4PSKA

Mycobacterium tuberculosis reca phosphate bound low temperature structure i-lt
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
308
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 96
structure length 308
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pskA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pskA01
4E03A 1KY2A 3CBQA 3I3SR 5JS7A 4XVUA 2D3WA 4LRWA 1KMHA 3ADBA 1G7SA 1G18A 1JPNA 1OLOA 3L8ZA 4TYNA 1UBEA 4FMCB 1G8PA 4KVAA 3KKNA 1EESA 4IW3B 1MABB 2VA8A 4M53A 1FP7A 5HR5A 1YR8A 5AR1A 2C77A 5KYKA 1W36D 4ARZA 2QBYB 2A30A 3RNLA 2IK8A 4BZPA 5B30A 4Y0AA 5HCIA 3WNCA 2PX3A 3WMFA 4QGFA 2NPFA 3BERA 3B9QA 3S1AA 1QHXA 1TQDA 3K0EA 5CK5A 3TUZC 1QHNA 2VSXA 4HUQA 3L43A 4KO8A 5ANRB 3QF7A 5EP4A 5HPYB 5LBIA 2RGXA 3P27A 1VMAA 5JI2E 4CW7A 4JSYA 3R9IA 2VH5R 5G3ZA 2YNMA 4HB4A 3K0AB 1KSJA 2Z6VA 3I4LA 3LDAA 2GTPA 4JLBA 2ZI4A 3ZD6A 2PZFA 2BCGY 1DAMA 1TAGA 2AX4A 3KJHA 3BH0A 2XXAB 2V7QA 3EA0A 5L8VA 2IYVA 2VO1A 4IVRA 4NYMQ 2R6DA 2FGJA 1J8MF 3RRMA 2ZJAA 3T12A 1S3SA 1DPFA 3AP3A 1EK0A 2OXCA 3QG5A 3EXAA 5C4GB 3ZGXA 5JCZA 2BOVA 1J99A 2EFDB 2JJ2A 4LGMA 1W7AA 2ZAOA 4UXIA 4JYBA 2N42A 4NONA 3NDBB 2CE2X 2ORWA 1NG1A 3B1VA 2J0QA 3H1TA 4JLDA 1TQ4A 1F3OA 4JBWA 4EPXA 4PQFA 1KO4A 1LVGA 3EPJA 2HDNB 4MITA 4OKSA 3TJZA 3ICEA 3CRW1 2EWWA 2C98A 3QBTA 5CLLA 4ZCLA 3ZQJA 1BYIA 5KDLA 1E79A 4JS0A 2GEDA 3IIMA 1ELOA 2EFHB 4HB2A 4OHXA 2GA8A 4A1FA 1EFCA 1M34E 2QN6A 1JAHA 5E7IA 1NJGA 1G21E 4G1UC 4N0EA 5GJCA 4GZMA 1IY2A 5GJBA 1D8TA 3TH5A 2WJVA 3VX3A 2GZAA 2KB0A 3AGQA 4O2LA 3LNCA 4I99A 3PUZA 5DNYB 1NSFA 1DO0A 3CR8A 2G0NA 4DLTA 3UWOA 2FZ4A 1G4UR 1SVOA 1S0UA 1KO7A 5E95A 1CF4A 4DCSA 2CNWD 3QXCA 1T8TA 3EC2A 4ARZB 4TN1A 1VECA 5DSZA 3C5HA 2O0KA 1U98A 2J7KA 3LBHA 4KCGA 2R2AA 2IXFA 3RRZA 4NYJR 2NQ2C 4JVSB 1ETUA 1TQ2A 2A9KA 3CPJB 4JLOA 1CEEA 1RZ3A 2GJAA 4I1VA 5EE3A 4NU0A 5KSYA 1FTNA 5GVRA 2NTYC 4TMXA 1IM2A 2C03A 4MYUA 4ZCIA 2J0UB 2XJ9A 2J87A 3VKGA 4B3XA 2ECKA 3B82A 2IBMA 4Q66C 2JCSA 4OYHA 3TKLA 4G3XA 2GJSA 4LYHA 2HYIC 1NVWQ 2V1UA 1U8AA 2AD5A 5DI3A 4PAMA 5KTYA 1LV7A 2BEKA 3LXRA 5KDOA 3K53A 3P20A 4TTRA 1NN3A 2IYLD 4URVR 3I5YA 2VHTA 1A7JA 1RIFA 3U3MA 1QZXA 1P9NA 2ZANA 2QSZA 2QP3A 2XTNA 2BEJA 4FCWA 3CONA 3NXSA 4KV9A 2JLRA 5F98A 1P3JA 3THYA 2H1LA 2ZRIA 1BH2A 2J3EA 1OFTA 1US8B 2GAAA 2ZJYA 4PAOA 4CYMA 1E2DA 4KYIB 4PHFA 4B6FA 1NG9A 5IK2A 4MDEA 2DPXA 4HB3A 3KJGA 5C2JB 5LD2B 3VNVA 4NP6A 2OUKA 5CB8A 3OHMA 5EZ5A 4F4CA 5FI0B 4KSCA 1W48A 4AYTA 3U3JA 4NZYA 4BWYA 5CYOA 2WMNB 1TL7C 2PLFA 2ZPTX 1CJKC 3JVUA 1SZPA 4RZ2A 2P5TB 2J7PD 5JWHA 2XB2A 5FPSA 1E0KA 1GFIA 2MSCB 621PA 1P9RA 4MKIA 3QXSA 1MRSA 2GVZC 1Z0AA 5D3MB 4A4DA 3UMSA 4PHTA 1XPRA 2ZETA 3E1SA 3VHXA 4RFSB 1GUAA 1N6PA 3FGNA 3TQCA 5K8TA 5B2ZA 4QM7A 1QHYA 1F2TB 3K09C 3SR0A 3IBGA 4TMTA 1P4SA 3AVVA 2O0JA 1AS2A 1M1YE 2GWHA 3CKLA 2O8EB 1Q1BA 3A37A 5EP1A 1SVLA 2WWGA 1GG2A 5DYIA 2XZLA 3VR6A 2DFLA 3GLGE 5KOYA 4U5XA 4DLRA 4PZYA 2VYFA 1I4DD 5BQ5A 4NCKA 2JLQA 2CL6X 2JDID 1CR1A 1XX6A 4URUR 5CJPA 3T1OA 3CNOA 1E0SA 1VHLA 3I8XA 1RKBA 3NTUA 4LYAA 5TDHA 3RAPR 2C5LA 3V9PA 5HZKA 1XFAA 1AIPA 3V00A 5FPYA 2AKAB 3CF0A 5BXQC 4TQ9A 5FL3A 2VPPA 4DSNA 3EW9A 3O8CA 1IOZA 1JECA 2ZRLA 1GRRA 1I2DA 3Q7QA 1NBME 4Q9HA 1EX6A 2IEYA 2GHIA 2WIBA 1OYYA 1G3IA 1GRNA 2AD1A 3LX8A 1FMLA 3NIBA 2V1XA 2V3CC 1P9WA 3FDIA 3K0FB 4LHWA 3RS5A 3EIHA 5A5GA 1N6IA 1KO5A 4EPWA 2BCJQ 5IK2D 5B57C 2AXNA 2AR7A 3GLHB 3QUSA 1XXHB 1OH5A 2Z0MA 2AXPA 4CEHB 4AC9A 5EE1A 4M2LA 1JR3E 2IYYA 4GBMA 2B8WA 3CRVA 4Q4JB 2RGEA 2RGDA 1IN7A 4C0LA 4OQLA 1XTJA 4HSEA 1VTKA 2P6UA 1DG3A 1DVRA 2PL3A 2WAXA 2G3YA 4JSTA 3CUEF 1ONBA 1ZUNB 2WICA 2IF0A 2FWRA 3MRSA 4XWOA 3KFVA 5FPKA 2ZRDA 3HJNA 3BH7A 3KKQA 3RS7A 2H17A 1XCGB 5BYJA 2AK2A 4LHXA 3L0OA 5HE9A 1QHIA 1RRCA 1T8UA 1EFHA 