4PRNA

Crystal structure of a hla-b*35:01-hpvg-a4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4prnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4prnA01
3IXTA 3LPFA 5ALBL 1T1YB 1S7WA 1JPSL 1UKSA 2EDXA 1N5YH 1BBJB 1WFTA 1QKZL 3FQWA 1NAMH 5JW5A 2FCBA 1KFAH 1U0QA 1ZVSB 4NT6A 1J8HD 4BZYA 4JM4H 2R2BA 1AR2A 3FZUD 5E6YA 2P5EA 2F54D 3KLHD 3PDOA 5AZ2H 3TYGL 3VD9A 1BHGA 2O61B 4UTAL 1HHGB 1EO5A 2NY2C 1G9MC 2GUOB 3UPRB 5DHVH 5C09A 4LGRB 5IVXA 3UYRL 4Q9QL 1KJ2B 5JORA 3TJHD 4W68A 5IBLC 4QOKA 2VITA 2FR4B 1UKQA 2IQ9L 3D39E 1TCMA 1G84A 1U9KA 1W8OA 4ELMF 3WFZA 2WINB 1TTUA 1DN0A 3MRLA 4JZOA 3O4OC 4AMKL 5JHDD 5EBMA 3QNXB 3I6LD 2D7NA 3GMRB 1CL7L 2VC2L 2XN9E 4AEIH 1EX0A 4HKXA 3SGKC 4CADB 4DZ8A 3OF6D 1QLFA 1YEFH 4NO0D 1RUKL 3V52H 3TNMB 3QUML 5CMAA 3QJFA 3BSZL 3ZDYE 2WUBL 5ALBH 1DVFB 2AXGB 1MFBH 1T89A 1JPSH 1KXVC 1LNUA 4KK6D 2EDQA 2VDML 2X4UA 5FYKL 2HJFB 5JA9A 32C2B 2X09A 1FG9C 1I3RB 4ONGL 1GSMA 2HT4C 3D25A 3DRQB 4PRBA 3RI5K 4X7DC 2DN7A 4U7MA 3G08A 5MI0C 3LKSB 2UVFA 3TYGH 3T1FB 1BOYA 1OP3H 5B38G 1AIFB 2ZG3A 4E42B 2OZ4H 2BVQB 2G2RA 1EHLL 4PGZA 2YSSA 4TNWK 4FP8L 2X4PB 4G59A 2A6JA 4FFVD 3WIHA 1QSFD 3UYRH 2HMID 4Q9QH 4JPIB 1ND0A 5BS0B 2XG4A 3I50L 3L5WA 3MBED 3O6ML 4GW5B 2IQ9H 2VLMD 3OKNA 3QWRA 2DAVA 2CIKB 2WNGA 1CD8A 3GMOA 5FOBB 1CLOL 4PUBH 2PTTB 3TPUB 2A9ML 5T33L 5E00B 4JHWH 4JN1L 3MUHL 1A1NB 4U6YA 3HZMB 2EXWD 5DVLA 1CL7H 2D7TH 2DWDA 2VC2H 2YXMA 3AM8A 4M6ML 3UTPE 5E5MA 1W0WB 3QUMH 4O00A 5EOQL 2APFA 4YHLL 1QPXA 3LCYA 3ARGB 1FP5A 3SDAC 3IGAB 3H7LA 2Z31B 4G9FB 4F9PC 2J8HA 1Y0LB 5DZOA 5SWSB 3UZVB 2VDMH 5AYUL 5FYKH 4YHKL 4BSJA 1NKRA 3PGDB 4ONGH 1DJSA 4QRTB 3PGCB 1XF2A 4UQ2A 2PCPA 2EO1A 3EJYD 5IVNA 4M03A 3BH8A 3TM6A 4PJCF 4HMDA 4EN3B 3F12A 4RNRB 2GQHA 5D5ME 2Q6WA 3L3GB 5EH1A 1I9JL 2XN9A 1CDBA 3I50H 3O6MH 1IKNA 4OCRH 1F42A 1PVHA 3EDJA 3BKYL 5MEOB 5EN2B 4AT6A 5ANMB 1CLOH 1D5ZB 2A9MH 3U9UA 4N5EA 4YXLH 1J0KA 1LE9A 2FSEB 1GZQA 4WW2C 5IVOA 1V3LA 4NRXA 1AXTL 1NGZB 4PJGB 4M6MH 3JZ7A 4Q9CA 3MRQB 2W91A 1PQZA 4ZUSB 1TVHB 3FCTA 1RJCA 3BIAX 4YHLH 4O5LL 1JBJA 2XA8L 3F6LA 1XCTB 3KDMB 43CAA 5ICZA 4PV9A 3QEHB 2X4TB 4PB0H 3WJJC 3LS4L 1DEDA 3IDMA 4YHKH 2IGFL 1FYHB 1KEGL 4OF3A 3H9SD 1NUNB 3HC4H 4YZFF 2EDHA 5CEZE 3UAJD 4RAHA 2X9YA 1EO8H 5I1CH 5KZCB 1S9WB 4QKXB 5FECA 3SKMA 3D18A 3I75A 2EDBA 3SPVA 4MWFA 5BVJB 3MLSH 2FHCA 4LSRL 4MD4B 1CBVL 3QPQD 5L7XH 3RZCD 1GGIL 4MD5B 3C5ZA 3NZ8A 3P9LA 2AJ3B 4TPRL 3N1FC 5EUKA 4ZTOH 5A16B 3EOBA 4HLZG 5EU3B 2NY3C 1FG2B 3NZHL 5J7CC 5T1DL 4HDIB 1MHHA 1DP0A 1OTSD 4UOJA 5HYJE 1J7VR 3SKUD 4V1DE 3T0XA 5MP6L 1B0RA 5EO0A 3VXQB 5DXWA 4IDJL 1A6UH 3VRLF 4Y19E 3LZFL 1KCGC 5DR5H 4O5LH 5EIIB 2XA8H 1DBAL 1QNZL 1EVTC 3IAGC 4X9GA 2OTUB 4JQVC 3DYOA 4XPHL 4ODSL 4X5WB 2IF7A 2FJHA 3FOMB 3WIFA 5FXCH 2IGFH 3RWEB 1KEGH 5C0FA 1KACB 4F7TB 3AAZA 1I3UA 3PNWB 4XCYB 5L2KE 2X4NB 1DVFD 1QUNA 3MV7B 1NFIB 3CX5K 5DJ8A 3HUJB 4M1CC 2B4CL 1UJ3B 1C5BL 5HVHB 4LSRH 4R97B 4W4OC 5INCB 1OSPL 1KJVA 4RAUB 3WCYA 2GFBA 4HF5L 4PJDF 4K7FA 1GGIH 4HJGB 1IAOB 2OK0L 3EO0A 1BQHA 2L4OA 3AC0A 1N6UA 3DX8A 3HMWH 1MCBA 1SJVA 3NZHH 5JNYB 5T1DH 3AGVA 4X5LA 3JV4A 1C7SA 4Q0XL 2VO5A 2YD9A 4JANB 4YDLC 3MOAL 3WIHL 5BS0D 5MP6H 3OB0K 3UDWC 2FO4B 3QT2A 4NQVA 4OFPA 4BZ2L 4IDJH 1IC4H 1KIPB 3SE9L 3CC5A 3CX2A 1QSEE 3S35L 3NPSB 1G1CA 3LH2H 3SY0A 3LZFH 3S36X 3BAEL 4HK3N 3RUGE 1DBAH 1QNZH 4N0FA 3E6FA 4K3JL 1S7UB 3SBWC 1C12B 3QUYC 2X5PA 2E9BA 3BYTA 4JM2F 3BGFC 5JPNA 4XPHH 3CGTA 2ED7A 1FFRA 4U3XA 4JZNB 3MLPA 3FFDA 1ZS8A 4D0CB 5DJCB 1XR8B 5GRVK 3V7AE 1TCRA 5IGXL 3ARGD 3HS0A 1BFVL 3MRDA 5ICXB 3KJ6L 4YHPB 2Z31D 1DEEA 2B4CH 1HHHA 2OL3A 3D0LA 1M4KA 5HYJA 4OGYL 4V1DA 1OSPH 3TVMA 1S7VA 4PJ9A 4MA3B 5BJTA 2OK0H 1X5IA 2NY4B 4C83A 1MJJA 2APVA 3P0VH 5FYKU 5HVGB 4Y19A 3SKNB 5ISZE 4PV8B 2F53E 1UWXH 4J8RB 5I1HH 4EN3D 2IH3B 8FABB 2CDGB 2DQHL 1T3FA 1FJ1B 2DQGH 1IM9A 4NC1E 4UDTA 3WIHH 3QIWA 5TFSH 5EC1A 4DN4L 4U05A 1NCCL 3BJ91 3TBWA 1JYNA 4BZ2H 3BW9B 2GTZA 3SE9H 3IDNB 1N59B 2M2DA 3S35H 3SOBL 5KSAC 1YPZE 3S8WA 3BAEH 1QBAA 3LKQB 5L2KA 3N9GL 4LGSB 3RBGA 2HKHL 1NC2A 4K3JH 5FK9A 4WFFE 2IFFL 3GBNL 3IFNL 3VRJA 1C7TA 1WCBA 1T1ZA 4XP6L 4M6NL 5FGRA 4PLNC 4YDIL 1Z3GL 1HILA 5IGXH 2VZSA 4Z7UE 3TLRA 1BFVH 2R0LL 3QNZB 3KJ6H 1ZV5A 4WRLA 3CK0H 4F33A 5JPMA 4ZNCD 1NFDE 1RJLB 4IM8A 4P23C 4U2ZA 5DJYB 1EFXB 1BREA 4P2RD 4CN1A 5DJ6A 2DIBA 4CMHC 3NCMA 3BD3A 1H0DB 3MV8E 2ZPKL 1QSEA 2GYSA 2VLJA 3BH9B 3QDMB 4HHAB 1JTOA 4A6YB 4D9LL 2UY6A 3O41A 1F58H 3QXAB 2DQHH 3OX8B 4PLJC 4D94A 3DX9A 3LQAC 4D0BA 2RAMA 3ETBF 3JV6B 4DN4H 3QFJB 1NCCH 4S1DC 4OF7A 3CVHA 1XCQB 2Z35A 3RWHB 2APWA 4XBPB 3ILPB 1P7QA 3SOBH 3UBXA 3L5HA 1F4AA 5E2UH 4NHUE 1BVLA 3N9GH 3MRKA 3F8UB 2HKHH 5L8JB 4KI5C 4Z7NE 2V2WB 2IFFH 5KG9B 2YOCA 3GBNH 1EBPA 3B5GA 3IFNH 3KLAA 5T1LD 3TYFB 1DL7L 4Z7WE 4LL9A 2IMNA 1IGTB 3GUTB 3UTSA 4XP6H 4M6NH 3KPSE 3D0VB 2CIIA 1Z3GH 3PIQB 5CP3A 5BVPL 4K71C 3TO4A 1F6FB 2FBJL 4RRPA 2IALB 3SE4C 2R0LH 4R9HA 3RPIA 4EOWL 1SY6L 3ARVA 2D9QB 2D0HA 3WXVH 4JFDD 4G8GD 5D9SA 4Y16B 4OF5A 3QI9A 3SQOL 2EXYD 5F7WC 3HNVH 4KUZL 5CJQL 2HFFA 2ZPKH 