4PSDA

Structure of trichoderma reesei cutinase native form.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
DWPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Carbohydrate esterase family 5
total genus 78
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4psdA00
4FHZA 3QZUA 4X6UA 3R40A 2RONA 2JGMA 4WCVA 4Y2SA 2FUKA 4L9AA 2WHRA 4QNNA 3ESDA 5IVIA 4B7ZA 2AJCA 5AKIA 1SFRA 5CH8A 4KJXA 4WFIA 4BRSA 3R3XA 4EUSA 1XRRA 2QS9A 3FSGA 4OD0A 4B9EA 5JZBA 3WLAA 5ALDA 2PPLA 4BZZA 4L0CA 1UKBA 5K3FB 5HF5A 5BWBA 4OB6A 5ALXA 1BCRA 5AI5A 3O4GA 2XB6A 2BUCA 3WWPA 1UWCA 4X92A 1LPOA 4K5QA 5AKGA 5T4BA 3CCBA 1M33A 1LPSA 4UHDA 4EY7A 1FFAA 1PV1A 3F97A 1THGA 2I3ZA 2WUDA 3ANSA 4MQMA 1ZJ4A 2VAVA 5AK5A 2QTBA 4B81A 4YK7A 3Q8WA 3HC7A 1R88A 4KAJA 4H7JA 2O2IA 5JD4A 4BC1A 2W22A 1CUDA 3M82A 3C70A 1H2YA 1LNSA 4V2IA 4H7EA 2WIKA 2VJCA 2VT6A 4DSZA 1Q0RA 4FTWA 4M0FA 2XQFA 1DU4A 4MYDA 3KOOA 2VT7A 1P0MA 4RNCA 3WKBA 1H2XA 4WJLA 1C7IA 1CPYA 1EI9A 4NZZA 5E4JA 4CFSA 3WKDA 1CUJA 4KE9A 4AX4A 3LIIA 1UK9A 5HQ3A 1ORWA 3ESAA 3BJRA 1UXOA 1QTRA 2X5XA 3ED1A 1DQZA 4MEBA 3ZPXA 2XE4A 4LXIA 1QLWA 5KBYA 2G4LA 3R3UA 4DSAA 3I28A 5FPQA 4G9EA 4FFVA 1BN7A 1H23A 5T4HA 4BVJA 2RHWA 2VJBA 2PX6A 1MX1A 2WIDA 4X6XA 3A2LA 1LPMA 3H1AA 2WG0A 1E66A 5JANA 3BXPA 3C5WP 3NWOA 4BRZA 3TGLA 4OUKX 4GECA 3AZOA 1UK7A 2ZYRA 2XUAA 2XMSA 5E4TA 2G5TA 4BE9A 4DNQA 3CN7A 1CUCA 4AZ3A 2OQIA 1NU8A 2XUIA 2BUBA 1GQSA 4NVRA 2ACEA 4IH1A 4W63A 3DOIA 5A7GA 4BVKA 1YA4A 3DJYA 2ZVDA 5ALLA 1CQZA 4K6HA 4N8EA 5FKJA 4MQLA 3EF3A 5CH3A 4YX9A 1IVYA 4AQDA 5FLKA 5JARA 1B41A 3G02A 3I1IA 5AI9A 4RPCA 1T2NA 3Q0TA 4IH4A 1UOOA 1UT6A 1U65A 5DNVA 1QGED 2XQGA 5LZ5A 4QWWA 1AUOA 1E8NA 1VE7A 1I6WA 5FP0A 3FWHA 1WOMA 3VVLA 2C4HA 1HBJA 4Q3LA 3WI7A 4G4JA 2PVSA 4DIUA 2J3QA 2OCGA 2YYSA 1DINA 3FSGD 2WTMA 3PFCA 2QRUA 2WHPA 3IUJA 3OOSA 2XMGA 5K3CA 5CXXA 3LCRA 3NUZA 1A7UA 1CVLA 5FUMA 1CUYA 2VJDA 2Z3WA 1CUVA 2V96A 2Y6UA 1THTA 3G0GA 2HM7A 2ZYSA 5AKHA 4KEAA 1U8EA 2XLBA 4GXNA 1WCYA 1ZD4A 3AFIA 1EVEA 4PSDA 2VSQA 1JT2A 4CG3A 1WB5A 1FFCA 5EHQA 1USWA 1VA4A 5AKEA 5ALTA 2OAGA 1IUPA 2HFJA 4G4IA 2GBIA 2DHDA 2HL6A 1YS1X 2QKYA 3PI6A 5D3ZA 2AXEA 4DGQA 2XLCA 1DT5A 1Q0ZA 3C8DA 4X93A 5DYTA 2JGFA 1MNAA 5AK4A 4QLAA 1QFMA 5CXUA 3H17A 5DNUA 3FVTA 1C7JA 3FLEA 3QPDA 2FX5A 4Q05A 5DTJA 2XMZA 5CURA 4KAAA 1W6RA 3WYDA 3JW8A 3N0TA 4H35A 5IVKA 2Z3ZA 4KYVA 1LGYA 3M83A 1BRTA 5FXMA 3M3DA 4J0CA 3WMRA 3ANTA 4K2AA 3OM8A 4PNZA 3WKEA 1EDEA 5ALOA 2JEYA 1VJ5A 4YPVA 4Q3KA 1EA5A 3HRHA 5AM3A 3I2HA 2Z8ZA 2WHPB 4INZA 3DOHA 1LBTA 2H7XA 4B0PA 1CUUA 3H2GA 3RLIA 1G42A 4A23A 3WYNA 5C8XA 4W9RA 3AUKA 5A71A 2QXTA 1MNQA 1VZ3A 4OB8A 3C45A 1QTIA 5C7YA 1ETHA 2GYUA 2WSLA 3D2BA 4FLEA 1G4HA 1N8SA 4X85A 1W4LA 1R1DA 5AK3A 3P2MA 3F96A 3DL7A 2BGNA 1TQHA 3WL8A 4Y2XA 5E4YA 4HVTA 3I6MA 4UBNA 1GXSA 2O7RA 4PW0A 3FNBA 1OCEA 2OLEA 1EB9A 3ZV7A 5A2GA 3I2GA 4C87A 4E15A 2JIDA 2HU8A 4FNGA 1XRNA 5AI8A 1ZI9A 3HYSA 1MJ5A 1XZDA 3LIPA 4E46A 1ZGCA 3G0CA 1ISPA 4CIBA 3FCXA 1N5RA 5ALNA 1CUGA 3H2JA 4UBKA 4BATA 4LXHA 3C6ZA 3KDAA 5LKAA 5HFNA 4BVLA 4PSUA 3I2KA 3W04A 2GBFA 4WY8A 5AI4A 5AP9A 4G8CA 1UOPA 1TCBA 4X97A 5JAUA 1U2EA 1ZJ5A 4ROTA 1R9NA 2D5LA 4HXEB 3V1LA 5SYMA 4Q34A 3ESBA 5BV7A 1JFRA 3ILSA 2GYVA 3WWDA 3KWJA 2HA3A 1BEZA 5ALKA 4AMZA 1HPLA 3N2ZB 4E11A 4XIIA 4DMHA 1BE0A 2ZSIA 2GZRA 3EIOA 5ALUA 4N8SA 1WB6A 3BE8A 4BAGA 1H2WA 4TVKA 2XMCA 1W52X 2XUHA 2Y2VA 1KEZA 3NOXA 2HFKA 5DWDA 1GZ7A 2DHEA 2IITA 3PE6A 3I1YA 5AIBA 4BBZA 4GBGA 4LHEA 3PFBA 4TPKA 1XZMA 5LLSA 2DQZA 4RE6A 2O2HA 3O9MA 5DNWA 5ALYA 4UHFA 2XUDA 1FJ2A 2ONCA 5AKXA 2WJ4A 1F0PA 1XROA 1XRQA 3T52A 1XLWA 1K6EA 1YAHA 4H7HA 4U2EA 4F5ZA 5K3AA 1CUZA 5FDFA 3E4DA 3FOBA 3DYVA 4XJVA 5ALSA 5JAOA 3IDAA 4TGLA 4BCDA 5EIAA 2VAXA 1Q83A 2JGJA 3QVMA 2RIPA 1YA8A 2PBLA 2XMQA 2UZ0A 1DT3A 4ZV9A 4I3FA 3QH4A 5CT6A 5DTIA 2HIHA 4MXDA 1WB4A 2C0PA 4HRYA 3M81A 4B0OA 2PSHA 2WIJA 2Z8XA 3OTQA 5DJ5A 1PFQA 3WIBA 3WK8A 5CBKA 5YASA 3FYUA 3RM3A 3WK7A 1ORVA 1FFBA 1B6GA 1Q84A 3RARA 3IUMA 3BWXA 5EIHA 4CI9A 4C6HA 2C0QA 4GWLA 2AJLI 3V48A 4DMFA 4HS9A 3IUNA 2K2QB 3QM1A 2XUOA 3I6YA 2CMFA 3V1NA 3FAKA 3DEAA 5JD6A 4EHBA 4W1PA 1UK8A 5K3DA 4Y2PA 5AKYA 4OU5A 2B4KA 1N1MA 3PF9A 3CCCA 5AIAA 1DTEA 3VVMA 4Q1VA 3A2MA 2ECFA 3G9TA 3DYIA 3ZLUA 4F60A 4QLOA 1EX9A 5HKAA 4GLBA 1HL7A 3O95A 3VJMA 4P08A 3IURA 1BN6A 2WU3A 3LP5A 4DTCA 4U2FA 2WU4A 5ALEA 4BDTA 2I03A 3RK4A 3OG9A 4MYSA 5KWIA 3WWEA 4PSCA 1JU3A 4UUQA 5K3BA 4J0HA 2H9YA 4ZRDA 1X2BA 4X6YA 4WY5A 4XWGA 2CB9A 2WQZA 4J0JA 3EQ8A 4K6GA 2QT9A 1XZBA 1C4XA 4S0XA 4EZIA 4OYYA 2BAGA 3R0VA 1XZHA 2XQJA 3OURA 2ZJFA 3WIOA 5IVHA 4A5SA 3B3QA 3DQZA 1DWOA 1XRPA 1O6GA 1XZIA 3DKRA 4J0DA 5IH7A 4Y2YA 5JZ9A 3AILA 1MPXA 4U2DA 3B5EA 5A7HA 4FLFA 2JGIA 2CEKA 1CUHA 1P0QA 1GGVA 4J7AA 3STUA 3DLTA 5LZ9A 2XDWA 5CT9A 1RWQA 2XUKA 2QOEA 1QOZA 5JALA 4AB1A 5AM2A 2GZSA 4DMKA 1XQWA 1CUBA 4UFPA 5EI5A 4DMCA 3L1JA 2WFMA 1VKHA 2I3DA 3DKKA 3A6ZA 3QMMA 4H77A 1XQYA 3CN9A 5H3HA 4MWTA 3ZWQA 4BCCA 1W1IA 1BU8A 2ROQA 4CCWA 1YB6A 1E8MA 1K63A 2PSJA 4NS4A 3S2ZA 2BJHA 3UUFA 3WJ1A 1VLQA 5HKBA 2WUEA 1H2ZA 4DLNA 3HACA 3ICVA 4JNCA 