1NSTA 2QNRA 3IGFA 2UZIR 2ZI5A 1CULC 2WJYA 4PXAA 1JALA 2EQBA 2HYDA 3X2SA 3TSZA 4D4JA 4P4SA 1I4TD 1P2TA 4UNNA 4URYR 5JWOA 2YWGA 3CF6R 2F55A 3CZQA 3GJ4A 2WAYA 2CEAA 3ZZTA 4R9UC 2GK6A 1U99A 3GD7A 3OAAA 1US8A 4RVCA 2DB3A 2YWFA 3TNFA 3HWSA 1OFUX 5FOVA 4EJSB 4ZV4A 3SDZA 1XD2A 2TMKA 4MA4A 4S2EA 3TUJC 4BLRA 1CJUC 3AUYA 4HLUA 1WF3A 2OCBA 3OE7A 1NNEA 4PZLA 1XZQA 3O47A 2IYXA 4P0TA 3DKVA 1KJWA 2QORA 1II8A 4TYWA 1JEDA 1XTQA 3THWA 3A1WA 1KI8A 3RWOA 2OCAA 4NTZA 4LJ9A 5FL7A 2J5XA 4LX0A 1TTTA 4C0AC 4OHYA 4KITB 3KXLA 2A2ZA 4QNMA 2NZJA 2CDNA 1L2TA 2GJKA 2QY9A 3KB2A 3Q9LA 3SE0A 4KODA 2FFHA 2ORVA 4QBHA 2IT1A 3B7GA 1W2HA 3VR2A 3BOSA 3I92A 2ORIA 2ZI3A 4KI0A 1X8JA 3I1FA 5FUYA 3LW8A 4M1KA 5DN6A 2KSQA 3SS8A 2F3TA 1W5SA 1X8LA 2OLJA 4ZIRB 2ZS8A 1OSNA 5EZ6B 1KDPA 1Z83A 4BQSA 4AG5A 4P4TA 2CXXA 4TTPA 2W2TA 2VP0A 4UNPA 1CXZA 4C3ZA 2N46A 5E7MA 2ZU0C 4LPKA 1XNJA 4A6XA 3VFDA 2JEOA 5B58C 3ETLA 4GI7A 4TMWA 1FNMA 4OJQA 4FI3C 4A36A 2ZSEA 1ZCBA 3MSXA 2O8DA 1V5WA 2OBLA 3BXZA 3OEED 2GBLA 1GKUB 2LWIA 4GMXA 3I62A 2G83A 2OV2A 3WBJA 2ZRCA 3ZYCA 3A58B 1X1RA 4GT1A 3BFXA 1K5GA 1G20E 5HKKA 1RJ9A 2FG5A 1P72A 1OE0A 1X8KA 3TW4A 1SXJB 1W0KD 5J4LA 2GDJA 4TYPA 5AK0A 4HAWA 2H16A 4DT1A 1UJ2A 3BH6A 4OHZA 2DFTA 3ZVMA 1S1CA 1G4AE 4U00A 5FBQB 3VR4A 4HLQB 1NBMA 3B13B 3GEHA 4C0BA 4BLPA 1ZW6A 1JXMA 4DCUA 2DCUA 1D2EA 1S9DA 4WA7A 4K46A 4CEJB 5FL7D 4XTCS 4XSGA 3LX5A 4L8GA 3T34A 5K8IA 4RD6A 3KTAA 1M2OB 1XD2B 4IXMA 1CP2A 5KO2A 1P2UA 1KIMA 3L0IB 4K81B 3QXHA 3RWMB 2QMUA 2REOA 2Z4RA 4DSTA 1OB2A 4QFMA 2DFKB 5SZIA 4KAXA 221PA 4M0LA 4TL9A 1LY1A 1BMFA 2W6JD 4G0NA 1FW6A 5L3RA 3PEYA 1JQJC 3ZVNA 2PEYA 1W44A 2WM9B 2FSIA 3RSLA 3TSOA 4A8JC 3QPVA 1CR0A 1W4RA 3BGWA 1TUEA 1OJLA 1UPTA 2BKUA 4MH0R 1HH4A 1JI0A 1VIYA 1Z0JA 3CRMA 5KHOC 2QM8A 2F43B 2VRWA 4XOIA 5E4FA 5CLQA 2QMHA 3BFKA 4C0HA 3U44B 1G8HA 2WBLC 2IC5A 1T0HB 2LKCA 4MRRA 5SZKB 2DWOA 1NLYA 1D9XA 4XH9B 2KJQA 1W47A 2YINC 3LBIA 3NBXX 3AP2A 1DOAA 2Z83A 3WBKA 1M7BA 5A4JA 2JAQA 5JFGA 4ZCMA 2ZYTX 4LJAA 4PC2A 3D3QA 3WYGA 1X1SA 1XZPA 2Y8EA 2ZR7A 1O87A 3A4NA 1N6RA 2B92A 5G53C 4I1OA 2AK3A 3PV0A 4NCIA 4QHTA 4LC0A 1BS1A 1TADA 2ZJBA 4A0HA 4AKGA 3A4MA 4D4KA 1LFDB 2MMCA 3CX6A 2FH5B 2WZQA 4A0GA 5BN5A 2OAQ1 3RC3A 4QXAA 5L3SB 4F4JA 1TNDA 2GF9A 1Z6AA 2OCYC 4XVQA 3I61A 1KKMA 2B7BA 1TF2A 5FTMA 4I81A 3X1XA 4AIIA 2V9PA 4MGYR 4EPYA 1NN5A 4JLVA 3BD9A 1NVXQ 1SVWA 1S3GA 2OBMA 4YMVA 1IN4A 1LB1B 2QI9C 3EZ2A 3M6AA 4AI6A 4PZZA 4PC3A 5IDVA 1WE2A 3TR0A 1R7RA 3FFBA 1KI9A 3U3KA 4JLNA 3R9XA 2CJWA 5CB6A 2HUPA 3AF1A 3FYHA 5JCPA 1IAQA 1OHHD 1GOTA 2BKEA 1BKDR 2GZDA 4US2R 1OFIA 3Q5EA 1NLFA 1BMFD 2YC2C 1P62B 2BBTA 2ZYWX 5BW8A 2QUZA 4A8JB 4R2HA 2HLDD 1JQLB 3EIQA 1IN5A 1SULA 2ZU6A 4QJ4A 4JMPA 5DGXA 2KBEA 4B3BA 3GLGB 3QPWA 4N3NA 2HXYA 4NDZA 4GMDA 4BRWA 1GKYA 3B1YA 2ZJ2A 4N0DA 1IY1A 1UBGA 1XTSA 1JXOA 4GDFA 2PZEA 5FBRB 1ZVQA 4I4LA 4ZIRA 3TE6A 1M8PA 2V8OA 2FSHA 1GIAA 1SXJD 121PA 3IDQA 2CHVA 1G3QA 3O8BA 1CKEA 3IBYA 1CJTC 3QEOA 3GLIE 3A1VA 3EG5A 2IS1A 3I32A 4CGZA 3VU9B 4KLNA 2FDCA 1MRNA 4DSOA 2Q3FA 3LY5A 5F3WB 1RRFA 4BECA 4D82A 1VG0B 4IRUB 1IY0A 3SJBA 1V43A 2C2HA 2FGKA 2A3RA 3FKSD 1II9A 4L5BA 4X8MA 2G9NA 5J40A 5LDDC 2FA9A 1WA5A 3PJRA 1R8SA 1DAHA 4A2PA 4EQ6A 1Q1QA 1NJFA 4Q01A 2ERXA 2ZAMA 4IVPA 3IPYA 1K8RA 4TLEA 1N0WA 4FD2A 1VCOA 2QPOA 3BWDD 1DARA 1II8B 4PC1A 4O3MA 2ZRJA 2PCLA 3CB4A 3WY9A 3B1ZA 4TSFA 4NHOA 4P33A 1OH6A 1DG1G 2PT7A 4PPQA 4US1R 4DCTA 2C8VA 1N6LA 2BWJA 1UKEA 1FNNA 2V54A 1ZU4A 4PC7A 5DLQC 3NC1C 3SHWA 3OFND 2R6GA 4IXNA 4D6PA 1AQUA 4RJLA 2RAPA 1GKIA 3A1TA 5DIFA 2A78A 3AVTA 4HZIA 1P6XA 2VP9A 2ZRBA 4C0JA 1WBDA 5A0FA 2CK3D 4DUGD 3RS3A 4DEXA 2O0HA 2P65A 3OIWA 5KU1A 1YU9A 2F9MA 4WVFA 3NHBA 4NH0A 3AKEA 4PPGA 4B74A 1KGDA 4M9XA 4QOSA 5FOXA 1LF5A 5C4MA 2WWYA 