3VFNA 1IKFL 1VGKB 1YPZA 5HDBE 4CGTA 3MV7D 4FTVB 4M5ZL 1E4KA 4HIJB 3U7WL 3C5SB 4I0PA 4P5TA 4OBSA 3U0PA 5E8PB 3STLB 4Z95L 2CGRL 1IVLA 2H9GB 3RTQC 3WN5B 5D1QA 1BF8A 2GEEA 3PWUB 3EOAA 3C60B 5IG7A 3ULVE 5JW4M 4G42A 2ICWA 1NCAL 5EOTB 1LO2L 2DM4A 3OR7B 4YAQB 4Q2ZB 4YLQT 1ZHBA 4Z7UA 1QPPA 2EIZA 3MLTA 1BZ7B 12E8L 1JL8A 2WLYA 4MJ5A 2E9WA 4R2GB 3FQUA 1VB9A 2LV4A 3HC0A 3CNKA 1DL7H 3D85B 3M07A 1MFEL 1GZPA 3K4ZA 1OTTD 2QQNL 4NN6B 4ZUUB 3BKML 3MV8A 2ARJA 1A6ZA 1JP5A 4IRZH 3QDHA 5BVPH 1QBBA 3IDJA 5EO1B 4QXGH 2FBJH 2Z93B 4LHUB 2Z92A 4UT9L 1BQSA 1S7QA 5HHNB 1NLBL 4JPKL 5JO5B 3BX7C 3U82B 2YN3A 1CD0A 3G5VB 1L9MA 4HGMA 3W5NA 3B6SB 1C16A 3K8LA 4H8WC 3WE6A 5C7XL 4U0RB 4M4RA 5CJQH 1IKFH 5ACZA 4ODBD 5FCUL 3OKOB 2YPLB 4NHUA 1U8KB 4M5ZH 3LRSB 2DQFB 2FZ3A 3FRPA 3U7WH 2HLFC 5H94A 3GMPA 4Z95H 2CGRH 2LU4A 4D2NA 1OWRM 1HDMA 2OL3L 2Q76A 3QSKB 4X80H 5J1AB 4Z7WA 2F19H 2NTSP 5TDNB 5TGBB 5FO7B 4BUGA 5DQJB 1MIML 3KNBB 1KUMA 2NY4D 3CZFB 1GGUA 2OM5A 3TC9A 3KPSA 1I1AB 2QV2A 1ETZA 5I1EL 4L9LA 4K7PX 4U6VL 3X14A 12E8H 4PGDB 4LNRA 1TPXB 2IH1A 3DROB 1SM3L 2X7LA 2NY6D 1J12A 4KJQC 3BHBB 3AMKA 4P9HH 3K2MC 3QEGL 1T1WA 3GMQB 4N9GB 3BIKA 4KMTL 5CEZH 2JJTA 1T2XA 4Y4HC 1I1RA 4ZAKD 4UT9H 2Y72A 5DD6B 1NLBH 4R26L 1U8LA 3KS0J 2QLVB 2BSTA 5IM7A 3L3OA 1F4YH 2J6EA 1P2CA 3PV6A 5C7XH 5B39A 2BMKA 5D7LB 3WNOA 4AIXA 5J1TC 2YD6A 4NKQB 3RL1A 3V8CA 5CJOL 3TWCH 1G7MB 1IAIM 1A7NH 1MUJB 5IESL 4XCNB 1SYVA 1YY9C 1R5IB 2OL3H 1EFXD 3QEUB 4UOW0 1EZVY 1DSFH 2AJSH 1L4IA 5DYOB 2XQYG 4P5KB 1UZ8B 3BP5B 2XACC 3A67L 4RFNB 4ONFL 2PXYB 3IETB 4QRSB 4YR6B 5I1EH 1CVRA 3MZTA 3SGDH 3GBML 3SGKA 4OV6F 3VGAC 1JZ6A 3OKYA 1AR1D 1PG7W 3HC3L 2VTFA 4HBQA 4N8CL 2C9AA 2UZYB 1AO7B 4P5MB 5DF0A 4XVTH 4ZUWA 4IOFC 4Y4KD 2CRIA 4RGOL 2V5TA 1RK0B 3CVIL 4UIMB 3OSKA 3CVHL 4AENB 5KS9F 5J3HD 3LN9A 1U3HC 5TH2B 3QEGH 3GSUB 1KJMA 3JWDC 2GY5A 4X8XA 2B1HL 4KMTH 4MS8D 5T1KB 5MERA 5FM8A 1W0VA 5KSUB 3QA3B 5AWNL 1I8IB 1YNKL 2X4OA 3BZDA 3B9KB 1LDPL 3ILQC 2EO9A 3IFOB 3PL6C 5C6PB 3DSNA 1N7MH 3BWAA 5DC0A 3ULUD 1OD9A 4Z76A 1KT2B 3AU1B 3OKEA 3JBG7 4X9HA 5CJOH 1ORSA 2EYTA 3ARBC 3EDFA 5ILTL 3V95A 4M1DL 1MWAB 4R8WH 5IESH 1P7KA 4Y16D 4NSKB 4HGKC 5L0QB 2ZJSL 3W0WE 4Q9RL 5A1AA 2Q86B 5HI5C 4Z18A 1VACA 1TJGL 3KPPB 4ONFH 1GL4B 3MNWB 4FTVD 5DJ2A 3JWNC 1I8MA 1DANT 1B6DA 4G9FE 4JRYB 2JB5L 3EYOB 3O9WB 4N8CH 1ZE3C 3OMZA 3VE0B 5I16A 1MCWM 4OCWL 4P2OD 4RGOH 3CVIH 3QHZH 3CVHH 4F9PA 3PHOA 1LO5A 3RVTD 5HYIA 1DBBH 1Z6JT 5CBEA 3RA7L 2BVEA 4FXKA 1VSCA 4JFXA 4KQ4H 4BQ6A 5AWNH 4MJ6A 2FH8A 1YNKH 5DJXA 5EZIL 1S9KC 2Q3AA 1LDPH 1BF2A 3D2UA 3GMLB 1P9MC 2AKRA 5E2TL 4RFEB 5D6CB 3OKMA 3WNPA 3IS1X 1U58B 5LXGL 1I9RH 4YDVB 3ARDC 5D1XD 3RKDC 2QQLL 4HS8L 4LHUD 5ILTH 1ZLUH 3S4SB 35C8L 2KZ1B 2Q7YB 4BKLB 1UQSA 2KL6A 2QADD 1OGAB 4EDXB 2ADGB 2ZJSH 4NYLB 5DRXB 1QVOB 4Q9RH 3DV6B 4RZCA 1BFSA 4KRLB 5GS2H 3ISWA 1QFWL 5BO1L 5A2JH 3SDDD 1TJGH 2YHGA 3ZHKA 2YPLD 2CUHA 1REIA 1EERB 3HKFA 1EHAA 4ZXBD 4KJPD 2XQYK 4LEOA 2JB5H 1ZT7B 2X70A 4HKZB 4QHKI 4LLVA 1JNNL 4PBVC 5GSRB 4X7EC 1S8DB 4GS7B 3L9RA 5DSCA 4MYWB 3F6IA 5FKAA 2KH2B 2GSIA 5FUCC 5ACLA 4XPGL 4OLUL 3INUL 3RA7H 4GBXB 3KLSA 4PIRF 3V79C 4IRSB 4KRPB 1K4CA 2J8UF 3ARFB 1JN6B 5GRWA 1IZJA 3UPCA 4ZFGL 4RGNB 3NMEA 5IEHA 3W0WA 4HUUA 1H15B 4Z0BL 4WV1B 1WITA 1W0WA 2BNRD 3NCYP 5AD0A 2JKXA 5DK2A 1OAXH 5M7QA 2Y5TA 1E27A 4L8BA 2DMBA 3UMTA 4WTZA 2DIJA 5AZEL 3MV9B 3O2DA 2ITDB 4OCYL 5I71C 3IGAA 4OLYL 2QQLH 4HS8H 4HZAA 4P4KB 3FB5A 2AAVA 4HUWB 3VFWA 1MSPA 1UB5B 5I8CB 4G6FD 5DFTA 1IGFH 3L3HA 2CK0L 3MLUL 4OAWA 1CCZA 2J6EL 4FZEL 3ZHDA 5C0GA 4ISVA 1G9ML 1QFWH 5BO1H 2FD6L 3ULVL 2JJVA 1KIQB 3O11B 3QDGE 4KV5E 2HFEB 4JE4B 3KPQB 4QHNB 4KUCF 4QRUB 4G9DB 4MCZB 1JNNH 5D8JH 3EHBC 3MLWL 3HG1D 4UDUB 4RIRB 5ID0A 3MOBL 1SJXA 4OZFG 4DW2L 2I9TA 1VPOL 5AUMB 3QAZB 2PXYD 3KVQA 3MLZL 3INUH 3DOSA 1OY3B 5EN2A 4XMLH 1RJYA 2UY7A 3R4DA 1S5IL 3DWTA 2OJEB 1OTUC 1AO7D 5FCSH 5DD3L 4KVCL 5IVXF 1UADC 4Z0BH 3JV5A 5FV1L 4F7PA 4TTGA 5ENWA 3FOLB 1ULVA 5D1ZC 3REVA 3X17A 1XF4A 5AZEH 3L5JA 4W4OA 5LAXB 3L3KB 4OCYH 5GZND 5JOEA 3O3BB 2UZXB 1T0PB 3B9KD 4OFIA 1DUZA 1HNFA 2W0LA 4WU7B 4AEHL 4H1LA 1I4FA 2DWEA 3OKKA 3QUXC 3RDTB 2CK0H 1XIWD 3MLUH 1DTUA 3X11A 2J6EH 2Z8WC 4FZEH 4DCQB 3RVXC 3ULVH 3C8KA 5GGSB 1S9WA 4NUJB 1Z9SA 1H3TA 1HN1A 3UDWA 3VXUB 1RHHA 1BLNA 4TSAH 3VGBA 4LSDA 1WCQA 5IBUG 1CS6A 3MLWH 4OJFH 3GI9L 1E4XL 1HSAB 3MOBH 5INDA 4Z5RB 3B5HA 4DW2H 5JXAH 5DD1H 1VPOH 3SBWA 3QUYA 5GRZA 4JFEB 1A6AA 4JZJC 1T04A 3HE6D 5A16A 4M9OA 3U48A 2ARWA 4HDIA 5BV7C 4JRYD 4S2SA 1S5IH 5E0QA 4NKIH 4GRLA 5CJXC 3FZUC 3O9WD 1H3XA 2I9LA 1XGPB 5EA0L 5C0DB 2IPUG 4HJJL 3LHPL 5DD3H 4KVCH 1Q72L 2VH5H 1CFNA 3EBAA 1IAIH 4M8VA 4KI5E 2DYPB 1VFAB 4LSTL 2QEJA 3QDGA 4HV8A 4JKWA 1SEQH 1WUNT 2NY1B 43C9A 1U8QB 4HWBA 4BUHA 1PYWA 3OJMB 5IHZA 2EYRB 3OGCB 3QP3A 4U1KA 3RWEA 5F21B 3SGJA 1CDUA 4WHYG 4CUCA 3JUYA 5DK0B 4ZFFB 5MENE 3MGOA 4F58H 5C07E 3V5HB 3PWJA 4I18C 2Z8SA 4UILL 4P49A 4HH8A 1D3CA 3K81A 4LAQL 5KN5B 1A64A 3TESA 1LD9B 1ZEAL 2ADJB 5BQ7A 5ICYA 2WBJC 5FF6B 3A6BL 5TF0A 3GI9H 1MHPL 3UZQA 4CNIB 5IJVB 4GXVL 