4F0JA 4CG2A 4OPMA 1O6FA 4B83A 3G0BA 3L1IA 1ACJA 3C6YA 4UHEA 2HDWA 2RAUA 5AI6A 1LLFA 4H18A 2OGSA 5HF6A 2Y2UA 4M0MA 3WL6A 4I19A 4ZV7A 4G4GA 2OQVA 5K5EA 4ARAA 4X94A 2JBWA 4C4ZA 4UHCA 5I8PA 3KD2A 3BIXA 4BCBA 4FMPA 4X7BA 2WFLA 3I2FA 5ALRA 4KRXA 5AM5A 4AN0A 1CIJA 4CG1A 1XZJA 1EINA 3F67A 2HA7A 4NMWA 1AZWA 4RGYA 3NGMA 1LPNA 4H7DA 1ZGBA 1WPRA 4KE7A 4B82A 5JAPA 3AZQA 4UHBA 5FRDA 3WZLA 4C89A 1XZGA 5LZ2A 1HLGA 2DQYA 4X95A 2BUAA 4IO0A 4BB0A 2PUHA 1K4YA 2C58A 5AICA 3FYUC 1H22A 3ICWA 4JUIA 4DNFA 1XZFA 2OCKA 1X70A 2PL5A 1LPBB 3GA7A 2NW6A 4L72A 2B61A 3BIWA 2Y1KA 1ZICA 1QFSA 3E0XA 2X8BA 1TCCA 3H19A 4WDQA 5AKJA 1A88A 1ODTC 3AIMA 4J0IA 3STVA 1DWPA 3R3WA 2IX9A 2EEPA 1FFEA 3K2IA 3OPMA 2WM2A 5LIPA 5D3KA 2D0DA 4Q3OA 1FFDA 5LZ7A 3AIOA 1W75A 3GROA 3QITA 5AOAA 5C8ZA 1TRHA 2C5GA 1YSCA 3I2JA 4AN1A 3HJUA 2WJ3A 3O9VA 3WK6A 2FJPA 4W1SA 3D3NA 2VTVA 2PKYX 2GBGA 3R3VA 5DLPA 1R3DA 1SOMA 5EHZA 1AMNA 3G0IA 3G9ZA 2PM8A 5FOQA 1GPNA 2PSDA 4WFKA 4XVCA 4M0EA 1YR2A 2ZYHA 4ZWNA 3QMWA 1R4ZA 2VA9A 5DYWA 1YS2X 5K3EA 2WG1A 4BE4A 4UBMA 5LZ4A 2B20A 5ALHA 5KWJA 2LIPA 5AOBA 4CCYB 4CCYA 4OCZA 5A7FA 1AC5A 3SK0A 4Y2QA 5CMLA 7YASA 3GUUA 3V1MA 3ZI7A 4B85A 5HK9A 3SX4A 3ZLTA 3W06A 3DL4A 5BWCA 1NX9A 1BEEA 2XUGA 2OCIA 3QPCA 3E3AA 2ZYIA 4HXGA 2ES4A 5AO9A 1EB8A 4BP9A 4ZXFA 3HXKA 3WWCA 5AM4A 2O2GA 2ZSHA 3H1BA 3DNMA 4ZREA 3VJLA 4C4XA 2CBGA 2XUQA 1AQLA 5T4FA 1XRLA 3DD5A 5SYNA 1CUAA 1MAAA 4KR0A 3R3ZA 4HRXA 1QIFA 5ALJA 3VKFA 1EVQA 3BJMA 1XZEA 1R50A 1BS9A 1JJBA 5AH0A 2WLSA 1EK1A 5EGNA 4FWBA 2OPHA 2XUFA 1TIBA 2DHCA 5BOVA 1K5PA 2WKWA 3D2CA 3O4IA 3TJMA 4ZI5A 3KSRA 4JYPA 4X3CA 5LP1A 2PSEA 3G8YA 2H7YA 1GKKA 1X2EA 2WILA 3H0CA 1XKLA 1J07A 2XMRA 3STWA 2ZJ6A 3T4UA 1QE3A 1L7AA 1CUFA 4HXFB 4OU4A 2HADA 3EQ9A 2R8BA 4HZGA 1MN6A 3JWEA 4FFWA 2ZJ7A 5CRIA 1JMYA 5CT8A 1AGYA 4L3WA 1MAHA 4Y9SA 1DX6A 4K6KA 4U2CA 2HRRA 1QIMA 2GBCA 2JGKA 1MO2A 1EDBA 1VZ2A 2HA5A 4IHAA 1XQVA 2AJ8A 2OCLA 5EIEA 2DSNA 1GPKA 1TCAA 4AMYA 3L1HA 2HA6A 5E2IA 3STXA 3IULA 3WQHA 2AJBA 3STTA 3I6ZA 6YASA 2DCMA 1P0PA 2V98A 4KE6A 5HCUA 4AZ0A 1IUOA 1LBSA 4KACA 5ESRA 4AO7A 5JIBA 3V9AA 1G5FA 2VEOA 2YXPX 3F9CA 4Q82A 2XQIA 2IIVA 1EHYA 1E5TA 4Y2UA 2YH2A 3DCNA 4FLMA 1MU0A 3WL5A 3WKAA 3DS8A 3G7NA 5ALIA 4Y2VA 1RP1A 3W9BA 1QIJA 4PQEA 2WG2A 1ACLA 4X90A 2XUJA 5JASA 3FBWA 3BF8A 5ISMA 5AOCA 4PF1A 2DFPA 2WHQA 3H04A 3AJAA 1LZLA 1GPLA 1F6WA 2CZQA 5LKRA 2HHAA 1EK2A 2XMBA 3FYTA 4YASA 1TK3A 3MUOA 2OGTA 1E8DA 4UFNA 1T4MA 4MWSA 3MGAA 2J3DA 4Y2JA 4P9NA 5ALMA 1MX9A 1UK6A 5EHXA 3FCYA 2CUTA 1CV2A 2GYWA 4EA6A 5I7UA 4X91A 3D4LA 3W05A 1BROA 1LPAB 1AURA 1CUWA 4N8DA 1XRMA 2H7CA 4AO8A 4N5IX 1DWQA 4FNMA 2QUBA 2BKLA 2QM0A 1K8QA 1UKAA 3UUEA 5K3FA 1HQDA 4QWMA 4C4YA 1ZIYA 5JAHA 4W1RA 3C6BA 4QDTA 5ALPA 3R3YA 3GFFA 4H7FA 4H0CA 4C88A 2G5PA 2C7BA 4EY6A 3HEAA 5CT5A 2XI4A 1TAHA 1E89A 5HF8A 3PF8A 4QZVA 1NU6A 4GEGA 3FVRA 1F0NA 2H1IA 3AZPA 5AKKA 3MVEA 3GZJA 1WHSA 5FV4A 2B9VA 4J03A 4UBLA 1XZAA 3BDIA 3TRDA 3H2KA 4OYLA 4RE5A 1EXWA 1SCIA 2OGZA 3H2IA 1VE6A 4E14A 4KRYA 5FPPA 5AM1A 3A70A 4XX1A 1U4NA 1OXMA 1UOQA 4C01A 4BAZA 5C81A 3D7RA 5ALFA 2BGRA 4EY5A 4DNOA 3O4HA 4UPDA 1QJ4A 1JI3A 4J3JA 1OILA 4G8BA 3GELA 4H7IA 3BDVA 4G9GA 3MUNA 3V1KA 3PDCA 1J06A 4FDMA 2WFLB 2QUAA 1ZIXA 1VXOA 1KU0A 3VDXA 3K9BA 3E1GA 3C5VA 3D5EA 5JATA 4EY4A 1R9MA 2BFNA 3O0DA 4JH0A 3KWFA 5IKXA 3D59A 1UKCA 3H2HA 4Z49A 2VATA 2PU5A 1ZD5A 3YASA 2WIGA 1XLUA 2C5FA 5AM0A 5JZSA 1GQRA 5CH5A 1ZI6A 5JADA 4BTLA 2I78A 1LPPA 5F4ZA 4EBBA 1ZD2P 1S8OA 2J4CA 2X76A 3BL8A 1HKHA 2CJPA 4H7KA 1XZLA 3SC2A 1YASA 3RKSA 3U0VA 1XFDA 4KAFA 1SCKA 1HDEA 1Y37A 5EHNA 1QIKA 2HRQA 4GHWA 2G63A 4FKBA 2RHTA 1CEXA 1QZ3A 4X00A 3FYUB 2W6CX 2RGUA 5A6VA 2JF0A 1BCSA 1D07A 5D7BA 1VXRA 4AO6A 3DDUA 4B6GA 4EY8A 3FLBA 3IVMA 1QONA 2BCEA 3AIKA 3PICA 4QE3A 3VJKA 1EH5A 5T4EA 2EDAA 5CTAA 1WPXA 1MTZA 4P93A 4Y2RA 1ZI8A 3QPAA 2O7VA 2PSFA 3OC0A 3QMVA 1G66A 2ORYA 4Y2TA 1CUEA 2QZPA 1QIIA 5AKZA 1XZCA 4CIAA 4LYEA 1AKNA 4OB7A 1FSSA 5AHXA 2WJ6A 3IBTA 3QBJA 5A62A 2HA0A 2R11A 4FOLA 4FBMA 3WKCA 2VQ6A 3WK9A 2HA2A 5AK6A 1WHTA 1XKTA 1KU6A 5HK8A 5JD5A 4D9JA 5D6OA 4DYHA 4QA9A 1E3QA 3UMJA 4AXBA 4G8DA 1CQWA 4GI1A 3O4JA 5AKLA 2XQKA 3LS2A 3IB3A 1JU4A 1CR6A 3PUHA 4DNPA 3C8HA 5AI0A 1CRLA 3HLKA 1YCDA 4HTAA 1DQYA 4BZWA 3R41A 4GW3A 4BDSA 2FJ0A 4PO3X 4U2GA 2RI6A 3AINA 2WIFA 1J1IA 4IH9A 4QDZA 4FBLA 2HU7A 2JEZA 4ITVA 5I9IA 1GKLA 3ZLVA 1QIHA 3F98A 3W2TA 3WA7A 2WFZA 2V9ZA 3WWOA 1J2EA 3PUIA 4LKOA 4B9AA 2VJAA 4HAIA 3TEJA 1IZ7A 5J3JA 1ODSA 2QJRA 3IIIA 3WA6A 4MEAA 2QR5A 3STYA 3ESCA 1LZKA 3F8SA 4U2BA 3U1TA 3D2AA 1YB7A 4W1QA 3LLCA 5LZ8A 4BAUA 1F8UA 3HABA 2QJWA 2JGLA 1QO7A 4Y7DA 1JJFA 2Z5GA 4LYDA 3W9UA 3C43A 1CLEA 1YAJA 3HZOA 2AJDA 5ALZA 1JKMA 4UFOA 2JGEA 4OSEA 2OXEA 2P8SA 3K6KA 5IVDA 3EQ7A 1EDDA 4WFJA 1IZ8A 4ZGBA 2Q0XA 3B12A 3KXPA 1JMKC 2QMQA 1ZOIA 4G1FA 1IUNA 1CUXA 3FLAA 1JJIA 3C87A 3QYJA 4LXGA 4P92A 5HF9A 3S8YA 5ALWA 5ALGA 1QIDA 2WUGA 1Y7IA 3BF7A 3GBSA 4GDMA 5EFZA 2WUFA 4LIPD 1UFOA 1N5MA 4IQ4A 4X71A 1SC9A 1L7RA 1RYYA 3I2IA 2QXUA 1QIGA 1W76A 3EBLA 2QVBA 1Y7HA 2PUJA 3A2NA 5HQ3B 2OAEA 5KREA 1A8QA 5ALQA 3X3HA 5DYYA 3CXUA 4BTVA 4MJ3A 4WDRA 1CUSA 4QEKA 4BYMA 4J0KA 1L7QA 1WM1A 4KE8A 1P0IA 5JYCA 3WK5A 5HZGA 1IMJA 4BC0A 3WJ2A 1A8SA 4G5XA 2CKMA 3D0KA 2WTNA 2YASA 1VA5A 5HFAA 3WK4A 5CW2A 5ALVA 1ZD3A 1CUIA 1PJAA 4N5HX 1QIEA 4ARBA 2J4FA 3VXKA 1XZKA 2HA4A 2Y6VA 4I4CA 1GT6A 4UHHA 3G9XA 1DX4A 4UBIA 4O08A 1XLVA 4F21A 1AX9A 1UZAA 1MX5A 2VF2A 4QDOA 2XUPA 4QDUA 3WZMA 5C8VA 1VOTA 3HI4A 3IUQA 3SWWA 3G0DA 1TKRA 4B84A 4B80A 4EB0A 2XMDA 4UBJA 1CFJA 4ETWA 5AJHA 1MT3A 4JEIA 2E3JA 3WL7A 2OG1A 4JYMA 5CT4A 1SCQA 3G9UA 1ODCA 1Z68A 5LYYA 4QDXA 3C6XA 4UBOA 4PV7A 3HSSA 2XT0A 4J0GA 1XQXA 1A8UA 4DM7A 4A16A 3H18A 3JYHA 2DR0A 2PU7A 2HU5A 4BP8A 3IA2A 2EDCA 1QO9A 3VISA 2ACKA 2V97A
