4PRNA

Crystal structure of a hla-b*35:01-hpvg-a4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prnA01
1MREH 3IAQA 2AI0L 5EN2B 5E08L 2AAVA 2DQCH 5J57B 5I1CL 5TQ0H 2OK0H 2OMNA 4LU5H 1UXWA 3RX7A 1OP3K 3SDDA 5I8KL 3ABZA 2OR9L 1IM9D 1I1AB 3OAUH 3BFOA 1FO0H 5IWLC 1UWXH 3OJ2C 1KCUH 1XF4B 5EU6D 2COQA 1RUKL 3C09B 1A7PH 4HSQA 3UTSB 3SDAC 4F58H 5HYJD 5CSZB 1T7WA 4ELMA 5EIIA 5IHUL 5ITFB 5JORB 5C6WH 3V5DA 5J11B 1JGDB 4PRIE 3V6OE 4Y2DA 1QEWA 3VDAA 3C5ZC 4JKPL 2ZJSL 2BHUA 4NO3B 3GB7B 5KS9F 2JB6A 4M5ZL 2N4IA 3A6OA 3N85H 4JM4L 5DQ9A 3JTTB 4N8VG 1D5BB 2D4FA 3FZUD 4C59B 2K9UA 2PKDA 1ITCA 3QCTH 5EOTB 3UTQB 2J8HA 1DFBH 2DWDA 5FKAA 5EOQL 1EHLH 2P42B 3KPMA 5CUSL 4M48H 4JFEB 2NW2A 1UACL 3TBYB 1MLBA 5LXGH 3E8UH 5DJDB 4F7PA 2D7OA 1KLFA 4ONHA 3VXSB 4UDUB 3WSQH 4CMHB 3CFCH 5BMFH 3WXWH 4Z7WE 1UKQA 1QKZH 5D7SL 1OOAA 1TETH 4G43B 4L4VD 5ISZA 8FABB 4AYFA 3SO3C 1FCGA 3HR6A 5E9DE 2CRMA 1TPXC 3IT8D 4S1SL 4P5KA 4ZPVA 3KPSA 5E94B 5FKPA 3FN3A 2QR0B 3H7BA 2O5ZH 1CIUA 3MYJB 5HDQL 3QEQA 4LHQB 4U1LB 3UJTH 4J1UA 5CLWA 2YHGA 4PV8B 5GISL 5KVFL 1BZ7B 5GS3A 1NANI 5C0CB 1BZQK 3G6JB 2VTFA 3V5KA 3SE3C 2MPAH 3QXDA 2HMID 3VI3F 4DEPB 2JJWA 3LPWA 1E4WH 2R9HC 1EFXA 5IQ9A 4WHCA 3SDDB 2YN5A 2F15A 4FQHA 4WEUD 3ES6B 4JFYA 2Z31C 3BD3A 4CNIB 1OM3H 4XVTL 3I2CH 1MJJA 1TZGL 4PJGF 1CQYA 2BVEA 5JQ6H 1FG2B 5L7XL 4OGYL 3WJLC 2Y23A 4JO4L 4IMKA 2R4SL 5EIIB 3MV8E 4MNQA 1ZANL 3BZDA 1EO7A 4M6OH 2IPUG 1Y6KR 3QH3A 5F9WB 1ZGLM 4Y2DB 3KYMA 3ARGD 1H8OA 5F7DA 3NIGE 3RWIA 2XRAL 3P0VL 4MXVF 2DAVA 1U8KA 4PRPE 5L88L 4HC1H 1A0QH 2VR9A 1MPAL 5BVJA 5JXEA 2RQ8A 5HI3C 4M62H 5IB5B 5DA0B 1AO7A 4ZUSB 3HFML 2DQFB 3GRWA 4IJ3C 1MLBB 2AJUL 1H3GA 3I02A 4F7PB 5EIQA 4ONHB 3FOMB 4XPGL 4PG2C 4PRID 4MB4A 5BZDA 4YC2C 4Y4HB 3SY0A 2QBWA 2R2BB 2XN9A 4ZPVB 4P5KB 4M93B 2VLRA 3P11H 1WIOA 3LKSB 1N8ZB 3H7BB 4NZRH 3KLHD 2EIEA 1JL8A 4NN5C 1ZAGA 1YC7A 3IDUA 4NHUB 1WQVT 2NY1D 5DO2D 2W07A 1JZ4A 1T5XA 4RAUA 3UPRA 3MCLL 4PB0H 3OSKA 1B3JA 3Q5OA 5E6ZA 4AEHL 5IGXL 1JNNH 1EFXB 3AY4C 1YNLH 2ITCA 3C5SA 5DR5H 3SQBA 3TJEH 5BJTB 1Q9WB 1TZHB 1HIMH 4JFYB 1EEQA 4XBPA 5F7MC 1RIUL 4TNVK 5IVOA 5IW1B 5CGTA 4J8RB 4KVNL 3HI5L 3IDXL 3K8KA 4Y8AA 3X3FH 1SY6L 1NDMA 1RIVH 4MNQB 3VXUA 4MAUH 3S37H 3VWKC 2GW5A 3QH3B 4WW2F 5DEFA 5TQ2H 3KYMB 4LEXH 4DUWA 2VZ1A 3MRBA 3U4BL 4KZEL 4LVHB 5F7DB 3RWIB 4I9WD 1H3UA 4EDWL 2UY7A 4M43L 3DO7B 5BVJB 2D9QB 1GJIA 3ZYZA 4DUXA 5EBMB 1RVFL 3L7FB 2CLZB 1DE4A 1ERNA 1VKXA 3RZWA 4BM7A 2WUBL 4KKAC 2YA0A 4RWYH 3I02B 3MV8D 2MCG1 4DKFH 3T3PF 2OS7A 5B4MC 5BZDB 3VXQA 2NNAA 2CD0A 1BD2D 1HCVA 1YECL 4HXBH 5KSAD 4I3SL 3FQXB 4O58L 1C8PA 4HKJB 2XN9B 2YS4A 2VLRB 4ZOEA 2MSPA 5K59E 3QHFL 3QUXD 4Y1AB 4W6XB 1LDSA 1AGCA 3QIBC 1N6QL 1YPZA 1G7QA 1S7TB 1BM3L 4U0RC 3WS6C 1HWHB 1W8OA 3D18A 2WUCL 2NMSA 1T5XB 1ZTXL 2P46B 2XT1B 5CZVL 5DD3H 4RAUB 1P7KB 2HRLA 1F3RB 3TF7C 1P1ZA 2F9BT 1I9IH 4N1EA 4QRPE 4PREA 2O5XL 4XNXL 3BGAA 4N8CL 2ITCB 3C5SB 5CJQL 5EUKB 3B2UC 4NO2A 1Z6JT 3U1SL 1AR2A 2VLJA 2FBJL 4GKZB 4XBPB 5ANMB 1ORQB 1S9YA 3OPZH 4DKEH 4I4WB 1T1YB 3W11D 4GJTB 3MLUL 3ZDXF 4Z7UE 4H5SA 5IWLA 1Q9KB 3V8OA 3T0EA 4PRDB 3MPCA 4HJGA 1WCQA 3MJ6A 5DEFB 3FQWA 1U3HC 3SDAA 5JA8B 2H1PL 3WIIL 4JG1L 3GMQB 1NGYA 3SDXE 2K1MA 1FNSL 3NIDE 4FQCL 1IM3A 2QQLL 3O3EA 2DM2A 3C5ZA 5B21A 1A6UH 4MXWL 3KS0H 5JDSA 3GJEB 3V6FA 3EDDA 1VKXB 4U1JB 4RGOL 3K2UH 3QPQC 4P3CL 4V1DD 4R96B 5I76A 5J9PA 2F19H 1Q1JL 1IC1A 4I2XB 3JV5A 3O3DA 4MD5A 4RFEA 3ARUA 3EYSL 3VXQB 4BUHA 2NNAB 2EH7L 1FL6A 4JDVB 5KSVB 1E4XL 1LE5B 3P30L 3DMMB 4G6AC 1J0YA 4UBDD 1IAOA 5DJ2B 3U30C 2XV6B 5JOFA 5M7QA 1XCTB 3N50A 2D3VA 1HILA 3WLWC 1BQLL 3CX5J 2Y5TA 4ACPA 4PJFA 3DARA 1YPZB 4UDTA 1I85A 1G7QB 1NUGA 4DKDC 3PDDA 3WXVH 1A6WH 1BWMA 1FH5H 2LAGB 4FQXD 4K3JL 3T4YB 2BRQA 4OLZH 3FOLB 5D1QC 1HCFX 4MCYA 4X4MA 3LKPA 5DC4B 2BVQB 3P9LA 2G5RA 4OLUL 2C7UA 3IF1A 2BNRE 4ZG1A 3U7YH 4JPKL 3QRGH 3S4SB 4KQ4L 3ZKNC 3SE3A 5FO9A 3EHBD 1T4KA 4NO2B 4NBXB 3ROOA 2VLJB 1QO3B 5BXFA 1CYGA 1S9YB 2ZG1A 5I19L 3U79A 2VDPL 2ENYA 2X4PA 1XGPA 4X6DF 4XMKH 4X4YA 2FECI 2YD7A 3Q2CA 4KHTH 3CU7A 1K4CB 1LDPL 2JJUA 5CP3A 3WJLA 4HJGB 1QG3A 5DVMA 4NNPH 4PYHA 3O6MH 3SDAB 3MSPA 3A6CH 2W0KA 1NGYB 2Q3AA 4LHJB 1NCWH 5C6TH 3RIAK 4YXHH 2X1QA 3JUYA 4WI5A 3VFOA 3EJJX 3O3EB 4WENB 5I8OL 3C5ZB 5IEKA 5IVXE 3QDGA 1E6JL 1CXHA 3O2DA 4Z7OE 5JDSB 3V6FB 1QPPA 1FLRH 4B0MM 2XWTB 4ZAKB 3GUTB 3MLVH 5I76B 1R5IA 2KZWA 3MUZ1 4PJEF 4X6CF 4GG6A 2NY4D 3IB4A 4LSSH 4RFEB 2DDQL 2Q8AH 1VACA 4JM2F 1MCRA 5J12C 2FJHA 2AJXH 4MMZC 1FN4B 1HILB 4PGDA 2Y5TB 3BQUD 4RSVA 5DJCA 4LEOB 1TPXB 1F02I 1DANU 4JFFD 4FA8A 1V7MH 5CAYB 1YEEL 1Z9LA 3LKPB 5I1HH 4APQC 1CFVL 3P9LB 2MQCA 3TBWB 3WS3A 3V95A 4QTIH 2C7UB 3IF1B 3RU8L 1FBIL 2EDFA 4WI6A 2FGWH 1V7NH 3GGWA 2R56L 4PGZA 1FFQA 3FO1A 5FO9B 5FFLA 1CGWA 5KN5B 1F8TL 3B9KD 1WBXB 3ROOB 3RDTC 5C86A 1M05A 1SMAA 5B3JE 1NPUA 5ACMA 2IALB 4F7MA 2XZAH 3AY4A 2X4PB 4HAFA 4K3EH 1FORH 1XGPB 3QUKA 4P46C 1K8IA 1R24A 1T04B 1WCBA 2Z31B 4X4YB 3QFJA 1GIGH 2YPLD 3NOIA 2Q1EA 1C08A 5H94A 2IMMA 4PJXB 1RD6A 3ME0A 4ZMAT 1AGEB 4RGNC 2R1XA 2BNRD 2P4AB 