3TBTB 5KAQG 4HEME 3W81A 1Q9KB 5D2LA 3DSFL 4XXCA 5DFWH 4QRPB 5GRJL 1MCWW 2F9BT 3JVGC 2ARJQ 1R6VA 3DX6A 4JANA 4HJJH 3LHPH 1JPFA 3MR9A 3UJTL 4KDTC 4X6DF 1Q72H 2NQCA 5EFIA 3QNYB 1IGCH 2EE2A 2O5ZH 4FFVC 2HMIC 3FKUS 3LQZB 4P23A 2BX5A 3QDME 4GBXD 1QD0A 4LSTH 4V3DB 3TBSB 3TN0D 4IRSD 4KQ3L 4KRPD 1WIOA 3B8SA 3VFTB 5ESVB 3ZDYF 4YHNB 3MRHB 4LFHD 3ARFD 1SYSB 1FZJA 4JKMA 1Q0YL 3OR6B 3QFJE 5E8OA 5I2IA 3RVWD 5DTFA 4UILH 3O2DL 2JELL 4H0IA 4YHPA 4P4KD 4LAQH 1J87A 3TFKD 2ESVD 2XKNB 1CFTB 4X7FC 1U93A 5F1IA 5E6IC 2YD1A 1MHPH 4XP5L 3AXLB 5FYLE 2HN7B 1ZWIB 2QHLA 1EH9A 4GXVH 4FFEX 5IF0A 2W0PA 4EQ3A 1AQDB 3ZSTA 5GRJH 4OZGB 1C08B 4NBYB 3O8XB 4IRJB 5IK3A 1MLCB 3T2OA 1ES0B 5TE4H 3EJYC 4Y2DC 5DC9B 3HAEA 4G80B 5FM5M 1H8NA 3UJTH 2LVEA 5MHSE 3VXSE 3FAWA 4W6WB 2VIRA 3SE4A 4YDJB 3MRPB 4YBLB 1PD6A 1N59A 4R7DB 5MENA 4FZ8L 5C07A 1CGSL 1KCRL 1UT9A 4KQ3H 3O3AB 2X89A 3SN6N 2IADB 1LEIB 3G6JE 1UWGH 3HMXA 3WHXA 1T7VA 1Q0YH 1J0IA 2NMSA 1OAUL 3L3IB 1WWWX 3VXOB 4AQOA 5IQ9B 4ZS6D 4WWKA 5GGRB 3RTQA 5KSVA 1DDHA 3MRGA 4FQQB 2AV1B 4BQBA 3IDIA 3F5WA 3HZVB 5EO9A 4I2XA 1R3JA 5D7IA 3RDTD 4YHYB 2ZUQB 2G9HA 2JB6A 3BPLB 2LQRA 3MROB 3QWQB 2FWOB 3QDMA 1WV7T 3P73A 4A6YA 3VFPA 3ZSSA 3VXUD 5EUOA 4JFQB 3UAJC 2VXTL 4LCWB 3TT1L 4LRNH 5HYSA 1EEYB 3LAFA 1UZ6E 3BN3B 4ELMB 2NPLX 5FDYA 1KIRB 3DPBA 5F1OB 2CD0A 3RX5A 1A4KA 1WZMA 3GSXB 1OP9A 3S3JA 3QPQC 4R3SB 4NFCA 1CGSH 1VKXA 3RZCC 3FQNB 4QEGA 3MRJB 3DYMA 5SWQA 1MVFA 2C7UA 2AV7B 5J9PA 1HHJA 4JY4A 1OTSC 2DD8H 2UUDH 2Z9TA 1BVZA 2ADFL 5CJBA 3NFNB 2HVJB 2NY1D 3BVNA 3K4AA 4CJ1A 5IROC 4Z7QE 2H8PA 4HWBL 5IW3A 5GGUA 1JFMA 4LOUD 3C5JA 4B0MM 4H1LH 2MQCA 3VXSA 3T77B 5D7JB 4D8PB 5HI4D 3MJ7B 4BK4A 3F7PC 4OQTA 1ZVHA 1W72A 1YQVL 1I9IL 4ZSOB 1FFPA 1B4JL 4HIJA 5IIEB 2LFGA 2W60B 2CO7B 4U3HA 4QY8A 3ZTJG 2VXTH 5E5RB 3TT1H 5LKNA 3G6JA 4I48A 2NYYC 5A3ID 3S35X 5IB5A 5GGSY 1K3IA 5D7LE 1EMTH 1OLZA 4ENED 3UZEA 5SX5K 1SQ2N 4LMQI 4N0CD 2EYSA 3PXJA 1NBYB 5K9OB 2JCCE 4QRPD 1LE5B 4EDWH 5DEZA 4R90L 4PS4L 4RFOL 5GJTL 4IIQB 4B5EA 3MJ8A 5E95B 3SDYL 2BP3A 3VI4E 2MOVA 4G6AC 1KV3A 1CL7I 3QO1B 3V8OA 3QQ9D 2M26A 3CLFH 3LPGA 5EO1A 1IM3A 5JIIA 1KCVH 2VAAA 4BK5A 5HHNA 1R3LA 4U1IB 2F8OA 3BP4A 4ACPA 3HLAB 4HWBH 3TZVA 1I1YA 4DUVA 5FM4A 1AGEA 1S78D 3P9MA 5TE7L 3SO3B 4PJCB 1AD0B 4QHUA 4WFED 1LQVA 3C9NA 1HQRB 1F8TH 5D7SH 2XFXA 4GKOA 1I9IH 1FV1A 5D93C 4URTB 5DJZB 1U3HA 2IAND 4Z77B 4LK4A 3MNVA 5DMKB 4NRYA 3ARGC 1V7NL 2VZ1A 4U1NB 5TDNA 4JVWA 5FHBL 5F7YC 5IB1B 3G6AB 5DUBA 2GK0A 1D9KD 3S98A 4M43L 1LQSR 1I1AA 5I6XC 4L4TE 4U1SA 2DQDL 1HQ4A 4OIBA 3AB0C 1XGQB 1AHWC 1I8LA 2WIIA 4YHIB 5IHLB 1KB5B 1JIBA 3O8XD 4BQ9A 1FFOB 4R90H 5FUCE 3CCHA 4RFOH 2NW3B 5DLML 4LIQE 1VFBB 5GJTH 4QF1B 4OD2B 1HI6B 3SDYH 3MGTA 2FIKB 4I3SL 4U6XB 4Y1AE 3GMQA 2BSRA 2I60H 4P3WA 2ZCHL 4CN4A 2XG5A 4OUUB 4FA8A 3BP6A 2HRPL 3I6KB 4OLEA 1QR4A 3QCTL 3SDCD 1ITCA 3C6LB 2Q20A 1H5BB 4JLRA 3HMXL 4ZFOB 2WANA 3KXFE 1ZVYA 5CHNB 2X4RA 4WI9A 4ORZC 4MVBD 2C1PA 2MJWA 4NHCL 5CGTA 3FFCB 5D7LA 2PW1A 2CH8A 3H9HA 3PQYE 3QXVA 3JTTB 2ENSA 4OCXL 4HZLB 5KSBE 1G7MA 3P30H 5DQDL 5T3XD 2JCCA 1MCCA 4JDVB 3Q0HA 3O45B 4O58L 1CGWA 4NQDB 5CKAA 1NBVL 2AJVL 5FHBH 1TZHA 4WU5A 4WNQB 2R1WB 4M43H 1JRHL 1CDGA 4OSUL 2DQDH 3FONA 3MRIB 2Z91B 4L8CA 3DMMB 4M4PA 1TZGH 1MQKL 3QEQD 3MBXH 1YPZF 3L6FA 1G6RB 4NCC2 3LDBB 4PRHD 2ICEA 2G5BB 3OPZL 4UQ3B 1JGUL 3ARDA 4IMLB 3H42L 3HAEH 3I3EA 4UIMA 5GS1B 1M7XA 1RPQA 3BPCA 3GSUA 4QRQB 5C8JB 2ZCHH 1FC1A 5J6HA 4OD1L 5AAWA 5T1KA 1KLGA 1HH9A 1KPRB 4LLYB 4NN5B 3QA3A 3C2SA 1R5WB 3MO1B 4Z7UF 3R0MA 3EO1A 1F3DJ 1QQDB 4CW1A 1W8NA 5LCVL 1RZIA 2BXZA 3CFBA 4PJ5B 4NHCH 1FFQA 1RK1A 4ODWA 4FHBD 4L4TA 3D9AL 5L2JA 1S9VA 4OCXH 2XT1B 2FGZA 4EZMA 4RBPH 2OTWB 5DQDH 4YBQD 2ORBL 1BD2D 4PJDB 4O58H 5E8DH 2XZAL 4I3GA 4FQCL 4LSVL 4RGNE 5LBSL 1NBVH 3S6CA 3K8KA 5D7JD 3FTGB 1RJZB 1CLZL 4Y1AA 5GGRY 1JRHH 4OQTL 4GSDL 4OSUH 4Y4FB 4JFOA 2HT3C 1W72L 3MNWA 2DF3A 2V9QA 3TO2B 5I19L 2JJUA 3KYNB 4O2FB 5E08L 3RWCB 4A6YH 3T04D 1XGRA 3ECBB 1JGUH 4Z7NF 2DLGA 1X5HA 4LLUA 4Y7MA 3KXFA 5F3BB 4Z7WF 4DQOL 4XPAL 4R97C 4YO0A 4JM2B 3PQYA 1ZGLA 2GJ6B 1JNJA 5KSBA 1QSZA 3DXAB 2YN5A 5T3ZD 3QPXL 1PY4A 4JFPA 1K4DB 2H3NA 4K8RD 5LCVH 3PUCA 1EHXA 2DBLL 1I7ZB 2PUQT 1U58A 3BXNB 3OJ2C 3TPKA 5HGHA 2XKSA 5FYLH 1WBYA 3G9VA 3FO1B 1E6OL 1OAKL 2J4WL 1AKJB 2OR7A 2C3VA 5F93C 1N8ZA 2ZZUT 1RURL 4BQCA 1OTTC 1FAKT 2ORBH 5HDBF 1DZBA 4M6AA 3RWFB 3HNTH 5IKCB 2YZ1A 1P4LA 2XZAH 3LB6C 4FQCH 4HT1L 4LSVH 2EDTA 1FNFA 4C56D 4GRWF 4IBLT 1I3GL 3UTZB 3DV6A 4GQPH 4X99B 5BXFA 3IKCB 5IQ7H 4J3VA 3UTQB 1YDPB 4HIEB 4NZUL 4Q6IC 3TP4A 2P45B 2ERJC 3I9GL 4TULL 1I9EA 4PJ8C 3ULVF 5EIQA 5JLZA 1W72H 1KTDA 3KYMA 5I19H 4KK5C 1ZLWH 5E08H 1ACYL 2VDQL 3VXPB 1VADB 4HUKB 5D1ZA 3JWDL 4JN2A 1OSZB 5FKPA 3CU7A 4S10A 1BM3L 2CUMA 1ZGLP 4DQOH 4XPAH 1EEUA 4PRDA 2R2HB 4D9RE 3W2DH 1IQDA 4X7SL 1QEWA 1KYOJ 3QDJB 4OD3H 4KHXH 1AGBB 2R2EB 4PTTB 1U3ZA 3QPXH 5B8CB 3OXSA 1CWVA 4OFDA 4YX2L 2BSED 4W6XB 3IDGA 3FRUA 4QT5B 5E99L 5IOPB 1H15A 4NO5B 4IOIA 2DBLH 2EIDA 4OCSH 5EWIL 3T3PF 2NY6C 3FHQA 4AM0B 5J56B 4JFEE 1E6OH 4MMZC 