chains in the Genus database with same CATH superfamily
1VJ0A 3PEYA 3HU1A 5T6MA 2WICA 3QZUA 1RM0A 1WZEA 4FHZA 4J1TA 4MI9A 3L0OA 2JIPA 3K0KA 4B4DA 1EUZA 3HBJA 2QG6A 3X2SA 2JGMA 1USIA 1KYIA 1Z3IX 3HCRA 4PO1A 3S2YA 4Y6QA 1OV4A 2E0IA 4AY3A 2FUKA 5BW4A 4L9AA 2W6QA 3C3EA 3DVLA 3K9GA 3AHFA 4RKFA 3ESDA 5EZYA 4C5BA 1MJNA 5HFJA 1JFFB 3UT0A 4OAQA 5CH8A 1SGWA 1X7DA 5E8JA 1HDIA 3RNOA 3H9JA 1Q74A 3HCOA 3R3XA 3TK1A 5K99A 5U4XA 2ZZMA 5D5PA 5IN4A 4S04A 3T9EA 3QBVA 1G5RA 1B43A 3VZDA 3IPCA 2FPKA 1YBAA 1ZK1A 1G6OA 4ZOBA 1Q1GA 2BCJQ 3KSUA 3QUCA 1OQAA 4ILEA 5EZYB 2MCFA 3T54A 2D0IA 1VCIA 2Z2XA 3U4QB 1IVSA 4F38A 1MVLA 1SHJA 6GPBA 4JXXA 4KQMA 4KR2A 4GM0A 1MO4A 2BUCA 3IV7A 4MVCA 3KKNA 4FDAA 2G9NA 3ZHCA 2Z57A 4I5FA 1Z4LA 1FP1D 4YJ3A 2VXCA 3DW3X 3KPJA 5JW6A 2ST1A 3FHJA 5DE3A 2WDPA 4JT4A 4IIDA 1SG0A 3CCBA 3B2NA 4OG2A 3RE1A 5BUQA 1HI9A 1LPSA 4UHDA 4EY7A 3EPHA 3CLHA 3PNYA 3UK1A 821PA 1QNLA 1EMDA 2I3ZA 3HJRA 1SXJC 3TGPA 4BP3A 4YAWA 3E9YA 3KT3A 3HY3A 2WUVA 4TTSA 3NTVA 4A26A 5IMSA 3CSSA 1YCGA 5AK5A 4MP6A 1JPUA 4OO3A 1NKTA 2A94A 3Q2IA 4YK7A 4OREX 3W5IA 3Q8WA 5JD4A 2O2IA 2ZWMA 1VIDA 2CLDX 3MMPA 3VC3A 1YK1A 4ICIA 3UW3A 1TYDE 3HWRA 3M82A 1S2NA 1YB1A 2AUTA 3C70A 3GCWA 3ORYA 5DP2A 4A8TA 4E1AA 3TOVA 1X19A 3K5IA 2X5JO 1PZNA 5BWLA 3TECE 3Q11A 2X41A 1GN8A 3ONWA 1UMBA 2VJCA 1E1NA 2ODWA 3GC6A 4X1IB 4LEIA 2JDID 3MB5A 2Q5OA 3WLEA 1DU4A 1YI1A 1YZLA 2CLEB 3MERA 4A0SA 4MYDA 3HUTA 2HT1A 4Z4EA 4WXMA 4KDCA 3KOOA 5C8DA 1QR6A 2IYSA 4GQBA 4OJYA 4DPKA 4RNCA 1M2OB 1IAQA 1XVLA 3TIIA 3TW4A 1BYUA 1C7IA 1EI9A 1SVSA 2CJXA 2O1XA 2QW1A 2WSYB 2P2NA 3PHHA 4GKBA 4KMMA 5E4JA 4AUNA 5HUHA 1G5IA 2G9UA 1OTYA 2C2YA 3JYNA 1CR4A 2JA1A 5LDGA 2JHGA 2Z1MA 2O5VA 1QQ6A 1B2RA 1G3MA 4HWTA 2ZSUA 4RJKA 4AKSA 4DN6A 4EF6A 4BRSA 1QORA 1CJTC 1XNJA 2XJ4A 3ESAA 3PX7A 1F0KA 2D2XA 2AFHE 2VH2A 3BJRA 4B6SA 1VLVA 3OHPA 2EZUA 2LZ0A 4DQDA 4BJ3A 3ED1A 5B6PA 2W11A 4PZDA 3RAJA 2G7MC 3HVIA 4EZBA 3DC7A 5KNBD 4YP5A 2YYZA 3QE0A 3FF4A 3UMBA 3FBGA 2VPQA 1WDMA 3ZCTA 3ZWVA 3QFSA 3E5MA 3I28A 1PR4A 2EP7A 5FPQA 1Z5GA 3MWEB 3BGDA 5B7GA 3KPVA 4G9EA 3R76A 1BN7A 2C31A 1H23A 3UOWA 4D9JA 3K9CA 4R68A 4NFSA 2R5FA 3DJFA 1JSCA 4KITB 1Z0ZA 4YAJA 2QP9X 3ECSA 4UMFA 2WWWA 3HO6A 3QG5A 4BVJA 2RHWA 3GI1A 2CXTA 2KLHA 5E7IA 1MX1A 1I2DA 3PBKA 4TV9F 2BGJA 4CFYA 1OH8A 3JAMA 1Y1QA 2IXFA 3BTSA 2WEKA 4FOSA 3ZEIA 1LPMA 2G09A 1QP7A 4PX3A 3AY6A 2WG0A 1E66A 1G8YA 2WE8A 3JQ7B 3BXPA 4I8IA 4B4KA 1F0YA 2ID4A 1JB1A 2Q2QA 1Q1AA 3TGLA 2V7QA 5GMOA 2P41A 5C3MA 3OOJA 4IQFA 4GECA 3TAXA 1XL0A 5JPIA 4BNXA 4NOLA 4TLBA 4AMBA 2ZYRA 1PNRA 3PXEA 1U8CB 1MB0A 2YTZA 4YC7A 3SMVA 1M8GA 4MVJH 3L02A 2OZLB 1EUCA 5FFNA 4M8LA 1MENA 4MVJP 4CM8B 3AHCA 4JUCA 1X7ZB 1UM9B 2H2AA 4CVNA 2WJGA 3CN7A 2OECA 4G07A 3W2GA 1G3QA 1CUCA 2ANBA 3KPYA 4AZ3A 4EAQA 1U9IA 3DULA 4HDMB 2O2JA 3WMEA 5HQJA 2BHSA 2OQIA 3EGCA 1V1MB 3B6ZA 3E0QA 3G0OA 2NPOA 3P2OA 3ZTYA 2OR3A 1QFXA 3LQRA 4MVWA 2VHYA 1V4BA 4TKUA 3D8SA 1VB3A 1NPYA 3DOIA 5DHUA 1WXEA 1D6JA 3HJFA 1YDFA 4UM5A 3E3NA 3MJSA 4NQRA 4B3HA 3IR7A 4OQXA 4M0PA 1P61B 1FLAA 3AWDA 4JLDA 3OX2A 5AHKA 4AYWA 1FVFA 5IUNC 3LKDA 4M76B 3EXFA 3IQDB 3MTEA 4TZTA 3K0SA 4Y1RA 5FKJA 1U7OA 2QI9C 5EQJB 1P1CA 1Q91A 1ZA1A 3M5PA 4V0QA 1GUAA 1VSQA 4YRAA 1GG9A 4E5SA 1SRQA 1B76A 1JW9B 2PMCA 2Q4TA 3EXEA 2JAWA 2XVAA 2N0SA 4GMGA 4H9GA 4PSAA 4PPNA 4LDJA 3EZLA 4IIJF 4L4YA 1T2NA 1UADA 5KNDA 3DBOB 4IH4A 4JB0A 1Q0LA 3VR0A 4U39A 1CQJA 1UT6A 2ZZKA 2P4QA 3ESQA 1QGUB 3GA0A 1Z5ZA 1U65A 1KFKB 2C4UA 5DNVA 1QGED 3GAZA 5ECDA 5B3LA 5I51A 3F5QA 3QE2A 4V1CI 3F5FA 1AUOA 4XQ0A 1I6WA 1VE7A 2KI5A 3R5KA 5L4SA 4P32A 1U7ZA 3CZ5A 3N2NA 3DE6X 1FW6A 2JKYA 4RK1A 1MV8A 1WMAA 1I36A 5DT9A 4XVHA 1Y1PA 3SZRA 4B6FA 1LRLA 3L9WA 1WOMA 4IS2A 4GC5A 1PLKA 2F1HA 3L7MA 4G67A 4B5LA 4HDKB 3VHXA 4X54A 3WI7A 3EVFA 3TTUA 1O58A 2C4VA 2OCGA 3PU6A 2VSXA 2JBAB 1BOFA 5F33A 1Y8RB 3EQ6A 5TVGA 1E3TA 2W2LA 5L9AA 3PQCA 1DINA 3FSGD 4UEQA 1RRFA 1XJCA 3M34A 4AICA 4P7BA 5B3KA 4RK5A 5EJFA 3I39X 5AW4A 1IY2A 1CKEA 3SJAA 2WYOA 2ZS8A 1V1JA 2CDRA 3LCRA 3NUZA 3CRVA 3LRTA 4R8LA 4N3BA 5KJ6A 1XN4A 2IU6A 2ZI3A 3A3KA 2GHQA 4OHCA 3SS8A 2FMTA 4W4TA 1CVLA 4AY4A 1JSRA 3KAKA 4FBGA 5DW3A 1NM5C 1HYQA 1U90A 2VPZA 2R60A 5T57A 5TSDA 3TOCA 4L4ZA 5FUMA 5EYPA 2ZAGA 4G26A 2ZSBA 1S9HA 1I94B 4RY0A 4HZUA 1LY1A 2ZE7A 3D6NB 4JGBA 1CUYA 4YDRA 3MPUA 3AVYA 2OLJA 1JKXA 4LTDA 2HQRA 5COAA 1CUVA 2FPSA 3W8EA 2V96A 4U7PB 4ADSG 