4O25A 3QXXA 4EQ6B 3KKOA 3GLFA 4DLSA 2JJ2D 2JLXA 3FHOA 4LK2A 2JASA 5SZHB 2FF7A 2Q3MA 1GTVA 2YC4C 2OEPA 2BBOA 3KX2A 1FX0B 1SXJA 2GVDC 1OB5A 4IDPA 5FFMA 1FFHA 3TLXA 4AKHA 2P0EA 1E2NA 4QHSA 3KXKA 3ASYA 1WMSA 3E2IA 1NN0A 2B21A 4KFTA 5GADl 2R8RA 4M4SA 5FUXA 4CRWB 4HZUB 5KNDA 4B32A 3F5FA 2HF8A 1S2MA 2F1JA 3CRRA 3K9GA 3FKSA 4LHVA 1TEVA 1NVVR 2GXQA 2D4HA 1CIPA 1VHTA 3CX8A 3PFIA 1KSGA 4LC1A 3GLIA 1XU4A 2WSSA 1E98A 4Z54A 4RCYA 3F3YA 5HKKD 1Q1EA 1HYQA 4XIGS 1T4GA 2JJ1A 2C04A 3NG1A 1L4UA 3UMRA 1E3MA 3QKSB 5FTLA 1W0KA 2XB4A 3PCRB 1KZ7B 4NCNA 4ZDWA 1CBUA 1KAGA 5FR1A 2B6HA 5JSZB 3GJ3A 1PLKA 1X86B 5HZHA 3QKUA 3H2YA 4ZDIA 1SKYB 4M1OA 1A2BA 2UKDA 3ASZA 2GZHA 2RCNA 5CDFA 3O8RA 1IBRA 2CJWB 3SFVA 3W6OA 1E94E 2VIIA 3OFNA 3GPLA 4MQBA 2VEDA 2JATA 2YWHA 4JBXA 4D0NA 4DIDA 4DRZA 1OH8A 1NI3A 1Q3HA 4J0QA 3HPRA 4PO9A 3MCAA 3IIKA 4M22A 1P60A 1MO6A 1ZNXA 4QKQA 5KSZA 5FPHA 3TW8B 3FTQA 3VHLB 4U7DA 3HYRA 1G19A 2C9CA 5CDFE 2GCPA 4D0GA 2P67A 4V0ME 3W5IA 1LTQA 1UADA 3EZ6A 4BZQA 2VSOA 1N5LA 2ZYUX 3GFPA 5JZVA 1XJ0A 3OZXA 1FUKA 4RD0A 4ESVA 1ZM2A 1VDZA 3TUIC 2F1RA 2OM2A 1H8ED 5CIWA 2HJVA 1E2IA 3PEVA 1VKJA 2QMEA 4OQMA 3LBNA 3NBZC 2VF8A 2Q0HA 2NO9A 3EZ9A 4XTRA 3TAUA 5JHHB 1E9AA 4RZUA 2OCPA 4LDJA 5JEDA 3OIUA 4LV5B 1CR4A 5L3QB 1TX4B 2WWWA 3PENA 3DKPA 4BLOA 4GZLA 4OHVA 3B8HA 1MABA 2KE5A 3RANA 1PUJA 2ZVQX 3U7GA 1JBKA 2WMOB 1T5LA 2JA1A 2Z5FA 3C4JA 2N1BA 2NZ8A 2J59A 2BMFA 2QU8A 1E9BA 4BRUA 3I73A 4XVRA 4Z51A 2RGNC 4LJ7A 2Q21A 2O52A 2IX3A 2ONJA 2B7CA 5DHAA 2ZSAA 1FTSA 5JJKA 4Q48A 2GEUA 3K70C 4LV6A 4POAA 1EGAA 2AHOA 1S1MA 4D81A 4OK3A 3BBPA 3OIYA 3BB3A 4IOLA 1E2KA 3HU3A 5JJLA 1FQKA 2CHQA 4HATA 1TU3A 4X8OA 4NCJA 4OI4A 3QBVA 5BN4A 5EE9A 5IT5A 5TARA 1KNQA 4QL3A 1XXHA 2OT3B 2X77A 1XD8A 1UEJA 2C96A 3LAWA 1U81A 1Z6TA 4G01B 4C4PA 4MYCA 3CPEA 4DEYA 1RRPA 4OL0A 3AF4A 3Q85A 4JBYA 3FKQA 4Q1BA 2REBA 1T3SA 5CIQA 4AURA 2GK7A 1TPZA 4AWXA 3SQWA 2QAJA 3B2EA 2L0XA 1RE0A 1ZM9A 2YOFA 2VP6A 1OXTA 5EJEA 2H18A 4CEIB 4TSFD 1Z07A 1YQTA 2WVJA 3EASA 3RS4A 3UANA 4D4MA 2PT5A 4RZXA 1E0AA 3TIFA 2BBSA 1KI6B 4R7ZA 2YKGA 3QY0A 4JKYA 1AS0A 3RABA 3MLEA 1AZSC 1VG9B 1KSFX 4IDHA 4LJ6A 4O2RA 4HZUA 1Z3IX 3K9HA 3EIEA 2O8FB 2CCGA 3DPUA 1Z0FA 2VP4A 4P32A 4PHGA 4B3GA 1FPMA 1AGRA 3TVTA 1W36B 4B75A 5BYKA 4HAYA 2AWOA 2FSFA 1R10A 3FE2A 2XZPA 2CK3A 1BO6A 4MKFA 1GNQA 2PH1A 4Z8XA 1R0YA 1R0WA 4FIDA 1KI6A 4JL6A 4MGIR 3EX7C 3CNNA 4BE7B 3U6KA 1T6NA 2F9LA 3ZIAD 2QP9X 2Q9BA 5JHGB 1NN1A 5JRZA 2IXEA 3A1SA 3MG9A 4Q1CA 2Z43A 2ZI6A 1R2QA 1UFQA 1IONA 4CT4B 1EFUA 2OXRA 5JECA 3EZFA 3KJIA 2GCNA 4FWIB 4LJ5A 1CR2A 1HY3A 2KI5A 1KMQA 8OHMA 4DZZA 3WNBA 1LF0A 4UXJA 4IFBA 5TVKA 4DCVA 1Z63A 1QDEA 1NRJB 4QHYA 3TSWA 3BC1A 3KKMA 1XEWY 2J9RA 1KDRA 3ADCA 1J8YF 3LVRE 3G5UA 4DB4A 1Z0IA 3DDCA 4B71A 4B43A 5H70A 3W8NA 1TU4A 3A6PC 2F3RA 2GRJA 2XSZA 3W8RA 1NY6A 4ESHA 1RVDA 2PJZA 4EFLA 2FX3A 5JWRA 4MRPA 1VG1A 1YZLA 4FINA 3B60A 2QA5A 1A2KC 4MKGA 2QGNA 2O5VA 1G5RA 4YQFA 2WSSD 1XJCA 2ZROA 2ZREA 2JJ1D 2ZXUA 1U0LA 3OAAD 2D7CA 1RC8A 1SHZA 1HQYE 5JI3E 4PPNA 1ZAKA 5LPNA 1Q21A 3OESA 3ZH9B 3K0CC 4M9QA 4R71A 4Q19A 3K8YA 2WWFA 3LD9A 3OE7D 1EFRD 1W5TA 4DUGA 1ZP6A 1MR3F 4U02A 4URWR 2ZIAA 3C5CA 3ADDA 1IJFA 1Z6GA 1DAEA 3CRQA 3ND8A 3ONWA 4GSYA 3DOEA 2MSDB 5FBVB 1YRAA 4V0MA 4HUTA 2H57A 4ERNA 5LB4A 3THYB 2JLVA 4LCBA 1SHKA 2ZYVX 3DMNA 5J4VA 5AUPB 1NMZA 1W1WA 3M4YA 3CW2A 4M1TA 5TMPA 5E7JA 1P61B 4YDHB 4Q1EA 1XPOA 4GP7A 3ZIAA 2ATXA 4Y0VA 3W90A 1X3SA 5J47A 1E1RA 2QROA 1U90A 4CDGA 2ZM5A 2VQSA 3K09A 3NH9A 3CF2A 1GVNB 1W4CA 5B64A 4OK6A 1M7GA 5FI1B 5AUOB 3CZPA 1TF7A 4BEBA 2KWIA 1F2UA 2MSEB 3HP1A 3GP8A 4HYYA 2PMKA 1NL3A 2WOJA 1IN6A 3QF4A 4F92B 1W49A 3GLHA 4QBGB 4ZKDA 3AVYA 1Z5ZA 1ZC3A 3FFAA 1PLLA 3CWQA 2I4IA 1VG8A 1LNZA 3BAFA 1LW7A 1L8QA 1NKTA 