1OAKH 2J4WH 1DE4A 1PG7X 1RURH 1W2KT 2BNQB 3I2CL 4ZOBA 1AQKH 4OCMC 3LKRB 2QSQA 4HT1H 5F89A 2X4SB 4JZJA 1C8PA 4ZAKC 3VG9B 4DGIL 1EXUA 3LN4A 5GJSH 1WZKA 3DURB 3FFCD 2HP4A 4TULH 3C08L 5B3JE 1JYVA 2HFEA 5FDWB 1IL1A 3OL2A 5BRZB 4M48L 3SKOA 1FRGH 5F6IC 1VEPA 1K2DB 1JE6A 2VSCA 2GJZB 1G0YR 2DI7A 1JYWA 1BM3H 4M9PA 2X4QA 3PABB 5B38A 4HKBB 4M3JA 5TDPA 2HA1A 5F3HA 3LSOA 5I1DA 3NFPB 1IGYB 5DHXB 1U8MA 3UROR 4J1UB 3R8BB 4NKDA 4P2QB 1A2YA 3HE7D 4F7MB 4YX2H 4QTHB 1A6VL 5E99H 2Y23A 2XY2A 2YK1L 3V0VB 4I18A 1AR1C 2YC1B 4H5SB 5EWIH 2PYEB 4X8JA 5A2LH 4J3OC 1N2RA 1S5HB 4Y4KC 2WBJA 2R0KL 1ITBB 3I2CH 4FQ1L 5MEPB 1XF3A 4KMQA 1NMAH 4QCIA 2QL1A 3LEVL 3BGMA 2FYYB 4Y8AA 4HUXB 1MI5E 4MS8C 3CUPA 1CZ8L 3RNQB 4YHZL 3P77B 3JVGA 2A74B 4I13B 2IQAB 1JWSA 4NFDA 4Z78A 4KDTA 1E28B 3ULUC 4M48H 3FQTB 3NTCL 3L95A 1DBML 3MFFA 4LIQL 3ME0A 3RAJL 5ALCL 4RX4A 1A4JB 1TDQA 4NNYB 2EC9U 5C0AE 5I9QC 4OM1L 5ITFB 4Y16C 1GGCL 1INQA 5DEFA 4JFEA 2DIAA 1B88A 4XVUD 2X9XA 1AD9B 4JRXB 4GH7B 2XIDA 2L0DA 4PBWD 1CU4L 4NFBA 1S7XA 1A6VH 2VDKL 2OP4L 1RIUL 3FB8B 3VG0L 1BGXL 3W9DA 1A7QH 1XR9A 4JM2D 2A9NL 3WN5C 2GJ6D 4P2OC 2R0KH 1UXWA 2YPKB 1NQBA 4OZGE 5E6IA 1RZ7L 2XTJB 3LEVH 2CLZB 5FO8A 1CG9A 3RVTC 1U8QA 2VDPL 5LVEA 3O2VH 1MRDH 4BELD 2GT9A 4L3ED 1JUFB 4B50A 1H8OA 1YY8B 1TTGA 1GVIA 4YHZH 3D48R 2MHAB 3JUZA 2Q8BL 3GK8L 4ZFFA 3L7EB 5CWSB 2IEPA 5E5UB 1OD7A 3OWEA 3O6KL 4DGVH 3ERYA 1AKJD 1NAMB 5HHMB 4Y2DA 1MHEA 3FN3A 2QTEA 3UP1A 1WICA 1QRNE 5KN5A 4HH9B 1PX3A 1AFVH 3IJHB 1XGTB 1WT5C 5D1XC 2RIKA 3KPNB 4PJIA 3RAJH 1R0AL 5ALCH 1AC0A 3TIDB 2DS4A 2Z4QA 4LCUA 5EPMB 2VWEC 3ULSB 5IJVA 2QADC 4OM1H 4X4YB 5CAYB 4L8DA 3TBTA 5GGTH 3SJVB 3KWWB 3D69B 3TEUA 5J89A 2HJLA 4TN9A 2DLFL 5L6YL 4M6OH 4O2EB 4RA3A 4HCRA 3SDDC 1MI5A 5DI8B 4D0DB 4ODXB 3MA7B 1SEBA 2VDKH 2HT2D 3PP3K 1I7TA 2OP4H 4KJPC 4OKVB 4ZXBC 1RIUH 1YEGL 3GIVB 1BGXH 3RHWF 1KTRL 2WM0A 3CAFA 2FL5B 1OPGH 1H3WM 3U4BH 1OHQA 4EKXA 4I5BB 1MH5A 1RZ7H 3QDJD 4LCWE 4OLWH 1MJUH 2VDPH 1DQQA 1IFHL 3QIBB 1SYSA 2CPCA 2A6IB 3QUZB 1D7FA 5C0JB 4ELME 1JFQL 3MCLL 3V4UH 1ZHKB 3F7VB 3WO4C 1U8HA 1JZ2A 4K7PY 4UV7L 5F88A 5C0AA 3EZJB 4U1MA 3X3FL 4X7TB 3OGOE 1KTKE 2UYLB 2BNQD 1M05B 1YEIL 2R56H 4GKNA 3WLBA 3V4PH 1A6WL 1TTFA 3DHJA 1NC4B 2J12B 3HI6L 1R0AH 3VFOB 2JTDA 5J06A 2EH8L 3WUWB 5BV7L 4HGWB 3VFMB 3GM0A 5C86A 3KPOA 3NA9H 3V4VL 2RR3A 1YN7A 1AE6L 5L6YH 5BRZD 1Q94B 4Z0XA 4OM0L 5KS9B 3E1F1 1GIGH 4UZGA 3ARRA 1FL5A 4MA1B 4AJ0A 1I1FB 3X12A 4FQ2L 5FM5O 1YEGH 1BZQK 1FDLL 2P8MA 3HRZA 5IROA 1KPVB 3IDUA 4HJ0D 4NQSB 3HPJB 5HHOB 2O93L 4H20L 4ETQB 1ZA6A 2P7TA 5K9KA 4HKJA 2VLKB 3RWIB 1QRNA 4UNVA 1V3JA 1IFHH 1ZAGA 4PY8I 1U95A 4WJ5A 5IV2B 3QUMB 4JJ5A 2VLLA 1JFQH 2R4SL 2PO6B 2AJYH 1IBGL 4EI6B 2PYED 1L0YA 2W0FA 2XWJB 2PW2A 1I8KB 3X3FH 3NABL 3BD5A 5IQ9A 3VFSA 3FQXB 4NJ9L 2J2ZA 5FA3B 4MXVE 4KV5F 4AG4L 4OLZL 2V7NA 2XICA 3VFUA 4EXKA 3RY6A 3HI6H 2A77L 4I4WA 1U8JB 1JK8B 4U1GC 2EH8H 2H1PL 3B9KC 1J10A 1S3KL 3V6ZA 3DO3A 3WYRA 4G7VH 4KJWD 4G8EA 1J05B 4HWUA 4ZQKA 4C4KT 3D5OF 1XIWC 1AE6H 3V5DA 4OM0H 1T21B 3PG2A 4MMXC 4WEMB 1SJHB 3GGWA 1P4BL 1NBQA 1NCUA 3WD5L 2F15A 4CMMA 4GJTB 2NZ9C 4PJCE 4PGCA 1J1PL 1FDLH 3ZTNL 1JZ4A 4H20H 4JRXD 4TVPE 2BY1A 4GUPA 3U30B 5D2LF 3FQNA 5T1MB 3UBXI 3QCVL 4G43A 5C08B 4LCIL 3HE6C 3MC0A 4M5YL 5D96B 5LGJA 4WFHD 2R4SH 3AREC 1IBGH 2XWTA 2EEAA 1KTLB 3T0EB 4PREB 3ROOA 3O3EA 4OZIE 4PGBB 1RIVL 3NABH 5DJAA 5ESAB 4NJ9H 4TUKL 2AK4B 5E9DE 1GGBL 1FIGL 3W5MA 2XTJD 3IF1B 3KYAA 3QIUD 3KPLA 4AH2A 2P8PA 3MRMB 2B5IC 2F5AL 1S9YB 4CN6A 1TJHH 2DKUA 1CIDA 3NCJL 4ZYKB 4AIZA 4O02H 4M8QB 1S3KH 4ZG1A 5HHMD 1JCKA 1YEJL 3QZWG 4MA7L 3RWJB 1Q0XL 3DVFA 5FUOL 1A7PH 1F13A 5H37G 5GRVL 3CXHJ 4MJID 3P4MA 4LASL 4RWHA 4DEPC 3RVUD 1P4BH 4LLWB 3RNKB 2EEDA 4G3YL 4XXDB 4EVNA 4DAGL 3KPRB 1RUQL 1J1PH 2X41A 4Y5VB 3S96B 4Z7VE 3ZTNH 1FNGB 2J8UB 4I3RL 3PP4H 4LPUA 3SJVD 4KI5F 4KTEL 2AEQL 3EDEA 4X98B 2PR4H 4DKFL 1KNOA 2ICWI 1KN2H 4PRPB 1Q9WA 4ZUVB 4HCRL 1EGJA 5IEKA 3TA3B 5JIPA 4LCIH 2NXYD 4NQDE 4M5YH 2CKBA 1F6AA 4P2CG 5IW6B 3DGGB 5C2UB 4OGXL 5F70A 5IMOB 2CDEA 3IAPA 2OJZL 2D31A 4TUKH 2FATL 2DM3A 1FIGH 1FC2D 1Z9OA 2XA3A 1WIPA 4Q58C 2LTQC 5EU6E 5DRWB 3QIBD 3NOIA 4HX1A 2D2OA 3V0AC 4P2RA 2QSVA 2F5AH 4PRID 4J4PA 4F37K 3TN0C 4IRSC 4KRPC 4LCCA 4NZTL 3IXTB 3ARFC 1S7WB 3K46A 1J5OH 3PWPD 3FQWB 5E2WL 4MA7H 5JW5B 5T5FL 2HG5A 3P3YA 1QFWI 5FUOH 4NT6B 1FPTL 5KVDL 3BESR 4LASH 4APQC 1JWUA 3VH8A 2R2BB 4G3YH 4JFYB 4YGVA 2YRPA 4M7ZC 5IB1A 3PDOB 5D7IF 1RUQH 4I3RH 4KROD 4OZIA 3GHBL 2MTPA 2AEQH 4XP9L 5C09B 5IVXB 1KB5A 5E9DA 5CSBA 4DKFH 2ZNXA 4ZDHB 3RFZC 1NANH 2QHRL 5JORB 3H2WA 5DURB 4HCRH 4HULB 4YEEA 5EUOF 1FZKA 4KKNA 4QOKB 2VITB 5ITBL 3SCMA 1A7RL 4OF8A 1JF1A 2XKUA 1NCDL 5HYQB 1NBZA 4PJAE 4KWUA 3N1GC 2Z8VC 1DN0B 3SEPA 3MRLB 4M7LH 4JZOB 2OJZH 5EBMB 1YYLL 2VLKD 5C0BD 3HRPA 3TH2T 3VRIA 3QAZC 4HKXB 3C6LA 4G8GA 3CXDL 3PHQA 4M62L 2DBJA 1A1OA 4DZ8B 1QLFB 2N4IA 2AJUL 1KYOK 5CMAB 4S1QL 2D03L 1NGYA 4PFEA 4NM8L 5HJ3A 1R3KB 1A9BA 4WGVB 4Z7VA 4DKAA 1T7WA 5FYKD 5E2WH 3DXAE 4L4JA 2X4UB 2FX7L 3QRGL 5IMLA 5MEQA 1FPTH 5KVDH 4PRBB 3D25B 