4PSJA

Crystal structure of engineered protein. northeast structural genomics consortium (nesg) target or464.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
255
structure length
255
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQINANNSDIKSVQGIQYLPNVRQLNLGGNKLHDISALKELTNLGWLNLSSNKIEKLPQGLFESLTTLTQLNLSNNQITSLPQGLFESLASLTQLNLSNNQITSLPQGLFESLTNLTQLNLSNNQITSLPQGLFESLTNLTQLNLSNNQITSLPQGLFESLTSLTQLNLSNNQITSLPQGLFESLTNLKQLNLSGNQIQSLPQGLHESLTQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR464
publication title Crystal Structure of Engineered Protein OR464.
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 95
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2014-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4psjA00
3OGKB 4R0AA 4TZHA 4R6JA 1LTXA 1YRGA 5IJCA 5GMGA 4LI1A 1M10B 3RFEA 4Q3GA 4LSXC 5AWBA 3ULVA 1W8AA 3JB9j 4OQTA 4LSCA 3REZA 5A5CA 2XOTA 2V70A 3WN4A 3RJ0A 2P1PB 4FD0A 5GS0A 3C6OB 4GT6A 1M9SA 4BSSA 3RW7A 1XWDC 2IFGA 4U08A 5HDHA 3O6NA 4CNMA 3CIGA 3E3ZA 3RFJA 2P1OB 4XGOA 3G3BA 3KJ4A 4P91A 3UL7A 2Z64A 3O53A 4XSQA 2WQVA 2Z7XB 3WPGA 1FQVA 4FS7A 1D0BA 1G9UA 3W3GA 4ECNA 4ARRA 1K5DC 1M9LA 1OGQA 3G39A 4QC0A 3RGXA 4PQ8A 3ZYJA 3W3LA 3W3MA 4Z79A 2V9TB 4U09A 2ASTB 2ELLA 4ARNA 1O6SA 2O6RA 3G06A 3UL8A 4R6AA 2UZXA 1P8TA 3C6NB 4LXSA 1DS9A 2Z7XA 2JQDA 2P1NB 1P8VA 3RGZA 3E4GA 2WFHA 3M19A 5D3IA 4C2AB 4MQWX 1KOHA 2BNHA 3WPBA 5HZLB 5B0NA 4BSRA 1FS2A 5CMPA 2JE1A 4LSAA 4AW4A 4RCWA 4Q62A 2RR6A 4G8AA 3G3AA 2P1MB 2CA6A 1M0ZA 1GWBA 1OZNA 1OTOA 1H6TA 1OTNA 4AY9X 4R6GA 4BSUA 3M18A 1O6VA 4CP6A 4C2BB 5CMNA 3W3NA 4IM6A 2WQUA 3CVRA 4RCAB 1XCDA 3P72A 4UFRA 3WPFA 3PMHG 3ZYIA 2RA8A 4FDWA 4I6JB 3OGMB 4LXRA 2Z65A 4MN8B 4H09A 2ID5A 2WQWA 3ULUA 4BV4R 4V2CA 3BZ5A 3W3KA 4CC4A 5IJBA 1KOOA 5AZ5A 5AWDA 5B0TA 3UL9A 1OOKG 4CNCA 5GS2B 4PKIG 1JL5A 1O6TA 3RIZA 4M7EA 4J0MA 4L3AA 3DZEA 3G04C 1OTMA 5LFNA 3SB4A 2A0ZA 4XOSA 5IJDA 5GQRK 1A4YA 4YEBB 3WPHA 4V2DA 3ZYOA 