1RW4A 1U8YA 4KFUA 2QL6A 1UKYA 3SYNA 3VAAA 4CVNA 2NO1A 2J0SA 3SHFA 5CM8B 1MT0A 1EX7A 4A15A 2ANBA 4OJKA 3SC3A 1U9IA 3AVPA 2C9OA 4OI2A 4Q5IA 1E2FA 3C8UA 4AYWA 2ZE6A 3C15C 5FBLB 5IRCD 1R4AA 3T5DA 3AEZA 2ODBA 1KKLA 2D7DA 1KO8A 4IEEA 1MKYA 3HR7A 3QJYA 1II0A 3EZ7A 1E2LA 1E1QA 4LHYA 3DEFA 3N5CA 1IXRC 1KDTA 4ACBA 1M7HA 2IS4A 3VR1A 3SOPA 2G88A 1GNRA 3LXXA 4PPFA 4B48A 1R8QA 4NKRA 5AJZA 4IOMA 1DELA 2GXAA 1SVIA 1I2MA 4RZ3A 4DC9A 4UJ3A 3ZD7A 2VSFA 4IVQA 4OQFA 1XMIA 2CBZA 4XD7D 1XRJA 3QI2A 2ZTSA 3ZVLA 2BDTA 3I8SA 4II7A 2FNAA 4XWKA 2P3SA 3QXJA 4PSKA 3WMEA 3NKVA 3ZZUA 3ZVRA 1G9XA 4UNQA 3IQWA 1DAIA 3AQ4A 4WZ6A 4QGGA 1R0ZA 2PJRA 3CIOA 5KSPA 1E1RD 3KQHA 4D26A 2RGBA 2FFBA 1GL9B 3LA6A 1ZC4A 2F1HA 4JJKA 6Q21A 2WKQA 4B6EA 4JKIA 3UG7A 4MGKR 4V0KA 2ZUDA 1UM8A 5LD2C 1GL7A 3CX7A 4M9SA 4D80A 1SVSA 2PCJA 4EDHA 2NGRA 4HB0A 2FU5C 2XXAA 1N6KA 2H92A 2R6CA 4IFEA 2ATVA 1NY5A 2OFOA 3IUYA 4PQYA 1ZCAA 1QF9A 2RHMA 4P4SB 1Z06A 1DE0A 4HLUC 1TQ6A 3LLUA 1W46A 5CYPA 1Z8FA 5HTKA 2K5UA 1UAAA 3RS2A 4DCNA 1S4QA 2FMXA 1KTVA 3WRXC 1K5DA 1A5TA 4DLUA 4LBVA 3CNLA 3SBEA 1HA3A 4LSGA 2QQ0A 3C14C 1SGWA 2OO7A 2ZE7A 5TV2A 2IS6A 2GAOA 1XBTA 2I1QA 4B3FX 3MWYW 3PUVA 5KSOA 4LJ4A 1OIVA 2DR3A 4LBWA 1XXHE 4M21A 1GILA 1WBBA 1E1QD 2XEXA 1E2JA 2QTVB 2RB4A 4MUAA 4KFRA 1OV4A 2V6JA 4D2IA 1DBSA 1EFTA 2YHSA 3VU9A 2MMGA 1KI2A 1RJ9B 3PVSA 2IEZA 3T06B 3ZS8A 1NIPA 1NIJA 3JZAA 4K8OA 1ZNZA 1KO1A 4Q02A 2GEVA 4TL8A 4JVLA 4YC7A 3U5ZB 1FMJA 2JLSA 2WSMA 1L7VC 2ERYA 1KDOA 3AKDA 1S8FA 1X6VA 1U9IC 4YXWA 4C2UA 1CJVC 2EFGA 2LCFA 2R6FA 2OAP1 1KOFA 4M8NE 3RSOA 5JEEA 3KXIA 3RVBA 5HE8A 5FOWA 2CL0X 2J41A 4RFVA 2C78A 2WKRA 4FMDF 3C7KA 3KQUA 4BASA 2XTMA 4C7OA 3IHWA 1G7CA 1R5OA 3UG6A 2YYZA 2GJ8A 3Q72A 2IYZA 1HE1C 3WP1B 4A82A 2H8KA 4PO1A 2WTUA 1ANKA 3LW7A 3AH8A 3Q5DA 4PSVA 1F5NA 1JPJA 2D2EA 2Q6TA 3HDTA 4MGZR 5FOUA 3VMFA 421PA 4QRHA 1E2EA 3H0KA 3UWKA 2GF0A 4QC2A 1DS6A 1NP6A 4L4UA 1XTKA 4JLJA 3D7MA 2QAGA 2ODWA 1XMVA 4FW9A 4DLXA 5BN3A 3VNUA 2Q9AA 4WBSA 1FX0A 1PVOA 2ZRAA 2EWVA 2OILA 4NCHA 3LFUA 3R20A 5UKDA 4JL5A 4HLDA 4NL4H 4OI1A 3W34A 4RFSA 3UATA 5C18A 1KK2A 1Z2CA 1MO5A 1G6OA 1YRBA 3GLFB 3CO5A 3TK1A 3T35A 4BEJA 3AVOA 3AF0A 2XSZD 4YONB 5L3SA 2X19A 4G5GA 5JBQA 4B34A 2J0VA 3FMOB 4QM6A 3V4RA 3AUXA 2BM1A 2BMJA 4HAVA 1UDXA 4JZKA 1XP8A 1E2HA 4YLGA 1C4OA 3L0PA 4HEJA 1LS1A 2CL7X 2GKSA 3BRWD 3CR7A 1H8HD 2ZRGA 1E99A 1ZD8A 4YDSA 5K8LA 2CE7A 3LO5A 1XEFA 1ZM7A 5SZJA 1GM5A 2ZSBA 521PA 4ASUA 2FV8A 3K70B 2JIZD 3U4QB 1EFRA 3SFZA 3BORA 1ZUHA 2WPDA 3P26A 5FTJA 1JJ7A 5G40A 1I4LD 4BLTA 2RGNA 5H68A 1Z0KA 1EWQA 4Q9KA 2WJIA 4ON9A 1EWRA 4KHZA 2J46A 4B76A 1Q20A 4LYJA 5F9FA 4Q7KA 4PR0A 2CLCX 3RS0A 5FH9A 4RD3A 4JLAA 4MYHA 4YMTA 2QRZA 2FPKA 2A5JA 5EUMA 2R6AA 3MD0A 1UBFA 4UNSA 4WZAE 5FPTA 4DJTA 3DL0A 1N25A 2ZS9A 2E9SA 4TL6A 4BUJA 4WXRA 4URXR 2QEQA 1SVKA 3RHFA 3W3AA 2YOHA 1KHTA 3R7WB 1GL6A 3GJ5A 3B9PA 4H1VA 2EFEB 5DI9A 4CEHA 2OHFA 2G0TA 1P75A 2QRNA 4JLPA 5EQTA 1XEWX 2FEOA 4C0QC 3A4LA 1T3HA 4F4IA 1JAIA 3TRFA 4MDFA 1Z08A 1XTRA 4Q4HB 5D3QA 4B33A 5CITA 1TEXA 1G7TA 1N6HA 1YZUA 1Z0DA 2J1LA 3SQXA 4ZDKA 2UVQA 4RD4A 1Q1ZA 5CK4A 1E2QA 4A9AA 1QHHA 3KKPA 2BV3A 5ELXA 1S9HA 3R7WA 2W6IA 1XCMA 3ZJYA 1TF5A 4UKDA 4GFDA 4IKEA 5GJWC 4Q9JA 4GNKA 2R9VA 4BLSA 3P4XA 2NG1A 1ZM3A 1NVVQ 4TMVA 2XTZA 4ZDJA 1N5JA 3IEVA 1KI7A 2JJ8A 4V03A 4A92A 3FWYA 2HT1A 2ANCA 1DAKA 1XMSA 1H65A 2IYTA 4A8JA 4Q9LA 1KK3A 2IF2A 5EXXA 3R8CA 3G82C 3PEUA 4FN5A 3KFXA 5DO9A 2IUUA 3L8YA 3THXB 1CS4C 1E9CA 4DLZA 2WHXA 4TYYA 1YJ5A 2A5YB 1ZYUA 4EPRA 1YZQA 3K0FA 4RKEA 2QAGC 3L2OB 3QKTA 2O8FA 4EPVA 3SYKA 2W00A 3FB4A 2O8BB 3FMFA 5AWFC 2O8DB 2YV5A 1G41A 2YZ2A 5DH9A 1JR3A 1AGPA 3LLMA 4WW0A 1ZNWA 4C7OB 2IXGA 1ZIOA 4JVNA 4OI0A 4PTLA 1VYUA 4DLWA 1IHUA 3G0HA 2JGNA 1T5IA 2HT6A 4FMDB 