4NQDA 4QLRA 3G08B 1WEJH 1ZXQA 5C0IA 4YQXH 5IUSA 3AUVA 2G2RB 3GMNA 3GHBH 2YSSB 4F7EA 4XP9H 3KR3H 5DRZB 4XPFL 2A6JB 3LEXA 1ND0B 3KJ4B 4PRNA 2QHRH 4HQQL 5EU6A 3L5WB 2R39A 5CIPA 3CMOL 4UQ3A 2BERA 1WBZA 5ITBH 3G6JF 1MF2L 4WCYL 2AVGA 3OKNB 3OHXA 3G6DH 1FZMA 1NCDH 4G6ML 3GMOB 4NQEE 4J6RL 4U6HA 2HKFL 3G04A 4JQXC 3K0WA 4LPXA 3GZKA 3VDBA 1YYLH 3VFRA 4U6YB 1R5WA 4C59B 4XI5C 3P2TA 2DWDB 4Q6IA 2OI9A 5C08D 3CXDH 3E6HA 5E5MB 3UJJL 4PJ8A 3ARYA 1X5XA 5GS0C 3VD4A 5EZJA 4NM8H 2HWZL 1LWRA 3WXWL 4R4ND 4JY6A 4JEGB 2AK4D 2FX7H 3QRGH 1O5DT 3M1BA 1CD1B 4O51A 5EOCJ 4UQ2B 4MHHI 4GKZB 4IS6A 2PCPB 1UZ6F 1MCJA 2X44D 1T03H 1TMCA 1UCTA 3BH8B 1BZ9B 3ZT7A 4LOUC 4PJAA 5GQBA 3F12B 1E4XI 3S88L 2Q6WB 3FB7A 1MY7A 3UPAA 4X6DB 1KCSL 1MQ8A 5F7EL 1J0JA 5BZWA 2XN9B 4HQQH 3CMOH 5BZDA 1WJ3A 5J13B 1MF2H 3KPRD 5L88L 1NFKA 1UB6A 1F4WL 1YMME 1FGNL 2H6PB 2HLAA 4G6MH 2YMXL 4AT6B 4J6RH 3GO1L 4QWWD 4OLXL 4PP8C 3Q6GH 3U9UB 3DXAA 4V2BA 4ZAKA 2ZUXA 4YHML 3CH8A 4MCYA 4NRXB 4PRPD 4ENEC 1WTGT 1N0XH 3TA3D 1A0QL 2FBOJ 1EGJL 3UJJH 4MXWL 4L4VE 3B9EA 2CKBL 3FCTB 4F2MA 4ZPTA 1TJIH 4F3FA 4Z7QF 4P9ML 3MRBA 4HC1H 2HWZH 2XYCA 43CAB 5ICZB 3N50A 3WXWH 4ALAL 3U46A 4Y5XC 1NUGA 1HWGB 5JDSA 3WS6C 4J3SA 5CUSL 3IDMB 2VXQH 3ARZA 3QQ9C 4P2QE 3WKML 1PLGH 5E7BA 2IWGA 3QH3A 1V3KA 4H26B 2E9JA 3MV11 4KUCD 1U91A 5FECB 3SKMB 4NQEA 3I75B 2YRLA 3E2HC 3SPVB 3S88H 4MWFB 1CICA 1S78C 4W81A 1KCUL 4TVPL 1KCSH 5F7EH 2VWEE 2P4AB 2JCCF 3NCYS 3CDGA 5F6HI 4Y4KA 4PBXA 3C5ZB 4FQXC 3NZ8B 4XAKE 3OZ9L 3P9LB 2P5ED 5EUKB 5L88H 3GSNA 5DQ9A 3EOBB 1F4WH 4OZHE 3VI4F 1L7IL 5JW3L 1CT8A 1MHHB 4WUUD 3GO1H 4ZD3L 3S5LG 4MS8A 4OLXH 1RSFA 5C09D 5GHWL 3Q1SL 1D9KC 5T5NF 3QR2A 5DURD 3DARA 1B0RB 5EO0B 1B0GA 3B5TA 2I5YL 3QQ4A 1A0QH 4MAYC 3UO1L 4QOKD 1F90L 4MXWH 1QOKA 1KG0A 5JOPE 4LLDA 4S1RL 4ALAH 4P3CL 4ZO7A 1B2WL 4KVNL 4TYUA 4YFEA 5CUSH 3TJEH 3WIFB 5IMKA 5L9DL 1PBYA 5C0FB 4IMKC 4YC2C 4NC0B 1ZHLA 3AAZB 1U8NA 3H3KA 2BNRE 5A40E 5FYJE 4ONOA 3SDCC 3DURA 3MLYL 1YMMA 1MNUL 1S7TA 4XWOD 4HPOL 1KCUH 4KZDL 4TVPH 4LP4A 5D72H 1UENA 3RL2A 4MX7A 3EYUH 1KJVB 2C3GA 2GFBB 4LSQL 5GIRA 4K7FB 5DEGA 4L4VA 5E2JA 1EDQA 3EO0B 3OKDA 4P2OA 4XAWL 3OZ9H 1BQHB 4P59H 2RGSA 1R3HA 1DBJL 1PKQB 2A38A 3DX8B 2BVOA 1L7IH 3HHRB 4KAQL 1IARB 3JV4B 2ED8A 2LAAA 3RI5F 4YHYC 2GCYB 3LS5L 1KB5H 1OARL 4J1UA 2FEEL 3MZGB 4NQVB 3UO1H 3HG1E 3CC5B 2EDRA 4J23A 3SY0B 3ZMRA 1U2CA 4XP1L 1IZKA 4TNWF 5JQ6L 4S1RH 5I1AA 1UXSA 1X4XA 1FZOA 1WT5A 2GTWB 4N0FB 3E6FB 5D1XA 4EI5C 4P3CH 4K9EH 1B2WH 3SQBA 5JPNB 5C0EB 1NDGB 3SKJL 2FYYA 5KSBF 4CBPA 4MQSB 5CLTA 4DJMA 3FFDB 4Z7OF 1V7ML 1ZS8B 1ROWA 4MB4A 4MDJB 4YHOH 3CSPA 4YK4C 4NKOA 1TCRB 3D3VB 6FABL 1HK6A 3MLYH 1A21A 3HS0B 1NGQL 4OZHA 1MNUH 3MRDB 4X7CC 1FORL 3SDDA 1K8IA 1DEEB 3WFBL 1HHHB 2OL3B 4KFZC 4S0SD 4ZXBA 4HPOH 3D0LB 4KKBD 5HYJB 4V1DB 1JPGB 3TVMB 4PJ9B 4LSQH 1VFMA 3VMNA 1CGTA 3GSRA 2P8LA 4YBQC 1RZKC 4LDLB 4C83B 3D39D 2FDBP 2VN4A 4Y19B 1URLA 1DBJH 1T2QL 3O6LL 3K4DA 2HFGH 4X6FB 2H26A 5FOJA 4KAQH 1A14L 1T3FB 3FO2A 5D7JC 1IM9B 4UDTB 3LS5H 3BZEA 3QIWB 5EC1B 1OARH 2X2YA 2XN9D 4OFKA 3TBWB 4RAVA 4OZFA 2GTZB 1QP1A 1BQUA 2BNRA 4ONHA 4XP1H 1M7DA 1HYRC 1FGVL 5L2KB 1MCNA 1R5VA 4XC1L 2FX8L 4HPYL 1NC2B 3UXFA 1KB9K 4N5ED 2R0WL 2DDQL 3SKJH 4NZRL 5DVNA 3X13A 4F9LC 3NH7L 3VRJB 4JPWH 1CF8L 1WCBB 1T1ZB 5HHQA 4XNZB 4ZODA 1TZIA 4QXTB 3EFFA 1JGLL 4U6TA 2NY5L 3FN9A 5I66A 4Z8FL 6FABH 4IIQC 2VR9A 5CWSA 5HHOE 1FORH 2P1YA 4K8RC 1J0HA 4EXPX 3R8QA 4F33B 5JPMB 1OB1A 4XHQA 3WFBH 5F9JA 1JF6A 1NCWH 4HH9A 1BJMA 3ZL4L 4XH2A 5DJ6B 3HG1A 2J8OA 1HH6B 2P5WD 4X9FA 1QSEB 3DUUB 3EIFA 1ZTXL 2VLJB 1T2QH 1QYGL 5LWYH 3KWWA 3O41B 4P3DA 4NBXB 1A14H 3DX9B 3SO3C 4D0BB 1YECL 4O2EA 1YJDC 4J3TA 1UJTA 3PWLA 1IILE 3QWOA 4MNQE 3UTPD 4KDVA 3BPOC 3G5XA 4PRAA 4LQ1A 2Z35B 3C5ZD 2MKLC 4WFGE 3CXHK 3KHOA 4P46C 1QZ1A 4I77H 3UBXB 2FB4L 1GXEA 1FGVH 1BVLB 2M1KA 1OM3H 3GSNL 2WBWB 3MRKB 4LNVA 3REWA 4XC1H 4FG6C 1J18A 2FEDC 4FNLH 4JFFE 4U2YA 15C8H 3L5XL 2R0WH 4M7JL 5HPOA 3DETC 2DDQH 3KLAB 1EHNA 4NKMA 1R24A 5B21A 4K2UH 5GSVA 2ATKA 3W9EA 1CF8H 3UTSB 3NAAL 3H8NA 5JA8B 3FMGH 1JGLH 1UACL 2CIIB 1RUPH 2NY5H 4Z8FH 5HD8D 2GW5A 3TO4B 1Y6KR 1XF5A 3AS3A 3RPIB 1ODAA 2W9EL 2NX5D 3VXRB 1QRKA 3RIFK 4ZS7H 1RULL 5D9SB 1VCAA 3QI9B 3ZL4H 1S9XA 3RBSA 1MJ7L 2J5LB 3VFNB 1YPZB 4H25A 2AI0H 3T0EE 3WUWA 3S37X 2R1XA 4GQ9H 1ZSDA 1QYGH 4U1HA 5I17A 4PG9A 1UM6L 1GHFL 4JGJA 4P5TB 3U0PB 4DFIA 5J6GB 4CKVX 5DWUL 1K8DA 2PYFB 3AREA 4YNYA 1K6QL 4XWGH 1PFCA 1RFDL 1BPVA 1MCDA 5IG7B 1P6FA 1N3NA 3SO5A 2ICWB 2E6QA 3NCCB 5M95B 2E9IA 4G8IA 4EJ1C 4PY7B 1ZHBB 3VWKC 4Z7UB 2EIZB 3GSNH 3M17A 3MLTB 3HPJA 5HHOA 4UAOB 5KW9L 4XCCL 1A9EA 3FQUB 4F7CB 4M7JH 2CXKA 3HC0B 4FQLH 1NPUA 4WEUD 4U1JA 2IAMA 1BIIA 1GZPB 5IV2A 3ZLQC 3NAAH 5E56A 3MV8B 2ARJB 1A6ZB 5CEZD 2PO6A 4EI6A 1UACH 4ODUA 2HTLD 3IDJB 1UA6L 1F97A 2VXUL 3HE7C 4TSBL 5C0RL 3BPNC 2W9EH 2R29L 2Z92B 1S7QB 5FB8B 5GS1C 1RULH 2AQ2A 5B3JF 2I07A 1C16B 2BOCA 2F8VA 5EU5A 1WZ1L 1MJ7H 4MNQA 3WE6B 1F3JA 3DIFA 4N1EA 5GISH 4EIZC 5CJ5A 4XNQA 5ACZB 2DQTL 2W1NA 4NHUB 3TNNA 2FZ3B 1GHFH 4JFFA 5H94B 3GMPB 