4KTEL 5T33L 2DQIH 3VWKA 4G8IA 5I8EA 1EUTA 3LQZB 4BZYA 3T4AA 3LS5L 5IEKB 2PCPA 2IFFL 1H5BB 5KJRH 5D2NE 5GSVB 1TTUA 3WFHB 5DURB 1R5IB 3D1MC 4QHLB 2CKBH 4P48A 4XPAH 4D9LH 3ZL4H 1K4DA 3P77A 5GS0L 5DRNB 3BIAX 4IJ3B 1VACB 2XPGA 1CLOH 1T0MA 2V5TA 3IDIB 3JWDH 2ZUQC 4QHKI 1U8HA 3KJ6L 5L6YL 4EI6B 2FJHB 2Y07L 4ERSL 3WDHA 3KPLA 2DBJA 3ET9F 4OLEA 1HWGB 4YC2B 1GAFH 4Z78A 5MP6H 3WDJA 1A1OB 2JCCF 5EZIH 4NKIH 1RUML 1Y18B 3PWVA 4Q97A 4MA1C 3S5LG 5TDOA 3RWDA 1G9EA 4FTVA 3ZT7A 3QIBA 3HMWL 4NN5B 3PXJA 3WS3B 3IXAB 5L0QC 1C1EL 4QY8A 1KJMB 4JN1H 4ZS7H 2ZCKL 1I7RA 2IADB 4G9FA 3WHXA 3GGWB 3MRGA 3J8F7 3DI2B 1J87A 3D9AL 4N0UA 4PRHE 3IXTA 4HK3N 2B4CC 3BPCA 4NT6A 3CDFA 4OCXH 2ZSVB 1EFQA 3QUKB 1K8IB 5I15H 1JUFA 2OI9B 1WCBB 2H9GA 4XP5H 5EZLA 3QFJB 3MNVA 3HE7C 2X9XA 1RFDH 2WW8A 3IS0X 3JV4B 4D0DA 1FDLH 1N2RB 2D9CA 5H94B 3HE6D 3DX7B 2R1XB 4Z8FH 5ETUB 5KSBE 5HDLA 2R8SL 3X12A 3VWKB 4XCFL 1CGSH 4G8IB 5I8EB 4TRPL 1U3HA 3MRPB 2OP4L 1HXYB 1W8NA 1WZLA 2DQEL 5FHAL 3BP6A 5SWZD 1H3VA 2DM4A 2C4XA 3LEVH 3S6CA 35C8L 3NH7H 3VDBA 1D5XA 1QFWL 4Z7VE 1IVLA 5MEND 2VR5A 3QUYA 1SBBA 4EIGB 3VE0A 2KZ1B 1K4DB 1KTDA 3EO9H 3HS0B 2PTVA 4D9QE 4NUGH 1T0MB 2KDGA 5K9KB 2B2XH 1M71B 4K7FA 5HYQA 4LLYB 1FE8L 3S34H 4RMSA 1VGKA 5EBWA 3ILQC 4L4TB 5I1GH 4MNHA 4NM4H 1JHLH 5IOPA 3EOAA 4Z78B 5D7IA 1GC1C 4G5ZL 1RHFA 3MLSH 4M7JL 3CK0H 3BN9C 2ADGB 4LCWB 2BNQB 3INUH 4Z7WF 3ARFC 2CDGB 3H9HA 1OAUL 3BKCL 4MMXC 4U0RB 4JQXA 4QY8B 3HZYA 2VXSH 3DV4B 2GTZB 4M1CC 5D1QA 2GFBA 3WHXB 4ELKB 1A14L 3MRGB 5KVGL 3FFDA 4Z18A 2Q8BH 3QDJB 4N0UB 4OI8A 3TA3D 4XXDA 4LCIH 3TIDB 4V2CB 3NCJL 4Q9QL 4GFTB 4LSQL 5E8EB 2V2XB 2QTEA 1MFEL 2FR4B 2A0LC 3U7WH 3VD3A 4JFOB 3TVMC 5GJSH 1JUFB 5IEHA 1YEDA 3MNVB 4JO3H 5TDPA 4G8EB 4BZ1H 1J0ZA 3HNVH 1YEKL 1NEZA 2HJKA 4WI2A 3SDCC 2E5EA 4BKLA 1T2QL 4HK0A 1M7DB 1DQQB 2VDRL 5D1XC 5EH1A 4PRHD 1W72H 1QLRA 5IB2B 4Z0BH 3U36B 1VDGA 1IGYA 3FJTA 4NQCA 2ATPB 3OKOA 1ODAA 3S96A 2EXYD 2UUDK 1T66D 5FYKH 5F9JB 5FO8A 1YEIL 4NWUL 3LPGA 1QOKA 3NIGF 4LP5A 5FYJL 4OCRH 2Z8WC 1KC5H 2FRGP 1NCCL 2DI7A 2OJZL 2H3NB 4MXQA 4MQ7B 5HYQB 2ZG3A 1ZK9A 1OPGH 4N0FA 4L1HA 4ZFOA 4MNHB 1B0GB 1T20A 3HI1A 1BBJA 3CVHH 5D7IB 4LPYA 3BKJH 3ARED 1FV1A 2ITDA 2YMXL 1AFVL 2A6IB 3QDAA 4ODTH 4OSUL 2NQCA 5ENWB 1FZKB 5FCSH 3DIFB 1MCCA 5HI4C 2HWZH 3ECBA 2XXMB 3QEUA 1KIQB 2ADIA 1HXMA 4LHUD 4U2YA 4Y19E 5D1QB 1YEJL 2GFBB 4LSPL 5J8OA 3BEWA 3FFDB 4APQA 3TT3L 4PRBA 5HYEA 3LB6C 1MFNA 2DI8A 4AT6A 2NY5L 1JIBA 2MKWA 5HGGS 1FNGA 4P2YA 1HDMA 1Q0XH 3C6SB 2X89D 4ZXBC 4ODHH 2ARJQ 5EDXA 1ZA6A 5IEHB 3RDTA 3P0YL 1YEDB 3NCCB 3BIBX 1X5JA 5TDPB 4JDTL 3I75A 1AC0A 2EDWA 1NEZB 4OCNC 4QRUA 2HJKB 4WUUE 3F6IA 1RV6X 4NSKA 5KZCD 1F42A 3I3DA 4BKLB 4JFED 2IG2H 4HK3J 4HK0B 2D7PA 1WF5A 3TP4A 3ULSA 1R3KA 2PW2B 2ZP0T 4IRJC 1DBKL 4KJYB 4W6YB 1YC8A 2AJVH 3VXSD 3MXVH 1FGNH 1IGYB 2VXQL 4EN3D 2IPTL 4E5XA 4NQCB 3S96B 4L5FL 1C7SA 1ES0A 3JBG7 1OTSD 4JJ5B 3X17A 1IARB 4ZSOA 1ZHBA 2NYYC 3P73A 5T3XL 4DGYH 1QRNB 2EYRA 4A6YA 1P2CA 3DGGA 5D7LE 1MCOL 4ZUVB 1UWEL 3GIZL 4YUEH 2JB5L 1NAMH 1QBLL 4P2OD 1T20B 4DOHB 4YWGH 4U4BA 1CR9H 3HI1B 1MCPH 4GBXC 3WKNA 5IFJB 1JFQH 2QQNL 2OZ4H 4Y4FD 3JVGA 1G9NH 3V4PH 2ITDB 4P5TD 3ZDZE 3D39E 2JIXA 4IS6B 5C0DA 3ZYJA 2VQTA 4NZDA 3WHE0 2W91A 5HDOA 1CE1H 3DX8B 1CLYL 1VPOL 3ECBB 4GS7C 4GRMA 5K59F 5DK0A 1HEZA 4TOYL 4Y0GA 4WY7L 2EC9T 1EGJH 2P5WE 4PRBB 4MSWA 1RJLA 1MOEA 5GGTA 1HDMB 2ZWLT 2PETA 2LAAA 1BBDL 3EDJA 3HZKA 5C0EA 1E6OL 3RDTB 1ZLWH 4S0UC 2EEBA 1NCBH 1X3DA 5DLML 2RFXA 4OV6F 4QRUB 4YHNB 5CWSA 4P46B 4RA0C 1EV2E 3BKYL 1IZKA 3L6FA 5FM5O 3HE7A 1ZLVK 1AGBA 4PD4J 4Y19D 5EU4A 3RZCC 4Z7UF 1OGAB 4UIKH 1DN0A 4G6JL 4RGNB 1UKSA 3EJZC 3H2WA 3QFDA 1P4LA 4IHOB 2UZIH 2EDNA 5CMAA 4DGIL 3EOYG 1DSFL 1QSFB 5F1SA 4UV4H 3A6BL 1IFHH 3O41A 4ZSOB 1MVFA 2E8YA 3P73B 2VL4A 2VUOA 3SDXF 5HHOD 3MFFA 3TO2A 2EYRB 4A6YB 3NIDF 4LLVB 1P2CB 1CU4L 4PJIE 1QYGH 1HSAA 2ZG2A 2ZSWA 3RUGE 5ERWA 4MA3A 4IEFB 1IAIL 1U6AH 4LLQA 3DGGB 2XI9A 1TJHL 2IAMC 3MRNA 1RURL 3R0NA 2B0SL 1IBGH 1BAFH 3V52H 4GG8A 2C3VA 3V6BR 5D7KE 2ZUQB 3L9RB 3FQNA 3MCKA 4WVRA 1A8JH 5HYIA 2SEBB 4Z7NE 3UYPA 5C0DB 3MNZB 4U33A 5DD5L 4ZNEA 1PFCA 3SKUD 5C07E 1GGBL 1I75A 3AGVA 3CX5K 4MA1B 1IL1A 4GRMB 2AV1B 1UC6A 3ARFA 1IEBA 4L3CA 4R4ND 5DK0B 1HEZB 5D7LD 4PLJC 5L0QB 4DN4L 2EDHA 5FGCB 4U6VL 5D70L 3DGCR 4MSWB 3V0WL 4IRZL 4G8GA 5L8KB 2MFNA 5B38A 3TNNA 3HZKB 1I8MB 2F5BL 3E3QE 3VRJA 4JHZA 2J4WL 2NR6D 4EEEA 3MBXL 4W70A 5HY9B 3D39D 2OCFD 5ITBL 1QVOA 1CF8L 2RFXB 4LKXA 2ADFH 3V5HB 2LV4A 5CWSB 4RBPH 1EPFA 2XKSA 1L9NA 2ICWI 3L6FB 2ZCLL 5DT1L 1N7ML 3P9MA 4QRRB 5EU4B 1IC7L 3GJFH 3L3OA 4ZFFA 4RGMC 1ZLUK 1N5YL 4OGAD 3UJIL 1Y6MR 3SDCA 1DN0B 2P5WD 2AGJL 3I6LE 1JFMA 2OL3A 3WUWA 1EBPA 5CBAA 2AXJA 4MNGE 1D6EB 5CMAB 3ZTJG 3EYQD 1YN6A 3CX2A 4LLUA 5TQ0L 4YAQA 2OK0L 1N59A 2GT9A 5D1XA 3OMZA 4D9RD 3CLFH 3LEXA 4YBQC 3PWNB 3F7YA 2CIKA 3O41B 2UYLB 3OAUL 1FO0L 1I7TA 4Y1AD 1LEKA 1N0XH 1HSAB 2Q6WA 3O9WC 2VYRE 5AWNL 4HH9A 3HG1E 5DRXA 1MJ8H 4FFVC 5IVXF 1JNHB 4AK1A 5CEXA 2I25N 4Z7OF 4EOWH 2JELH 2P7TA 5FHBL 4E0RA 3NA9L 3RY6C 4ZTOH 3S3PA 