1UF9A 4TMKA 3GLGA 3N70A 3AVWA 2BMEA 4V02A 2O8CA 3AM1A 4JL8A 5AJXA 2OZEA 3A8TA 3FHTA 3WHLA 1YZNA 1RFLA 1ZM4A 1YR9A 3A36A 4PO8A 1GNPA 3BE4A 3KZ1E 3KB1A 3LQQA 4CZ2A 1G3MA 1Q22A 4Q1DA 5D3MA 1YR7A 1T0JB 1IXSB 1ZIPA 1Z29A 2QGZA 4NYIQ 1J7KA 2BM0A 4Q18A 3REGA 4QBFA 1G291 2IL1A 3VQTA 4PSAA 1W4BA 1OKKA 3GJ8A 4LYFA 5J4YA 2G1JA 4A6PA 4UXHA 3FMPB 2IYUA 5AJYA 3EPLA 4BFYA 1P73A 1H8EA 5F9HA 5AUNB 1DADA 1NLZA 1WCV1 1XJQA 3MWKA 1IXZA 1E4YA 3OF5A 4OHWA 4TWZA 2ZR9A 2V55B 3CLVA 5EP2A 5FBWB 5CM9C 4C9BA 3AB3A 4IJMA 3LV8A 3U6BA 2QE7D 4H1UA 3PIRA 1G3RA 4JT4A 3RC8A 2JLYA 4TMZA 3Q8XB 1Q12A 1UKVY 1HUQA 3AVQA 4AD8A 1FL9A 1ZNYA 4DXAA 3AVUA 2RH5A 4PANA 3DHWC 2NO0A 2CHGA 5L3VA 1XEXB 4IDNA 4EJSC 1BYUA 2AL7A 2X8AA 2CLDX 4DLVA 4BFWA 2ONKA 3IKJA 3UIEA 4EFNA 1E9SA 2RGAA 3EWSA 3QENA 1XD9A 4OK5A 1WXQA 5L3QA 2PMDA 3RRYA 2ODNA 1EXMA 4RKFA 3RDPA 2IYSA 2ZS7A 2CVFA 2GNOA 1AKYA 2V4ZA 3BFVA 3DOFA 3ND9A 1HT1E 4A0FA 2VP5A 2GETA 3E5HA 2IHBA 1AN0A 1U0HC 2GILA 3GQBA 1UDWA 3AV0B 1PV4A 1MH1A 2VLIA 1JJVA 1OIWA 3U60B 3GFOA 3DZDA 2XGJA 2HJGA 3I5XA 3VX4A 1SKQA 1HURA 2C99A 1MV5A 2ZVPX 4Z8YA 3ZS9A 4Q47A 2W0MA 1SXJC 4ZI3A 4I1UA 5DI3B 1C9KA 1QVRA 1NMXA 4Q7LA 3T15A 3TR5A 2DHRA 4I1SA 4H9GA 1U94A 2A5FA 3REFA 1J2JA 2CCKA 1Q44A 2CMKA 5EP3A 2YOGA 4GL2A 1ESNA 5KUTA 1HT2E 1GAJA 4QGHA 1OPXA 4ASUD 4P3YA 3X1WA 3KTAB 1OXVA 1U0JA 2JIZA 2F1IA 2WPDD 2AKYA 2DWQA 4HDOB 2ZRNA 4MYTA 2IUTA 4CEJA 4DDWA 3EWAA 4KFSA 2OLKA 3WYAA 4WIAA 3IPXA 2VL7A 2H5EA 3K9LA 3QKSA 2QTFA 5IHPA 1E2MA 3NHAA 3D8BA 4LOAA 4W9MC 2NMVA 3D31A 4KBFA 4MRNA 4PHHA 2QE7A 3SN6A 2BHRA 2DBYA 2D74A 2YVUA 5FOTA 4PAQA 4EIWA 3T5GA 4IOKA 4B47A 3GLHE 4JIMA 1WDTA 2IA5A 1PUIA 3WHKA 4TQUS 1WP9A 3H84A 4A0RA 2VP2A 5LB2A 2XZOA 3K70D 5GJVC 1C1YA 1FQJA 3WRYC 2R44A 2NIPA 1UBCA 1XCPA 3T61A 4GOXA 1KI1A 3GJ6A 4E09A 5FR2A 2O8EA 1DTSA 2FZLA 2ZR0A 2JLUA 1G6HA 1VCMA 2ZRMA 2A7QA 3LQRA 4IEIA 4NYMR 4LWZA 5JJIA 1KK1A 2ZI9A 1OT3A 4TL7A 5JLJA 4QGAA 4W5HA 1M74A 4AG6A 5G3YA 3EARA 3CH4B 4V0LA 1J70A 2E87A 2UZ3A 3W9YA 4D4LA 1P2VA 1DO2A 2WJHA 1N5KA 4BFVA 3B78A 1HV8A 3K1JA 4MRSA 4BPBA 1NVUQ 4BFZA 5KDDA 4C0KA 1NF3A 3THXA 2GESA 1QG4A 3S1AB 5JSZA 4AK9A 4TZ0A 2XNSA 3PR1A 2W0SA 5KPDA 4Q21A 1BIFA 4UJ5A 1QVAA 2ZI7A 1DEKA 1R5BA 2WIAA 3WNDA 3GLFE 4DKXA 1XF9A 1YZGA 2ZQ5A 2G6BA 2W83A 4Q9IA 5HCNA 3PUYA 2PX0A 4TZ6A 2XNDD 3FOZA 1QG2A 2BVNA 2NOAA 2OE2A 3MWJA 4NYIR 5FUWA 1AM4D 2F7SA 2O8BA 3FVQA 3KQKA 1FOEB 3U2QA 3AF2A 2QMOA 1G16A 3F0TA 2PLRA 4B3CA 4OQNA 3IO5A 4ZPXA 4M9ZA 2FPMA 4KJZA 1IN8A 1F6BA 1G5PA 2VTKA 3QF4B 3K9NA 4IHQA 3EAQA 3I72A 4G5OA 1IQPA 3TMKA 3QKRA 4BFSA 5EE5B 3X1DA 1KJZA 3P1JA 2V6IA 4E22A 1OXUA 1T3LA 2BMDA 4MKHA 2IYWA 4Q1FA 4ABYA 1PZNA 4DWJA 3Q3JB 2YJTD 4NYJQ 1G8GA 1AJEA 1PJRA 1GZSA 3VKHA 3R8FA 4EUNA 3PG5A 5AJVB 5KNBA 3SU8A 1DAGA 4HI0E 2ZUBA 1WB9A 3H4MA 2B8TA 4JLKA 1E4VA 1KYIA 4YMSA 3W6PA 3VKWA 1G64A 1E69A 4HAUA 1ZMXA 1N0UA 2RKOA 1YZTA 4KSBA 5DISB 4Z1MD 3EA5A 1D2NA 2VHCA 2P6RA 1VYTA 5FTKA 1E2GA 3F8TA 3W5JA 1G1MA 1A4RA 4NE2A 1XB2A 2VHUA 4WXPA 3BK7A 3KDSE 1KI3A 1Q3TA 2FOLA 1JR3D 1N0VC 2G1KA 4DLYA 2ZRPA 1GWNA 3WYFA 1SXJE 2XX3A 3DZ8A 4OQXA 2EYUA 3GMTA 4DIEA 2FFQA 5K8UA 2GBLC 2WOOA 2G77B 2PBRA 1ZD1A 3B1WA 2H7VA 3FHCB 2EU8A 4V0OA 4Q4AB 2W2VA 4G5QA 1E9EA 4QG7A 1GDDA 3IO3A 3K0SA 5FTNA 3U4QA 4DB2A 5TB5A 4WZBE 2BC9A 2AN9A 3SJZA 3A1UA 2Q3HA 4IDOA 4ZO4A 3U61B 1Q57A 1B0UA 1UEIA 1K6MA 3OEHA 2HCJB 5P21A 1RPZA 3PQCA 5CJ2A 3TQFA 2DWPA 2HV8A 3GJ7A 3HYTA 4B35A 4RCZA 1OKKD 4B73A 5JS8A 4LZZA 3SYLA 2X1VA 2X2EA 1G17A 2OESA 3DM5A 4CF7A 4XD7A 1F60A 5EE0A 4LI0A 5H1YA 1HTWA 1OW3B 3Q7PA 1N2CE 5J4KA 4KU4A 2DFNA 2ZJ5A 4M1MA 4V0NA 1AS3A 3IILA 3ECCA 5BWMA 2KBFA 2ZITA 3O8DA 4EKDA 1OH7A 3W3ZB 4ZI2A 3HU1A 1N5IA 3GCGA 4Q1AA 4QJ5A 1OIXA 1W4AA 1N3BA 5EXTA 5DYGA 3K0AA 