4P8SA 4CC4C 4K17A 4NKGA 4R5CA 4Y61B 3VQ1A 2OMTA 4R08A 1Z7XW 2Z66A 3W3JA 4FHOA 4M7EC 4Z64C 4QBZA 1XKUA 2ASSB 2Z62A 3RW6A 2V9SA 3E6JA 4Z8GA 4B8CD 4R6FA 4CILA 3CIYA 1DCEA 1FT8A 5AWCA 4FMZA 5GMHA 4KT1A 2OMYA 3TSRE 4KNGA 3WPEA 1SQ0B 2OMZA 2R9UA 1U0ND 5AWAA 5FTTB 4NKHA 4RWTC 4Z61C 2O6SA 2BEXA 4R07A 5GMFA 3VQ2A 2Y5QA 3WPDA 1ZIWA 2Z63A 3RFSA 1XECA 1H6UA 1K5GC 1FO1A 4R58A 2OMWA 4LI2A 4L3FA 2FT3A 3WPIA 4U7LA 4Z94G 1DFJI 4V2EA 2OMUA 2OMXA 4WYKA 1XEUA 2WQXA 3ZYNA 4PERA 5B4PA 2OMVA 3OJAB 4KXFB 3WPCA 3OGLB 4U06A 2UZYA 3E2JA 4Q3IA 4R5DA 3A79B 1PGVA 4WP6A 2XWTC 1WWLA 2O6QA 1IO0A 4FCGA 4GLPA 4R09A 3ULAA 4PEQB 4LSXA 4HQ1A 4J4LA 3C6PB 3UN9A 2Z81A 3GOZA 2Z82A 4EZGA 2JE0A 2P1QB 4ECOA 1P9AG 4QXEA 4PSJA 3OJAA 2Q4GW 5IYXC 1QYYA 1A9NA 3FXIA
chains in the Genus database with same CATH superfamily
4NZRM 3OGKB 4R0AA 4TZHA 4R6JA 1LTXA 1YRGA 5IJCA 5GMGA 4LI1A 1M10B 3RFEA 4Q3GA 4LSXC 5AWBA 3ULVA 1W8AA 3JB9j 4OQTA 4LSCA 3REZA 5A5CA 2XOTA 2V70A 3WN4A 3RJ0A 2P1PB 4FD0A 5GS0A 3C6OB 4GT6A 1M9SA 4BSSA 3RW7A 1XWDC 2IFGA 4U08A 5HDHA 3O6NA 4CNMA 3CIGA 3E3ZA 3RFJA 2P1OB 4XGOA 3G3BA 3KJ4A 4P91A 3UL7A 2Z64A 3O53A 4XSQA 2WQVA 2Z7XB 3WPGA 1FQVA 4FS7A 1D0BA 1G9UA 3W3GA 4ECNA 4ARRA 1K5DC 1M9LA 1OGQA 3G39A 4QC0A 3RGXA 4PQ8A 3ZYJA 3W3LA 3W3MA 4Z79A 2V9TB 4U09A 2ASTB 2ELLA 4ARNA 1O6SA 2O6RA 3G06A 3UL8A 4R6AA 2UZXA 1P8TA 3C6NB 4LXSA 1DS9A 2Z7XA 2JQDA 2P1NB 1P8VA 3RGZA 3E4GA 2WFHA 3M19A 5D3IA 4C2AB 4MQWX 1KOHA 2BNHA 3WPBA 5HZLB 5B0NA 4BSRA 1FS2A 5CMPA 2JE1A 4LSAA 4AW4A 4RCWA 4Q62A 2RR6A 4G8AA 3G3AA 2P1MB 2CA6A 1M0ZA 1GWBA 1OZNA 1OTOA 1H6TA 1OTNA 4AY9X 4R6GA 4BSUA 3M18A 1O6VA 4CP6A 4C2BB 5CMNA 3W3NA 4IM6A 2WQUA 3CVRA 4RCAB 1XCDA 3P72A 4UFRA 3WPFA 3PMHG 3ZYIA 2RA8A 4FDWA 4I6JB 3OGMB 4LXRA 2Z65A 4MN8B 4H09A 2ID5A 2WQWA 3ULUA 4BV4R 4V2CA 3BZ5A 3W3KA 4CC4A 5IJBA 1KOOA 5AZ5A 5AWDA 5B0TA 3UL9A 1OOKG 4CNCA 5GS2B 4PKIG 1JL5A 1O6TA 3RIZA 4M7EA 4J0MA 4L3AA 3DZEA 3G04C 1OTMA 5LFNA 3SB4A 2A0ZA 4XOSA 