z5LB 1MCPH 4AJ0A 1JTOA 4R96A 3AM8A 1EEUA 4FQLL 2Z35A 1ZMYA 1H8OA 5DC4B 1A3RH 2W9DH 3NIGF 4DCQB 4M5YL 3VFTB 1IGTA 4P2OB 5EDXA 2DM7A 2HKHH 2IG2H 3MLWL 3QFDA 4MA3A 2YD2A 4Z7UA 2Q6WA 5KVEH 3C2AH 3BUYB 1D9KA 4XI5D 3PQYA 4PJEF 4K3EL 3CC5A 5HHOA 5IVXF 2J8UB 4HXBH 2MJWA 2Z31A 1QQDB 5MERB 5FAAA 3Q0HA 4IOFC 4UB0L 1A22B 1ZS8A 4HS6B 5CEZE 4PJCA 4G8IA 2H3NB 3NCFB 3MREA 4X7SH 5IKCB 2NXZD 4M61A 3KXFA 1DVFC 2Q7YA 3QZWA 1Q72L 2DQIH 4XWOC 1CXLA 3IU3A 4YBLB 5E24E 4MVBA 2UWEF 1OT2A 1SVZA 3SKJH 4YX2H 4Q2ZA 4WCYL 4WJ5A 3HUJB 2DMKA 4X5WB 2ZCHL 4EDWH 3ARQA 1BF2A 4OCYH 1XF1A 5DO2D 1PSKH 1LEIA 5MENB 4I13B 3GRWA 1FO0H 3OKKB 4OKDA 4GW1A 1YEDB 43CAB 3BPNC 1BOGA 3ARVA 4I77L 3KYKH 4Z76A 2ZUSA 3P40A 3RDTD 5DFVD 2ZG1A 1ZT7B 5CBAA 2ARJB 2CD0A 4X6BB 5HYJB 1BVLB 4XI5C 2VZ1A 3EDJA 1NAMB 2CMRL 3BKCH 4WNQA 3GMMA 2NPLX 3BZ4B 3MLZL 3L3GA 3TO4C 4G8GE 3W2DH 4OLVL 2EE6A 2EH8L 3ZKND 3HS0A 4NP4L 4JO1H 4D3CH 1WF5A 2KQMA 3S3PA 2V5SA 4GW5B 4OQTA 1T83C 3BGMA 5DSCA 2OCFD 4OZHE 1UB5B 5JLZB 3OKOA 3IAQA 1R3IL 2NXZC 4JPWL 3J7HA 4LOUD 1BZ7B 5CSZA 3RPIB 3L3HB 1T21B 2A2QT 1TCRB 1Z9OA 1GPOL 1M6OB 1EAPA 3BKYL 2MNUA 4QRTB 1YN7B 3OJDB 4G9FE 1I8KA 1ZGLM 3H8NA 1KB9K 3S37L 4AL8L 2OS7A 2DI9A 4XBGB 4PGCB 5CKGA 5DO2C 5LGJA 4UNVA 3PG2A 4G6JH 2FD6L 1KLUB 3OKNB 1P4IL 4M00A 2XQBH 5F21B 1J87A 1DFBL 1MHPH 2YUZA 4QHNA 1U0QA 5CP7B 5FUZH 3VXSA 2FX9H 5JHDD 1RFDH 1J9CT 5IT2H 3RDTC 5DFVC 4WEBL 3QRGL 4RNRB 1CFNA 4IM8A 4QGYA 2R2EA 1IKNC 4IMKC 1FNLA 2HJFB 3LQAL 4PJAA 3AU1A 4F15C 3M1BB 5D93B 5LXGH 2PF6A 3DRQB 3SCMD 3EZJB 4JQVC 2BY1A 3E3QC 2Y07L 1UKSA 4JG1H 3KYMA 3ZKNC 3LB6D 5I15H 4GXUN 5DRWA 2I9LB 5C1MB 5E56A 1A4KB 1OD7A 4ONGH 4N5UA 4H26B 2P8LB 5ADOH 