4OBEA 4BLQA 3NH6A 2FFAA 2EVWX 2JDIA 3KUDA 4F93B 3JVVA 3T1QA 3RLFA 4G5RA 3N2IA 3B85A 3QQ5A 2REXB 4CIDA 4QJ3A 1QHGA 4HUQB 2QT0A 2OG2A 3NWJA 4IDQA 4F38A 4R98A 4Z1MA 2J45A 2GXUA 2ZSDA 4BFTA 3ZQ6A 3MAAC 4HLCA 5J5CA 1KZGB 5G41A 4TTQA 3FPAA 2WWIA 1OF1A 5KPJA 2C9YA 2QP4A 3J81k 1FZQA 1ODFA 2X2FA 3N2EA 4US0R 1J90A 2GXSA 4LBZA 3R9WA 3UKDA 4FMBB 3MGCA 4FWTA 2XJ4A 3NC0C 4P31A 4BZXA 1SQ5A 5EXSA 5TY0A 1WQ1R 1G8FA 1P7CA 1ZUIA 3QEJA 4FCTA 1COWD 2FJUA 4IOJA 2XOKA 1N6OA 1P2SA 3GJXC 3HU2A 4QBIA 3ICQB 2DY1A 1VIAA 4ZKEA 1Y3AA 1VYVA 2HCBA 4HDCA 3E70C 1T91A 2NPIA 3MFYA 4LHZA 3EPKA 4X8LA 2OSBA 4GOKA 4TLCA 3IIJA 3L82B 2IS2A 3X1ZA 3HPQA 2WJJA 2ZSFA 2FE4A 3U7FB 1G5TA 4GPTA 2WKPA 1Z28A 2E1RA 3PUXA 4B2LA 3M0EA 3UPUA 2QSYA 1HE8B 3LVQE 1ZJ6A 4UQOA 3AF3A 3CWZA 3H86A 1GSIA 4GRAA 4HDQB 1QBKC 4NMMA 3RRNA 4YXWD 4RD2A 2F43A 3U44A 3B5JA 4L16A 4XSHA 2OFXA 3WMGA 2ZE8A 4JLMA 1YR6A 3KQLA 2W58A 3NVAA 2J0UA 1ZBDA 1D5CA 1A1VA 1KK0A 1VPLA 1Z47A 4LY6A 3NBFA 2FEMA 2R65A 5AUQA 3T1VA 3HR8A 1RYHA 2FPLA 3VR5A 3U7HB 1MO4A 3NEJA 3PXGA 4KXFB 2NO6A 3SJCA 2AFIE 2QTHA 3SNHA 1GITA 4N1AA 4C2TA 4TT3A 1CRPA 1W2GA 2HEIA 1JR6A 4LUCA 4WOPA 2ZJOA 1P5ZB 4PQRA 3M1IA 1OYWA 2ODEA 3IEUA 4DDVA 1RRGA 1FP6A 4YMUA 4P4UA 3P4YA 1XEXA 2ASEA 3CPHA 1XMJA 2AFHE 2WJGA 3MJRA 3GLIB 3AKCA 3BIFA 2EFCB 4Q7JB 1D6JA 4XJXA 4D0LB 1E2PA 4ILEA 2VHQA 4B44A 1RYFA 2IHYA 1O3YA 3C41J 1E9RA 2R62A 2VBCA 2EW1A 1G7RA 2RGCA 4KBGA 1ZD9A 3SJAA 3NDPA 3ZDQA 1AA3A 5C1BA 3KL4A 4D25A 1M6NA 1E6CA 2V7QD 5FUVA 1IJEA 2O8CB 2QT1A 4F7WA 1G3UA 3FMIA 2WWHA 4FCVA 4DT1B 2ZUCA 4TQAA 4PC6A 4E07A 4KYUA 1OXSC 2D62A 3SBDA 3U3RA 4A2QA 1XWIA 3AVXA 4ITRC 2HF9A 2QM7A 2QPAA 2AWNA 3LH5A 4NBSA 4B2PA 5DN6D 1QRAA 1WRBA 1AA9A 1LS6A 4PFSA 5F2EA 3UK6A 4A2WA 4DSUA 4Q4AA 1H8HA 1XTIA 3GEIA 2RMKA 3SI7A 2XNDA 3CH5A 3THWB 3VR3A 2VHJA 1F48A 2RGGA 1D9ZA 1N6NA 2GJ9A 2PZGA 4HAXA 3U7EB 3KQNA 1W36C 2BJWA 1B23P 5H8WA 1KJYA 2ZJ8A 2IUSA 3QIAA 4LV8B 1JEEA 3ADKA 4EAQA 4YMWA 3QPUA 3JZMA 3C16C 3LRPA 3K0CA 1S96A 3OEEA 1KAOA 1CU1A 4CT5A 1YE8A 3RYTC 1U2RA 3PEWA 3AKYA 3NBYC 4JVMA 5C46F 2QBYA 1Z22A 5DHFA 2D06A 4EPTA 2P5SA 3BB1A 4L9WA 1G8YA 3OEHD 1U8ZA 2D2FA 4LPSA 5AJWA 4JYCA 4Q4HA 1VCNA 1YKSA 1W0JD 1KMHB 3MWLA 4FMCF 3QVUA 4LJYA 2A5DA 1EG7A 2CNWA 2P6NA 2ZRHA 3GFTA 5EUQB 3UMFA 5JMTA 1NBMD 1UKZA 3VTKA 1AKEA 1SVMA 2CVHA 2ZJZA 4PX9A 1NMYA 3DVLA 1OFHA 4UNRA 1E0JA 4URZR 3SEAA 3DMDA 2FSGA 3X1YA 5JRJA 3T1TA 3V4FA 2JLWA 1Z2AA 2W6ID 4Q4JA 5FOSA 4DVGA 3ZLJA 2VF7A 5EXPA 4M1YA 4C0SA 3EPHA 1QHHB 1KI4A 3QNUA 1MOZA 4DBLC 3ZZ0A 5J4HA 2QPTA 4AYXA 3AP1A 1CLUA 4Q4LA 2A5GA 4NPHA 1VCIA 3MUFA 4F91B 3GJ0A 1Z6YA 1Z6XA 4EJSA 2W6JA 4DDUA 1TMKA 3BS4A 4WAUA 1AK2A 1KNXA 2BJVA 3TAHA 5GVSA 3IHLA 3QOFA 1XPUA 4AY2A 3P32A 1DAFA 3TBKA 2OBNA 4S35A 3MMPA 1PLJA 1XDBA 2GCOB 2ZRFA 4LJ8A 1SKYE 2SHKA 4M1SA 4Q00A 2IWRA 3UXMA 5E3HA 3BJIC 2CLSA 3WXMA 1E96A 4KLZA 1JB1A 1JNYA 1CJMA 4BGDA 4Q03A 1HQCA 3LWNA 3QE0A 3KUCA 2P2LA 4RY2A 2QENA 1R0XA 1Q0UA 1ZINA 4X8HA 4O0MA 4W7SA 2JLZA 3SZRA 4MRVA 1A82A 821PA 3QVVA 1FUUA 2XOKD 1KSHA 4W5JA 3CM0A 4M1WA 1HEIA 1YHNA 1YZKA 4L15A 1E9FA 4DDTA 4R2IA 4BFUA 2J7PA 1F2TA 1T9HA 2I3BA 3OIVA 4B2IA 4TYQA 4MUBA 2WWXA 1GRQA 1W0JA 3WP0A 2F6RA 4JJZA 2LKDA 3D6TB 2XITA 2ZRKA 2BBWA 4TLBA 3B1XA 1KY3A 4W5WA 1BOFA 5DE3A 2XAUA 3AGPA 2QQEA 4GOJA 4E5UA 2BIFA 2WV9A 5IF9A 1CTQA 2IYRA 1ZU5A 4RSGA 1E9DA 4XWAA 4TLAA 4BFXA 2FN4A 2Z4SA 3IQXA 1ESMA 1R5NA 1MO3A 3PUWA 4GP6A 5M04A 1CRQA 721PA 4C30A 3THOA 4HAZA 4CEIA 2QZ4A 4L9SA 3B6EA 4AKEA 2GCOA 3TVDA 1TUIA 4QNRA 1E32A 2QAGB 2IYQA 4TT3D 2C95A 1AQYA 1OHHA 2IWHA 2CCJA 3BB4A 2ZEJA 3TGPA 4DHEA 3QSYA 4JT2A 4ACAA 3DO6A 5TXGA 2RHDA 5KNCA 3MJHA 2IW3A 2PEZA 2HXSA 4G5SA 2HLDA 2NO7A 2EYQA 3GEEA 3EC1A 4B3DA 1YVDA 4EFMA 3U3OA 2QG6A 1COWA 3DM9B 4TLDA 2ZE5A 2W2XA 1ZRHA 3W6NA 1D2MA 1F2UB 3PITA 1GP2A 1L4YA 2DYKA 1NKSA 2OFWA 3KJEA 4AKIA 2I1VB 1OXXK 2Q9CA 1R6BX 4KVGA 1QHSA 3QG1A 1AZTA 1Y63A 4FXPA 4Q7MB 2YWEA 3NEYA 3L0SA 3QKRB 1E79D 4LBYA 4RD1A