4ES6A 5BSUA 3N2LA 3OO1A 5IP5A 1L7XA 4BNYA 3OT1B 3ZC3A 3GN1A 3VAZA 1AUVA 5AKHA 1MC5A 2I80A 2JI7A 2G36A 2HO5A 2PGIA 4PAGA 5CM8B 3G79A 2XLBA 4B3SB 2Q6TA 5A9SA 3MMSA 3PDUA 4JX8A 3HWX1 2RHOA 4I5GA 2ZUWA 5HIMA 5C0OE 5JNLA 1NVFA 2H08A 3OJOA 5DCLA 3B3JA 1J0DA 1EVLA 1V48A 4PSDA 5J63A 3I9NA 3KC2A 1RYBA 1V6AA 3K0HA 3OD5A 1LJUA 1I7QB 4G0NA 4PZCA 1KO1A 3F7NA 4ENUA 3AIIA 1UWKA 1Z5PA 2MR6A 1GL7A 2YV2A 1ZK4A 3LDFA 4DIEA 3PUJA 2C95A 4M3NA 4IWXA 4CF5A 1RYZA 2HFJA 3NXSA 1KZGB 3H6KA 4HUTA 3THWA 1CS0A 1HDOA 1TKCA 2GBIA 3KL2A 5C4IA 5K01A 3HJBA 4NFHA 4YRFA 4BL5A 3EGXA 4C5AA 5KDOA 3ZGLA 5F5XA 1XTBA 2P69A 1RAGA 5HE8A 1JTFA 4QVGA 4MDFA 1MQSA 1XVVA 1PLJA 4L75A 2WYUA 3KJZA 4RJJA 4ZDJA 2DR2A 1QRAA 4LNAA 5DYTA 4R54A 1K6MA 1QQ7A 2JGFA 3QKSA 1SCUB 4W5JA 3ZCVA 1X77A 3CZCA 5FWAA 3E1SA 4PXSA 2J1LA 2ASEA 1ONOA 3FNRA 3FVTA 4NOKA 3KVVA 4MCJA 3NASA 5AHOA 1JKJB 1HM5A 2ZAYA 4L8VA 4Q00A 2ILVA 2VJLA 1T0IA 3RAFC 3KZVA 3B1FA 1OI2A 3AEXA 1TVKB 4KN6A 3ZH9B 1ETUA 4TKVB 1N6KA 3OJ0A 1HE4A 3BJEA 4HBZA 4KIUA 3LPNA 4DIOA 2IJGX 4RA9A 1Q2XA 1GYQA 4PYQA 3UV3A 5FV7A 3WYDA 2A3RA 4W7HA 1YVEI 3SLRA 1S8NA 1DZIA 2XKAA 3N0TA 3I72A 3ORSA 1V4NA 2EX0A 3VOTA 2VVTA 2Q5JA 2XYRA 4EHNA 2CXQA 2RH5A 3HDVA 3LPAA 5KOIA 1BKYA 3OU6A 3M83A 1U3FA 4UVHA 2W37A 4BMDA 3HUDA 3M3DA 4WLNA 1LV7A 4RFSA 3NBUA 4ZTBA 1UXJA 3ENZA 1T8TA 1QHFA 2GKSA 4J0CA 4K2AA 4WRRA 3TEFA 3WMRA 1CEYA 2CV1A 1REQB 2P7IA 4H15A 1UFQA 3H4MA 2DFNA 2HPZA 1LFAA 1ZGJA 2JEYA 3UJ6A 2HF2A 2WVJA 3UJAA 2BKEA 3C48A 1Y6QA 5CP8A 1VJ5A 4WW0A 4HLUC 2Z4SA 1UBNA 2BJWA 4FEAA 1O95D 2G25A 1U1FA 4L74A 4JA2A 4UTXA 2GASA 1KEWA 2BTOA 4ML3A 1NPDA 3BWMA 1JXQA 2V7WA 5DNYB 1GGNA 4Q1EA 4QO8A 4BKQA 1L0BA 1HNXB 1HX7A 4BZXA 3CX8A 4O63O 2W2TA 4LOIA 1LDBA 2XPCA 5DX1A 2DBRA 2QRNA 2H7XA 2Y1LA 5KSOA 3IP1A 3RYFB 5GZ1A 4F71A 3MS4A 4OHUA 1JIIA 4ZU3A 3H2GA 3VSBA 2JLWA 1I1NA 1LK5A 2EJCA 1K2WA 1CP2A 1ISHA 3Q41A 4FDUA 1YZVA 1OX4B 5C8XA 4OQYA 4W6ZA 1W87A 2R8EA 3AUKA 3K05A 3L04A 4JCCA 4LK2A 4M1KA 1C3OA 1RM3A 4ODIA 2AG6A 3LO5A 4KNWA 5T67A 3O3OB 4JVSB 5FOSA 5T8KA 1GEEA 2Q27A 4GX0A 2O2XA 5GVSA 2PVCA 3BC1A 3PV0A 4YONB 5HCIA 3NAQA 4NENB 2XOEA 4TQ9A 5HX7A 3QWIA 2H0RA 4KKXB 3M5CA 3MTAA 3MT9A 4FLEA 2ZVQX 1G4HA 3IXQA 2BR4A 3BBLA 3B1WA 1ZSYA 3Q5DA 5D01A 1OBVA 3FYDA 5B55A 4AI6A 1GRRA 4OQDA 3GLFB 5FWYA 4MYHA 2EKBA 1WCIB 2CSUA 1EFLA 2V8OA 1FRVA 3PLRA 1YOVA 2G88A 3QLUC 4MR7B 2OXIA 1HE3A 1Z45A 2NZUG 5TARA 3B1KA 2VUUA 1G291 4TV9B 1EGQA 1PEDA 2FG5A 3VFDA 3PRJA 4IIXA 3PJDA 4OHPA 2I67A 1ZM2A 1DFGA 3KLBA 4DEYA 1L5KA 1AZTA 2M6LA 3VH3A 2WSSA 4GBMA 3GCXA 3QV2A 3JALB 4JP5A 4WN9A 5ETJA 3SQLA 4EG6A 1NQ5A 4BY9E 1V41E 2NVOA 1UQTA 1XU7A 3I6MA 2FZEA 3HVKA 3JQEA 3GOQA 4IGEA 2AXPA 3ZE6A 3RLFA 3B70A 1R6VA 5EP1A 1KDPA 1K7CA 1TK2A 3JR7A 4GI3A 3IP6A 1JFTA 3FRHA 2XHZA 3RYIB 4CKEB 4PRKA 5J2UA 2X1HA 4X1YB 2C4WA 2OD9A 1OCEA 3KVYA 4JDPA 4X64B 2A9QA 3KLPX 5EJEA 1NOKA 3KYDB 2Q5IA 4PXYA 1UIMA 4J7UA 3ZBQA 3THOA 3SBXA 2I8CA 1QHHB 4IJ5A 1H0KA 3GGCA 3PUVA 1U5BA 3QJYA 1CB0A 4TL7A 4WNIA 2Z2IA 3ZXIA 4A1OA 3U62A 1Y7TA 4C87A 1F4PA 1G8MA 3OFKA 1TOAA 1TA4A 3C7AA 1W19A 3WTBA 2XA1A 3QV1A 3NHZA 4IZHA 5IC4A 4HY3A 2YKGA 1M2WA 1G41A 3GBVA 4FNGA 1WCXA 2VL7A 1PK9A 2OTCA 4Z9YA 3SLKA 5JRZA 5FBQB 5AI8A 5JYDA 3N8KA 2QN6A 5DI3B 5L7TA 1EA7A 1K89A 5FNZA 4EFMA 1RCTE 4EF4A 3P9XA 3MGBA 4FT2A 1TNDA 1ZI9A 3HYSA 1KMNA 1MJ5A 3HHPA 1PD1A 5EIFA 2Q1UA 1TAGA 1RJGA 2P4SA 3H75A 1ZGCA 3FJYA 3MEQA 3C7DB 1DBPA 3V6LA 2JFQA 3G0CA 1ATZA 1IOWA 4GX5A 4IV5A 1SHKA 4BB5A 3BTOA 1UT5A 3CO5A 4OJTA 3FCXA 1N5RA 5ALNA 5FWDA 1JDSA 1HZZA 3H2JA 2JDIA 3CT6A 3S0JA 2LXNA 4PTLA 4HN9A 3FBTA 2ACWA 5EMHA 4OQMA 1P75A 3BORA 4LOJA 4N3CA 2IHBA 4ZRNA 4B3DA 4BATA 5JFOA 3C6ZA 2PZMA 3KDAA 4XAQA 4ZZ2A 2ZM6B 3PGKA 1D0SA 1MJHA 3QVLA 5LKAA 4LF7B 5CVEA 4DCJA 1MO5A 3AF3A 3HBMA 4LYYA 4QYSA 3CC8A 4UU0A 3ZD9A 2LBPA 1NMEA 2CXNA 3PL5A 4WY8A 3TKYA 5AP9A 1C9NA 1LFDB 1SUBA 1VJCA 4KO3S 1Y4DE 1TCBA 5E6SB 3RRNA 2P6OA 2GESA 1NR7A 2W71A 3GGJA 3NNNA 4FE7A 4MVYA 2IDZA 3M9LA 2GYYA 1KDVA 1M76A 3E8XA 3FCEA 1K3FA 3PNKA 4ROTA 4WIAA 3W2IA 1L5NA 1IWPB 4FSDA 2DTDA 3O8CA 1N9KA 2JCXA 2E9SA 2M9MA 5KNBA 1OGIA 3KSAC 2IBSA 2HCBA 1PT6A 1XG5A 1GCUA 4KQWA 2R7NA 1YJQA 4HXEB 1ZN7A 4Q34A 5CB4F 1Z75A 3FNHA 3IQEA 1OFTA 3H5OA 5DTEA 4LVUA 3IQFA 4L8YA 1ECCA 2DP4E 2HMSA 3EIHA 4NJMA 2NPFA 1RQRA 4MLCA 2DQSA 3VYUB 5KYNA 4PHHA 4A8PA 4RMNA 2P5UA 3PDIA 1VDMA 1YE3A 3L6BA 3WO1A 1N2ZA 3S8EA 1T6XA 3B85A 3CW9A 3GFOA 1FQWA 4NCNA 4DG9A 1A1VA 2QTZA 4Q6BA 3PPVA 2O8EB 5BV1A 1UPBA 3NM6B 1IHUA 3OZDA 4A27A 5AVUA 3E9RA 2BFCB 4XYBA 3KQMA 1XTJA 4A10A 5E3HA 3NRJA 4WXRA 4DAOA 4KTTE 4DMHA 5FV4A 3MWDB 2ZU6A 1BGVA 3LA6A 3NG1A 1SUWA 2H6EA 2JFZA 3EIOA 3L77A 3UY4A 1H9CA 3TH5A 3ORHA 1JLHA 3W4JA 5JJLA 1TQ4A 2Q50A 3ANNA 4TVKA 5ELMA 2PS9A 5I4KA 1KY2A 4FDVA 2B3TA 1A96A 3EC7A 2XMCA 3TZQA 2XUHA 3V9PA 1ISGA 1KEZA 3ZGOA 4LKRA 3QEJA 1NWCA 1V25A 5C1IA 2HFKA 1M6VA 1A1SA 1A95A 1Y5LA 3C7TA 3EFBA 3JD3A 3QVWA 4H27A 4L5IA 4D80A 3FPEA 1O87A 1ZJJA 2JK0A 4K6CA 2JH8A 2CC2A 2DPMA 4F2GA 1WUJS 2IITA 2YIVX 2MYTA 4WN3A 2AEFA 2Z08A 3P4UA 2P6MA 2WT8A 5HPYB 1GG2A 5AIBA 3O3CA 