3VGEA 1M7IA 4YDIL 3D25A 4GG8B 5B39A 25C8L 3UTPE 3JWOL 3FQNB 4HHAB 5DS8B 1K85A 1UENA 5GGQH 3DPBA 1XGRA 2P43B 3X13A 3AU1B 4PP1D 4MQXC 4BA8A 2OSLB 1DFBL 4H8WH 1U58A 4LNRA 1IL1B 4TPRH 5M95B 1WV7T 3R0MA 1M6OB 1QSEE 4P2QB 32C2B 4KK8D 5IV2B 1T22B 3RBSA 1UJ3C 2A83A 5EZJA 5LXGL 2AERT 4QXGL 3GNML 1NMAH 1X5XA 2OM5A 2W9EH 3WSQL 1FNEB 4N9GB 3WXWL 5B38B 3OHXB 1TETL 1S5IL 2NW3A 1A02N 2GITA 1NBQA 4DZ8A 1KJ2B 4YFDB 3GHBH 3TN0A 1FFPA 4ZXBA 1VEOA 4WW1A 3EGSB 5JLZA 1QVOB 4OBSA 1WWCA 3RWCB 3TVMB 1I1CA 4JFQB 5C07D 3OKMA 5B3JF 1FIGL 1S7VA 2YXFA 1UA6H 1R6VA 2VL5A 3L3OB 4L3EE 4ZFFB 1MQ8A 2XQBH 3TCLA 4LL9A 4GLRH 2MPAL 5GS2D 1ZWIA 2Y6SD 2OL3B 3WUWB 4MWFA 3VXTA 4EUPB 2NPLX 1YN6B 4YAQB 1N5AA 1WUNT 2GT9B 1E4WL 2WLYA 3DX6B 1UWGL 4KMLB 4M6MH 5D1XB 3UDWC 3VFWA 3P4NB 3DMMD 5HYFA 1J8HE 3O4OC 4OLYL 4RAVA 1LO3H 4EJ1C 1I7TB 4HX1A 3I2CL 4HWZA 4YZFE 2Q6WB 3VXRA 4D0BA 4WO4C 1F5WA 4HH9B 1JF1B 3IFPB 5CEXB 4LLWA 5F1NA 3T1WA 2ZUVA 3IFNL 4E0RB 3TEUA 3HNSH 4XH2B 1WSST 3H42L 1S5HA 3NFSH 1M7IB 3CFEA 4L29B 4G59A 4YHOL 2HJFB 3D25B 3TGXA 5HYSA 5B39B 3P2TA 3I6LD 5T1MB 5AG8A 5BRZB 1P5VA 2BFVL 2W59A 5J7CC 4NFCA 4BZ2H 1E28A 4GBXA 1C5BH 2R0WH 4X0KA 5T3ZH 2O93L 4DWHA 5DUPL 4ZO6A 1TQCC 4I0PC 1F4WH 1IGFH 3HG1D 3MRRB 3FRPA 4LAJH 3NCFB 1RZJC 5EZJB 1RUAL 5JQHC 1BF2A 1DUZA 4KK6C 2EIZB 3MO1A 1S9XA 4U1GC 7FABL 3UTPD 1UADC 2H32A 4JR9H 2GITB 1VHPA 4DZ8B 3NA4A 4LCCC 2EDYA 1FFPB 3NZHH 4ZXBB 1HOCB 3ILPA 4WW1B 3SE4A 1UKTA 1A9BA 1NBVL 3OXSA 3QISA 3V4UH 4MS8D 3QIWC 1KN4H 4YXLL 3OKMB 1UWXK 1UH2A 1S7VB 1QSED 4Q58C 1BFTA 3U48A 2H2SD 2RJMA 4OM0H 1ZHNA 3UTTE 3FB8A 4NOFA 1T1XB 4PB0L 1ZWIB 5L2JA 3QQNA 1U8LB 3VXTB 3EFDL 4HKXA 2A6DA 2I9TB 4PJDE 3EAKA 3ARDD 3O2WL 4IRJB 1T1ZB 3CC5A 3ZKMC 4IDJH 4RAVB 4X7TA 1YMMA 1HIML 5KSBF 5TE4H 5AG9A 4PJ5A 3BYTA 4HWZB 1MCBA 2XG5A 5GSRA 4PJ8B 4OKDA 3GI9H 4ISVA 2VQ1B 4UT9H 4QRTA 3F58L 2J2ZA 5DI8A 5IK3A 5A2IH 1T1WA 1YNTA 3ZYOA 5MEOA 1S5HB 3S37L 1CDYA 1U8MA 5JOPE 4OF3A 3AXLA 4Z7VF 1NKOA 5HYSB 4CW1A 4XMLL 2IAMA 5DMGD 1REIA 4CN4A 4OZ4A 1TXKA 5DEGA 4UUJA 2NY6B 5K9OA 3T0BA 3RKPA 4GBXB 1QFHA 3VWJC 1J8HD 5H8DA 4X0KB 1GGUA 1U93A 3MRIA 1YEHH 1NLBH 1OSPL 5CGYD 3SE8H 4FFZH 3SEPA 1U8OA 4HUNB 4NUJA 3JTSA 1JK8A 5KAQG 5IW6A 3PHSA 5K93A 3EFFA 4Y5VC 4HIJA 3MOQA 4GS7B 3CDYA 5JPNA 1FZOB 1A47A 2IBGA 3MO1B 4PP8C 1NGZA 1LQVA 1S9XB 2I26N 2HFTA 4NZUH 2H32B 4HXBL 5T3ZE 4LGSB 1PW3A 3QQ4A 2XKNB 4P5MB 2GCYB 5I1JL 2VC2L 1A9BB 4KJQC 4RNRB 4P2RA 1T21B 4U6XB 5C0NC 3RBGA 2EKSA 4NPYA 4K3HA 4Y16D 5JW4Q 1JBJA 1WICA 3QXVA 2V2WA 2DYPD 5DD3L 4OF8A 3TFKC 3QO1A 3FB8B 4FZ8L 5FDWB 4O02H 5JIHA 4RFOH 3RA7H 4HS6B 4NM8L 1P4IH 4LSRL 3RZCB 2FO1A 4XPTH 4DZBA 4OCSH 3CMOH 1S9WA 3RWJA 3G5VA 5SX4I 2VZVA 5EBGA 1QUNA 1WVZA 1CI5A 1UZ8B 4NN7C 3RIFF 4X7TB 1YMMB 1QR1A 1ADQH 4PJ5B 5CILH 4ODSL 3OPZL 4JHWH 5DMYA 3GI8H 1IT9H 4X6EB 3RTQC 1RK0B 1DBML 5DI8B 5EU7C 1T1WB 1MHCA 4WNQB 4YQXL 3O9WA 5AUMA 3Q6GH 3UTTD 1DVFD 3AXLB 4Y4KD 4K9EH 4CW1B 5HHVH 1MCWW 1TLKA 1K5NB 4FOMA 5ESAB 1J05B 2NTFA 4OZGE 3RY6A 1BLNA 1QLEH 5CKGA 5ACZA 4PP2A 5DEGB 3QDMA 4N1HB 4UUJB 5K9OB 1MVUB 1VB9A 4LIQL 4LLDA 1U93B 3IU4L 3MRIB 3R8BB 1A7RH 5JW3H 4O5LL 4BSVB 1G7PA 6FABL 3JTSB 3PWPB 2YBRB 1JK8B 5CEYA 4AG4L 1WZ1H 4URTB 5IW6B 3U0TB 4YNYA 1MAJA 3OAYH 4AM0B 2W9DH 4GMSL 3ZE0E 5DUBB 1ACYH 5JPNB 1U8NA 1T80A 3MRFB 4B7LA 3UZEA 4R3SA 2VXUL 3L5IA 1UJ3A 1C12A 5BS0E 1HQRB 4X99A 1K3IA 2NXZC 1NFDE 1U8PA 2P8LB 1CGXA 1S7SA 1YMHA 1TTFA 3CSYA 3N1FC 3GSNL 3ISWA 1RZ8A 2XICA 4NPYB 1UEMA 5D72L 1YJDC 3WXVL 2HT4C 1QFWI 2V2WB 3H3KA 3DXAA 3Q6FB 4AMKH 3ZE1E 2FJGB 2YPVH 3QO1B 2ICWA 5GS0C 5E0QA 4XGZB 4FABL 3ARVA 4U3CA 4FXGA 1MI5B 3V6ZA 2WAHA 3MTRA 4DZBB 5HHQA 1S9WB 2ZZUT 3F7VB 4GAJL 5D2LA 3CPLA 5T3ZD 1H9VA 4L4TD 1IQWL 4YR6A 5SWSB 3TZVD 3MXWH 2VH5H 1UCTA 3UDWA 1A6PA 5C0AA 3ULUE 1TJGL 2BNQD 3MBEC 5I66B 1AKJA 2ARJA 5TH2A 1CL7I 3O9WB 1MEXH 4WO4A 4D0CA 4U1KA 5EORL 2E27L 3HR5A 5F1KC 5IESH 1RIHH 4NNPL 5CHNB 2AEQH 2HFGH 3H3PH 1NCWL 3U0PB 5C6TL 4HCRL 2IANB 4OQ1A 1GGCH 3QDMB 1NGXB 4AEFA 3C2AH 4HKZA 3O6KH 4LLDB 1MFAH 2XTJE 4QRQA 1FLRL 4HIEB 1I9JL 1JPGA 1P4BH 3O8XD 1GH7A 2RR3A 3LKRA 3O3AA 4ZUTA 4TVPE 3O6LL 4K55A 4OQTL 2IPKB 2BVOA 3Q0HA 4PJHE 3LY6A 4W68A 4I0PA 2PXYA 3ZDZF 1WLHA 4GAFB 4R3SB 1O7SA 2OR7A 2B1AH 1CXIA 1UJ3B 1AD9B 1C12B 4X99B 4PB9H 3C2SA 1EMTH 2AJXL 4KKBC 5I1LB 1S7SB 2Y7QB 2OXGA 4HPOH 4GKOA 3MOAL 3JSSA 4JRXA 4LCCA 3RWGA 1Q94A 5GZNC 4WU7A 3JV0A 1BQHG 3CUPA 5T1DH 1KELH 3QIWA 5DD1L 5I1HL 1UM6H 3QRFM 4XVUD 4F2MA 4U49A 4LPWA 5D7JD 5E5RB 1OAXH 1YN7A 2Y9RT 1G7HA 1X5HA 3V6ZB 2FGWL 4LKCA 3FT2B 4PD4K 4KVCL 4XHQA 3FKUS 5GQBA 4HFWA 4JO2L 3HRZA 5ID1B 5DJ0B 3KLDA 1JGEB 2RB8A 3DUUA 1OP5K 2BMKA 3BZFA 3B8YA 5C0AB 4FQ1H 4BK4A 1VADA 3O4OB 4CVWA 4LOUC 3CFDA 5IUSA 2ARJB 1MAMH 3KXFA 5E4EC 5TH2B 2CRYA 5HHMA 2HLAB 3NTCH 2GSIB 4FQPA 3QQ3A 4D0CB 1A3LH 2QHRL 4IRSD 1I1FB 4U1KB 4I1NB 5EO0A 3HR5B 4Q0XH 4S2SA 3HZMA 5EC2A 4FXKA 1A3QA 4PJIF 1DBAH 3BPOB 3RUGF 3QNXA 4F57H 4P23C 4PRAB 7CGTA 5CCKL 4IIQC 2X10A 5DDHB 3SE9L 5C2BL 2ESVE 1SYVB 3U9PH 1JPSL 4WU5A 1S78D 1G7JA 4FFYH 1UB5A 