chains in the Genus database with same CATH superfamily
3HO1A 2APJA 1CUAA 1KY2A 1E9VA 1UZMA 1ZHFA 2D0PB 2LDBA 3WQSB 4XVUA 5JAHA 2D3WA 4LRWA 1KMHA 4AO7A 2N1MA 1DHRA 1G18A 4LNAA 1B1CA 1VPVA 2CZQA 2QE6A 4FMCB 3JD4A 4IIDA 1EESA 3L8HA 2WB2A 1MABB 4ZI7B 5FWDA 1F1JA 2XVAA 2HN9A 3T9AA 1TGVA 3ETEA 2GYVA 1L5ZA 2IXTA 3TIXB 1S02A 3A9RA 3UNXA 1TIBA 5U4QA 1O57A 1RIIA 3G02A 4OU5A 5B30A 1H66A 3E58A 4RDIA 3BF8A 4KR2A 1J1UA 4HQ0A 1O97D 2VJNA 3PNYA 5HP4A 1C0PA 1P4AA 1RJGA 1NATA 5B3KA 2YWJA 3OKPA 2PX3A 1DPGA 5AJTA 3JAMA 2EXXA 1WVMA 3HUTA 2X9LA 3SM3A 3UYKA 1SCQA 2Q1UA 2XF8A 1O9BA 2YJ4A 5KBYA 5IBPA 1J42A 4KO8A 2SICE 3KJQA 2FY8A 5HPYB 3QF7A 4YYZA 2RGXA 3DQZA 3H3XA 4BWVA 3VU0A 4WI1A 1H0RA 1KQOA 2VH5R 2ECOA 1KVSA 2YNMA 1X7XA 1B6SA 3Q3CA 1TK9A 2YJNA 3CT6A 2PZFA 4DUPA 5BW6B 1CZNA 4NK4A 2ZPAA 3EA0A 3S2GA 3AFOA 4R1MA 3GAMA 5JAMA 4IVRA 3QI7A 5A9TA 3O2SB 4NYMQ 2R6DA 2B6NA 3G8YA 1HQKA 2ZJAA 2AFIB 2ZW9A 4QFDA 3AP3A 2OYRA 1EK0A 3GMDA 1WPGA 3M9LA 5C4GB 2QTRA 2WA1A 5JCZA 1J99A 1V8BA 2AVNA 2XMZA 4LGMA 3HO6A 3OTQA 4UXIA 2JVJA 1N2BA 2I6FA 3OLXA 3PVZA 1XPJA 4G56A 4MARA 4NONA 1NG1A 1FFCA 2NW6A 3B1VA 3DTYA 4X0EA 1JYSA 4DQDA 3AR6A 4JLDA 3E2PA 3F5MA 4WKBA 1F3OA 4F5DA 4CFZA 1KZ9A 4UPVA 1ID8A 1LVGA 3TNDA 4DA9A 1YS4A 3D6MA 2VJBA 4MS1B 4OKSA 4P7BA 3RKUA 1R6DA 3CRW1 1M6VA 1BH6A 2VS1A 3PDIA 3PGA1 3LPMA 3QBTA 2OXIA 5KDLA 3RVLA 3ZQJA 4EKYA 2Q46A 2A9FA 2JGIA 4ETWA 1PWEA 1VZ3A 2QTBA 4QD3A 3LS2A 1ELOA 3BEOA 4UOEA 3RAGA 5FNVB 1EFCA 2QN6A 2RHLA 3ZWDA 2B0JA 4YB8A 4JNKA 4PX2A 3OZEA 5BVHA 2A1UA 4N0EA 4EO9A 3K4HA 2OV1A 2QN3A 3FVRA 1C3OB 2YHUA 3R74A 3OQHA 4HTFA 3NTXA 3VX3A 3OQNA 3E84A 3K1AA 3MINA 4O2LA 5LFAA 3LNCA 5LUBA 3SIPA 5I5GA 3L1UA 1NSFA 1DO0A 2WD7B 3S7ZA 3UWOA 3KZCA 5BSTA 1ZI9A 1ZKDA 3Q2OA 1DEAA 3LK7A 3I83A 1Y42X 5DM1A 1S0UA 7REQA 1I3CA 5CW1A 3IELA 5EXEA 2X15A 3G1WA 4G85A 3IALA 3CA8A 3TFQA 3WRWA 1MJHA 2CNWD 5ENZA 3TRDA 3WOVA 3EGVA 1T8TA 2B94A 2HD4A 3AWIA 3PHCA 4H1HA 4QPPA 4D56A 5JATA 4AZTA 3IJ5A 3GA0A 1AHNA 2WIGA 4C6HA 4PCUA 3AR3A 2AA3A 4N7RA 4NYJR 1EK6A 4B80A 1CEEA 4OVKA 1RZ3A 5A71A 2GJAA 1C9EA 3G2NA 3ACDA 5EE3A 5SICE 4AXXA 2D5BA 3L1HA 5ALFA 4HQRA 1IM2A 3LUBA 5E1MA 3B5EA 3FMVA 1ZXXA 4ZCIA 2XJ9A 1RZRD 2UDPA 4ZAGA 3VKGA 1ZWLA 2I71A 4TVBA 2WYOA 3B82A 5BN4B 3L4EA 3ABZA 2QTVA 4EECA 2CD9A 2WD8A 4OYHA 1EAYA 2YHBA 3C97A 5C9ZA 1NURA 3D1JA 2M1ZA 4GQAA 4UZSA 3EHDA 1NVWQ 3FOWA 3MB5A 1U8AA 2DQYA 3Q8WA 3SKYA 4BS9A 2C0CA 1SRRA 3HXLA 1V5GA 2BEKA 3LXRA 4HDRB 1KTIA 1EEXB 3GEMA 1T5SA 2BGLA 2IYLD 3BXOA 4U6QA 4URVR 1NLMA 3S29A 1O8BA 3LHIA 2E4WA 2ZBDA 3LZDA 3M6VA 2M9MA 2QP3A 4WZBA 1NJSA 1QH1A 1UAGA 2JLRA 3KJNA 3NXSA 4PSCA 1P3JA 4B5KA 4OLHA 3TOXA 1CDOA 1ES9A 2G04A 2AJBA 1OFTA 2GAAA 2J3EA 2YJ5A 3IV6A 2VR1A 3OCJA 3UAZA 1NG9A 2QTLA 2YV4A 5IK2A 3P0IA 4FIZA 5C2JB 3PGXA 5HKOA 1X1BA 3EMBA 5FYQA 1GPMA 2XVMA 4NP6A 5KZMB 1X7DA 4CU2A 1UP7A 3OHMA 3L49A 4FYPA 3FVVA 3LO8A 4KSCA 1PR0A 2OKGA 3H9JA 5FI0B 4AYTA 2GCGA 4P92A 5IUNC 2H7XA 2WMNB 5CB4B 4KYTA 1TL7C 2PLFA 3AM5A 4JXXA 2ZPTX 1PQYA 3OOSA 2EEPA 4L5CA 4N40A 2PU7A 4RZ2A 5CTJA 2QPLA 5LNK6 1WSDA 2BEWA 3H2IA 1NM5A 4B5LA 4PYMA 1Z88A 2B4RO 2ZCVA 1XDDA 4TVOA 1ZL2A 3R5XA 4MKIA 3QXSA 1MRSA 4OB6A 4Z7JA 2I8AA 4YBRA 4U6NA 3UMSA 3ONDA 3ZBPA 4X60A 3KPUA 1KFJB 1U8TA 1Y6ZA 2VYVD 3VHXA 3WGYA 1N6PA 3FGNA 1JH9A 1BFKA 1RS0A 1WY7A 1JWAB 1W34A 3B5IA 4NZMA 4QM7A 5HA5A 4ALKA 1LX7A 3K09C 4OX9B 4CQMD 4MPPA 1AS2A 1GGJA 4KC0A 1M1YE 2YQZA 3CKLA 3OU2A 3C3YA 5EP1A 1XU9A 4ZEWA 3V2HA 1EBFA 1XK6A 3ELUA 2XZLA 3SWWA 5BQOA 1D6SA 5I8ZA 5KOYA 4DLRA 1KY5A 1ID1A 