4LHEA 3TIXB 3BG5A 1XZMA 1QGAA 2YOGA 1VMIA 4IR7A 5ADHA 3C7CB 2Y1DA 1B1CA 3GAFA 2F43B 4K1XA 5FHQA 2O2HA 5DNWA 1VHJA 2GPNA 4KWHA 4R0NA 2GXSA 4CU2A 1K0FA 1Z0IA 2DF8A 4QUEA 4RJ2A 4U8GA 2QNIA 2XUDA 4HGPA 1E0DA 3TD2A 4PQGA 5AKXA 2F1RA 1SD1A 1TEHA 4LBWA 3ROZA 4V1CB 1G98A 3A7DA 1YAHA 4E32A 3A1NA 4LTNA 4OQQA 3PXGA 3NQ41 3GVIA 4CKCA 2P6RA 1A9PA 4H7HA 2C4TA 4OHKA 3N0RA 4MS4A 4Z7JA 5FUXA 3A31A 2D13A 3HYRA 4PG5A 4UARA 2AW3A 3D6TB 3CTMA 1A69A 1GN9A 1YCHA 4LI0A 1Q0QA 3I3OA 4M1EA 5ED4A 2YXNA 3ETNA 5E6UB 3RS0A 3WBKA 1I5OA 1YIAA 5FDFA 1AJEA 3DYVA 4XJVA 2O59A 1V5WA 5DGXA 5HNKA 4GZMA 4BMPB 1G16A 3EXHA 5JAOA 1BKSB 2Q2VA 2H4WA 1UBRS 5K3SA 3R6DA 1HO3A 3CLTD 2BMVA 4OHOA 3VBEA 1PZMA 4BCDA 3HB4X 2PRIA 4XR9A 3GJ3A 1P3Y1 4M7OA 2H2WA 4OGWA 4HEJA 4Q24A 2C5SA 3CRNA 3IAUA 3JQ7A 5FBWB 4M1OA 3W3AH 2YZMA 2PBLA 2GJSA 3HUUA 3PXAA 3Q9UA 3QE4A 3DGEC 1UBCA 4MRMB 1KK1A 2XMQA 3NFRA 4ZV9A 4I81A 4NCAA 4RKWA 3FNGA 1RRMA 4L28A 1TEXA 5A3SA 5EIBD 1YR7A 3K0FA 2FN4A 3FPCA 1FFXA 1P1BA 2VHQA 4M0UA 4J49A 4EGJA 3Q1LA 5F2NA 4KBYA 3HKEB 1PR3A 4A8HA 3QEMB 2SKDA 3RRZA 3TTYA 5LSAA 4MXDA 3QTTA 4GEKA 2CHGA 4YECA 1U7DA 4HB3A 1XEXA 4XWKA 1WB4A 5L4NA 3L8CA 3NUQA 5KYTA 1H1TA 4UVIA 3BK1A 3M81A 3WLHA 5A1JA 4JDUA 1W5BA 3CUKA 2WIJA 2VHEA 3OTQA 3KJHA 2ZSFA 1PFQA 2XGMA 2YJ6A 4KU4A 1OD6A 4LZAA 4RK0A 2H1SA 1IK4A 3FUTA 2ADFA 3NBXX 5FL7A 5CBKA 1I10A 2FN9A 1RJ9A 3F7TA 1MEJA 1R0LA 3FYUA 1PBNA 4IDFA 3H16A 5JBNA 3II6X 1FFBA 4G09A 4GRAA 1R6UA 2NO4A 2PBFA 3IKJA 3NIGB 2PANA 4CZ2A 1U0RA 1Q84A 1Z7WA 3IUMA 4Y0VA 4MKXA 1OAKA 1SUIA 2FPIB 2Y92A 1V3QE 1Q1ZA 3NYWA 3THRA 1EIWA 4C7KA 3CUUA 4X63A 5F78A 1U5AA 4LHZA 3BMXA 4RVSA 1BH2A 1CCWA 3V48A 2VHXA 2AYXA 1WXQA 1ZESA 1Y9AA 2WT4A 2OZVA 2ZB7A 4FGZA 4MB6A 5FF9A 5T8KC 4PGGA 3IL2A 2GVDC 4DMFA 1D0IA 1TQDA 2A0FA 2I3BA 3E82A 3K5WA 3L8ZA 3OZXA 3P71T 4O5AA 3GFRA 1OU0A 4DLBA 1PWYE 3U3XA 3SCZA 1T4CB 4LFBB 1EP9A 2BTEA 1H85A 2J5XA 2GN2A 5FPSA 1HA3A 2C8JA 3EXG2 2GO7A 1AF7A 3MMNA 3BIJA 2YIMA 4FXOA 2HB6A 4MAAA 4U3JB 4UXHA 5H68A 3ROQA 2OXFA 3CNBA 4NR0A 2ADOA 1J90A 5AIAA 1DTEA 2FPGA 5HEKA 5EAIA 4BO2A 3A2MA 3AJDA 3RK0A 4CKZA 4MKRA 1EVJA 4EW2A 2H4FA 1F06A 1P2SA 2OBFA 3HCWA 4R84A 2R0QC 1V7PC 4JYCA 1Y48E 1VPLA 3ZLUA 4F60A 2VDNB 2CE2X 3G8CA 4W9NA 1XMIA 1GQOA 5HKAA 1J4AA 2AXNA 4M0KA 1HL7A 4CTOA 3BGWA 4LZLA 1K3TA 4P08A 2FMHA 3QEOA 5F3DA 2WWXA 4ENTA 2NU6A 1GAWA 1P3DA 4DTCA 5CTJA 3IP5A 1FSFA 3L6RA 3MQFA 3F5DA 1B8PA 4M54A 5EFOA 3OESA 1B93A 1JG1A 4Q0MA 4CHGA 3W3AD 4PC3A 4CKWA 2BBWA 1VHLA 3G5UA 3HKDA 5KQGA 1WXHA 4BDTA 1OF1A 3RK4A 3NJRA 1OR8A 4IO1A 4FW9A 1GNLA 3GCZA 3OG9A 2ILTA 2R48A 3OTHA 3HCEA 2VP5A 1KDYA 1V3VA 2QLLA 1CWUA 2EKQA 4IJUA 3S29A 3V2GA 4DXDA 4UUQA 4IDNA 3NHBA 3E27A 5MFZA 1E2EA 3EE6A 4LBYA 2POCA 1X2BA 2JFBA 2HAEA 1UBUS 3F2VA 1KEVA 4E51A 1C3JA 2EF0A 1MXFA 1ZVMA 1Z6AA 3PFHA 4XSGA 3RYCB 5KNLA 4ND3A 1KA9H 4L16A 2H4JA 3UV6A 4QAQA 1BG6A 1HOTA 5ITWA 1H8HA 2CUNA 2J32A 2VDLB 4QHYA 5C1OA 2X0RA 1PR0A 3BB1A 3QU2A 4XR4A 4PO9A 3VR5D 4OXYA 3E53A 3WLQA 5IZCC 1PL8A 1EG7A 4AURA 4BUCA 1VG0B 1LK7A 2IYVA 3R77A 4HPWA 3TSAA 4BNNA 1JRLA 1G8FA 1GVHA 2F67A 4EGQA 4MP3A 2ZG6A 4AJ4A 4QYMA 3K8ZA 1S3SA 5HZHA 5UKDA 1TTHA 3LOPA 1P8JA 5C9ZA 2C7RA 2QK4A 3FYCA 5FO0A 3BMCB 5F77A 2B8TA 4OGFA 4JJ7A 3BE6A 2C92A 4XWOA 3PCRB 4TLCA 3OE1A 4YCJA 3DQZA 5ELLA 1CF2O 2DFVA 1Z06A 2FB9A 4DCGA 2ZEJA 1OH7A 3N58A 1GADO 1VHWA 3AR7A 3LFUA 1XRPA 4WESB 2PBRA 1ZK2A 3K70D 3AVUA 3ZZNA 1GGKA 2JGAA 3DKRA 3L7CA 1PG2A 1Q3KA 5DULA 2XDQA 3AK4A 4BNHA 3IOEA 5JZ9A 2VYVA 3NALA 1P7CA 3MJVA 3AILA 4G4SP 5REQA 3WICA 2LDXA 5H02A 1UEXC 3W3AA 2IHTA 4DC1A 1ML4A 1UJBA 2H8KA 2GNOA 4IIJB 4FFOA 2Z6VA 4I0WB 4U2DA 4F5YA 2VC2B 3KWMA 3EGIA 1DPFA 1KSGA 1SZCA 2CEKA 2UVPA 1H6BA 1CUHA 1USGA 1P0QA 2IC5A 3M6LA 2QRKA 4XKJA 1RKXA 5LFAA 2HYDA 3SR0A 4E22A 2FDRA 4IL5A 1AXGA 1ZSVA 5AW6A 1EHCA 2BR3A 4RK4A 3WP1B 3ZOKA 3IIJA 2DSTA 5H82A 3UV7A 4AUKA 2XRZA 3CE6A 3MQ4A 5CD9A 3EMVA 4YLEA 2ZSJA 3PX3A 4RD2A 2YN2A 1FSZA 3T7TA 1XF9A 1QOZA 2E21A 3IMFA 4F6LA 1O6ZA 4HGYA 5AW0A 1R4NA 3HYTA 2GZSA 4YHBA 1J20A 4C7XA 1SMKA 4TVSA 2GBPA 3GYBA 2E4VA 1CUBA 4GNKA 5EI5A 4DMCA 2FOLA 2O3QA 1T8RA 3C7KA 3GYGA 4F8JA 5CK5A 1MIHA 4ARZA 2JANA 3U7HB 3K1AB 1NP3A 1NFQA 1K1EA 4D9BA 2I3DA 1P4AA 1KP2A 1HRKA 2VRWA 1RZVA 1T0JB 2WJIA 2M6SA 3A6ZA 1QHIA 3DKKA 3JD1A 3QPVA 4FX5A 3UXYA 1ZG3A 1V5IA 2RBEA 4D0SA 4GPAA 4XTRA 4YRRA 5IASA 3UJ8A 4E5NA 1X1AA 1XQYA 2FFJA 5KAMA 1E9BA 4HD8A 4LJKA 5BVGB 1DC5A 2W0SA 4XGQA 3E7WA 3ZWQA 4BLSA 1GUFA 1ND6A 1BVYF 1ZNQO 2RSLA 3Q3VA 2IHJA 4M0DA 4D8WA 4WPGA 1SXIA 4CM7A 1BU8A 2ROQA 1LI5A 3FNIA 1FF9A 1BS2A 3C3WA 4L50A 3IMCA 1IHYA 2Y1XA 2F3TA 4HQ6A 4QASA 3S2ZA 3ZKWA 3BOSA 2JFOA 3MT8A 4LJRA 4BFVA 2WUEA 3B8EA 4PHCA 1QGOA 4ISBA 5GOTA 1LDGA 2VRNA 3AW8A 2YWHA 4JNCA 3X1ZA 3FJ1A 4Q01A 1RM5A 2ZLBA 3ZYZA 1DB3A 3EEQA 3P96A 3PPIA 1MF7A 1LTHR 1Z6XA 4YP7A 1YJ5A 1CZHA 1O6FA 2XV1A 2Z09A 3GUCA 3PT9A 4LY9A 5CLQA 5BSWA 7AT1A 3AVXA 2W70A 3EOBI 5FBZA 5ILOA 4RD3A 2FMIA 2R96A 1E2HA 2RAUA 2VNHA 1W85B 2GD0A 2X15A 1FY2A 3LGAA 2JFNA 4LY3A 4Q9JA 4BJ1A 4EF5A 8AT1A 3OLXA 2XKJE 3NO4A 2HMTA 4DV6B 3OT1A 