1CLZH 4H20H 5L6YL 32C2B 4LOUC 1EEYA 2IALB 5JOPD 2ZZUT 4L29B 1ZLWH 1OD9A 1DQLH 4OB5H 5LGHH 3FQXB 1HOCA 1ZK9A 2Z9TA 1MEXH 1IGML 2DWDA 1TJHL 1YEFH 3DLQR 3KLDA 4L1HA 1ED3A 1C7SA 3TPUB 1I75A 3TNNA 1IC5L 4PRNA 3TO4A 1D3CA 2X70A 4JM2F 4P46D 1YZZA 1RVFL 2JJVA 1NBVL 4Y5YA 5ALCL 1T83A 1CD0A 1CDJA 1QFOA 3JWDH 3SO5A 3BRFA 2B4CL 4HZAA 3EYUL 4JZJB 2BP3A 4M93C 1KEGL 3LS5H 4M7JL 4CVWA 5D2LB 1RK0A 3LD8C 3Q6FA 5D1XB 1S7UA 4URTB 2IC2A 4P3DB 3W0WD 3SCMC 5LQBH 1G7IB 5TDNA 5EZIL 1OAYL 3LB6C 4AK1A 3GSQA 1XGUB 5HGDA 4UT9L 1EEQA 4JPVH 5D9SA 4NCDA 3N1PC 1UT9A 1ORSA 2F5BL 4U1KB 2WINB 2XKNB 2ATKA 3NZHL 1FV1A 3RDTA 5DC0A 4HW6A 5C6TL 4IMKA 4OLYH 2BVPA 3I2CL 1FYTE 4HPOH 1TQCB 5AWNL 3ZE0F 3C5ZB 2HFGL 4UV7L 4Y19A 4XPAH 4YXKL 2EDOA 2EIZA 3Q5OA 3E3QA 2NY0D 1U8HA 3GKWL 3IFLL 4P46C 4AIOA 5SWSB 1TVBA 5B38G 5TE6H 3R0MA 4P2OD 3WD5L 5D7KD 4EZMA 4R0LB 5AG8A 2AJSH 4X99B 3I6LD 4XAKE 3UEZA 1NC4B 4DGYL 1JHLH 1XZ0B 3MJ8A 1ADQL 3C60D 1LILA 4HMEA 2XRAH 4AEIL 4DKFL 4X6FB 2LAAA 2P5WB 2MQ0A 5IB5A 5HBBA 4QTHA 1JF5A 4BSVB 4QF1A 5DJ8B 2Y6SC 5ESVA 3HZYA 4WV1B 2I60L 5EU3B 1HH6B 3SE3C 3NIGE 1V7MH 2GK2A 1A4JB 3C09C 1CR9H 5D71H 4L3EB 1J1PH 4PJHF 3TVMB 4RMVA 4KRLB 5HSFA 3K80A 4NKIH 1CD8A 3UO1L 1W0WB 3H6JA 3DIFA 1X7QB 4F7TA 5MEND 3P11L 5CJXC 1UWGH 2G5BB 4Z0BL 5C0GA 5DI8B 3L6FA 3VXRE 3UBXB 3OGCA 5TDOB 4NC2B 2F19L 1N4XH 2E6QA 2D9CA 1KLGA 2DQGL 3ULVD 1S3KH 2G75A 3LKSB 3S34L 2FO4A 2NY0C 4FZ8L 5EBWA 5HY9B 1JWMA 4X4YB 4KKBD 4HAGA 1XIWB 3QQ4B 2W07A 4P2OC 1ZA6B 3CVHL 1I9RH 1NPUA 5JUEH 2P5EA 1EMTL 1BBDH 4RMQA 5HYJD 4JKPL 3TFKA 5JR1L 3L5XL 1IQWL 4P57A 2NLJB 1EGJA 2DQFB 3PE9A 5EFIA 3KWWA 4I3SH 5FKAA 4PRIE 1PEWA 2UWEE 1A7BA 1ZGLP 1F4YH 