3LKRB 4H25A 2ICCA 2A77L 3GK8H 4WJ5B 3PV6B 4PJGA 1TQCB 1NMCC 3HZVA 3O0RL 3KNBA 1Q0YH 5BW7C 1RHHB 2CKBL 4JLRA 4QHMA 3OKDA 3ZL4L 4Z7NF 3MMEA 1BVKA 3ESVF 4Y5VA 5DC0A 5JHLH 3GBMH 3H0TA 4XNZC 3TPUB 5ADOH 4QHNB 2ENSA 3ZKXC 3JWDL 3MJ9H 4UNTA 4U1GB 4RMWA 3CFKB 3QUML 5KS9B 5MP6L 1Z5LA 1IGCL 2KPNA 5CIPA 4PJCA 4BK5A 2FX9L 1OCWH 4XZUA 3QB7C 3G6DH 3GBNH 1LEIA 1X5ZA 2ZUSA 3VFVA 4WU7B 3VGFA 2EDQA 4L8CA 5EO9A 1D9KC 3QIWB 3H9SE 1KJ2H 1SM3H 5GRJL 3ARXA 2E7LC 3MLYL 5HVWA 1YN7B 1G7HB 4JM2C 4DGVH 1OTUD 4N5ED 4LKCB 2G5BB 4OLWH 3O4LA 4PY8I 4RFNC 1CD0A 3GMRA 4HFWB 5IR1A 4KJPD 2DTMH 5I1AB 5GRZA 1WFNA 4UT7H 4NJAH 4TULH 3BZFB 4ODXA 4OCXL 4ONFH 2DM7A 4HWBA 3V79C 3P0GB 1DZBA 2F54E 5I15L 3CFDB 5I1IH 4DAGH 3KXFB 3UO1L 5HHMB 1D6VH 4JGJA 3QQ3B 1KN2H 3I84A 1T2XA 5EO0B 4JG0H 4X9GA 4FHBD 3HZMB 1IQDB 5DUML 4EQ2A 2HFFA 3D69A 5IMMA 5K9JH 1CGSL 4CU6A 5E6IA 5C70A 2G2RA 4XCCH 5J6HA 3BP4A 3MRDA 5I73B 4PBWD 5C1MB 3UMTA 2X9YA 1UB5B 4H25B 4NYLA 4JE4B 5HHNA 4DFHA 1QHOA 3VWJB 3BH8A 4GW4A 3UPAA 4Z0XA 4ZDHA 5GGUA 5GIRA 1ZKAA 4PJGB 3HZVB 4X6BA 1MCIA 1N6VA 4P0DA 1DQJA 3OKDB 4QHMB 2XA8H 3MMEB 3BO8B 3EO9L 1EVUA 4Y5VB 1GHFL 3EZ8A 3H0TB 4OUUA 4OFYA 5HSFA 5C09B 1V3MA 3EYUL 4FN0A 4AH2A 1ULVA 3MROB 4NM4L 5ABDE 2AK4A 3BT2L 4ALAH 1Z5LB 2BSTB 2FB4H 4XHJD 2P48B 2ESVD 2DQDH 1S7RA 3RAJH 4EI5B 4HFUH 4RIRA 3TM6A 2L0DA 1LEIB 3QEGH 1A6AA 3FN0L 3ZDYE 4LCUA 5FIEA 4HDIB 2QKIA 5LKNA 4GAGH 1G0XA 2AJYH 4XBGB 2R2EA 1YY8A 4RZCB 5IR1B 1F4XH 4LCIL 1KNOA 1L7TH 1F4HA 1ZLSL 1D5MA 3QWRA 5JPMA 2N1KA 3BZ4B 5I74B 1RMFH 3BDBA 4PJ7E 3VGGA 2HMIC 3W2DH 3PXHA 4YXKL 1K6QH 3W82A 2W0FA 4JO3L 4PJAE 3RWHA 4JB9L 2VQUA 1NH6A 4GXUM 1DQLL 3QG7H 2HYMA 3RTQB 2VDQH 4YEFA 1L0YA 2FHFA 3MBEA 3D3VE 3PUCA 4P3DB 4YZFF 2VXVL 5IHLB 3DVFA 4PTTA 2AEIT 5C0RL 2G2RB 3DWTA 1W72L 1FFOA 2YK1H 5J6HB 1YYML 1U3JA 5HPMA 3FQTA 1R3IL 4FZEH 1J1OH 2EYSB 3ARGC 1NCDL 3QIUD 2F54D 4DW2L 4GMTH 3VMOA 4Z0XB 4M7ZC 4ZDHB 5GIRB 1P7HL 2V7HA 3W39B 1FL5B 2AI0H 3OL2A 4JRYB 3ARBD 5E08H 3BZEA 1VFAA 2V2TA 2V9RA 4ETYA 1AH1A 5D5MA 2OR9H 4FQJL 4OUUB 3WKML 2W65A 2Y4SA 3VFUB 3V4VL 4TSAL 4WW2B 4AH2B 3BUYA 1ONQB 3OWEA 5FOJA 1RUKH 1EEZA 2VZTA 5BV7H 5IF0A 2JE8A 1F4YH 4NQVB 4Z95L 2EDRA 1S7RB 2AEPL 3RIFK 3V6OC 5T1LA 3VMNA 3IAPA 4RIRB 5IHUH 1R3LB 4ODTL 2P24B 2ORBL 3OGCB 2BVTA 4GQ9L 4OFPA 3BGMA 1VFMA 4V3DB 4LCUB 1JGVH 3OKEA 2FL5B 1W0WA 4JKPH 1I7ZA 1QFUL 3CSPA 3L3HA 4M5ZH 5CKAA 3KLHC 2PO6A 2HRPL 3DBXB 1OARL 4NFDA 2R2EB 3GM8A 4GO6B 3CAFA 2NY1C 5DO2C 1TIUA 3L95B 5E6YA 3FL7A 2XKUA 5EOQH 3VMPA 3PJSA 3BAEL 5CUSH 1F6AA 4IBLT 1UACH 2W0FB 3ARWA 3DYPA 2Q87A 2GTWA 2YD9A 4MJIA 3HUJA 4Z9KB 3F12A 4PJDF 4RQQB 1FVCA 2FX7H 4BFIB 1X4XA 5F7FA 2MKLC 3QPXL 4LVNC 4OFKA 3MBEB 1P69B 4RDQG 5D7SH 1QNZL 3BI9X 2WM0A 3PV7A 4P2QD 1S7UB 1JI1A 4ZUWA 4S1SH 4DK3A 4AJ0A 2HKHL 4KZDH 2ZOLA 5LQBL 2DICA 2AXFA 3AS0A 1FFOB 2AJVL 4ELME 1FGNL 1G6RA 4OF7A 3FQTB 4YDVA 3BEVA 5KVFH 4P23A 3VGBA 3K4DA 3BE1L 3GRWH 3B9VA 1KLUB 4Y88A 4YHML 3NPSC 4YHKL 4MX7A 1U3YA 4JO1L 4GAYA 5L8JB 2LTQB 4OZIA 1JHTB 5D9SA 4X6DA 3MODL 4OZFA 4HXAL 3BWAA 4G42A 4HIHA 2X1WL 3D3VD 3VGDA 4JANB 2XZQL 5BW7A 2CDFA 2V6HA 1NAML 4NNYB 4XVTH 1TZGH 4X8XA 1H8NA 2F8XC 43C9A 4OGYH 1R3HB 2EZ0D 1JFQL 2VKXA 2OZ4L 3GSXA 3V4PL 1G9NL 2R4SH 5DHVB 4PBXA 5MEPA 1EDQA 1ZANH 5FK9A 4E42A 4R26L 4PGBB 1CE1L 2DLGA 5ISZE 3OKEB 1IMHC 1I7ZB 3QUXC 4X98A 3KPSE 4HMCA 3K4ZA 3MA7B 3P0VH 5C08B 3BXNA 5L88H 3TESA 1QQDA 4X6CA 2E7LA 5JXAL 1E4JA 2BY0A 3G04A 5IHZA 3QEQE 3IS1X 4I0CC 4H0GA 4JM2A 1OSZA 3BESR 4XNMA 5DF0A 5CSGA 3PJSB 3HFMH 5LVEA 1CK0H 3Q1SL 4BH7A 2GTWB 1OD7A 4MJIB 3WN5C 2ZKHL 2EDKA 2XWBA 2CIIB 2OTWB 4NRYA 5E4EB 3NACH 3W11C 1IM9A 3FT4A 4ZUWB 2ZOLB 2MWCA 4O4YH 4YDVB 3FRPG 2IJ0C 4P23B 3U6RB 2XG4A 4UV4L 4IIQB 5HYJA 5IG7A 2P49B 3F62A 4C83B 1MFBL 4NQEB 3MCLH 5I6XC 4TVSa 3MV9B 4JPWL 2CXGA 4U0QB 1QYGL 5D9SB 4X6DB 5IGXH 4AEHH 1FAIL 3BWAB 5FO7A 3C9NB 1BEYH 4UINL 1AO7E 1HSBB 3EO1A 3GDBA 1BAFL 2V5SA 43C9B 4XNZB 3ZE0F 4HWNA 4KVNH 4OZHE 3D0VB 3HI5H 3L3GA 3ZKXB 3GSXB 4U31A 1SY6H 5DTFA 5MEPB 2E9WA 3KVQA 3ZTNL 2WP3T 2DQHL 5IM7A 5LBSL 1INDL 3M8OL 4UBDC 1NFDF 4X98B 2WINB 3U4BH 4L4VA 1FZMA 2JKXA 1NFIB 3F8UB 1G0YR 2FIKA 1D9KB 2ATKB 3BXNB 4PJEB 4X6CB 4M43H 4FQXC 1DLFH 1WWWX 2VDML 3GSRA 4F7CB 4JM2B 1QBAA 1MCJA 4XNMB 3ZE1F 1RVFH 4X9HA 4QT5A 3U7AA 4CRPA 4D3CH 2KBGA 4P4KD 1PEWA 4E41B 4YX2L 4KI5E 3WNMA 3WEXB 4BH7B 2BNUA 4EDXB 2WUBH 2NY6D 5IMKA 1NUFA 3VFNA 4K8RL 1FGVL 3EHBC 2JCCA 1CGYA 1G7MA 5ISZD 5ADPL 1YECH 3DYOA 1Q8MA 4NRYB 4XB8A 1JWUA 4I3SH 1CFQA 4O58H 3KPSD 1IM9B 3FT4B 3GSOA 5CP7A 2D7MA 4QXUH 3ULUF 4LLMB 4KJWD 3QHFH 3WDIA 2LU3A 5DZNA 1X5IA 5EU6B 1FRGL 3QEQD 1N6QH 1N26A 4PIRF 4YHYC 3T77A 3VXUE 1X4YA 5FECA 3PWLA 1ZT4A 1O0VA 2WUCH 3TCXA 1ZTXH 5CZVH 2H41A 3EYFA 2J7LA 4PTUA 2R2HA 3GKZA 3LSOA 1F2QA 3TLRA 5ESQB 3LKOA 1MJ8L 2O5XH 4XNXH 4N8CH 5F7UA 1XR9A 3U1SH 3S8WA 4ZTOL 3EO1B 4AEEA 1NBYA 1R5WB 5H37G 3QJFA 1J12A 3LRHA 4PJHF 5EZOL 2KQNA 3F6LA 3ORJA 3MLUH 4LMQI 2NY4C 3BGFB 3RI5F 3PGDA 1L8JA 2Q7YA 1LO2H 1VFBA 1CVRA 4CMMB 2R1WB 5DTFB 1DCLA 4XI5D 4G3YH 1NCTA 