1PQYA 4AMGA 1DXOA 1PGPA 2FW7A 3K6RA 3SHWA 2WJAA 1QAQA 2B8WA 2OQVA 3V8RA 3CH5A 4R2WA 3TQHA 1AU9A 2F00A 5EQFA 5AHWA 3N5KA 3W5VA 2Q4DA 2YXDA 5KQPA 3OZAA 1DBSA 2IT1A 1Z38A 4UHCA 3P4YA 2J3EA 4TOIA 5I8PA 3KYIB 2V9PA 2AVNA 1ULHA 1JEEA 2ZBUA 2BMAA 3QF7A 3ZWAA 3F7OA 1K98A 4KLCA 2ZIVB 4BMSA 1IXKA 1T1EA 3TRFA 4Q02A 3N2GB 5TX7A 2J9XB 2BT4A 1CTQA 2ZANA 4FIDA 4LXUA 4BQNA 1W9MA 5F7OA 2WAMA 3OX4A 5AR1A 2JCSA 5AVZA 5KNDD 4F5DA 1IWOA 4R9NA 3OWHA 5COQA 1FLVA 2N42A 3PGLA 4WNAB 3K30A 3REOA 3VGJA 3NGMA 3K16A 3OFVA 3X1MA 3RSLA 4H7DA 1X94A 4KZPA 4JI6B 4WXHA 2V7UA 5CLJA 4CMEA 1ZCJA 1JR3D 3O2NA 4LJ7A 1H6CA 3KOMA 5LWHA 2Y4OA 1LBQA 2I7VA 4X84A 3C3DA 5JAPA 3AZQA 4BO3A 3KR9A 1JJAA 4P38A 3GPDG 2JLCA 2VDWA 5FNVB 5CA1F 2GPBA 4N9WA 2B4AA 2IYLD 5HXAA 4A0RA 2ZJ0A 2IELA 1I4EB 3GNLA 4IO0A 2QTNA 5JY6A 2I8LA 3ZDAA 2IGBA 1S8AA 4PHGA 3QWFA 5AICA 1HOXA 2IYRA 3OPVA 1VMAA 2G08A 3FYUC 3ICWA 3MLEA 5EIBC 2W2LD 3TSZA 1IZYA 1X70A 2OBMA 3C3MA 3SVZA 3T99A 4D8VA 3GJTA 1GSHA 3KKEA 5THQA 4TX1A 2QYSA 3LXMA 5A9RA 1ABBA 2JZCA 3U49A 1L5ZA 4I3GA 1AA9A 1L5FA 4P3NA 3UGJA 1FFYA 2Y1KA 1ZICA 1X92A 2OV1A 4MUGA 3E0XA 4JBYA 2OHXA 2ZI6A 3IT1A 1TCCA 1SQGA 2B5VA 1X3LA 4D44A 3IEPA 4WDQA 4GE0A 5AKJA 1KQGA 1E3SA 1ODTC 1YHNA 4FOOA 4OJMX 4RVUA 3WY9A 5B1EA 4A82A 1SCNE 5KSWB 2BV3A 2PVPA 3CM0A 1Q50A 4OLAA 1OFUX 4PS1A 2XYVA 3R3WA 2FPXA 4QULA 1YBHA 4BBAA 4YRKA 4HR7A 3OPMA 5LIPA 2WWIA 4W5HA 4XD7D 4CKBA 4YRCA 4QHSA 5TQ0A 2YRFA 2VHCA 3JRWA 4M8SA 2NN3C 3RC9A 2ISCA 4YJDA 2RB4A 1GNQA 5C5IA 2J33A 4BO1A 3KQUA 1ZUHA 3SP1A 5JDCA 1XTSA 4A91A 2AFIE 2EKDA 3QQPA 2ZW9A 3ITDA 3F6PA 1F1BA 1R5OA 4LXYA 4UOEA 2VK8A 3PRKE 4C4OA 2FSPA 5JWOA 2VF5X 1JR3A 1NJSA 1NZFA 2EHJA 2NAFA 2QY9A 3NR2A 4ZZ1A 4I4TA 1NQVA 1J1UA 4YP6A 5F73A 3AB7A 2C5GA 1YQGA 1QMGA 4EPXA 1YSCA 2GEVA 4RIFA 4B2YA 4JOBA 4NCXA 3HJUA 4OFBA 3OWXA 3AETA 4DCCA 4OVKA 4GGMX 3O9VA 3WK6A 1FLDA 2IHYA 5HM6A 3BJZA 3U60B 3D3NA 2OD7A 2B5OA 3SSAA 1GFWA 2GBGA 1HLPA 4P3YA 2DT5A 4MRRA 4AJNA 5EHZA 1AMNA 3G9ZA 2BRUA 2VXBA 5JQGB 1NG9A 3IESA 1EGHA 1RLTA 2C29D 2HLDD 2WZQA 3UAGA 3FLMA 4HNUA 1N4AA 5EJ8A 3Q3GE 5D3QA 2YHIB 3UFXA 5CA1B 3ZVLA 2PMBA 4FYPA 3ZQJA 4D3SA 2CFOA 3DTVB 2OZPA 5HIKA 4CLRB 1XK7A 1ZA2A 1U0HC 1KR5A 2A86A 4P7JA 5CNMA 4BZPA 3JQFA 4XVCA 2AKYA 3Q3IA 1XQ9A 1G38A 4QTTB 5MHTA 2A0KA 4FFRA 2BEVB 5FIUA 2C9MA 4MQEA 1FFWA 1P81A 1SUFA 1W5FA 1Y9ZA 3LBAA 4I50B 3OM1A 3RS7A 2V7XA 4B79A 4DOMA 4F84A 3H9BA 2JKZA 1T2EA 1DIAA 2H2DA 3MZ0A 4QELA 4QYTA 7ABPA 3O74A 4OBEA 3LM8A 5J4KA 3LUHA 3QUTA 1NJ6A 1QM5A 2YFYA 4O1MA 1CHNA 2TRSB 4O5OA 5B5SA 5IFKA 4NECA 2CLLB 2A5DA 1PFGA 2PGAA 1YS7A 5E3IA 1IDN1 1K8XB 2PEYA 1ZS9A 4UE2A 1YVPA 5BVGA 5A7FA 3N8GA 2J67A 3IJEB 2UYGA 4HG2A 2VP4A 5DP1A 4ZIRB 1T0UA 4FILA 3LWNA 1XMQB 2EJTA 4XYGA 1KNXA 4UNQA 3F6EX 3L93A 4IBOA 3ZLTA 4FQ8A 3V4LA 1NMYA 4HDNB 1L5HA 4R2LA 1NX9A 1DTWA 1W9HA 2IP1A 2XUGA 3AY7A 1HEYA 1E3WB 3NS7A 3UJ7A 4IJKA 4JK3A 1UMBB 4CLRA 1TE2A 1U8YA 3L82B 1GZ5A 2ZYIA 1NW7A 1DI0A 2UZ3A 4POAA 1B3RA 4HS4A 5F21A 3MAAC 3L0CA 1XXLA 2B6NA 3CZPA 3INRA 3LX6A 3N05A 3PJGA 3VZSA 1LV8A 2MYUA 4BP9A 3T3OA 2EWWA 4IHKA 1QH1A 1ZIOA 2PUEA 9MHTA 3ML1A 4R1UA 2O2GA 4XOUA 1WSAA 1RAIA 3H1BA 3ZHZA 5CVTA 4QT0A 1BAPA 3DNMA 3HQ4O 3CPHA 3FCAA 3HVUA 1UBGA 1VBNA 1UC8A 3R09A 1ZP6A 3BAFA 2EJBA 5IWAB 5CFZA 3I01A 3SR3A 5ICMA 2NU8B 5LLDA 1TD9A 4X20B 4HDNA 1J2YA 3BXEA 2PTGA 3DD5A 4R51A 4Q3AA 3GQVA 2VCHA 4MGZR 3DLHA 1M6EX 3GLIE 4MGKR 2D0PB 1D0VA 1QPZA 3VKVA 4KBFA 2VJKA 4HRXA 4A2QA 2I0FA 3MJRA 2EFYA 3VM6A 4YT8A 1J5PA 4BQEA 5I9BA 2LR0A 1PG5A 4L8LA 2CL0X 4LJSA 3TNLA 1LXCA 1KVSA 1BWPA 2YOFA 4BPRA 3WLPA 1JJBA 3FTFA 3EGVA 1TVMA 1VGRA 3ZK9A 1S2GA 4EX7A 1EK1A 1Q7RA 1N2SA 2YCLA 1A0OA 2DHCA 4D8TA 3G68A 1ZXBA 2BFFA 2WKWA 1TYBE 4RZQA 2MT9A 2R9VA 2FU5C 4U5QA 4JVLA 4C0HA 4NEGA 4IDBA 1Z4QA 1OX6A 3PQ3A 2ZYGA 1Z22A 1ZUNB 4OP3A 3IBSA 4X3CA 1T13A 1TW2A 2LP4Y 4LV5B 3G8YA 3PITA 3TL3A 2D2IA 3QA3E 3V34A 4CR6A 1OXKB 2WILA 1N0VC 1SKUA 2FWBA 2AXQA 3F3MA 4B6EA 4ZCTA 2XMRA 3GT3A 1FFGA 3MIZA 4I66A 1EXNA 2BHRA 2R2AA 3ER6A 3T4UA 1NV8A 5CDFA 4B35A 1L7AA 2R8OA 4UTPA 4EHAA 1QMPA 5EG5A 4YQYA 2NSDA 2Z2KA 4OU4A 3ZW9A 4ENVA 3D1LA 4Y67A 2G40A 3EQ9A 2WYHA 2OSVA 4JU8A 2J8ZA 4E5DA 3N74A 3IIKA 2B9EA 3N28A 4EABA 4ID3A 1YFZA 5BNTA 1V9CA 1GCOA 4TKZA 1N2GA 1DAMA 1LBHA 4B3MB 2XAUA 1PNQA 3T7AA 3I8XA 1RE0A 2P9ZA 2Q8QA 3QNUA 4PSKA 2QQ0A 2VYCA 1BMDA 3EUEA 4TM8A 3HKDB 4KQ2A 4B71A 2Z2JA 3LHKA 5BR8B 2WIAA 3IXMA 3T5AA 4QRDA 2RGRA 1C3VA 2R1VA 3JYOA 3BZWA 2UZIR 4ZOAA 4Y9SA 2DUUA 3PD0A 4MR8A 4UKDA 1GL3A 5I3CA 2OXRA 3B82A 1B4DA 4K6KA 3RYTC 3SSOA 5DBEX 3D6MA 1LWOA 2HRRA 1F1JA 4KL8S 4R31A 5IT0A 1UZLA 4OMDA 3RU7A 4EUHA 1AF4A 1YULA 4ABTA 2A8YA 1NBOA 1QIMA 1I13A 1VTKA 2IUFA 1J1ZA 2JGKA 1GGEA 2Q2OA 5DCUA 2ZREA 4HT3B 3QXHA 1G9TA 5GONA 1VZ2A 4MRPA 3I34X 1M2EA 1XCLA 2W48A 3FKJA 3V7NA 5DEIA 3DE7X 3N2KA 4I6EA 2AJ8A 2HC9A 4BUJA 4ESHA 2XQVA 2P7HA 3A3PA 4KDFA 3ZK8A 1SB8A 2BZSA 3EF0A 2A14A 1YF3A 3A1UA 5KI6A 4MITA 3ZOZA 2JW5A 1EU1A 5FOUA 4YBRA 2DSNA 2GVZC 3ZWNA 1EK5A 2YDYA 2CMDA 3LO8A 4JC5A 1TCAA 1OZHA 2X5NA 2K6GA 1UFRA 2G0AA 2HA6A 2V6BA 4D5EA 2QUZA 