3H42L 2HFEB 1MH5A 4NKOB 4U0RB 5IEKA 3C60C 3B9DA 1X5GA 4Z9KB 2AXFB 4NQVB 2I9TA 4PRDA 4OM0H 4LLMB 4D9RE 2F58L 2EKSB 5DJDB 5DTFB 3JBG7 4NBXB 2XNAB 1DBKH 3FB6B 1JWSB 2QQLL 3VGHA 4GMTL 5HVGB 4YBLC 1ACYH 3ZT6A 1LO4H 4OZIA 1CICD 4WDIA 4X4XB 4YFEA 3GO1H 5BS0B 4LPUA 1UJ3A 3D3VB 1QHOA 1HWGB 1QR1A 4F57L 2Y7QB 4O58H 3QO1B 1RZIB 3PHOA 3PGCB 3SJVB 3GJFB 5D1ZB 5FYLE 1MCPL 3BIBX 4U1HB 5KJRH 3ULVC 2E9WA 4U05A 1WBYA 4KKBC 3EFDH 1WAAF 3O8XB 3Q6GH 4Z95H 4LGRB 3UZVB 1FDLH 1MHCB 3P4MB 1IC7H 2W9DL 5MEOA 2N1KA 3SE3A 1S5IH 4OQTH 1CBVL 2HRPL 4K3GA 2XA8H 3KLAA 2QADB 1TIUA 4U6XA 2HKHL 2IG2L 4HT1H 3SDDB 4YO0B 4X4ME 1X44A 2PO6B 2FEEL 3EHBC 3IJYA 1FL3B 5KVEL 3C2AL 4ZO6A 5F7WC 3GSVA 5F9DC 1Z5LA 4WGWB 2FBJH 2OR7A 3T1WA 3QXAA 1MCKA 4LSPH 3MNZB 1T1YA 3MCG1 5C86A 4XNXH 4N9GB 5B38A 3QB7C 1JPGB 5IFJA 4PDCE 5FGRA 4X7SL 3GSNB 3BISA 3CH1A 3MRMB 2GITB 1CICC 1NGZA 3E6FB 4DKAA 2DQIL 4PG2C 4FFVC 3NA4A 4PYGA 3DX9A 4UTBH 4LEOA 1U95A 5FECA 3SKJL 4OV6F 1H3PH 4LVEA 4OFKA 3DO7B 1KULA 5DEGB 1WCBA 4XNQA 4B0MM 5IB4B 3C60A 4EDWL 4OCYL 3VDAA 1PSKL 3T09A 3WDHA 5GSVB 1M7XA 1T80A 4H88H 2OXGA 3H9SB 1YEGH 5E03A 3WFCH 3KYAA 5EU7C 3QDJB 1I85A 1WZLA 2DD8H 2RHEA 3HPJB 3MFGB 2B7DT 5C0BB 5D1XD 4FMFA 2Y1VA 1EO8L 3S37X 5KZCB 1GXEA 2C3VA 4G42A 4XVJH 5B8CA 1CF8H 5IHZA 4FQCH 4TULL 3L5WA 2ZUQB 1N2RA 3BKCL 4PJGE 4APQB 4V1DE 2JJTC 3W2DL 3VXNA 4OT1H 3OZ9H 4D3CL 3CLFL 1T89C 1K8DB 2XOTA 3VXQA 5DUML 4I9WD 5I1EH 4N1HB 5EOCJ 5C0CE 4GRWH 2NZIA 4OZGF 1BVLA 1G84A 4P2QE 2MKLC 4PLNC 5L9DH 4PRPE 4LLDB 3O6MH 3C5ZD 3ZYIA 3HNVH 1NAMA 3TO2A 4M7KH 5FYKL 5SWSD 4M48H 4XVSH 3UPCA 3VXTA 3BXNA 3IDYB 4G6JL 5INDB 1P5UA 3SKOA 3QJFB 1MI5A 1DEEB 2XQBL 4IRSB 1MHPL 5F70A 