5IJDA 5GQRK 1A4YA 4YEBB 4NZTM 3WPHA 4V2DA 3ZYOA 4P8SA 4CC4C 4K17A 4NKGA 4R5CA 4Y61B 3VQ1A 2OMTA 4R08A 1Z7XW 2Z66A 3W3JA 4FHOA 4M7EC 4Z64C 4QBZA 1XKUA 2ASSB 2Z62A 3RW6A 2V9SA 3E6JA 4Z8GA 4B8CD 4R6FA 4CILA 3CIYA 1DCEA 1FT8A 5AWCA 4FMZA 5GMHA 4KT1A 2OMYA 3TSRE 4KNGA 3WPEA 1SQ0B 2OMZA 2R9UA 1U0ND 5AWAA 5FTTB 4NKHA 4RWTC 4Z61C 2O6SA 2BEXA 4R07A 5GMFA 3VQ2A 2Y5QA 3WPDA 1ZIWA 2Z63A 3RFSA 1XECA 1H6UA 1K5GC 1FO1A 4R58A 2OMWA 4LI2A 4L3FA 2FT3A 3WPIA 4U7LA 4Z94G 1DFJI 4V2EA 2OMUA 2OMXA 4WYKA 1XEUA 2WQXA 3ZYNA 4PERA 5B4PA 2OMVA 3OJAB 4KXFB 3WPCA 3OGLB 4U06A 2UZYA 3E2JA 4Q3IA 4R5DA 3A79B 1PGVA 4WP6A 2XWTC 1WWLA 2O6QA 1IO0A 4FCGA 4GLPA 4R09A 3ULAA 4PEQB 4LSXA 4HQ1A 4J4LA 3C6PB 3UN9A 2Z81A 3GOZA 2Z82A 4EZGA 2JE0A 2P1QB 4ECOA 1P9AG 4QXEA 4PSJA 3OJAA 2Q4GW 5IYXC 1QYYA 1A9NA 3FXIA
chains in the Genus database with same CATH topology
3OGKB 4R0AA 4TZHA 4R6JA 1LTXA 1YRGA 5IJCA 5GMGA 4LI1A 1M10B 3RFEA 4Q3GA 4LSXC 5AWBA 3ULVA 1W8AA 3JB9j 4OQTA 4LSCA 3REZA 5A5CA 2XOTA 2V70A 3WN4A 3RJ0A 2P1PB 4FD0A 5GS0A 3C6OB 4GT6A 1M9SA 4BSSA 3RW7A 1XWDC 2IFGA 4U08A 5HDHA 3O6NA 4CNMA 3CIGA 3E3ZA 3RFJA 2P1OB 4XGOA 3G3BA 3KJ4A 4P91A 3UL7A 2Z64A 3O53A 4XSQA 2WQVA 2Z7XB 3WPGA 1FQVA 4FS7A 1D0BA 1G9UA 3W3GA 4ECNA 4ARRA 1K5DC 1M9LA 1OGQA 3G39A 4QC0A 3RGXA 4PQ8A 3ZYJA 3W3LA 3W3MA 4Z79A 2V9TB 4U09A 2ASTB 2ELLA 4ARNA 1O6SA 2O6RA 3G06A 3UL8A 4R6AA 2UZXA 1P8TA 3C6NB 4LXSA 1DS9A 2Z7XA 2JQDA 2P1NB 1P8VA 3RGZA 3E4GA 2WFHA 3M19A 5D3IA 4C2AB 4MQWX 1KOHA 2BNHA 3WPBA 5HZLB 5B0NA 4BSRA 1FS2A 5CMPA 2JE1A 4LSAA 4AW4A 4RCWA 4Q62A 2RR6A 4G8AA 3G3AA 2P1MB 2CA6A 1M0ZA 1GWBA 1OZNA 1OTOA 1H6TA 1OTNA 4AY9X 4R6GA 4BSUA 3M18A 1O6VA 4CP6A 4C2BB 5CMNA 3W3NA 4IM6A 2WQUA 3CVRA 4RCAB 1XCDA 3P72A 4UFRA 3WPFA 3PMHG 3ZYIA 2RA8A 4FDWA 4I6JB 3OGMB 4LXRA 2Z65A 4MN8B 4H09A 2ID5A 2WQWA 3ULUA 4BV4R 4V2CA 3BZ5A 3W3KA 4CC4A 5IJBA 1KOOA 5AZ5A 5AWDA 5B0TA 3UL9A 1OOKG 4CNCA 5GS2B 4PKIG 1JL5A 1O6TA 3RIZA 4M7EA 4J0MA 4L3AA 3DZEA 