1LEGB 3A67L 5IT2H 1DLHA 1ZLWK 3MUJA 2WNGA 4Y7MA 3SGDH 1T3FA 4H8WL 3V6OA 3U9UB 2VOTA 2H1PH 3WIIH 4JG1H 4L4VB 1G7LB 1FNSH 1BJMA 4MHHI 1FNHA 2QQLH 1VEMA 2X7LA 4HWEL 4TSBL 3MA9H 2NX5E 2WWKT 3GSRB 1MHEB 1AQDA 1PDKA 3MLZH 3JXAA 4NN6B 4M6NL 5GRYA 1AO7D 1A2YA 3BH9A 5TFSH 4QT5B 1LHZA 4RGOH 1X5GA 5DRWB 3HAEA 4P3CH 2WWMC 1TMCA 3MACL 4XMPL 2BNUB 3W9EB 2ADJA 5IROC 3UBXI 3MV7A 2JCCB 3QCUL 3B9KC 4ESKA 2Z93B 4R4BB 1PZ5B 2GYSA 2EH7H 4X5WB 3FTGA 1E4XH 4YGVB 5AEAA 1XGQB 3P30H 4ZPTB 3F7QA 5CP7B 4CJ0A 1KG0A 4M8QA 2XQBL 3G6AA 5A16B 1BQLH 3NFPA 2NZIA 2OLDA 4HG4J 3RFZC 1C16A 3IKKA 1Q9LA 3B83A 3T0EE 4YJZL 1LGVA 4M1GL 3LS4L 3OKKB 4M6ML 4U1HA 4KI5D 3EYFB 4OLUH 4GRWE 3TO4D 2R2HB 3LSOB 2BCKA 1MJ7L 2OBGA 1RZFL 2PYEA 1DUYA 3ARGB 4JFHE 3UTOA 1EHAA 3LKOB 3HPLA 4JPKH 4M7ZB 2YWYA 3ZZ1A 2VDOH 3CXDL 4CL7A 3P9WB 1XR9B 4R7DB 4XP4L 5C0BE 4JHAL 2XFXB 1E27A 1NBYB 3NFSL 5I19H 1V3JA 4DVBB 3QJFB 2VDPH 1A7NL 3PGDB 2Q7YB 4PG9B 3VXUD 5T1KA 1SJHA 3VD7A 2WIIA 3MV8A 3BW9A 1LDPH 5HVHB 3MGTA 5T3ZL 1DLHB 2H2PD 3C8KA 1KIPA 4PRIB 1C7TA 1I7UB 1BD2A 4OD1L 3B5TA 2DLFL 2AEWA 4Y5YC 4RBPK 4PJFE 1U2HA 5I8OH 1AP2A 3QUXA 5EBLA 1UB6B 1E6JH 3GJFK 1A2YB 4EBQH 4X4ME 3OKNA 2NY1B 3HAEB 4OJFL 1D3CA 3IDYC 2H6PA 2VITA 2Z8SA 3FCTB 3GM0A 2DDQH 1KYOJ 3VFMB 4QWWD 3FTGB 4Z7WB 3WN5A 1EX0A 5E1AA 5D93C 3G6AB 5A40E 5E4IA 3MZTA 2NX5D 3HLAB 1QFWM 4M8VA 3HE6C 2RCSH 5JDJA 5EU3A 1QBML 1Q9LB 5IB1A 1CZ8L 2AVGA 2X70A 3EJYD 3DVGA 4U1HB 1R0AL 1QFOA 2IPUK 2P8PB 3BHBA 3LMJH 4J6RL 1CFVH 2BHZA 2BCKB 1GVIA 1FBIH 3AMKA 2YUVA 1S7WB 4UIMA 4NO5A 5FYKU 1KEML 3HPLB 2R56H 3GI9L 2OYPA 5I8CA 4UT9L 1KTRL 3QUZB 2I07A 3QDGE 1F8TH 2J8OA 3RGVD 4LRNL 1E27B 4QCIA 4MA7H 3QJHA 3DSFL 5F3HB 3X11A 2B20A 1AHWC 2W60B 5A2FA 5KSUA 3QXAA 4GG6E 4V1DA 2AKRA 4WTWA 3C5JA 3T0ED 1SJHB 5DMJB 5DQDH 4KK9D 2LABA 3MV8B 1CG9A 3BW9B 1WZKA 1NC4D 3MGTB 4UILL 1KIPB 1NLBL 5FCUL 1BD2B 4FFZL 4O51A 4JFHD 5KSAB 1FO0B 4XT1C 5EPMA 1M4KA 1RI8A 3VH8G 3LAFA 4J7RA 3LS5H 3QUXB 1JZ3A 4A2LA 4LAQL 5D2NC 4JY4B 5C0BD 2IFFH 3ZDYF 4NBYB 1WBZA 3OKNB 1LE9B 2BY3A 3MYZA 3IFOA 4KAQH 1S7QB 3N0PB 2VITB 3TA3C 3PQYA 1MCEA 1GXEA 2R39A 4YLQT 5E5MA 4HC1A 2D7NA 2QSTA 1LP9E 4L8DB 4PJ7F 3KJ6H 1U8JB 2Y07H 5E1AB 4HD9A 4ERSH 5CD5D 2V7NA 3ULUL 4RMRA 4PJAF 3N9GL 4RFOL 5TGBB 1RUMH 4U1SB 1TNNA 5F3BB 1P4IL 3KWWA 3I6KA 1ZT1B 2X44D 5DJ6B 3BHBB 4JKLA 3DROA 1MCHA 3HMWH 2RIKA 3LZFH 1ADQL 1C1EH 5CILL 5A3ID 2Y36H 3DVNB 2C1PA 4UIMB 4NO5B 4NC0B 3B3IB 3MOBL 2NXYD 4HUVB 2Y06H 2CUHA 3D9AH 4GKNB 4L8BB 2EDJA 2EXYC 3QI9C 2Z4QA 4UQ2B 1T66C 1UT9A 2PN5A 3SCMC 2FJFA 4QCIB 3BIKA 3QJHB 4K9EL 3EDKA 4TVPL 3WMSA 3X11B 2VZ3A 3FQUA 5KSUB 4GW1B 5JW4M 3C5JB 4AENB 3KPRE 1CG9B 3QNYA 1V05A 5J13C 1MY5A 3QEHA 5KVMC 3KYAA 1UCBL 2YOCA 3FRUA 4NKMA 4O51B 3VXPB 2R8SH 2BXZA 4XCFH 3AREC 1B4JL 4TRPH 3QDGD 4OCWL 5D71L 2L4OA 1HKFA 1B88A 2OP4H 1KXTB 1II4E 2DQEH 5FHAH 3M1BB 1I4FA 4C54A 35C8H 4POUB 1N3NB 1FYTA 3FT3A 3GMPB 4FTVE 4LF3A 1C5DB 4FQXB 4X9BA 2BSRA 4JFFA 1HHIA 3IFOB 4L8SA 4G9FE 1Z3GL 3GKWL 3F5WA 4U7KA 1P84J 1ZEAL 2K3TA 3K4AA 5FGRA 2DF3A 1L0XA 1WT5C 1FE8H 4JY6A 1W2KT 5IROA 1OTTD 4F15C 2DL2A 4AMKL 3B9KA 2V7NB 5D6CA 4WDIA 4D8PA 4JZJC 2FH8A 2QEJA 4M7JH 1I8LC 1KEGH 1CBVL 5I75B 1TVDA 3JWDC 2YD3A 3TBSA 2YPLA 3MCG1 1OAUH 1IAKA 4MJ4A 4YHYB 1UEYA 1RZKH 5F44A 3V0AC 2CPCA 3MXWL 4HV8B 5EUOE 2BDNH 4CN1A 3UAJD 2HVJA 3OGOE 1A14H 2JJTC 4EI5D 4QRPB 5JOEA 5KVGH 2VDKH 4ELMF 3WFZA 2F58H 1OTSC 3NCJH 4Q9QH 4LSQH 3BPNB 5JNYA 4JQVC 4QXWA 1P6AB 3H7LA 4CVZA 1RIHL 4HLZH 2FEEL 2X4RA 3D0LA 4G6ML 2R2CA 2XOTA 3OAZH 3H3PL 5CBEA 1AGDA 4Z7UB 4K71B 1KIRA 1KCRL 1YEKH 2NY4B 4OI9A 4YIQA 2FATL 3DSNA 2CUMA 3QEHB 5FM4A 1P4BL 3GHEL 4DEPC 3SDXB 1XZ0A 2VDRH 4Y4FC 3TV3H 1DL7H 5IBUG 2PYFB 4PUBH 1WGOA 4Q9BA 3BQUB 4AZ8A 2VE6B 2WWKO 1I4FB 1A1NA 2CLRB 4Y5YA 2B1AL 3WIFB 1VERA 2BHYA 2BSRB 2OX5A 1YEIH 3WNOA 5I18H 3L3IB 1EMTL 3U4EB 1B0RA 3KPRD 3L7EB 2AJSL 3G5YA 1CE6B 3SPVB 4U6HB 1NCCH 2OJZH 4IOSD 5DJZA 4I0KA 1CLZL 1Z2KA 4B50A 3UBXA 2P5EE 5B4MD 2Z92A 3U46B 1EO5A 4LQFH 5T1DL 1KELL 3X14A 3REVB 2X4TB 1OAXL 3EO0B 1EEYA 3CD4A 3WIHL 1G9ML 5F97E 3TBSB 1AFVH 1DQDL 1I3UA 4FTVD 3RVTD 1JWSA 4OSUH 4UOW1 4JFDE 1L6XA 1MFCL 2VLKA 3RI5K 1IAKB 3HE6A 4TNWF 4G9FD 3LQAH 1A7QL 1FPTL 4FQ1L 1YEJH 2HVJB 4LSPH 3W5MA 3LRSA 1SMOA 2BNRB 4K3DL 1MUJB 4KH2A 3RNKA 3IDMB 2NY5H 4G9DB 2YXMA 1B90A 5JNYB 3TNMA 1A3LL 5DK2A 5SWZA 3OAYK 4Q0XL 1ZT7B 4MDIA 4S1QH 5FA3A 2X4RB 3D0LB 1KBGH 3P0YH 4S0TD 4HKBB 2C26A 1KIRB 5MENA 1AHWA 5DYOA 4L9DA 4RMVA 4NCC2 4OZHF 1U3HD 4R6UA 3GK8L 1TJIH 3PP4L 1BFOB 2BVYA 1DBKH 2HG5B 2X42A 4MJ5A 5HGDA 5GZOD 1NUDA 3VJ6A 5IMLA 2VXQH 4H88L 5IVXB 2IPTH 4WRLA 1A1NB 3EIFA 4L5FH 4AIXA 1HYSD 5F7LB 5ADOL 1T0NA 3QUYD 4R4NC 5D2NA 3GSWA 5T3XH 1B0RB 4HUUA 3MUGA 1K8DB 3G5YB 2JJSC 2GAZA 1PSKL 1KJ3H 1H15A 5GHWH 3IDYB 1TVBA 5DJZB 3QO0A 3EYVB 1MCOH 1UWEH 4S10A 3G6DL 3GBNL 4H1LH 3TA3A 3GIZH 2Z92B 3GEWB 2JB5H 1LNUA 4NKDB 2NR6C 4KI5F 1KPRB 3X14B 1MFDL 1TCRA 4MVBA 4H20L 3UC0L 1A6VL 2QQNH 4JFPA 5DMKA 5DEZA 5AZEH 4HUXA 4XBEL 1JWSB 1ZA3B 3FAXA 2E8ZA 2XYCA 4NIKB 4OAWA 3RKDC 1TTGA 