4IZOA 4C6TB 1KH2A 4R2HA 4OHRA 3IULA 5JNSA 1VKJA 4JZKA 1FP7A 2WNIA 1JBKA 2ZJ2A 4S05A 1H3NA 2D1SA 1OLXB 3A4TA 4BS9A 4ZD6A 1OA1A 3CISA 2V98A 3CH7A 5BW6B 3ZV5A 4G0QA 1Q7EA 1HFKA 1D7AA 1PL7A 3NHAA 4I9FA 4KE6A 4K9LA 4G5OA 4CKWB 1I1HA 2VJMA 2NP7A 2OKGA 4QJBA 4KACA 2IS2A 1SA0B 3LMKA 5JIBA 1F3LA 1R66A 2DM6A 3FCOA 4IYRA 2VEOA 2JAOA 4DXAA 1ESDA 121PA 1UODA 2CLSA 4Z4GA 3TIFA 1M9NA 2IIVA 2HHJA 3GFPA 1SIUA 4ND2A 3V55A 4WADA 4FR2A 1DJPA 1USKA 3T7SA 4BFLA 4MJXA 4TTIA 2ZT5A 2Y68A 2CF5A 3NAGA 4MW6A 1JIKA 4RYDA 4R1SA 3RVPA 5A5DA 1ZHHA 3DCNA 4PAMA 1Z2DA 3A7EA 4J0EA 1T3GA 4OFZA 1C1HA 4QL3A 3DMHA 4RIHA 3RJ9A 4IMIB 3RO7A 5ALIA 1ZKDA 4TWIA 4YALA 4F97A 4XCQA 3W9BA 2BFEB 3ONVA 1GARA 1KFCB 4FHCA 4YQFA 1EVIA 1T6YA 4PQEA 1OT3A 1ACLA 3T4EA 2GJ4A 5K8IA 1T0BA 1P77A 2V6MA 2O14A 3O31A 4ZOLA 2HWUA 2UXBB 1ZL0A 3PSAA 2X14A 5ISMA 3G2KA 5AOCA 3EZYA 2QYTA 3DLPX 1UDXA 2PQMA 4F3YA 2DFPA 3QOXA 3E22A 2WHQA 3WLRA 4F72A 3L6DA 1J9ZA 4DLZA 1EXVA 3N2GA 2BW0A 3OU7A 4BX9A 2F4NA 1T9KA 1GPLA 5DHTA 1F6WA 2XODA 4KXXA 4ZT7A 5J43A 1PS9A 1QUFA 1KI8A 4F4IA 4J9VA 2DY1A 2PKCA 2H1FA 4EELA 3OA2A 3ZE7A 3V8QA 4R71A 2KSQA 1EK2A 2FR8A 2XMBA 2YXBA 1U2GC 3DBVO 3FYTA 4UUBA 2JZOA 4C3OB 5FYQA 4E5MA 4X24A 1P7ZA 1KO5A 3A27A 2MSNA 3QHAA 1Z18A 4GT1A 4UFNA 8GPBA 2NU7B 1B73A 3WTCA 1T4MA 1GUZA 1XXHB 4HNHA 4ND8A 2C9DA 3FVQA 3WLTA 4I50A 4JP1A 4AWBA 1LSJA 3I09A 3GH1A 5EMNA 4WQMA 2BJVA 3I6IA 3TR5A 1Z13A 5CX1A 3IEMA 4LVCA 3FCYA 4QEZA 2R4QA 2CUTA 2UVPB 4TWZA 3DQQA 4WJZA 3TXAA 5A4MS 3Q2KA 1NDHA 1OVGA 2RAPA 2DECA 3CX3A 3E9MA 4G4SO 4L9WA 4W82A 4EA6A 4ZYLA 5JQGF 5CCEA 1B6RA 1NJFA 2XNJA 3OOWA 4HPJB 4FNAA 2J6HA 1A4IA 1AKUA 1WHTB 5AYVA 3D3EA 3AYXB 1HE5A 2PUDA 4PC6A 4UD6A 3OP1A 5TEVA 1WLSA 4MRMA 4LHXA 3DAPA 2QNBA 2XE8A 4WESA 5HDQA 3MRTA 1CUWA 2GPTA 1X86B 1AKWA 3SHQA 4N8DA 3SJ7A 2AMFA 3AEKB 3A1FA 1H9AA 4QFMA 2HSGA 3A14A 4I08A 4NS1A 3TZCA 2AFHB 1RWKA 1RWVA 2QUBA 1K8QA 3Q3EA 4RVGA 3KV3O 4E1BA 5SY6A 1CJSA 1Q92A 3R5HA 4YMLA 1ECFA 3EWNA 1JH8A 4PLWA 1NASA 3OUTA 5D86A 4DQLA 2ZCJA 2H4YA 1M1NB 2VYND 4PYKA 2FSSA 4QBGB 4JI8B 4MPRA 2WOOA 1SRRA 3U3JA 3DDZX 4KJZA 1NRWA 1WUHS 4FDLA 4WKGA 2P6UA 4W1RA 3KLNA 4KKVA 1VRVA 4QDTA 2H2FA 5JAHA 4CMIA 2O8BA 4TTPA 1Z25A 3SM3A 4E6PA 1YIOA 1V7QA 4JITA 4AECA 1Y5NA 3MMXA 1P6XA 1DKNA 3V8VA 5HIAA 4A03A 1TAHA 4F8EA 5HF8A 1C1YA 3L6EA 3BMQB 4KW7A 4OL0A 3S1LA 4CN9A 3JYQA 1FQJA 2CK3D 1F0NA 1RW4A 2ZVPX 3AZPA 5CCDA 4FYHA 2ZR7A 2EFJA 3C39A 4R1OA 5FA6A 3DE1X 5ED0A 3EVTA 4Z1OA 3S99A 2UXCB 1GAXA 1MX3A 3JZMA 1GT91 2IPXA 3HXTA 1OJLA 3LV8A 3ZHRA 4DG8A 4ER3A 5HJ5A 1T6ZA 3L5KA 1IIBA 2PWZA 5ESDA 1N7JA 1KSFX 4C78A 4CT5A 1R8XA 1FJGB 1JXOA 3TRDA 3H2KA 4O0LA 3OLQA 4HQFA 3EHDA 5BWMA 4GI2A 1PJZA 1SCIA 2FX2A 1SXJE 2NLOA 4XD7A 3VZRA 2OGZA 1J7KA 1E3EA 5ADWA 1JJVA 2FPRA 3MWFA 3FGPA 3DBRB 4ALMA 3T9DA 3DT8A 3PHGA 1NBIA 1ADGA 2ICAA 2FEKA 4KK3A 5IXYA 2DBVO 4M88A 1MD9A 4G85A 5H4GA 1LDNA 4XX1A 5FNVF 5I9LA 1PKEA 2QJOA 3ACCA 1NJ1A 1U4NA 1IMOA 4ILKA 4BBJA 4FOPA 4KPYA 3IEIA 1NBWB 4TQAA 3Q8LA 1FDOA 1JAHA 4LDRA 1O95A 4HYQA 4C01A 2XGJA 1BOOA 1VBKA 1GAQA 1XSEA 3LGXA 5ES4B 2C1ZA 5C81A 2QX6A 4GPZA 2G1PA 2GETA 3L0SA 3T1OA 2JHFA 5JZMA 3Q4GA 3D7RA 3MTJA 4ZYXA 3O21A 4TXNA 2Q6KA 2BGRA 2G6BA 3QY9A 3GLIB 3GFTA 3MTBA 4GG1A 4IOLA 1OIVA 4CM9D 3VOSA 1KJZA 2ZUTA 1EE1A 1M6NA 1ZMBA 3DCJA 1QJ4A 5BSVA 1B14A 3LFTA 2R6GA 1YZTA 3JQQA 4J3JA 5J1TB 3KB6A 4G8BA 1FZQA 2Q4OA 3GELA 1YBMA 4MYCA 4ZKEA 3DFKA 5BPFA 2R6AA 5A6SB 4G6ZA 2VPTA 5LJLA 1F8FA 2EZ4A 2XCSB 3N8DA 3U56A 3RT7A 1TJPB 2YJ4A 3QW4B 2B36A 2WKPA 3SYLA 2O8FA 1E4EB 1GEGA 1TQ6A 3TN7A 2B1GA 1C0EA 1UJ2A 2DY0A 4JLWA 5HA5A 3RHFA 1YQ9A 4JHLA 2QF7A 1V7CA 3KEMA 5BRAA 2HBYA 2VSOA 1SXPA 3HWWA 2BZGA 1EHIA 1IY8A 1VQ1A 3DEIA 2KS6A 4G0PA 5GV8A 3RJMA 1H2BA 1A5TA 4H1UA 1LC0A 3E1GA 4CV2A 2R4UA 2W42A 5KO2A 4BFZA 2UZ1A 1E2KA 5IT9A 1CY7A 3T3IA 5IAOA 4NK4A 1E99A 2O0HA 3QUSA 4UDYX 3SDZA 1HYEA 3OQIA 5KYUB 2PR2A 3VU8A 1R9MA 1FB5A 2RKBA 3S2EA 5F9HA 4EJ0A 3NKFA 2NVWA 3D59A 1MQ8B 4WZAB 4IFIA 1E6MA 2HMWA 4CKCB 4HDOB 1EGMB 1UKCA 4IWYA 2R87A 1H8HD 1U3WA 4Q4JA 2VNJA 5DX0A 5BP7A 4NATA 4Z49A 5SY9A 2WJZB 3VKGA 3OUZA 3V8NA 1X87A 3B48A 4LF6B 4DA0A 1LI7A 4PLVA 5AM0A 3UB4A 3IAEA 4AKEA 5JU6A 4N5NA 4Z0PA 2VR1A 1KORA 1GQRA 3LTEA 2JLZA 5CH5A 2F3PA 2VSNA 3MCVA 3V7YA 2GVNA 3LI2A 2GGSA 3LCCA 4PN3A 4KYTA 5DI3A 3E61A 1WCIA 5JADA 2DJ5A 4BTLA 2I2AA 2E1RA 3A37A 2I78A 4LX0A 4OSPA 3RH0A 4JY7A 5EJ4A 4WACA 1KYXA 4NYMR 1J8QA 5ESWA 3AVQA 1KQNA 4D4MA 1NTRA 1C4WA 3AR6A 4R83A 3ZVMA 1T5LA 3DVSX 4B33A 3J7AC 3VMFA 2B92A 2PCJA 3H0EA 3BL8A 3LAWA 4P80A 3O90A 2G9ZA 5AVKA 3WMFA 4EM6A 2CJPA 5HKKA 1Z26A 1P1FA 4DR6B 4H7KA 1E2LA 2BBTA 1PG0A 3PD7A 1KI9A 1ODJA 5C80A 5J4VA 2IF2A 4UQPA 5TQJA 1R0ZA 1TLFA 2VPYA 2FUG6 2QROA 1XFDA 4KAFA 2D74A 1M1NA 1AHIA 2FQXA 4WLVA 1HDEA 1QX3A 1ONSA 1QVZA 5EZQA 4CKEA 5JNVA 5KMGA 1Y37A 1JHVA 2RHRA 5ADVA 1IH8A 1RI2A 2HRQA 3BXZA 3Q0EA 2A9PA 1LDYA 1M66A 3QWBA 4GHWA 4HKTA 4KUHA 3CJQA 2QT1A 3JZFA 3AESB 3VNUA 4OIMA 1CEXA 1Z28A 5AJZA 4QBHA 4BLUA 3AM5A 1U1CA 2CHVA 4ZPXA 4BGEA 4YMIA 1QG0A 2UAGA 4YMHA 1ZD1A 3K35A 4YEDA 2QXYA 2W6PA 3JARB 