3G04C 1OTMA 5LFNA 3SB4A 2A0ZA 4XOSA 5IJDA 5GQRK 1A4YA 4YEBB 3WPHA 4V2DA 3ZYOA 4P8SA 4CC4C 4K17A 4NKGA 4R5CA 4Y61B 3VQ1A 2OMTA 4R08A 1Z7XW 2Z66A 3W3JA 4FHOA 4M7EC 4Z64C 4QBZA 1XKUA 2ASSB 2Z62A 3RW6A 2V9SA 3E6JA 4Z8GA 4B8CD 4R6FA 4CILA 3CIYA 1DCEA 1FT8A 5AWCA 4FMZA 5GMHA 4KT1A 2OMYA 3TSRE 4KNGA 3WPEA 1SQ0B 2OMZA 2R9UA 1U0ND 5AWAA 5FTTB 4NKHA 4RWTC 4Z61C 2O6SA 2BEXA 4R07A 5GMFA 3VQ2A 2Y5QA 3WPDA 1ZIWA 2Z63A 3RFSA 1XECA 1H6UA 1K5GC 1FO1A 4R58A 2OMWA 4LI2A 4L3FA 2FT3A 3WPIA 4U7LA 4Z94G 1DFJI 4V2EA 2OMUA 2OMXA 4WYKA 1XEUA 2WQXA 3ZYNA 4PERA 5B4PA 2OMVA 3OJAB 4KXFB 3WPCA 3OGLB 4U06A 2UZYA 3E2JA 4Q3IA 4R5DA 3A79B 1PGVA 4WP6A 2XWTC 1WWLA 2O6QA 1IO0A 4FCGA 4GLPA 4R09A 3ULAA 4PEQB 4LSXA 4HQ1A 4J4LA 3C6PB 3UN9A 2Z81A 3GOZA 2Z82A 4EZGA 2JE0A 2P1QB 4ECOA 1P9AG 4QXEA 4PSJA 3OJAA 2Q4GW 5IYXC 1QYYA 1A9NA 3FXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGK B;  4R0A A;  4TZH A;  4R6J A;  1LTX A;  1YRG A;  5IJC A;  5GMG A;  4LI1 A;  1M10 B;  3RFE A;  4Q3G A;  4LSX C;  5AWB A;  3ULV A;  1W8A A;  3JB9 j;  4OQT A;  4LSC A;  3REZ A;  5A5C A;  2XOT A;  2V70 A;  3WN4 A;  3RJ0 A;  2P1P B;  4FD0 A;  5GS0 A;  3C6O B;  4GT6 A;  1M9S A;  4BSS A;  3RW7 A;  1XWD C;  2IFG A;  4U08 A;  5HDH A;  3O6N A;  4CNM A;  3CIG A;  3E3Z A;  3RFJ A;  2P1O B;  4XGO A;  3G3B A;  3KJ4 A;  4P91 A;  3UL7 A;  2Z64 A;  3O53 A;  4XSQ A;  2WQV A;  2Z7X B;  3WPG A;  1FQV A;  4FS7 A;  1D0B A;  1G9U A;  3W3G A;  4ECN A;  4ARR A;  1K5D C;  1M9L A;  1OGQ A;  3G39 A;  4QC0 A;  3RGX A;  4PQ8 A;  3ZYJ A;  3W3L A;  3W3M A;  4Z79 A;  2V9T B;  4U09 A;  2AST B;  2ELL A;  4ARN A;  1O6S A;  2O6R A;  3G06 A;  3UL8 A;  4R6A A;  2UZX A;  1P8T A;  3C6N B;  4LXS A;  1DS9 A;  2Z7X A;  2JQD A;  2P1N B;  1P8V A;  3RGZ A;  3E4G A;  2WFH A;  3M19 A;  5D3I A;  4C2A B;  4MQW X;  1KOH A;  2BNH A;  3WPB A;  5HZL B;  5B0N A;  4BSR A;  1FS2 A;  5CMP A;  2JE1 A;  4LSA A;  4AW4 A;  4RCW A;  4Q62 A;  2RR6 A;  4G8A A;  