3RX8A 3HE6B 4OD3L 4YEEA 2R1YA 2YUWA 4OZFG 4OGAC 3IRZA 2EEDA 4ONFL 2MCPL 2WSKA 2H8PA 5FUCE 3EYQC 3EYOA 4WY7H 1BX2B 4DAGL 3RNKB 2P5ED 4PRHA 2MHAA 1F45A 1L6ZA 1HH9A 2OJEB 3TNMB 5DK2B 1T6VN 1BBDH 4JEGB 4TUJB 3V7MA 5FA3B 3QI9A 1E6OH 3SCMA 4PR5A 5C08D 5F8QC 5DLMH 5MENB 4GH7B 4MDJA 4JFDD 1AHWB 4KY1L 4XCCL 5DYOB 1CXLA 2D03L 3BKYH 3NZ8B 4U05A 5LGJB 5D8JL 3LN4B 5JA9A 1F58L 4G6JH 1EXUA 2FSEB 2J6EL 4L1DA 5IBLD 1AY1L 5IMLB 4PP1C 3SJVD 3FONB 3VRLE 5LJYH 1DSFH 1PBYA 3A6BH 3AREA 3S98A 2V9QA 1T0NB 5ICYB 4FFWD 5D2NB 4KK8C 5ID0B 1JNLL 5FUOH 3MUGB 5EWIH 2AV7A 2R23B 4QF1B 1IAIH 4LHUA 4MXQD 4ALAL 2QADD 2DB8A 3EZJB 1H15B 2FB4L 3OF6A 5FGCE 1TVBB 4N1CA 4PBVC 1TJHH 3UTSA 5CSZA 3TA3B 3QEGL 5ITFA 5JORA 2B0SH 2AJZB 1LNUB 1UYWL 3MV9D 4BJLA 4BYHA 2X89A 4HAGA 1RJYA 1J8KA 5T3XE 2L7JA 2F74B 4J23A 1OLZA 2AJYL 1D5BA 2ZUYA 2OXHA 5DD5H 2GJJA 1K2DB 5C3TA 1GGBH 1I8LA 2GK0B 2R1YB 3FQRB 3LH2L 3QXUA 3RVUD 3UTQA 4HG4K 4OCMC 2Y6SC 2OTPA 1G9NC 4JFEA 4NP4L 3TBYA 2VLLA 3EYOB 3GMOA 1UM5L 4DN4H 4U6VH 5D70H 4PRHB 2MHAB 3DMMC 3VXSA 4G8FB 2GJ6E 1X5KA 4IRZH 5DD6B 4UDUA 2JJTA 1G0DA 3PHQA 4GXVH 5ALCL 2F5BH 4GRWF 1BFVL 3OB0H 4H0IA 8FABA 1OWRM 4C56E 4ZD3L 1NGPL 4JQVA 5E94A 3FFCD 5HI5D 5ITBH 1CF8H 1KPUA 4MDJB 2IFGA 2UWEE 2WQ8A 1JZ5A 3MYJA 4DQOH 5DT1H 4U1LA 3VFSA 1N7MH 4E41D 3S37X 5GGSB 5C0CA 4J12A 5KSBB 5CJ5A 1N5YH 3UJIH 2AGJH 1BVLA 1ZS8A 1Z9SA 4Y4FA 3AREB 2DQGH 1GPOL 5F21B 1KTKE 3ES6A 4Z7VB 5EIVA 4CNIA 5CFHA 2AV7B 4PJFF 2EO9A 1FG2A 5AWNH 3WFBL 5BV7L 3JWNC 3T2NH 4LHUB 1ORSB 2BRRL 5HHXH 1F4YL 4JZNA 5FHBH 3NA9H 4G8GE 1CICD 1QR4A 3VCLB 1D5IH 4MB5A 1MLCA 4YDIH 1D5ZB 1DP0A 25C8H 1JGVL 4S0SD 1RJYB 1KYOK 3JWOH 4FMKA 2DQUL 4GUPA 4MS8C 3BX7C 4F15B 1PQZA 1QA9B 4CN6A 3LD8C 2CKBB 5DJXA 4JZJB 4ZAKC 1F13A 2H2SC 3IKCB 5GGSY 4Y2OA 4NQDE 4JCMA 5IB5A 4R8WL 3SKJL 5KZCB 4ZUSA 2DQFA 4ZS6C 2VLLB 3KLAA 5MHSE 3GMOB 3MZGB 3QUMB 4QXGH 3GNMH 3ARDC 2QJDA 2FX7L 3FOMA 5DGQA 4EN3B 3OQ3B 3PHQB 3NAAL 1CFSB 1IC4L 4Y4HA 5GGVL 1S5IH 5T3XD 1Z9MA 5C6PB 4QYOB 1A22B 1CT8B 2R2BA 4KZDL 5DC9B 5HHOA 3Q5YA 1KPUB 3RY4A 3LKSA 5I1DA 1N8ZA 2R0ZH 1BQUA 2VWEE 1RJZB 2EIDA 4WHYH 3VFSB 1FIGH 4NHUA 3K8MA 2AXGB 4MQTB 3GRWL 5DMGC 5EFIA 4KC3B 4O9HL 5I17A 4GG6F 4P2OB 1BVLB 3LOWA 4LPVA 2DN7A 3PIQB 2YD2A 3MREB 2GJ6D 3TJHC 4BFGA 3IDNA 4U1MB 1ZS8B 4KRPD 4Y4FB 1UWGH 4CJ1A 3QR2A 4UQ3A 5CGYC 4P5TB 3W0WD 3ERYA 1IC5L 4OLYH 5BJTA 1Q9WA 4NKOB 4C56D 5DFVD 1TZHA 4YFLI 1U91B 5FGSA 1GOFA 4L3AA 1SJEB 1SYSA 1VENA 5IW1A 4J8RA 2F5AL 1BECA 4HUKB 4M1DH 2XWJB 4OGZA 4WI7A 4JZNB 4TQEL 3EUUA 1W72A 3IFNH 1UZ6E 3GSUA 4RA3A 4FQQB 4KKNA 2FO4B 2JJSA 3H42H 4YHOH 1MLCB 3R1GL 1ACZA 4GUPB 1P7QD 2EDXA 2NLJB 1PQZB 2BFVH 5KAQF 2YRPA 1I9RL 1H5BC 1JP5A 4Y16C 3WHE1 3B9AA 5DJXB 4KHXH 4PGEA 3DO7A 1LP9F 5DUPH 1DN2A 2DL9A 3QA3B 1VA9A 1WEJL 5EBMA 4NHCL 1JVKA 3L7FA 4X9FA 2CLZA 1WC7B 4Y19B 1CFNB 1CK0L 1MCDA 2MMXA 1RUAH 3KLAB 3HB3D 2JF1A 3CVHA 4X83A 2P5WA 4NFBA 4H8WC 4PJBE 1L4IA 4NC1E 7FABH 4GRLD 3NACL 3FQXA 4HKJA 3VG0L 4AIOA 3VXRE 1P9MC 2CR3A 1NBVH 5HHOB 4Y1AA 5I1DB 1A6ZA 4O4YL 2KUTA 3QNZB 4YXLH 1DVFC 1S7TA 4Y4KC 4WUUB 4NQDD 5E24E 4P3WA 1A5FL 3DV6B 5EFIB 3SDCD 1E4KC 1CDJA 1PD6A 1P7KA 5MHSD 5I17B 4NQUA 5FAAA 2EDLA 4YHLH 3EFDH 4LRIC 3IDNB 4UQ3B 3O2WH 5EUKA 5C9JB 1BEYL 2OI9C 1G7IA 1JRHL 4AIZA 5E9DD 4GKZA 5ANMA 1INQB 1ORQA 1CDGA 1SYSB 4I4WA 1T1YA 1RZ7H 5MEQB 3F58H 4KDTC 4O2FB 5TE6L 1W72B 4TNWK 3GSUB 5D7LB 1Q9KA 5ICXB 2CGRL 4PRDA 1B2WL 1P84K 2XTLA 4XMLH 4ZUUA 1BJ1H 1YY9D 2RGSA 4F7TB 2KQMA 3GMQA 4H26B 5DSCA 2CSPA 1OAYL 3QUZD 5DWUL 2X05A 4JPVL 3D39B 4PGEB 1DLFL 5D1ZD 2YUZA 1OSPH 1XF2A 2FLBT 3GJEA 1MIML 5CJBA 1MHHA 5L2KE 4D3CL 4U1JA 4R96A 3L5WA 4I2XA 3CVHB 2P5WB 2C4FT 3OR6B 1WFTA 1HQ4B 3TZVC 2B39A 3LB6D 1CDHA 4JDVA 5KSVA 2A38A 3SGKC 2A74B 5HTSA 1LE5A 3VGAC 3TN0D 4PJ5E 4JFZH 5EUOF 3DMMA 4BQ8A 4QXUL 1IJ9A 5DJ2A 5I1JH 1TZIA 2VC2H 3K8LA 4PRPD 1XCTA 4XCNB 4G7VH 1N6UA 4PDCE 1A6ZB 2B1HH 1HN1A 1EGJA 3T4YA 3TBTB 4BFBD 2GQHA 3FOLA 4FZ8H 2ZPKH 2BVQA 4OM1L 4NM8H 4LSRH 4MNGA 3S4SA 1LO5B 5FB8A 4NDMB 3O8XC 4EXKA 1G7IB 4AIZB 1QO3A 3VXRD 5F1IA 4ODSH 4WFEE 2NYYD 4PJIB 4X7FC 3RUGB 3HG1A 1DBMH 1LO2L 5CJOL 1IKFL 3S88H 4E9LA 4G3YL 4YQXH 1AE6L 4M3JA 1K4CA 3HKFA 5DXWA 1H0DA 2VN7A 3SKOB 1YEFH 5IT2L 4ZUUB 3KPOA 1KENL 2V9TA 5DSCB 1OP5H 4ONOA 4AEIL 4GQPH 1EO8H 4P2RE 2ZNWA 3OKLA 4LIQH 3MA9L 3IU4H 3MLZL 4MS8A 5ECJE 4LP4A 5DHYB 1XF2B 1INEL 5C07B 4O5LH 6FABH 1MHHB 2XWTA 5TFSL 4AG4H 5D7JC 4ZAKA 1NAMB 3GUTA 3PWJB 3OG6B 5CJ8A 3RVVD 4GMSH 3L5WB 2VXUH 1MCQA 1FZJB 4WGWB 3O11A 2XACC 4N8VA 2CJUL 3ARDA 1UM4L 5I71B 5GJTH 5CZKA 1TZIB 2A73A 1FN4A 3GSNH 3O81A 3CH8A 3O2DL 2AK1H 4GOSA 4IRSC 2OQJA 3OTTA 5D72H 4LEOA 3QWQB 4HF5L 2W38A 5L2KD 4FNLL 4OKVA 5EC1B 1AXIB 4ZFGH 1M7XA 4J3UA 5E70A 5E00A 3TBWA 2FGZA 3MRQA 4PV9B 4FABH 1CXEA 2BOBB 1JYWA 4MNGB 1KOAA 4N0CD 2BOCA 2DIAA 4QTHB 2A6JB 4GAJH 1S78C 5FB8B 2VDOL 1HH6B 1IQWH 5KN5A 1ND0B 1WBXA 3G5XA 3TJHA 5F1IB 2IALA 1NCAH 3ZMRA 2R15A 1TJGH 3HCVB 3OJMB 5IMOA 3HG1B 1T04A 2BVPA 2QLVB 2Z31A 3MLXL 5F7KC 3MLWL 4WUKH 1GGYA 3C08L 4PJXA 5AAWA 2F53E 