5DWUH 4P2YA 1JRHI 1HDMB 2Q76B 1INDH 4V1DD 1NCBL 1SJHA 1K6QH 4PJ9D 1RFDH 4NUGL 3KPSB 4CRPA 4Y19D 4LSUL 4PJIF 5HI3D 1ETZB 1MCFA 4L9LB 1RUML 2EE6A 2IPKA 3X14B 4LNRB 2IH1B 2X7LB 1IM9D 2HVKA 3MFGB 5IWLC 3QIWD 1BFTA 3GJFK 2P49B 1KIUA 5T1MA 5LQBL 3GNML 3B2UC 1MIEL 4XVUC 1JMZA 4DZBA 4PJHE 1T1WB 5JIHA 2YA1A 4OFVA 3BIKB 3MXVL 1ZMYA 4ZUTA 3GDBA 5L2KD 1VEOA 3T0EA 4PREA 1U8OA 1UA6H 4JDZA 2VXUH 4TSBH 1NC2D 2R29H 4APQA 3GKZA 5IVXE 4GRWB 3H7BB 2ED9A 1VHPA 1U8LB 2BSTB 5IM7B 3L3OB 3CFKA 3GSWB 3PWVA 1P2CB 2NY2B 3PV6B 2ZUTA 2XOTA 4H88H 1CD9B 5E03A 5B39B 2BMKB 4GW4A 1X6LA 3HNSH 3RL1B 2DQTH 1FYTE 4LVNC 5ABDE 1ZANL 2DRUA 5DFVD 3IVKA 1ED3A 2Y25A 4MB3A 5D70H 1SYVB 1XFPA 3NFSL 1BFOB 5CINL 1NCBH 5IR1A 3QG6A 2VL5A 4NUGH 3DRTA 3O4OB 2JK5A 2OR9L 1QSED 4LSUH 4JFHD 3QBTB 3ZKXC 2E7BA 4X0KA 2DQUH 2JIXB 5GXBB 1DCLA 1FE8L 2BFVL 5E8EA 3O6FD 4ZUWB 4PP1D 5I8EA 1FVCA 3GNMH 2VQTA 2NY7L 1JZ3A 1MIEH 2UVEA 3WJLC 1ZKAA 4E41D 3GBLA 5FGBA 4OCLC 3ALXA 1KJMB 4X6CE 1P7QD 2VQUA 3QUKA 5MERB 5FYJH 4RWYL 5IB2B 3D87B 1GCFA 1W0VB 3V5KA 2HT2C 3ARWA 1YA5A 3EAKA 2X4OB 5MI0B 4GG6E 4TQEH 1JGVL 4NPYB 1L0XA 3LY6A 1KJ3H 4HBCL 2E27L 3BWAB 4XP4L 1AC6A 3Q3GA 3CFDA 3O3UN 5GZOD 4Z76B 2BVYA 1P7HL 3OKEB 3E3QC 3ROLA 2KQMA 1ORSB 3KYOA 2EYTB 5ISZD 2F53D 1QR1A 3OG6B 3VDAA 1FCCA 3NACH 4XZUA 1P7KB 1H3GA 2FJGA 3NFSH 3QI9D 4HWZA 4POYA 5CINH 5F96L 1RQ5A 5GS2D 1WF5A 4JO3H 3SGEI 4DOHE 2W9LA 4PJHA 4JFYA 4MD0A 4JQXA 3EOYG 1VACB 4NO2A 3GKWH 4TNVK 5DJ2B 5EZOL 3ESVF 1I8MB 4I0PD 4WFFD 1AJ7H 1GYAA 3BE1L 5I16B 4ZDHA 1FE8H 2BFVH 1T5WA 1BQLL 5D1QD 1J86A 3SDAB 1J0YA 2X42A 4KGJA 5C92A 3PHOB 1LO5B 3ZYZA 5CBEB 4R4FL 1FYTA 5HYQA 4FXKB 5DVMA 4JFXB 4MJ6B 5FFLA 2ITCA 4X6DE 5DJXB 4NGHH 4RRPG 3F62A 1IT9H 1JGVH 3D2UB 3JWOC 4HJ0C 2AKRB 2FHBA 4U4BA 4JR9L 1WISA 3OKMB 4HBCH 2E27H 5CZVH 3MV8D 1CYGA 4G8FA 1ONQA 3HFML 1R3KA 2BHUA 3G9AB 1SMAA 1FNHA 3QRFM 1QKZH 3WS3A 1UQSB 4MNHB 2VISA 1I7UA 5H2BA 4X9BA 5F96H 4NP4L 4RZCB 4MB5A 4WY7L 4X6CA 1TQBC 5ETUA 1QHOA 5EZOH 1JGDA 1ZT1A 4NNXA 4UTAH 5JDJA 2OBGA 1EK3A 4LEOB 2KZWA 2X70B 4IHOA 5DRZA 4LLVB 1QFOA 3BE1H 3KS0H 2IFGA 3WNMA 4GG6A 2XPGA 1J9CT 4XB8A 2VSDA 1JTPA 3L9RB 2VZVA 5CZXD 4KJWC 5DSCB 5FKAB 2BK8A 2GSIB 2WK2A 5E1AA 3BP7A 3KPSD 4KTYA 1SJEA 1FVDA 5J57B 1FL6A 4R4FH 1MCRA 2WUCL 4MSWA 4KPHL 2OYPA 1Y18A 4AYFA 4AMKH 1K4CB 2D7PA 5D2NC 3ZKMD 2NR6C 4PRHE 2Q1EA 5F7HA 3NBNA 5IEHB 3W0WB 4HUUB 4CU6A 4JR9H 4MXVF 4R0LC 5AD0B 2AABL 4U49A 1RUKH 3O3DA 5DK2B 3E2HA 2Y5TB 1E27B 4L8BB 5JW4R 3BSZH 2WUBH 3PV7A 3HFMH 4LPWA 2D7OA 3T8XA 2D0GA 3FB5B 3AROA 4M7KL 4FQXA 3VFWB 1CK0L 3PHSA 4NZJA 1FAIL 4K94C 5KOMC 3L3HB 4NP4H 2NY3B 4OAWB 1CD1A 3KG5A 2NY2D 3ULVD 5C0GB 4ISVB 4GKZA 4WY7H 3BT2L 3IU3A 3QIUC 4JG1L 3UYPA 5LG1A 1BZ9A 3WFDL 1EHLH 4MAYA 4HUVA 2OTPA 4M7LT 3MUGA 1K9TA 4FP8H 3MUY1 2R4RL 1G7HB 1IQWL 4X6DA 1B6UA 4UU9A 2VR4A 3CFJA 5KANG 5ID0B 4OBRA 5E4EC 4HS3A 3BO8A 2I9TB 5I1KL 4XVJL 4G6JL 4ZO8A 3RVUC 2H6PA 1RJYB 2V2XA 4IMKA 1X5KA 5T33H 4OZIF 4JN1H 3SDCA 1E4WL 5SX5H 4IJ3C 4F7PB 3BQUA 5ENWB 4AIOA 4D3CL 2AABH 5EOQH 3REVB 4A2MA 1XF4B 1PKQE 4GMSL 2D3VA 2C3XA 5I1LA 3P0YL 4JDTL 3WSQL 2NXYC 4JO2L 1HSBA 1TITA 5HPMA 5EZLB 4KKAC 5AYUH 4NNPL 1DUZB 1FAIH 3V2AR 1WK0A 5FYJU 4H1LB 4N8VB 3WFHA 1I4FB 2DWEB 2IPTL 3OKKB 3P11L 3X11B 3EUUA 4H26A 3C8KB 1QLEL 1ZA3A 2B2XL 3BT2H 4DWHA 4JG1H 4Y5YC 3U4EA 2E7LC 3WFCL 4AL8L 3WFDH 4PLKD 1RHHB 4Z7VF 1BLNB 4ELKA 4JJHA 1IQWH 1X5YA 4WGWB 4PRHA 4Y89A 1I9JH 5KJRL 5INDB 3S3SA 1MFNA 2FH6A 5CSZB 4EI5A 2XZCL 3NGBB 1IGML 3QUYB 4B53A 3LKPA 3BGFB 1CDHA 1PAMA 3D3VE 3BKYH 5I1KH 1A6AB 1T04B 3DTXA 4S2SB 4DN3L 4GRLB 2I9LB 2P44B 3ZE1E 5GS0L 1YEKL 4KROC 3VWJA 1AXTH 1CFNB 3OAYK 1UGNA 3RX8A 2VZTA 4LCYA 1NLDL 1A6TB 1N64L 4GMSH 3P0YH 3QDGB 4HV8B 3WSQH 1SY6A 1FN4A 2GK2A 43C9B 1AXIB 1U3YA 3RIAK 2YEZA 1PYWB 3MODL 5IHZB 3LS4H 3D2UD 3C8HA 4U1KB 2IPTH 4GAJL 1YEDA 3MGOB 1QLEH 2B2XH 1QFHA 3PWJB 3WFCH 5DMIL 1U3JA 1I85C 3CSGA 5BQ7B 5ICYB 1CBVH 3HPLA 5KJRH 3NN8A 1CFVL 2XZCH 1RAMA 4TPRH 1PKQA 5D2LB 1HXYA 1PSKL 5CGMA 3U4AA 2A83A 2BHYA 5F7KC 4DN3H 2CKNA 3FO9A 2GCYA 4PJAF 3ZTJH 4XC3L 3DX6B 3OAZH 5FV2A 3LD8C 1JPFB 5GS0H 3MR9B 3SHSA 5D6DC 1YEKH 5EFIB 2EDNA 2WAHA 5LGHL 3GJEA 4KHTL 1NLDH 2WP3T 1IEBA 5D71L 1N64H 4HD9A 4HIXL 4L8SA 2VLJE 4P23B 4OB5L 4XRCA 4LKCA 2GTWA 4CMHB 2GIYA 5C0EA 1NDGA 2F5BL 3MODH 1FZJB 2E7HA 4ODSH 2AQ3A 2EIEA 4P57A 5E8OB 3BZ4A 3HI1B 4GAJH 4C56A 5I2IB 4MDJA 4Q97A 1QLRA 4PTUA 1JWMA 4QHMA 3D3VA 4Z9KB 5DTFB 5DMIH 4G9FD 1HHKA 5SWSD 2DLEA 1C5BH 4P46A 1OT1A 4RMRA 1U93B 3HB3C 3U0TB 5F1IB 4R4NC 1CFSA 1JPGA 4EEEA 4HF5H 1B9ZA 3UTSE 4PDCE 1ZHNA 3B3IA 2EDFA 2ZWLT 1KBGL 4WI3A 1QSVA 1WGOA 5IF0B 3DVGA 1PSKH 2NTFB 4X6FA 5IK3B 3VXRE 2LAGB 4GRMA 4Q0XH 3SDXE 3MOAH 3HAEB 3IXAA 4K71B 4LPCA 2VUYA 3KYKL 4K3EL 2VIRB 2OSLA 3MLRL 4KHTH 5MENB 4HIXH 4LLQA 3X3GL 4OB5H 5HY9A 5C07B 3RGHA 4MQXD 1NJ9A 3NIDE 3QFDA 4FMFA 1V8HA 4X5XA 3WHXB 2F5BH 4Y5VC 1BJ1J 3ET9F 1H3UA 3QCUL 4JAMA 3IRZA 1Z5LA 4QWWC 5I15L 2HTKD 4QXTA 1JGEA 4M1CD 1WWAX 4BFEA 3CZJA 4WWKB 3RTQB 3U6RA 1D5MA 5KSVB 1DDHB 3MRGB 4LBEB 1XZ0A 4RMWA 