3G3A A;  2P1M B;  2CA6 A;  1M0Z A;  1GWB A;  1OZN A;  1OTO A;  1H6T A;  1OTN A;  4AY9 X;  4R6G A;  4BSU A;  3M18 A;  1O6V A;  4CP6 A;  4C2B B;  5CMN A;  3W3N A;  4IM6 A;  2WQU A;  3CVR A;  4RCA B;  1XCD A;  3P72 A;  4UFR A;  3WPF A;  3PMH G;  3ZYI A;  2RA8 A;  4FDW A;  4I6J B;  3OGM B;  4LXR A;  2Z65 A;  4MN8 B;  4H09 A;  2ID5 A;  2WQW A;  3ULU A;  4BV4 R;  4V2C A;  3BZ5 A;  3W3K A;  4CC4 A;  5IJB A;  1KOO A;  5AZ5 A;  5AWD A;  5B0T A;  3UL9 A;  1OOK G;  4CNC A;  5GS2 B;  4PKI G;  1JL5 A;  1O6T A;  3RIZ A;  4M7E A;  4J0M A;  4L3A A;  3DZE A;  3G04 C;  1OTM A;  5LFN A;  3SB4 A;  2A0Z A;  4XOS A;  5IJD A;  5GQR K;  1A4Y A;  4YEB B;  3WPH A;  4V2D A;  3ZYO A;  4P8S A;  4CC4 C;  4K17 A;  4NKG A;  4R5C A;  4Y61 B;  3VQ1 A;  2OMT A;  4R08 A;  1Z7X W;  2Z66 A;  3W3J A;  4FHO A;  4M7E C;  4Z64 C;  4QBZ A;  1XKU A;  2ASS B;  2Z62 A;  3RW6 A;  2V9S A;  3E6J A;  4Z8G A;  4B8C D;  4R6F A;  4CIL A;  3CIY A;  1DCE A;  1FT8 A;  5AWC A;  4FMZ A;  5GMH A;  4KT1 A;  2OMY A;  3TSR E;  4KNG A;  3WPE A;  1SQ0 B;  2OMZ A;  2R9U A;  1U0N D;  5AWA A;  5FTT B;  4NKH A;  4RWT C;  4Z61 C;  2O6S A;  2BEX A;  4R07 A;  5GMF A;  3VQ2 A;  2Y5Q A;  3WPD A;  1ZIW A;  2Z63 A;  3RFS A;  1XEC A;  1H6U A;  1K5G C;  1FO1 A;  4R58 A;  2OMW A;  4LI2 A;  4L3F A;  2FT3 A;  3WPI A;  4U7L A;  4Z94 G;  1DFJ I;  4V2E A;  2OMU A;  2OMX A;  4WYK A;  1XEU A;  2WQX A;  3ZYN A;  4PER A;  5B4P A;  2OMV A;  3OJA B;  4KXF B;  3WPC A;  3OGL B;  4U06 A;  2UZY A;  3E2J A;  4Q3I A;  4R5D A;  3A79 B;  1PGV A;  4WP6 A;  2XWT C;  1WWL A;  2O6Q A;  1IO0 A;  4FCG A;  4GLP A;  4R09 A;  3ULA A;  4PEQ B;  4LSX A;  4HQ1 A;  4J4L A;  3C6P B;  3UN9 A;  2Z81 A;  3GOZ A;  2Z82 A;  4EZG A;  2JE0 A;  2P1Q B;  4ECO A;  1P9A G;  4QXE A;  4PSJ A;  3OJA A;  2Q4G W;  5IYX C;  1QYY A;  1A9N A;  3FXI A; 
#chains in the Genus database with same CATH topology