1H0DB 1YNKL 2IAMD 5EORH 2E27H 3ALWA 3KPOB 1AGEA 4ZODA 4QRPD 4HCRH 3L5HA 5HVFB 1RUPH 3BD4A 4MD0B 3LQZA 2EECA 3OKLB 3T08A 1W0VA 4K9EC 3REWA 2M2DA 4EBQL 1H5BA 1UQSA 3DXAE 1I9JH 3LD8B 4JGUA 4Y16A 2BC4A 4WFED 1BMGA 3O6LH 5C0FB 1GCFA 1QSEB 4OQTH 5GSVA 1OTUC 1ZV5A 3WFHA 4QHLA 4KJPC 5D2LE 5DRNA 4KKCD 1A1MB 1U95B 3BRFA 3O11B 4LIQE 4N8VB 3IDIA 3ARDB 1AI1L 4EI6A 4NCDA 1CDIA 3GMMB 4OCYL 5C0AE 3BN3B 4QHKJ 4PG2A 2A73B 3WBDA 2IGFL 3E2HC 2QSVA 2X5PA 1A1OA 3MOAH 4EIZC 1WWAX 1Y18A 2OQJB 2RCSL 1F2XK 4MD4B 3LEYL 1TDQA 4OKVB 5DD1H 3LMJL 5MI0C 5ALBL 5E00B 3UEZA 1J11A 3UTTA 3IETB 4MHHG 3IXAA 3MRQB 1KJMA 3RHWF 4B53A 2IADA 5C7XL 4KUCD 1E4KA 2BOCB 2WIMA 4KVCH 5FUZL 3W81A 4AQOA 1V8HA 4JO2H 4PJDA 2VDLL 1NLDH 2B8OT 3G5XB 1J8HB 4LRIA 3W9DA 3PABB 4MA7L 5AZ2H 3GJFB 2ZSVA 4HJJH 2FDBP 5CIPH 5IIEB 1JV5A 5IMOB 3UBXG 2BVPB 4F7EA 2OI9A 3EBAA 4HPYL 2YPKB 3VRLF 5DQDL 3JV4A 4FFVD 1N2RA 3BDYH 2QHRH 2DLIA 4KDTA 3DX7A 3PWUB 3E6FA 5ETUA 1JZ2A 1CGVA 2YA2A 4X7SL 4XHJC 4DJMA 2XQYG 5CCKH 3QHZH 1Q9OA 4JRXE 1W0VB 3MRPA 3SE9H 3REWB 1HXYA 5C2BH 1PEZA 1NAKL 2E9JA 1JPSH 1UQSB 4Y16B 2BC4B 3X3GH 5DK3A 2A77H 4KROD 2DYPB 2HLFC 3O0RH 4KAQL 2X4SA 1FYHB 2F53D 1FVDB 1EERB 3TWCH 3HS0A 4R2GD 5AYQA 1XGTB 5K9KA 1M71A 5F88B 4LLYA 3IGAA 3T0AA 4L4TA 5JIIA 4J3WA 3S3JA 3O45A 4OGXL 3TZVA 3MRHB 3IVKB 4XVJH 3QUMH 2DMBA 3SGKA 1IGCH 2D7TH 1RU9L 1ITBB 5KOMC 2FX9H 2ADGA 4LCWA 2BNQA 3DXAD 3NCMA 2PR4H 2I24N 4JKWA 4LDOB 2CDGA 5D6DC 4UAOC 2CO6B 3UTTB 1DVFB 5GRJH 4Y4KB 3LZFL 5A43C 4GXUN 3WS6A 3MLYH 2Y36L 4LVEA 3PHOA 3DV4A 2GTZA 3G08B 2UWEF 4ELKA 2Y06L 4NC2B 3B43A 3QDJA 4PJDB 3TF7A 3TIDA 1F6FB 1UVQA 4P9HH 3W9DB 5E8EA 2VAAA 3JZ7A 4X7EC 2EYTA 3NN8B 2N56A 3VU2A 2V2XA 2FR4A 3ARBC 2D0HA 4JFOA 1AKJD 1JV5B 3O8XA 2E9IA 1JCKA 4PJGE 4XC3L 4F7EB 4RCAA 4S1DD 3UO1H 4Q6IC 4WO4D 3ULVE 4G8EA 1T03L 5C0JA 4RISH 4KGJA 4LDEB 4YHPA 1OAQL 3E6FB 4LASH 5DUMH 5E2JA 1FNFA 4X4ZA 5SWQA 2YD5A 1M7DA 1DQQA 2FLRT 5KBNC 4PJCE 4MXVE 1Q9OB 5IVZB 2B5IC 5IB2A 2JJVA 3U36A 1HKLL 2ATPA 1K3ZA 4Z77B 5F9JA 4I0PD 2HTKD 2PXYD 3SN6N 3MRJA 2X4SB 3JUZA 5FF6B 3O4LE 5D7JA 3GFUA 4XPBH 1GHFH 4TUOB 2H3NA 4MQ7A 3HN3A 1IEAB 5KTEL 3O3BB 3IGAB 3O6FD 1U92A 1T2JA 1J1PL 3EYUH 1NUNB 1IAMA 2WLZA 3TZVB 3O45B 1B0GA 3BT2H 4JRXD 3VGAB 4XPFL 3WL9A 4BQCA 3AMLA 1KEGL 2A6IA 1DDHB 5ENWA 3FN0H 1F3DH 3G9VA 5TJWK 1FZKA 2A6KB 2BXYA 3DIFA 3I6GB 1VEPA 1RZKL 1CXKA 1DEEB 1KIQA 4XCYA 2BDNL 3PHOB 5F6HI 3QSKB 2EE3A 2VDKL 4DVRL 2F58L 3MLRL 1ZLSH 4ZFOL 1UVQB 2VAAB 3C6SA 2EYTB 2R69H 4UOJA 4UNUA 1KCGC 3ZO0A 1MRDL 2IH3A 3O8XB 4RDQF 4YXKH 1BHGA 1IILE 4JB9H 1L0QA 2BZDA 5DHXB 5C0JB 3RJDA 1T7VA 1DQLH 4U3XA 3TYFB 4HULB 4YHPB 4DTGL 3BJ91 3KR3L 4U1NA 5DVNA 1I3GL 2VXVH 2EZ0C 5SWQB 2AK4E 2FHBA 5C0RH 3TV3L 1DL7L 4BELD 4PUBL 2PW2A 4KJYA 1YYMH 1R3IH 5BZWA 5A2LH 4NO0D 1UG9A 1NCDH 1XCQA 1BPVA 2APBA 3B4NA 4JJ5A 4DW2H 4XNUH 4R9HA 3DECA 3BP7B 5I1KL 3MRJB 5I18L 3ULVD 5C8JA 4MQSB 3VG9B 1QRNA 4PJHA 3CJJA 3WNPA 4HEPG 5D7JB 1V3KA 1EJOL 2FECL 4FQJH 2DLEA 3NCYS 3WKMH 3T0DA 1CL7H 4ZUVA 5BS0B 4G6KL 5TDNA 1U92B 1BOYA 3VFGL 3V4VH 4TSAH 4HS8L 4NBZB 2XXCB 4G7YL 4NJ9L 1NFDB 4LQFL 3L5JA 3VA2C 4QRSB 4HEME 4WWID 5IFJA 3PNWB 5F71A 3WL9B 4Z95H 1OQOA 2AEPH 1HI6A 2CUIA 4PJBF 3QXTA 5KANI 1BREA 4NZTL 4IS6A 2ORBH 1JZ6A 3UJJH 4PGJA 4GQ9H 3RL2A 1RUQL 3DX8A 4IRSB 4U6YB 5J1TC 1N64L 4A6YL 3SHSA 1QFUH 1X6LA 2EXWD 3HPJB 3LQAL 3STLA 3O4LD 4XCYB 3IRPX 4OZFH 3RY5A 2HRPH 1OARH 4D9QD 1BVZA 1V5JA 4OLXH 2VIRB 5F96L 3ZKQD 3MLTB 1BIIB 2V17L 1F3JB 1KPVB 2VB5A 4OBRA 3BAEH 3LN9A 1PY4A 4S1QL 2IH3B 1KBGL 1ZVHA 4CDHA 4M7KL 1U8QA 4PS4H 4YHNA 5D5ME 4P46A 3QPXH 3SOBL 1QNZH 1DANT 4U1NB 5F7NC 5E6ID 3DETD 3VRIB 1T83C 1BJ1J 1YEGL 2HKHH 2ILLA 5LQBH 1TJIL 1OGAA 2FEDD 2YRLA 4IHOA 2DQJL 4XP9L 5GGTL 1GGTA 5EA0L 2XTJB 2Y1VA 3I3BA 2ESVA 2VZOA 3ARQA 5BZWB 4POZD 1QSFA 1FG9C 3KPPA 3BE1H 1XCQB 4PJ8C 4YHMH 4R97C 4YHKH 3HNTL 2B4CL 4JO1H 4M61A 5C8JB 4PJHB 1OGTB 3VW3H 1CTNA 4LLVA 4NRXB 4RX4A 5F6IC 5HGHA 3MNWA 3MODH 3AM8C 1IGML 1OAZL 4HXAH 1KJ3L 5GHWL 1XGUB 3CFBB 2CLVA 2XZQH 5GGRY 5TDNB 3HC4L 4P4KC 3R4DA 2AK4D 2DMKA 3SGJC 2NY6C 4K23H 1VESA 4XP6H 2CH8A 5LWYL 3HUJE 3L9RA 1PX4A 3F65A 2IC2A 5GS2H 3WYRA 4KQ3H 1HI6B 3MR9B 5AZEL 1KB5H 3H8NA 2SEBA 3E2HB 3MNZA 3OJDA 4R26H 3RL2B 3OAZK 4KJWC 4MCZB 5BV7C 4KXZH 1OB1B 2AV1A 3STLB 2JK5A 2QSQA 3I50L 5E5UB 2FX8L 1RZGA 4HUWB 5D6DA 3L3KA 2G75A 1RSFA 5MI0B 2P45B 2X1XR 3QWRD 5JXAH 1FP5A 4YO0A 1UXSA 1L7IL 1KLGA 1I8IA 1I8MA 3FB7B 1FSKB 5INCA 2VAJA 3Q1SH 2DD8L 4LSUL 2YEZA 4OZIE 4J3XA 5HY9A 2ZKHH 1XIWB 4BFEA 1U8QB 1RULL 3V5HA 3KDMB 4MLIA 4Q6IA 2VRAA 3LKNA 2X4QA 4W6WB 2ICWJ 3L3JA 4JVPA 4QRRA 4WEMB 3SKNB 4XI5C 4JFXA 3DRQA 4ZTPL 5BO1L 1B9ZA 1D6EA 3LQMA 4C58B 2ESVB 4LGPB 1D7FA 4ZYKB 3KPPB 3PWNA 4XRCB 4QGYA 2UYLA 1MFBH 1E0OB 4I5BB 4M61B 5FUOL 5EWIL 4JPWH 4YHZH 1LK2A 3MRCB 4KRMB 2IWGA 5HGHB 2DI9A 3MNWB 2VXTL 3BUTA 5J1SC 1WAAE 1FAIH 4WUUD 2NZ9D 1JNHA 5DJ8A 2CLVB 1CCZA 1MCWM 4UINH 1Y0LA 1AC6A 2N7BA 2OL3L 5T1LD 4KGLA 4ODWB 4LBEA 2DJSA 4HHAA 4KUCF 3ZTNH 3N1MC 2D2OA 5DS8A 2DQHH 5I2IA 2A9ML 5LBSH 3OJDB 