4F15C 3IDIB 3MSPA 3F5WB 5EO9B 3IDYC 4OGYH 4I2XB 1R3JB 5D7IB 4W6YB 3VWKA 1QO3A 3ES6A 4QYOA 5HTSA 1HH6A 3A6OA 5TDOA 3MPCA 1BIHA 2G9HB 1CDYA 1KBGH 2JB6B 2VQ1A 4Q9BA 5KZCD 2C4FT 3DUUA 4FS0A 3RGVC 3P73B 5HHVL 4KU1A 5DDHA 3VFPB 5JXED 1T83C 5EUOB 2ZSWA 5HYSB 5E70A 3KYKH 2O5YL 3HE7A 3VDCA 3HR5A 4K3EH 1RI8A 1WSST 1NANI 1A4KB 3G5YA 4LLMA 3X3GH 1T6VN 3NA4A 1VKXB 1U92B 1E0OB 4GRLD 5HSFA 1LO3L 5SWQB 4GOSA 4UT6L 2C7UB 1EAPA 2PETA 3QCUH 5J9PB 1HHJB 4JY4B 5I15H 1AGDA 5C6TL 4H1LG 4B7IA 2CSPA 5F1KC 4YDIH 2DI8A 3QDGD 3S36L 5KOVC 3BRGC 3GB7A 2Q8AL 1T7ZA 4EBQL 3OKLA 3BVNB 4R4BA 2VR5A 3VXRA 3OJDA 3VXTA 2H8PB 1RZKL 5CD3A 2V9TA 5GGUB 3SDXA 3E3QE 1ACZA 1N4XL 3C5JB 3WO3B 2VXVL 3VXSB 4M00A 4LDOB 4N0YL 1U42A 3R06A 1W72B 5IWLA 1S7RA 3EOTL 1FFPB 2Y9RT 3QHFL 4D9LH 2P46B 5J6GA 4QY8B 1D5BA 4OZHF 4F80A 4GRWE 3G6JB 3DVIA 5CCKL 2PYFA 2E3VA 4I48B 4XWOC 4CDGC 4PJBE 1KENL 3VJ6A 2ZOKA 1C1EL 4W70A 5IB5B 2Y6SD 1T4KA 2DQIL 1WZLA 4PY7A 2EYSB 1A8JH 4QGTA 3T4YB 1UVQA 3EDKA 2Y7QA 3KPMA 3K2UL 1QFWM 4QHLA 2XQBL 4F7CA 3BEVA 2E8YA 1LO3H 1G7QA 1NEZA 1WAAE 2ZSVA 3MJ8B 1DLHA 1F02I 4UT6H 3OQ3B 4PJ7A 3MLXL 3F65A 4PYGA 4S11A 5T3ZL 4L3EA 1RMFL 2N1KA 5C6TH 4WI2A 5K93A 3GJFB 4K8RL 3LKNA 5I30L 2MWCA 4P0DA 5DK3A 5CD5D 1HEZA 3QISA 2D4FA 1IM3B 3DBXA 5IB4A 5LGKA 2Q8AH 4EBQH 4AY0A 4EOWH 2VAAB 4TSCL 1SY6H 1N6VA 1R3LB 5FB8A 2BSSA 3BP4B 1TNNA 1RZKH 3ZZ1A 3TZVB 1I1YB 1N4XH 1OVZA 3T3PE 3MRRB 1AGEB 2VXVH 4ZOAA 3SQOH 3VFGL 1N5AA 5ADPL 3P9MB 2VE6A 3VGAB 4QHUB 4AEFA 1F00I 3MNZA 4KUZH 4MZ2A 2R0ZL 3C9NB 2IBGA 5HDQL 2ZNWA 2XFXB 3MCKA 5DJ0A 3AM8C 1FV1B 2AXFA 5A2KH 5JOFA 1YJDL 5L8KB 3EOTH 3QHFH 3WJLA 4U1LA 1U3HB 5CCKH 6CGTA 3MNVB 4NRYB 4JY5L 1OAZL 3B43A 4KJYA 1X4ZA 4V2CB 5FIEA 1F11A 5CBAA 5IFHL 3EW3B 5DUBB 1C1EH 2P47B 4KI5D 2GK0B 2V5YA 5HYFA 4OZ4A 1NCAH 1FO0A 4KKBC 4U1SB 1LO2H 1HQ4B 4C54A 2WIIB 5CFHA 5LJYH 4ORGA 3STBA 4JREC 5EBGA 3CCHB 2CR3A 4RMVA 1AH1A 1J88A 2OMNA 5J11C 3E3QA 3PWNA 1X7QA 3MGTB 5IB3A 3KHQA 3MLXH 1MFEH 5D7KE 5F9WC 2QQNH 1N6QL 3BKMH 2BSRB 1MFAL 5I30H 5MEND 5TE6L 5C07D 3BP6B 3WDHA 4LARL 1IKNC 1E4JA 3H9ZA 4PJEE 2X89D 5TQ2L 5IMMA 2NY0B 2EICA 3BIBX 4JPKH 3UTTE 3H7BA 3PXHA 4JLRB 3MJ9L 2AP2A 1PZ5A 1R3IL 3GSWA 4OGAD 2X4RB 4PJBA 3VFGH 5ADPH 5I75B 2C1PB 4HLJA 4NRZA 3MJ6A 2PW1B 2R0ZH 3H9HB 1VGEL 3FAXA 2GKIA 5HDQH 2RJMA 2W9DL 4WWKD 5FCUH 3RTQD 4XNXL 2JCCB 2ZUUA 4FFYL 4U33A 3O0RL 1WAAA 1OAZH 1BFOA 4JY5H 4OTXL 1MCKA 1TQCC 4MA8L 4MNGE 1AI1L 5IFHH 1MIMH 1BX2A 1TZHB 3HAEG 4WU5B 3VW3L 3QHTC 2LVCA 1MCSA 4M93C 2OR8A 2K7PA 4KZEL 3FONB 3P4OA 4L8CB 1A1MA 3IU4L 1IEAA 3QDMD 3C8DA 4U6VH 4XMPL 4MQ7A 3L6FB 4XX1E 2Y07L 2JIXA 1SM3H 1UEYA 2ICEB 3NCBB 4K23L 3CSBA 3BWUC 2DQCL 3ARDB 4ODTL 3QFJD 4UB0L 4CL7A 1N6QH 3BPCB 2I24N 2WWMD 1MFAH 5J6HB 5TE6H 1KLGB 1HH9B 5IB2A 5KAQF 4KY1L 3F58L 3PP3H 5TQ2H 3T0BA 3EO1B 4R26H 2VN7A 4NPYA 1M71A 4CW1B 2CMRL 2DJUA 1RZIB 1R3IH 3CFBB 3VXNA 5FYLD 2RB8A 1RK1B 2AEWA 4ODWB 1GRWA 4J3WA 1VGEH 3P40A 4L4TB 1AGFA 5L2JB 3V9FA 1S9VB 2W9DH 3OG4B 2BC4A 4WO4C 4XNXH 2N7BA 4L29A 1NMCC 4KMLB 3GHEL 4CVZA 5HD8C 5C9KA 4OTXH 4MA8H 5JZ7D 5MHSD 3VXSD 1AI1H 4PRIE 4Y1AB 3VXME 4R96A 3VW3H 3A67H 2FJFA 4JFOB 3IU4H 5IBTL 5B22A 3GBMH 4PJEA 1U8IA 4R0LA 3HC3H 1IGJA 5AG9A 1XGRB 3CH1A 2D9CA 3UTTA 4K23H 2DQCH 2QKIA 4GMTL 4LLUB 4UB0H 5I71B 3KXFB 2SEBA 5EBWB 3SDAA 3C60D 5DRNA 4YO0B 4NJAL 4XPBL 5I1GL 3PQYB 1ZGLB 1G7PA 2B1HH 4PJFE 3ZKNC 4CVUA 4JKKA 5KSBB 2C3HA 2IBZX 4KY1H 3F58H 4TUOA 1KPUA 2Z0BA 4R2GD 2PTUA 4UV4L 1RUAL 1UM5L 5E8NA 5GS3A 4JFPB 2PNDA 2H3NB 3QIUA 3D85D 2CMRH 4MNGA 1DQML 2AEPL 2CR6A 2ICCA 5JQHC 5HGHB 1WBYB 4P9HC 4D9QD 4HK3J 1DQLL 3OAUL 2V7HB 2C3VB 1N8ZB 5CP3H 4M1DH 1HHIA 3CFEA 4E5XA 5IW1A 4MNHA 1P4LB 4GW1A 3TZVD 1A6PA 4MJIA 3T4AA 1IMHC 1EEZA 2LABA 5BXFB 2BOBA 3ARXA 1IAKA 1QG3A 3C2AL 1EFQA 4X4ZA 4WW2A 5JLZB 4LVOC 3KYMB 1KTDB 5DHVA 4OF6A 3FB6A 1U8PA 3Q6FB 2JJWA 1U3HD 4MGXA 5EIVA 2ZG2A 5D1ZB 4JN2B 5FKPB 4GMTH 4OCWH 2A0LD 2LU7A 4XTRC 1EJ6A 1I1AD 4PRDB 1FO0L 5I1GH 3WJJA 2FEEI 3ILQD 2BVPA 1IQDB 2NW2A 1QEWB 2EE3A 2YBRA 4PD4J 4QXUL 1QFUL 2GY7B 3T0WA 1FL3A 4UV4H 4ZTPL 4CVXA 5DD0L 1RUAH 1UM5H 4LHUG 3OXSB 5EZIH 4HXBL 2A2QT 3IDGB 2W59A 3FRUB 4JHBA 1H8SA 5E2TH 5DHYA 4IOIB 4Y5YA 4PRIA 1DQMH 1LP9E 5LXGH 4KKLD 3VXMA 3QIWC 1RZGA 5E94A 1DE4B 4U0QB 4NQXA 4RCAA 3PWPA 35C8H 1FVEB 2NY0D 4RDQG 1MCPL 1UG9A 4JCLA 5F89B 2VKWA 4JZJB 1EXUB 3LN4B 5BV7B 4XGZA 1OF2A 5D7LD 5F44A 3C2AH 3LV3B 2IC2A 1A3LL 2OZ4A 4N0UE 4PJFA 1QBML 3MREB 1IL1B 3SKOB 3CU1A 4JVPA 1F3DH 1G7HA 4ODHL 3RVVD 2X4QB 4NBZB 5B38B 4P4RA 5TDPB 4XPGH 5F3HB 4JQVA 3LSOB 5I1DB 1FO0H 4OLUH 4PJHF 2WMPA 1JPST 1U8MB 3JWOL 2EZ0C 1AP2B 3N85L 4QXUH 1QFUH 1KSRA 4NKDB 3P4NA 5C0BA 4ZTPH 1A2YB 2AXHA 3ARDD 4HXBH 3RWDA 4ZFGH 3RKDD 4I18B 1MLBA 3FO0L 2VXSL 4L3CA 5SV3A 4X8JB 1I85A 3O6FC 1N2RB 4PP1C 5T1KD 4PG2C 2WBJB 5D2LE 3MRFA 4OLYH 4YGAB 1XF3B 5KVGL 4QCIB 3CDCA 3BGMB 1CXIA 5EZLA 3WKNA 1X4YA 1BOGB 4GRWH 4WI7A 1MCPH 5AG8A 1JHLL 4N8VA 3CUPB 1P53A 1X5ZA 1Z0MA 3EYFA 4O2CA 1NGWA 3ZDXE 1G9MH 5I74B 2ZUSA 2FD6H 1IAMA 1CTNA 1A3LH 4L4TD 3LEYL 1QBMH 1JWSB 4CJ0A 