 4NZR M;  3OGK B;  4R0A A;  4TZH A;  4R6J A;  1LTX A;  1YRG A;  5IJC A;  5GMG A;  4LI1 A;  1M10 B;  3RFE A;  4Q3G A;  4LSX C;  5AWB A;  3ULV A;  1W8A A;  3JB9 j;  4OQT A;  4LSC A;  3REZ A;  5A5C A;  2XOT A;  2V70 A;  3WN4 A;  3RJ0 A;  2P1P B;  4FD0 A;  5GS0 A;  3C6O B;  4GT6 A;  1M9S A;  4BSS A;  3RW7 A;  1XWD C;  2IFG A;  4U08 A;  5HDH A;  3O6N A;  4CNM A;  3CIG A;  3E3Z A;  3RFJ A;  2P1O B;  4XGO A;  3G3B A;  3KJ4 A;  4P91 A;  3UL7 A;  2Z64 A;  3O53 A;  4XSQ A;  2WQV A;  2Z7X B;  3WPG A;  1FQV A;  4FS7 A;  1D0B A;  1G9U A;  3W3G A;  4ECN A;  4ARR A;  1K5D C;  1M9L A;  1OGQ A;  3G39 A;  4QC0 A;  3RGX A;  4PQ8 A;  3ZYJ A;  3W3L A;  3W3M A;  4Z79 A;  2V9T B;  4U09 A;  2AST B;  2ELL A;  4ARN A;  1O6S A;  2O6R A;  3G06 A;  3UL8 A;  4R6A A;  2UZX A;  1P8T A;  3C6N B;  4LXS A;  1DS9 A;  2Z7X A;  2JQD A;  2P1N B;  1P8V A;  3RGZ A;  3E4G A;  2WFH A;  3M19 A;  5D3I A;  4C2A B;  4MQW X;  1KOH A;  2BNH A;  3WPB A;  5HZL B;  5B0N A;  4BSR A;  1FS2 A;  5CMP A;  2JE1 A;  4LSA A;  4AW4 A;  4RCW A;  4Q62 A;  2RR6 A;  4G8A A;  3G3A A;  2P1M B;  2CA6 A;  1M0Z A;  1GWB A;  1OZN A;  1OTO A;  1H6T A;  1OTN A;  4AY9 X;  4R6G A;  4BSU A;  3M18 A;  1O6V A;  4CP6 A;  4C2B B;  5CMN A;  3W3N A;  4IM6 A;  2WQU A;  3CVR A;  4RCA B;  1XCD A;  3P72 A;  4UFR A;  3WPF A;  3PMH G;  3ZYI A;  2RA8 A;  4FDW A;  4I6J B;  3OGM B;  4LXR A;  2Z65 A;  4MN8 B;  4H09 A;  2ID5 A;  2WQW A;  3ULU A;  4BV4 R;  4V2C A;  3BZ5 A;  3W3K A;  4CC4 A;  5IJB A;  1KOO A;  5AZ5 A;  5AWD A;  5B0T A;  3UL9 A;  1OOK G;  4CNC A;  5GS2 B;  4PKI G;  1JL5 A;  1O6T A;  3RIZ A;  4M7E A;  4J0M A;  4L3A A;  3DZE A;  3G04 C;  1OTM A;  5LFN A;  3SB4 A;  2A0Z A;  4XOS A;  5IJD A;  5GQR K;  1A4Y A;  4YEB B;  4NZT M;  3WPH A;  4V2D A;  3ZYO A;  4P8S A;  4CC4 C;  4K17 A;  4NKG A;  4R5C A;  4Y61 B;  3VQ1 A;  2OMT A;  4R08 A;  1Z7X W;  2Z66 A;  3W3J A;  4FHO A;  4M7E C;  4Z64 C;  4QBZ A;  1XKU A;  2ASS B;  2Z62 A;  3RW6 A;  2V9S A;  3E6J A;  4Z8G A;  4B8C D;  4R6F A;  