1BGXL 3AU1A 1INDH 2VABA 3M8OH 2MQ0A 2OSLA 2DJ4A 3NBNA 3H9SB 2PO6D 3MJ9A 2JK5B 1M6OA 5JHDE 1RZGB 5DVOA 4P2QA 32C2A 1T89C 1GZQA 3L3KB 2G75B 4UAOB 5IV2A 1T22A 1TQBB 5I0ZA 2O61A 4M5YL 2YKLL 2VDMH 4YO0B 1UXSB 4KI5C 4MJ2A 5HYJE 1FNEA 1KLGB 4N9GA 3ZT6A 1I8IB 3TO4C 4GXVL 3OHXA 1SBSH 5INCB 3SGEH 4YX2H 4Q2ZA 3QIUB 2F54B 2YEZB 3KPTA 2P8MB 3BWUC 1KJ2A 1T7YA 4K8RH 3STZA 1XAUA 1FGVH 3EGSA 1KCVL 2HJLA 1VFOA 3ARBB 1JN6B 3DRTA 1N4XL 3RWCA 3TVMA 4JFQA 5ADPH 2WBJD 4DQOL 4MJ6B 4Q6IB 3LKNB 2X4QB 3L3JB 2GJZA 2G60H 1FRGH 4JFXB 4WI8A 3DRQB 4EUPA 1XF5B 1U3ZA 2H2PC 2M26A 4MAYD 3DX6A 4PLKD 2DQGL 3P4NA 2B5IB 2YSSB 3ESUF 4L4VE 5FOBB 1LK2B 3T2NL 3SKMB 1JF1A 1I3RB 3IFPA 5HHXL 4POYA 5DJ8B 1EK3A 2ID5A 4WI3A 4XH2A 1Y0LB 4L29A 1D5IL 4XP1L 2HJFA 5EZOH 1KFAL 4R4FL 4LSDA 5T1MA 4YHIA 5J3HC 5BRZA 4LBEB 5LG1A 15C8H 5D2LF 4QWWC 3RIAF 1JGLL 1YYLL 3M17B 5I2IB 3EW3B 3A67H 2VABB 4PLNC 5I1EL 2VISA 2E9BA 3S4SG 3MRRA 1GZQB 1SEBA 1ZOXA 4HWEH 2O61B 4TSBH 4U7SA 4JREC 4P4RA 5GS1B 3EJYC 4M6NH 5IQ7L 2EIZA 2NTSP 2ZNXA 4PJ7B 4D94A 5E2TL 2BSED 5D7KD 3MACH 4Q2ZB 4XMPH 2ZCHL 1EAPB 4XTRD 3NPZB 3TIEB 1HOCA 3STZB 4PJAB 3VGHA 1GZPB 2HJLB 1NBZA 3QCUH 3DRTB 2H26B 3RGVC 1OQXA 2R0ZL 4HMDA 5E8PB 4HBQA 5DQJB 3TH4T 2ICES 1WBYA 3D3VB 5JHDD 2GJZB 5E1HB 2YC1B 5IBTH 2LU7A 3T0EC 2GUOA 1T1XA 4IMLA 4KK9C 1U8LA 3TT1H 1MIEH 5LGKA 1T83A 1J10A 1E4XI 5E8NA 2I9TA 4HGWA 4M1GH 3LS4H 3NABL 2BJMH 4IRJA 1T1ZA 2AABL 4PGCA 1KF9B 1MJ7H 1RZFH 4YBLC 3PP3H 4PJ8A 4M1DL 3PGCA 3MJGX 2VQ1A 1DBJL 3CXDH 1EH9A 1C5CH 1MRFL 3WLBA 2J12B 4XP4H 5BCAA 2Z35B 3BPOC 2XIDA 4I48A 3AM8A 4JHAH 1ZMYA 4KI1A 3OG4B 1A7NH 2VSDA 5INDA 3UYRL 3P4LA 4YDKL 4YHIB 2FWOA 4P4KA 4XVSL 3MV7E 5AYUL 1NC2B 3SGJA 5LGHH 4KHXL 3OB0K 5CD5C 4KFZC 2EDOA 1EIBA 2GSGB 5IP4A 2VISB 4OD1H 5FA4B 1I85C 5C92A 5J4MA 2DLFH 1SEBB 5LAXB 2IMNA 3BKMH 4YBHA 4P4RB 3U0WL 4MLSA 1FZOA 1NCUA 4OTXL 1IKNC 4FG6D 1UFUA 4HZAA 4I3RL 2EDBA 3S36L 4JDZB 3MGAA 2X4OA 5A3IC 4OJFH 3QXWA 3UCRA 2XKNA 1DQMH 2NXYC 4FQIL 4P5MA 2PYEE 2YD4A 2GCYA 1NBZB 1GSMA 4RNRA 1JZ8A 1T21A 1UXWB 4I9WE 4U6XA 4UT6H 2ZOKA 3OX8A 1WBYB 3MRKA 2GUOB 5FDWA 4WHDA 4IMLB 3ULVF 4YHLL 4LARH 4HS6A 2CMRH 3G5ZA 5KW9H 1QBMH 4ELMB 3RZCA 5E8NB 4HGWB 1CZ8H 3V5DB 1R0AH 4CKVX 5JW4N 3H9YA 1UZ8A 1BD2E 4J6RH 1QEWB 4PGCB 5IFAL 3E0GA 3CSBA 4M7LL 2JB6B 1LILA 1WTLA 4PJCF 5DQ9B 4R97B 1KEMH 3PGCB 1RZ7L 4X6EA 4WIQA 1RK0A 4LSTL 5FYJU 3WLBB 3TC9A 5F6IB 2DWDB 2APXA 4WNQA 5FKAB 4I48B 4QNPE 4L3ED 4HBCL 4LRNH 3DSFH 3KPMB 4UV7L 4O2CA 4XC1H 4CU8A 2NW2B 1K5NA 3C60D 5INDB 5ESAA 1H3WM 5FYLH 4OZHA 2FWOB 4ZNCD 4P4KB 1J05A 5I73C 4K8RD 2DQTL 1KT2A 1MVUA 1KJVA 1A4JA 1OTTC 2EDEA 2Z0BA 4UILH 4YPGA 5JO5A 5FCUH 3ROLA 1F3DJ 5ISZB 4BSVA 1NFKA 3GO1H 1X4ZA 3PWPA 1JJUA 2YBRA 3U0TA 3KPSB 5FKPB 1FVEA 2BVUA 4AM0A 5BV7B 5DUBA 3Q3GA 2APTA 4LAQH 3TPKA 3QEQB 3MRFA 2GY7B 4J1UB 4TUKL 4EXPX 1T89A 2C1OA 4WCYL 2WY3A 2NY0D 1IGTA 4TYUA 2X4OB 2BK8A 1HQRA 3UAJC 4JFZL 3V5KB 5JZ7D 4EI5C 3MV7D 5KVEL 3K7UA 3VA6A 3QXDB 2P8LA 1Q38A 3WNKA 4I77L 4G7VL 3TO4A 1QD0A 4OIIL 4LPTA 1JPST 3RQ3A 2UV3A 5IQ9B 2B1HL 2PTUA 2ZOKB 4FQHB 3OX8B 5ILTL 5AD0A 3MRKB 1KTLA 3THML 3Q6FA 5BVPL 1MJJB 1LWRA 3ULUH 2FJGA 2ZPKL 1FHGA 4V1DE 3N9GH 4XGZA 4UB0H 1MI5A 3G5ZB 5I74C 1JMXA 1IGIH 4N68A 3F7VA 3BRDA 3EOTH 5SWSA 4A2MA 2PYED 2DKUA 2OMBA 3MOBH 1U8KB 5I66A 4H0HB 3S88L 1RQ5A 4LPUA 1YEFL 1P6FA 4TVPH 1AO7B 5TF1L 4O2CB 3T09A 4S1RL 5CHNA 2J3SA 5T1KD 3C87A 4OZHB 3U0PA 1JPFA 3PQYE 2IANA 1EO8L 1NGXA 3MFGB 1KT2B 4WTZA 1KJVB 1A4JB 2D0GA 4OFDA 4YPGB 5JO5B 4OLVH 4PY7A 3ROLB 3SY0B 1TITA 4CVXA 1UCBH 4HIEA 1G84A 1AJ7H 2E6PA 2IPKA 3WNNA 1FVEB 1B4JH 1CTOA 4OCWH 5D71H 5FYLE 3RVTC 3Q3GB 2NX5A 3UXFA 4WW2C 1SY6A 4QOKE 2C1OB 3K0WA 5JOPD 1IGTB 1AD9A 5GGVY 3UPRB 3VXME 1NQBA 5GJTL 5I1LA 1GOHA 1NKRA 1Z3GH 3GKWH 3L3DA 2Y7QA 1X7QA 3T0XA 3TO4B 1ZEAH 1BFSA 1T7ZA 2AK1L 5AD0B 4CDGC 4BSJA 1KTLB 4ZFGL 3RGVA 4XWGH 5EOCL 3AUVA 2NY3D 1CBVH 1NDMB 3VXUB 5D5MF 1KACB 3FT2A 1RZJL 3ARPA 3S97C 1RJCA 5EO1A 4CVUA 5ID1A 5DJ0A 2DKSA 1JGEA 1NC4A 2YUXA 5IVNA 1A3RH 1XF1A 3MRBB 1PYWA 1NCAL 2HT2D 5GZOC 1MWAH 2E7HA 3DI3B 4XB7A 3CLEL 2C3WA 4Y8DC 2HLAA 1HYSC 4WUKL 2GSIA 1FYTE 3QUYC 4FQ2L 1JGUH 5C0BA 1I1FA 4JFFE 1Q72L 1DE4B 1I3VA 1TCMA 2J8UE 4G6MH 3KPNA 4WWKD 4X5LA 1CD9B 4Z7QE 1JPFB 1RUPL 4K2UL 1I8KA 4PRAA 1KCRH 4NNXA 1MHPH 5DDHA 4PY7B 1SYVA 2FATH 4CVXB 2LTQC 2VZSA 3GHEH 4OB5L 4U3HA 2X1OA 3HUJF 4WJ5A 3PV6A 4P59H 1AGCB 1RHHA 4JCLA 2NX5B 2H45A 4GW5A 5DJYA 1ZVYA 4JQXC 4NWTL 2YPLE 3D18B 3PL6D 2P1YA 4N8PA 3BISA 4JREB 3TPUA 4QHNA 4F9PC 1IKNA 1P1ZB 3PQYD 1NEZG 1K9TA 3L3DB 1X7QB 2AJSH 3CFKA 1EUUA 5FEBA 4YE4L 4K07A 5KS9A 4PREB 4HS3A 1JPTH 4NGHL 1CLZH 1CN4A 3AS2A 1A7BA 3C6LD 1SVCP 3RWFA 1MNUL 3RGVB 1LQSR 2VJXA 4ZO9A 2EC8A 4OZIF 5FYLD 3LHPL 4LFHG 3ULVL 4J3OC 4H5SB 4NQTA 3WIHH 1G9MH 4QOKD 4LMQE 2G5BA 1DQDH 4PJ9D 3T0EB 5BS0D 2A2QT 1NSNL 5EO1B 4PY8J 1MFCH 5E03A 1NLDL 1EBAA 1NC4B 3FQWB 5I1AA 3VXMD 1CDUA 1Z0MA 5K9QI 4KUZL 3P4OA 4GRWB 4ZOBA 1A7QH 1PYWB 1FPTH 5AZ2L 4W4NA 4HJJL 5IBLC 3AFLA 1A9EA 1IM3B 2E6JA 4K3DH 1I9EA 2AQ3A 1JWMA 1HZHL 1MY7A