3C6SA 5D6DA 4Z78B 1EO7A 1XGYL 1EA9C 4DUXA 3QB7C 5T5NG 2J3SA 2FO1A 3DX7A 3OXRB 4WHTB 3L95B 3CSYA 3MFFB 4M61A 3UCRA 3WL9B 4XBEL 5CSZA 4Y1AD 1LP9A 1DQJB 1INQB 4NC1C 4P99A 5DEFB 1K5NA 1ZOXA 3MLZH 4X6CF 3KPTA 5C9JA 2J5LC 2R23A 1EUTA 1M7IA 3N85H 3KLHC 1FIEA 2EKSA 1S7XB 2FX9L 4BM7A 4I0PC 4GG6F 4P48A 3KXFD 4DKEL 3FO0H 4NN7C 2VXSH 3W9DB 1A6TA 1XR9B 1HXMA 3PQYD 5D1QC 3TJHC 4N0UA 1UXWB 2RFXA 5E6IB 3MXWL 2ATPA 5FO8B 1CG9B 2XWBA 4FXGA 2GAZA 2GT9B 4AEHH 4JRWA 4UAOC 2MKWA 3JXAA 1AXSA 5DGRA 4Y2DB 3LEYH 3ZE0E 1MHEB 1PX4A 4RGMB 5DJDB 1YC7A 5JHLL 3VCLA 3TCXA 5F7DB 1OGAD 4EQ2A 5KSAA 4PJIB 4ZPVA 5I73B 1ADQA 4KK6C 1E4XH 2Z4QB 4LCUB 4XBEH 4L8DB 3HTLX 5HGBA 2HJLB 1NL0L 2EDDA 2A6DA 2K9UA 2HRLA 5EULV 4TVSa 5H37H 1EUUA 1MI5B 5EA0H 5D1ZD 5CEXA 4I2XE 2VZ3A 1SEBB 5CS7A 5D7IE 1TNMA 1I7TB 4NQCE 4DKEH 3HR6A 4HW6A 1Y6NR 1FSKC 3Q5YA 3S5LA 4G6KL 2UWEE 1OQOA 3FJTA 3MBEC 5CZXC 1MH5B 5EUOE 3MXWH 5J4MA 4EIGB 4N1CA 1DQQB 1G6VK 3S4SG 5L8LB 1T66D 4L9LC 5FO9B 4RGND 1LMKA 1RVFL 5AEAA 3U79A 4AEIL 3T0DA 3BEWA 2DTML 1JI1A 3RGVA 3HI1A 3H9SB 1U8HB 1Y6MR 5F88B 1T83A 5C0AB 4R7NA 4HAFA 4TTDD 4U1MB 2EXWC 3DUSA 2OXHA 5F9DC 1EIBA 3MV9D 1MFBL 3BKCL 2VOTA 2DICA 4HUMB 4GKNB 1WBXA 3WLBB 5JHLH 2G75A 2FRGP 1ZEAH 2JJTC 1YN6B 5C3LD 3T2NL 1KGCE 3U0TA 3A6BH 3I02A 1LEKA 3RZCB 1I75A 4TUJB 1OAYL 2XNAA 1JZ8A 3TCLA 3KPOB 4GLRH 4X6EA 2OZ4L 1KLFA 1YN7B 3DSFH 2NTFA 4WUUA 1II4E 3T2PA 3ULVC 1NL0H 3JTSA 4Z0XB 4DGYL 4DVBB 4OI7A 1JF5A 1FL5B 3X12B 4LFHG 4HS6A 1FBIL 3BUYA 2P8MB 3HRZB 2V5RA 4PP2A 2IPUK 4G6KH 1ZA6B 2P7TB 2MCG1 5K9KB 4HKJB 4LAJH 1EEQA 4PUBL 4RISL 1QRNB 5D4QA 4JHWL 2P24A 1U95B 4WJ5B 2D7TL 1RVFH 4JJ5B 2VNCA 2VLLB 2DTMH 4FFWD 3DV4A 4PJXE 2W0FB 2PW2B 3ZE2E 2VABA 3VFSB 2WBJD 2B7DT 4I1NB 5F7LB 2OQJA 3BKCH 3O2DH 2JELH 4LBEA 3H0TA 2V7NB 2CLRA 5C0CE 3U36A 3T2NH 3VFUB 4NQCA 4I4WB 4XP5H 1DFBL 4KTDL 5AAMA 1LO4L 1OAYH 3V6ZB 1V05A 2UWEA 4G8EB 4ZQKB 4D9RD 5ELIA 1OWWA 1QA9A 3V5DB 4KKCD 4DGYH 5EBLA 4NQUA 3GGWB 2AJZA 1KLUB 5F71A 4PLKC 4RX4D 3MRNB 4CMMB 4OCRL 1FBIH 1IC5L 4PGCB 3EYVA 3NPZB 5SWZE 2P5WE 2Q3ZA 3LN5A 4JFED 4QNPF 4FZ8H 2NZIA 1KCRH 1JI2A 4GUPB 2Z8RA 1U92A 1T1XA 4RISH 4YXLL 4G43B 5HGDA 5LGJB 1PEZA 3QJHA 3GMMA 4HK0A 5D93B 4MJ4A 2XWTB 1X44A 1OAUH 3HZKA 1XAUA 2DYPD 1KCLA 3ROOB 3O3EB 4NIKB 2XZQL 5DJAB 5HGAB 1UC6A 1RZ8A 3HCVA 5E6ID 1CE6A 4XNYL 2R9HD 4XBGA 3KPLB 4AH2B 4PB0L 2P8PB 4POZD 5I6XB 3WEXA 3AB0B 3WDJA 1DANU 1AHWB 3LRHA 3HC4L 1T22A 1DFBH 2A73A 4KTDH 3D39A 1EO8L 4AIZB 1LO4H 1XH3A 5I1CL 1U6AL 1VEMA 4Y2DD 2NX5E 4NO3B 3MLSL 4JHZA 3P4MB 1KC5L 1DVFC 5L7XL 2EDLA 4BSVA 4EVNB 4Y4HA 1ADQL 1ZT4A 3ZE1F 5GGQL 1IC5H 4PJXA 1T0MA 4ZTOL 5DVKA 4J3UA 4EUPA 1LK2A 3T4YA 2KPNA 4BFIA 1KNOB 4IOSD 2D7QA 5F8RC 1Q9WB 1MI5D 3VFVA 1Q9OA 5IEKB 2X10A 4BH8A 2CKBB 2F74A 4LU5L 5C0CA 4A2LA 2W38A 1UKTA 4AEEA 1A6UL 1F6AB 1J11A 3GJFA 4MXQD 4UT7L 3QQ3A 2XZQH 5DR5L 2CDEB 5CILL 4QHKJ 1C5DA 2D31B 4B41A 2ADFH 2AQ1A 2X6MA 3U0WL 4XNYH 4YUEL 2GITB 2VLRE 4XPTL 4HX1B 1I7RB 4P2RB 2FECL 3MRRA 4LCCB 3BZFA 5C0AD 3ZO0A 5SWZA 2P5WA 4I0CC 3N1QC 5H35A 4WEBL 5ESQA 5EU4B 1YQVH 3LQAL 1U6AH 5IFAL 3AS1A 2HG5B 1B4JH 3MRCA 4N90E 3O4LE 3AY4C 3WV0A 3NIFE 1KC5H 1JWUB 1ZLVH 3VH8B 3B4NA 4YGVB 1N0LA 2Z31C 1ADQH 5F7FA 5GGQH 5GGVL 5DS8A 4NDMA 2DKMA 2COQA 4OZIB 3EJJX 5GRXG 4LHJB 5JMOC 3HMWL 5CGYD 5E9DB 3VI3E 1XGUB 2CRYA 3PL6A 4IRJD 4PS4H 4I9WE 1C5CL 2IG2L 5T1LB 1FZKB 1W0YT 2KUTA 4LU5H 4FFZL 3BDXA 3SCMB 4EN3C 3ARBA 4WO4A 4WWID 1IC4L 2KQNA 1JF1B 2MFNA 4UT7H 3LH2L 1NBZB 3DO7A 4QRRE 1TENA 5CILH 2P48B 4YXKL 1D5XA 3RZWA 2H2SD 3U0WH 2NX5A 1QRND 4YUEH 5D5MA 3VRIB 4XPTH 4JFDB 4G8GB 2YUWA 3PHQB 1A1OB 3JV0A 4MQXC 4PD4K 3S7GA 1MPAL 4YXHL 5TE7H 1NGYB 1TLKA 5HJ3B 1A9BB 4GG8A 4Z7VB 4WEBH 3LQAH 5F7NC 4KRNA 1D6EA 5IFAH 5DZLA 2NYYD 2HTKC 4Z7OE 1IE5A 3MYJB 5IMLB 5MEQB 1GAFL 3RRQA 2X9WA 1GGYA 1JMXA 1V7NH 5HHPA 3CD4A 3SDXF 3LOWA 5C0IB 3P0VL 5GGVH 5FGCB 3GMNB 1NGXA 4F7EB 2RCSL 3DNKA 5IJKC 5I1HL 1P9MA 3LEXB 2RHEA 5IVZB 2OLDA 3RWGA 4PRNB 4OV5A 2VLRA 3CIQA 4LCWD 2DQGL 5EU6B 1UYWL 1C5CH 2Y5EA 4G6AD 4QO1A 5CIPB 5DLMH 5TFSL 2IG2H 3NIDF 1WBZB 4FFZH 2DL2A 3DYPA 5JXEC 4I3SH 3OHXB 1FZMB 4JFHE 1D6VL 4U6HB 3G04B 2NLJA 4YXKH 2HRPH 1T80A 1JNHA 5A43C 3LKOA 3VFRB 2X05A 3NGBC 3H9YA 2C1OA 1FQ9C 3QCTH 4H8WL 3O4LA 2OI9B 2IMMA 4Q6IB 2GSGA 2ERJB 3K3QA 3QULA 1JV5A 3E6HB 4MLSA 4PJ8B 3HMXH 3TF7C 4E41E 1MPAH 4YXHH 4GRLC 4LF3A 4PJ7F 5EZJB 5CZKA 2C26A 4FOMA 4JY6B 4HIHA 2YXFA 3IFLL 3MACL 2HJKA 3CK0L 3H6JA 3M1BB 4DTGL 5ERWA 1GAFH 3BUTA 4UNTA 1ZGLM 4O51B 4W4NA 2AJVH 4C4KO 2H2PD 4IS6B 3PJSA 1CFQA 1TFHA 1TMCB 4XCEA 1DBKL 4ZO6A 4PJAB 4QRRA 1N26A 5DVOA 1BMGA 2PF6A 2RCSH 3SGJC 3FB7B 2EXYC 1MQKH 2B1AL 1G7IA 1F58L 2B39A 5BZWB 1MCIA 1FFNA 3W39A 4WW1A 2NY6B 1UYWH 3OPZH 5BZDB 4YPGA 4E0RA 2HFTA 3FT3A 1J8HE 4X6BA 3RQ3A 2HH0L 2YRZA 3H42H 4LVHB 5EBWA 1UB6B 2Y06L 1UJ3C 5HVHC 2F54E 4XNMA 2HLAB 1D6VH 4OD1H 5E2UL 2QR0B 2ZOLB 4N5UA 1Q8MA 4ZO9A 4ZAKB 4ERSL 3BYYA 5SV4A 2Y6SC 4MCYB 4H8WH 3S3PA 4XXCC 4F2MB 4ZPTB 4F3FB 3MRBB 2P42B 5F6IB 3U46B 3FQRB 3D9AH 2V7HA 3LPWA 5JDSB 4LPVA 3IS0X 3IFLH 3MAC