4CIL A;  3CIY A;  1DCE A;  1FT8 A;  5AWC A;  4FMZ A;  5GMH A;  4KT1 A;  2OMY A;  3TSR E;  4KNG A;  3WPE A;  1SQ0 B;  2OMZ A;  2R9U A;  1U0N D;  5AWA A;  5FTT B;  4NKH A;  4RWT C;  4Z61 C;  2O6S A;  2BEX A;  4R07 A;  5GMF A;  3VQ2 A;  2Y5Q A;  3WPD A;  1ZIW A;  2Z63 A;  3RFS A;  1XEC A;  1H6U A;  1K5G C;  1FO1 A;  4R58 A;  2OMW A;  4LI2 A;  4L3F A;  2FT3 A;  3WPI A;  4U7L A;  4Z94 G;  1DFJ I;  4V2E A;  2OMU A;  2OMX A;  4WYK A;  1XEU A;  2WQX A;  3ZYN A;  4PER A;  5B4P A;  2OMV A;  3OJA B;  4KXF B;  3WPC A;  3OGL B;  4U06 A;  2UZY A;  3E2J A;  4Q3I A;  4R5D A;  3A79 B;  1PGV A;  4WP6 A;  2XWT C;  1WWL A;  2O6Q A;  1IO0 A;  4FCG A;  4GLP A;  4R09 A;  3ULA A;  4PEQ B;  4LSX A;  4HQ1 A;  4J4L A;  3C6P B;  3UN9 A;  2Z81 A;  3GOZ A;  2Z82 A;  4EZG A;  2JE0 A;  2P1Q B;  4ECO A;  1P9A G;  4QXE A;  4PSJ A;  3OJA A;  2Q4G W;  5IYX C;  1QYY A;  1A9N A;  3FXI A; 
#chains in the Genus database with same CATH homology
 3OGK B;  4R0A A;  4TZH A;  4R6J A;  1LTX A;  1YRG A;  5IJC A;  5GMG A;  4LI1 A;  1M10 B;  3RFE A;  4Q3G A;  4LSX C;  5AWB A;  3ULV A;  1W8A A;  3JB9 j;  4OQT A;  4LSC A;  3REZ A;  5A5C A;  2XOT A;  2V70 A;  3WN4 A;  3RJ0 A;  2P1P B;  4FD0 A;  5GS0 A;  3C6O B;  4GT6 A;  1M9S A;  4BSS A;  3RW7 A;  1XWD C;  2IFG A;  4U08 A;  5HDH A;  3O6N A;  4CNM A;  3CIG A;  3E3Z A;  3RFJ A;  2P1O B;  4XGO A;  3G3B A;  3KJ4 A;  4P91 A;  3UL7 A;  2Z64 A;  3O53 A;  4XSQ A;  2WQV A;  2Z7X B;  3WPG A;  1FQV A;  4FS7 A;  1D0B A;  1G9U A;  3W3G A;  4ECN A;  4ARR A;  1K5D C;  1M9L A;  1OGQ A;  3G39 A;  4QC0 A;  3RGX A;  4PQ8 A;  3ZYJ A;  3W3L A;  3W3M A;  4Z79 A;  2V9T B;  4U09 A;  2AST B;  2ELL A;  4ARN A;  1O6S A;  2O6R A;  3G06 A;  3UL8 A;  4R6A A;  2UZX A;  1P8T A;  3C6N B;  4LXS A;  1DS9 A;  2Z7X A;  2JQD A;  2P1N B;  1P8V A;  3RGZ A;  3E4G A;  2WFH A;  3M19 A;  5D3I A;  4C2A B;  4MQW X;  1KOH A;  2BNH A;  3WPB A;  5HZL B;  5B0N A;  4BSR A;  1FS2 A;  5CMP A;  