3PP3H 1UJTA 2NTFA 3MYZA 1W72A 4ALAL 5FUZL 2FX9L 4JZJC 1RFDL 2R69H 4NQDE 1NC4D 1GZPB 5IT2L 1CICA 4I18C 1AGEA 1M6OA 1UADC 4PG2A 1YN7A 2DQEH 5IBLD 5D1XC 2BOBB 3WDIA 4UIMA 1EVTC 4QCIB 3LKQB 3HR5B 4PJXA 1OAZH 2ZSWB 3QDAA 3V79C 1CFSB 2GUOB 3ZE0E 4HUXA 4MA8H 4J1UB 4OAWB 4YIQA 2Q20A 5I15L 5DMKB 1DL7H 1G9NC 2EKJA 2F54B 1IRAY 4HGMA 4L3ED 3TVMD 3ERYA 1S5HB 2OZ4A 4D0DB 4MX7B 4ONGL 1X6NA 5ADOL 1HKFA 5ERWB 1CLZL 3DTXB 1O7VA 4I48A 1S78D 3MODH 4H20L 2RFXA 1BAFL 3IFNH 1TQCC 3QEQA 3BKJL 4OLUH 3RNQA 4Z78B 3C5ZC 3WYRA 5ENWA 4OB5L 3JWOL 2NQCA 3MRPB 3T04D 1J86A 4Z7WA 1MEXL 1YEFL 1XIWD 1BECA 2WIIB 1M7DB 4S1QH 2JJTA 4HK0B 4Z77B 4DK3A 3PABA 4R0LC 1A4KA 4QXUH 4H26A 2P8LA 1T1WB 2X4RB 3MLXH 2CLVB 3LN9A 1R3HA 3FCTA 3TCLA 4FQ2H 3JWDL 4RGNE 4X6EB 4ZUTB 2AGJH 3UTSB 1IGFH 1SMAA 4AH2B 2F15A 2UV3A 1YNLH 2E7MA 5T33H 2JE8A 3OV6A 5IBLC 5EZOH 3LS5L 1WV7T 1OTSD 3VFWB 1MQKH 2CO7B 2FX7H 2Y9RT 3DYPA 3LV3B 5FA3A 3SDCB 3EAKA 5A16B 4AZ8A 4JKLA 1TXKA 3RL1A 2X9YA 5LQBL 1KGCE 1D5XA 4WV1C 4Q6YA 2X4UB 5J0BA 5JIIA 2ED9A 3CXDH 3HNSL 1A6PA 4JPVL 2B1AH 5D8JH 4PR5B 5BS0D 4FTVE 2H6PB 4ZYKB 3D3VD 1FC2D 4I18A 2KKQA 2IBBA 1S78C 5D2LA 2BXZA 5AUMB 3AB0C 4NCC2 3MNWB 2XT1B 5D1ZD 4HPOL 1EGJH 1ZANH 2FX8L 1T03H 2VB5A 2QR0A 2AABH 2HLAA 2A1WH 4NQEE 4M7LT 2HMID 3UX9B 1GOHA 4ETQA 3O8XD 2BHYA 1XIWC 4ZUVA 4GS7B 3BP6A 2V7NB 3VE0B 2ATPA 1CZ8H 4LMQI 5AD0B 3PDDA 5TE6L 5JW4R 3JUZA 3QDGB 3T77B 4U1KA 1FNEA 2QADD 4YGAB 4P49A 3SDDD 4FN0A 2AJSL 2PO6D 3C08L 2YD8A 1I3GL 2BSRB 4K7PH 5F7YC 4DK6A 3HZKA 1SJEA 1V3MA 1TZIA 4ODWA 3CZFA 1VFMA 3QI9D 5IFHH 4N8VB 3C5ZA 4N0FA 2ZKHH 5K59F 4U0RC 3BVNB 1JHLL 4Q9RH 1NUNB 3ECBA 1R3JA 3RWGB 5IK3A 4ELKB 4ELME 2XFXB 