2XT9A 2JF0A 4K9OA 1VXRA 4A3SA 1DMRA 1OKKA 3SJBA 4M6WB 1FDRA 4AO6A 1RRCA 1XEXB 4E13A 1JV2B 2EYUA 4I1OA 5ES3A 3WSVA 5BWNA 2ZT6A 3IMKA 1X1QA 1LEHA 3NI2A 2A33A 4HRVA 4BX8A 2EWMA 4DCNA 4UUMA 1QNFA 3QOWA 1KZHA 1FNBA 3SEQA 2OHGA 1TYCA 1NVVQ 3KJXA 5CCBA 3U7QA 3LYLA 1C7RA 1WXFA 4F2WA 1JDBC 2N75A 2P0EA 4IDOA 3B52X 2H85A 1NJ2A 2BLLA 3NDIA 4BNDA 1XA4A 1D1QA 4HYTA 2PXHA 1RI4A 2BY4A 4L22A 3ZWKA 4O2BA 4N54A 4X44A 3BCSA 3GLHE 2GD2A 3IC5A 3ON5A 4Z2YA 1NWHA 4OBWA 1C3OB 3L41A 4URFA 8ADHA 4RA9B 5DHRA 1G8KA 2XVZA 3JVIA 1MJGA 1NLUA 1Z16A 4A36A 3MJCA 3OZVA 5KUTA 3D4IA 1A7AA 1T5BA 2JFUA 1D4ZA 2PYZA 4PLCA 4U4AA 1XD2B 2NYRA 1LH0A 2FGJA 2XGOA 4FYKA 4AUMA 2C5EA 4AWAA 1BW9A 4P81A 5DFAA 3HB5X 3QMVA 4X62B 1ZM9A 4CMGA 4ZMBA 4U00A 1HRDA 5T6BA 4D43A 2C42A 1JQ5A 1JYFA 2VA8A 3NEPX 4ZYUA 2CV0A 1RVDA 4ZMRA 1B7GO 1QIIA 2HGZA 3GG2A 2A92A 4OHVA 4W7IA 5EJ2A 1MW8X 1RABA 4G41A 1NJGA 4IQ8A 1EFDN 3DO5A 3QNMA 3V5NA 5B1HA 4H6VA 4XUEA 4DLVA 1YTLA 2WJ6A 4UUPA 3BTVA 4FCWA 2OBYA 2R11A 3ADKA 4FOLA 2FVXA 4FBMA 2GN0A 4Q66C 1JFSA 1R6DA 5TS3A 2R3SA 4JSTA 5DWQA 4ZI7F 2AR0A 3OZCA 5IKOA 3LXUX 1PQUA 3FZGA 2C0CA 3E2IA 3HBFA 3LUDA 4IZIA 4NE2A 5JYEA 4XYLA 3HMQA 1Z73A 2HA2A 1Z34A 3SBOA 3RC7A 2GKOA 1H2FA 1F2UA 3ZIDA 4RVHA 1FPMA 4ZAVA 1URPA 3QKRB 4PLGA 1GA4A 4N6GA 2VPPA 1CETA 3NVDA 4JBLA 5DISB 1QYVA 5D6OA 3ZCRA 1U2DC 3K4QA 4KMOA 1EVZA 1MAVA 4IY1A 2I7DA 4MV1A 5FOWA 3RUPA 3UMJA 3WLOA 1QVVA 1CQWA 1FE8A 4GI1A 3GLGE 3O4JA 3DB2A 3PDWA 2ZROA 4JIGA 3VPFA 3QE9Y 5K7SA 1BDIA 1UBKS 5K03A 3H5RA 4CUZA 5L3ZA 3IB3A 2DPHA 1CR6A 4HZUB 2QVLA 2J6IA 3OHMA 2RBGA 3EF1A 4FIZA 4G56A 3RS8A 1NXSA 1PRYA 2IXDA 3EFHA 3USZA 4FEGA 1CRLA 1YZYA 2WD8A 1YCDA 3HLKA 2ENUA 4HTAA 1OVMA 4R7TA 5LM3A 1GPH1 2HQBA 3FDZB 3I0ZA 1G2IA 3QLUA 1DQYA 3ND6A 3JQGB 4S2EA 3F1KA 3R41A 4S24A 1W30A 4BZWA 3A2KA 1XTRA 1CYEA 1DXQA 3QX9A 4WOCA 4O3MA 3DSRA 4NX2A 1H8ED 2YHUA 2VNSA 4YS6A 5IMBA 1FP6A 2AG1A 4PO3X 4QU5A 4REMA 4ZVNA 3WDMA 1X1SA 2RI6A 1YKSA 3ZCQA 3AINA 2H9AA 5DH9A 4C0QC 5GONB 1IQRA 5JXWA 1XAGA 5BVHA 1Z2EA 5K05A 2DGDA 5HDBB 2ZRAA 4C04A 1Y33E 4HP8A 1E79A 2V7QD 4FJ1A 3FF1A 2ODQA 4QDZA 4LHVA 1KC3A 3E7DA 4J07A 1QG4A 4FBLA 4X1YA 2JEZA 2QRHA 4UPVA 1Y4SA 5EVJA 4XQGA 5BQXA 4M9UA 1GKLA 3EQZA 5K3FA 4DARA 5EE5B 3ZLVA 3BK7A 1DIOB 3NYIA 2GAAA 4A1FA 2L69A 2C98A 2QSYA 4I1RA 1RJ9B 3N76A 3WHPA 4PFKA 4LHWA 1XTIA 2QSJA 2BGMA 2V9ZA 4JLKA 4WXPA 1ZCFA 2HQSA 5MN5A 5G0UA 4IDGA 4LWQA 2QN2A 2P1RA 3QI2A 4BHTA 1J23A 4B3XA 1QHYA 4BGDA 3U1BA 1TU0A 3MS7A 5KYVA 4B9AA 1IZZA 1NAIA 3CZ4A 4ZVVA 2VJAA 2Z9DA 2PRYA 2YJTD 4K26A 4II2A 4YI3A 2GWRA 2C5LA 2QE7A 3TEJA 2G77B 1O9HA 3QG1A 1W49A 1HF3A 4QJ5A 1J56A 4M9ZA 1RS0A 3FFWA 3WGJA 3ZS8A 3HXPA 3OZGA 4YJHB 3TQFA 4CE6A 3GMDA 2PWYA 1CDOA 1ZCAA 2AK3A 3EXHC 4IS3A 4B7CA 4EI7A 1JAYA 421PA 3Q7IA 4U2BA 5TLSA 4O1HA 3B5IA 1IEVA 4CEIA 3M4XA 2C2BA 3EYAA 4FZ5A 3EEIA 4UE3S 4B87A 1A9RA 4UHJA 3FDJA 4HMQA 4CW7A 3SR4A 5D87A 3R5FA 3W8FA 4GOMD 3K8OE 3RSFA 4YCDA 2JBAA 2C9BA 4NL4H 5I47A 5CVDA 3FPBA 1GTG1 1C1DB 3HA3A 3B1YA 3C3CA 1T4BA 3O8LA 4IIUA 2WZDA 5E6UA 1ZC4A 2NTEA 2XH8A 1K66A 1QO0A 1Z4MA 2W6ZA 1TB4A 2D2VA 2Z5GA 4KFRA 3BTUA 3TDNA 4EKNB 4CV0A 3C97A 3PHBE 2PLAA 3C1TA 1ZU5A 3C43A 1RBZA 2H5LA 3OUUA 2ZS7A 2NSLA 2CWWA 1PHPA 1WW8A 1Q6ZA 1SG6A 3Q85A 1W88B 1JHMA 1D2MA 3SHTA 4I2NA 4ZJPA 2FWMX 4LVOA 2VFAA 3WGZA 4LF4B 2FETA 3WV5A 3WLJA 1IJBA 4EY3A 1EDDA 1KEKA 4XTCS 1KHTA 2Q0XA 3FHTA 3G23A 1JMKC 3VZBA 1SBTA 2O06A 3AHIA 2DTEA 1ZOIA 2QX9A 3JRNA 2G9VA 2XZOA 1REQA 2PIDA 3JR3A 1ZW6A 4KXVA 3V4ZA 3ZYCA 1IUNA 1CUXA 1GSIA 1B6TA 2JVJA 5TGZA 1O6BA 1JJIA 3C87A 3UO8B 4QRIA 5C7OO 4R2IA 4Y9UA 5ALWA 4TWJA 3IO3A 3AUXA 3U5TA 1KKLA 3QVXA 3FKQA 1KL7A 1PBTA 2B1QA 3NTLA 1X1EA 5TS2A 2QE7D 2OCPA 4CNQA 2JHCA 4LWZA 3S6JA 4IILA 2GI4A 4TS1A 3HY4A 2FV8A 2H7VA 3C24A 3DAFA 4NU5A 3QIAA 1W36C 5IJ0A 3U0BA 4GDMA 3BKXA 2VZ9A 5EFZA 1I7LA 2X0IA 4P0PB 3NEJA 1IG3A 3RSOA 4UU8A 2ATVA 4BMCA 4HLNA 3FY4A 1XA0A 3AUJB 3HJCA 3HEBA 3GGGA 1T9GR 3IVXA 4HADA 2AG0A 2R8RA 3G0HA 1ORDA 2WKSA 2P9QA 4KQ1A 3VSAA 3ZU3A 2J0UA 3ZZUA 3JD0A 4MYTA 3REQB 3NJ4A 3MWDA 1B8VA 2GM5A 2IQ5A 4ZOEA 5DXAA 3S4YA 1OWNA 1MW9X 4CQJA 3Q98A 3G1TA 1E6UA 1Y7HA 5EVCA 3RG2A 3O6VA 4MULA 2I2WA 5H9VA 5CA0A 3TVDA 1UZUA 1S1MA 3IYLW 4NBUA 4R81A 3UPTA 3M6AA 3A2NA 3VUFA 2C2HA 2L18A 2E1PA 1HNNA 1Y1LA 1A8QA 2FLVA 2FPOA 2OP0A 2XSZA 4TMZA 5TF0A 3T3PB 4Z4IA 3AEQA 1IG0A 2J31A 2VHJA 2CW5A 4L5AA 4WDRA 1XXHE 4A0GA 5J5CA 3FPKA 1VPDA 1CUSA 1G19A 1H1LA 1UBMS 3AL2A 2DFDA 1BYIA 5B4VA 1HDZA 3DPIA 3RVJA 4U0KA 3A6FA 4PZLA 3FPAA 2V7GA 4P7FA 1WM1A 4KE8A 5ECYA 4DLLA 5KNCH 5MFPA 3ZD7A 5K4AA 3W79A 3RBXA 3ZHXA 3L07A 4NE7A 3RHZA 5TPZD 3D7SA 5HZGA 4YR9A 3BREA 5TNXA 2GZHA 1N32B 3RADC 2J48A 4J8PA 4ED9A 4TTRA 5EJMA 2IV2X 3PWZA 4IJVA 4JFRA 2F8TA 3EWAA 3SC6A 2WTNA 3NT5A 2G72A 1W4AA 4QJ4A 2BE7A 4BNLA 1U2DA 3B60A 3ZDBA 1YO6A 2BDTA 2RKOA 2GO1A 4RKEA 4BWGA 5G1NA 3HA7A 3JXEA 3MWEA 2ZJAA 2HRZA 2ZJ8A 3HB7A 2CVPA 3BFPA 2MSKA 4ZVUA 1X13A 1CE8B 1XZKA 4ND6A 3P45A 5I48A 3CINA 1TVEA 3COPA 1ZH8A 1GT6A 1I3LA 1SVIA 3I1JA 4I4CA 1OTHA 3ZJ4A 4CL8A 1BMFA 4GQAA 4HH1A 4NKRA 4UBIA 4E2WA