2JE1 A;  4LSA A;  4AW4 A;  4RCW A;  4Q62 A;  2RR6 A;  4G8A A;  3G3A A;  2P1M B;  2CA6 A;  1M0Z A;  1GWB A;  1OZN A;  1OTO A;  1H6T A;  1OTN A;  4AY9 X;  4R6G A;  4BSU A;  3M18 A;  1O6V A;  4CP6 A;  4C2B B;  5CMN A;  3W3N A;  4IM6 A;  2WQU A;  3CVR A;  4RCA B;  1XCD A;  3P72 A;  4UFR A;  3WPF A;  3PMH G;  3ZYI A;  2RA8 A;  4FDW A;  4I6J B;  3OGM B;  4LXR A;  2Z65 A;  4MN8 B;  4H09 A;  2ID5 A;  2WQW A;  3ULU A;  4BV4 R;  4V2C A;  3BZ5 A;  3W3K A;  4CC4 A;  5IJB A;  1KOO A;  5AZ5 A;  5AWD A;  5B0T A;  3UL9 A;  1OOK G;  4CNC A;  5GS2 B;  4PKI G;  1JL5 A;  1O6T A;  3RIZ A;  4M7E A;  4J0M A;  4L3A A;  3DZE A;  3G04 C;  1OTM A;  5LFN A;  3SB4 A;  2A0Z A;  4XOS A;  5IJD A;  5GQR K;  1A4Y A;  4YEB B;  3WPH A;  4V2D A;  3ZYO A;  4P8S A;  4CC4 C;  4K17 A;  4NKG A;  4R5C A;  4Y61 B;  3VQ1 A;  2OMT A;  4R08 A;  1Z7X W;  2Z66 A;  3W3J A;  4FHO A;  4M7E C;  4Z64 C;  4QBZ A;  1XKU A;  2ASS B;  2Z62 A;  3RW6 A;  2V9S A;  3E6J A;  4Z8G A;  4B8C D;  4R6F A;  4CIL A;  3CIY A;  1DCE A;  1FT8 A;  5AWC A;  4FMZ A;  5GMH A;  4KT1 A;  2OMY A;  3TSR E;  4KNG A;  3WPE A;  1SQ0 B;  2OMZ A;  2R9U A;  1U0N D;  5AWA A;  5FTT B;  4NKH A;  4RWT C;  4Z61 C;  2O6S A;  2BEX A;  4R07 A;  5GMF A;  3VQ2 A;  2Y5Q A;  3WPD A;  1ZIW A;  2Z63 A;  3RFS A;  1XEC A;  1H6U A;  1K5G C;  1FO1 A;  4R58 A;  2OMW A;  4LI2 A;  4L3F A;  2FT3 A;  3WPI A;  4U7L A;  4Z94 G;  1DFJ I;  4V2E A;  2OMU A;  2OMX A;  4WYK A;  1XEU A;  2WQX A;  3ZYN A;  4PER A;  5B4P A;  2OMV A;  3OJA B;  4KXF B;  3WPC A;  3OGL B;  4U06 A;  2UZY A;  3E2J A;  4Q3I A;  4R5D A;  3A79 B;  1PGV A;  4WP6 A;  2XWT C;  1WWL A;  2O6Q A;  1IO0 A;  4FCG A;  4GLP A;  4R09 A;  3ULA A;  4PEQ B;  4LSX A;  4HQ1 A;  4J4L A;  3C6P B;  3UN9 A;  2Z81 A;  3GOZ A;  2Z82 A;  4EZG A;  2JE0 A;  2P1Q B;  4ECO A;  1P9A G;  4QXE A;  4PSJ A;  3OJA A;  2Q4G W;  5IYX C;  1QYY A;  1A9N A;  3FXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...