3GMNA 5EZJA 1KN2H 1H8NA 1OLZA 1FZJB 1IAKB 2M26A 4N68A 4TRPH 1K2DA 3BZFA 4JDTH 3C9NA 2VC2H 1F97A 1SMOA 1WAAE 2NY6B 4M62L 4MJ6A 5DRXA 4LPWA 4M7ZB 4WHDA 3TIDB 3IETA 3UPRA 3B5TA 3MJ9A 4K7FA 4PJFF 1J1PL 3KPMB 3RJDA 4NKIL 4F7CA 5J06A 1HDMA 1MY7A 1U8LB 4X6FA 5D1ZC 3VFSB 4G8GA 2HN7B 4ONFH 1G6VK 4LRIC 3H9SD 4R7NA 1WIPA 1HILB 1IEBA 2HMIC 2NW2A 3IKCA 3PUCA 4OFPA 1S3KL 3O8XC 5ALBL 4OZHA 4JRXB 4R6UA 2GTWB 3QDJD 5IQ7L 3VWKC 5E7BA 3L3JB 3ZDZF 2QADC 5C0BD 3SDDC 5JUEL 5FUCC 2PO6C 4DFHA 1BBDL 1U3HB 2AK1H 4NJ9H 5KZCD 1NEZB 3DVGB 5I8EB 4G9FA 5DA0B 4U3XA 1OP3H 4Z7VB 5EIVA 5I8OH 2YPVL 4I3SL 3QI9C 4TUOA 1NMBH 1T2JA 1CQYA 1GH7A 4JFXB 1HNGA 3A67H 2X4QA 4GMSH 4APQD 2VDLH 3P9MB 5FO7B 1F4YL 2YA0A 1RIHH 1HSBA 2EIDA 3DUSB 1U58B 4WFFD 4DZ8B 3C5SB 4PGBB 3FT2B 3ZKSD 1Q94A 5ICXB 3GMRA 3U7YH 2VZVA 3W9EB 4U1IB 3GRWL 1RU9H 2NLJA 2DQFA 1ACYL 1GGYA 1LO4L 3BRGC 2FR4B 3ZE1F 3HAEB 4UDUB 1AC6A 3OQ3B 4PB0L 4JRWA 1VHPA 1RUKH 3HLAB 1AIFA 2HFEA 1BWWA 4NO0B 4MDIA 3LS4H 3INUH 2EDTA 4X9GA 5JXED 4O58L 3WN5B 2E9JA 5DJDA 5ISZB 4BFIB 5DTFA 1KTLA 3IDIA 2BSSA 4IRSD 3NFNB 1HYSD 2XNAA 4LGPB 1KJVB 5KJRL 3HKFA 5I71B 3O3DB 1ZLUK 3EFDL 3T0ED 2OTUB 1WQVT 3F7YB 2LFGA 4Z95L 1FDLL 3ULVH 4MB3A 3I6GA 1JUFB 5DURB 5BS0A 1S5IL 3I6KB 4OQTL 4XRCB 5J11B 2XA8L 4OZGE 4HT1L 4YWGH 3W39A 3WFEL 5D1ZA 1KTKE 2FBJL 3RVTD 1NAMH 4OLEA 4PJ5B 3WMSA 1IGYB 2F54D 4LDOB 1F3JA 2Q76B 2BJMH 4YGVB 4LSPL 3NOIA 5F7UA 2CUIA 3VWKA 4P2RB 4AT6A 2ZSVB 3M8OH 3WNNA 3QISA 4LCCA 3OAUH 5CJOL 4HIEA 1B90A 2NCMA 3ESUF 5I8CA 4HKJA 2BNQB 3WXVH 4BQBA 1B0RB 1R3LA 1SYVB 3G5YB 3FB5A 5KOMC 3OBAA 1W72H 1B3JA 4XPTL 5D5MF 3OKDA 3QI9A 2JTDA 1PKQE 2OSLA 3SDAA 1H3PL 3MR9B 3VGAC 1L0YA 3U0TB