4ZGBA 3GARA 5BWOA 3B52X 4YT5A 4WY8A 2VHZA 2JLQA 3QFHA 3R0VA 1RAFA 3WNQA 3PDWA 5JDIC 1VRCA 1AGXA 5DLPA 1ONOA 1BD4A 3CNOA 1EMDA 1PNOA 4X61A 3I04M 4L8FA 5I9SA 5TGZA 2J5KA 3GNQA 2FEXA 1R9NA 2C4KA 2VXOA 2ZTMA 1Y9EA 1Y6QA 1BVYF 2XMGA 2AE1A 3RH0A 2VWHA 4PG6A 5DV9A 5TQ2A 5A1TA 1IOZA 2W7TA 1JECA 1PT6A 1PZMA 3G9UA 4U2KA 1ZD5A 4HGQA 4EITA 1YGPA 2GHIA 5IAEA 4YIHA 1YZHA 1OYYA 4ZT4A 1NQTA 5FT9A 1PJSA 1FE8A 1HG0A 1WNFA 3NP9A 2O7VA 4JVOA 1K3FA 5A5GA 4B3TB 1AHHA 2C3YA 3CR3C 2BCJQ 3EOZA 3FZYA 3QFSA 4EYSA 1HFWA 2B61A 5B57C 3BWCA 2W6MA 3QUSA 1XXHB 4CKWA 4L4YA 1BNCA 3DOCA 2AXPA 2NSJA 1QGOA 4C1BA 3IVMA 3WGUA 4CEHB 1JR3E 2IYYA 4HZGA 2X6RA 3KZVA 1JAZA 1SJ9A 3ON5A 4MW6A 2RGDA 5D1HA 1IN7A 2JI6A 4FN4A 1QCDA 3AHFA 3ILYA 4M36A 4OQLA 3TRIA 3GBPA 3U4DA 1CY7A 1T6ZA 1WV0A 1V26A 4JSTA 4CLXA 4FILA 5FO1A 2IDJA 4BZZA 1KMIY 2WVHA 2ZJ0A 5AH0A 4PWYA 2G09A 1F3LA 5IYZF 1Y7IA 2ZRDA 1PNQA 4IV5A 2AMFA 4ENVA 9ABPA 1AQJA 2H17A 1UIMA 3EGXB 1JMYA 3G9XA 4BFLA 3OZVA 4FFWA 5HE9A 3WJ2A 1QHIA 5HILA 1T8UA 4OHFA 4UM8B 3IGFA 2PZAA 5NLLA 1S2NA 1NUTA 4PLPA 1JALA 3KQQA 3K30A 8AT1A 1OWLA 2HYDA 1B8VA 1XDWA 3RC1A 2NU9A 4D4JA 1U7XA 3RYCA 3OPXA 1ACLA 1I4TD 2CVPA 2HMSA 4UNNA 5CW2A 2XT9A 2YWGA 3UXHA 3PIDA 2F55A 5DKFA 5A5EA 1VRWA 3GJ4A 2WAYA 5AHRA 2Z8YM 2GK6A 1R0LA 1WO8A 3GD7A 1US8A 2AYYA 3BA6A 3OAAA 1ZI6A 2YWFA 4NFSA 2BGJA 4ZRMA 5E8JA 3QTTA 1UPXA 4HWOA 4M60A 4WFJA 3TNFA 3WLFA 3SDZA 2WI8A 4FE4A 5HQ3B 2MSNA 4ND5A 3I9JA 1UQTA 2FE1A 1YL6A 1TM3E 2FHSA 1RLTA 5IANA 4ZVTA 2JIPA 3BUSA 3JR3A 2DH6A 2OBBA 1XTQA 3H75A 2SKDA 4EBBA 5DBOA 3OQ6A 4NOMA 1TTTA 4LJ9A 3R0ZA 4J2TA 1XT6A 1K0FA 5JAUA 4DR6B 2CJPA 3LBYA 1ZGAA 4RELA 3OC0A 3FWKA 1CVRA 2HQ1A 4BVFA 2XV1A 1XNRB 3WQHA 1TKRA 3VO9A 3VSAA 4A73A 3L07A 5BPFA 2BELA 3B20A 3SE0A 2FFHA 3AEUA 4N8EA 4PEVA 4WJLA 3UB2A 4Y2VA 1LPBB 1W2HA 1T9ZA 4FGWA 3T7EA 3SZLA 2ORIA 1JHRA 2PUFA 4M8LA 4O2BB 1X8JA 3I1FA 1X7ZB 4MWBA 5FUYA 1F1BA 4M1KA 1B93A 1V5FA 2KSQA 2WLTA 3PP8A 4BUCA 5TMPA 2OLJA 4Q9DA 3W5HA 1D09A 1MGPA 1R0RE 4MLCA 3R6LA 5EZ6B 3W7VA 1Z5OA 3PWSA 4TTTS 3WDKA 1QGUA 1CDZA 2VP0A 5I7FA 4J1QA 3K7EA 1CQXA 2A58A 2GHQA 1CUHA 5LZ7A 3FFXA 3OHPA 3WLKX 5AIBA 5JJCA 2J3MA 4LPKA 1NRXA 1CUVA 1WD7A 4I9FA 4L5AA 3QLJA 4LRYA 2Q4OA 2JEOA 2C2XA 3STWA 2RH4A 4UBKA 5LLTA 1E6MA 3PNSA 4CQLA 1DLJA 4BL5A 4FI3C 2AE2A 3UEOA 3MSXA 3GYBA 1H6AA 1XVUA 1EK2A 3OEED 4QUEA 2LWIA 5F2KA 1KYWA 4J03A 5FULA 4RXTA 4CFYA 2C5BA 2I4OA 2OC9A 3Q10A 4LNUA 4E88A 3F9CA 2ZRCA 2FZEA 2PIDA 4K9PA 2HK6A 4QFBA 4RNCA 5F1KA 5JV5A 5E0OA 1X1RA 3BFXA 1K5GA 5HKKA 1QV7A 1RJ9A 5ALNA 2FPGA 3MW8A 3QFTA 1OAOA 5EYPA 5BV7A 3G6KA 3ESQA 2ENWA 5EERA 4UOZA 1X8KA 2Q3BA 1SXJB 1E89A 2CHFA 1J00A 2IHJA 2IY8A 1QB8A 2QXTA 4G23A 4CTMA 3PX7A 1A76A 1Y5NA 4HAWA 3E1KA 3FWNA 4FYIA 3N8KA 2OG1A 3ESDA 1VBMA 3X1JA 2CXTA 1PQ4A 2E48A 3PC4A 4H1WA 3ZVMA 3A10A 4OX9Y 4FSDA 2COEA 4HGOA 5J2UB 1YCFA 3AUFA 3B13B 2EGHA 3GEHA 3R7SA 4C0BA 4CDMA 5K0FA 1ZW6A 2DUUA 1P31A 2JHCA 4JT8A 1XA3A 4TZTA 4DCUA 1S9DA 4KQ6A 1KEZA 1H6CA 1UPCA 1BJTA 1DXQA 4ZO7A 1UC5B 4JJEA 4QWWA 4ZQHA 5ECYA 3FUUA 1FVHA 1NDUA 3L7NA 3T34A 4UM5A 3SQMA 2IXDA 3KTAA 1M2OB 3IQDB 4ZO6A 4QUIA 1C7QA 4B0PA 3QTBA 3K0KA 3F7NA 4E3ZA 2R7NA 3HDGA 3AUSA 3VR6D 2OBFA 4AS3A 2REOA 5K03A 5CEJA 1K75A 2DFKB 4QE3A 4QFMA 221PA 2EG5A 4M0LA 2R00A 2GFIA 4K9MA 4U4AA 4YRQA 5SYMA 2Q5IA 3RFUA 3RJ5A 1LY1A 3U3XA 5B36A 1K68A 2PMCA 4BTLA 3WB1A 2W6JD 4WCFC 3Q7TA 4F7DA 4CLOA 1EIWA 4XB1A 1NR1A 3MRTA 4DWOA 3H9UA 3KM0A 1ECPA 4AW9A 4CDRA 2OD9A 1C1XA 4FR2A 2QV0A 4XUEA 2WM9B 2FSIA 4CF3A 4A8JC 3WLNA 5G0VA 4E1VA 3ESCA 1W4RA 2PTGA 4I4IA 4FFPA 4IAOA 1YBVA 2BKUA 5C8YB 1QYIA 5IYZB 3IQEA 5JS6A 5KNDH 1JI0A 1HH4A 1VIYA 5CNKA 1FP4B 3MPOA 1H22A 1DRVA 3UA3A 5KHOC 3IE0A 2Y9PB 2VRWA 1FJXA 3DBHA 1ND6A 3BFKA 1Z2PX 4HYQA 5E4FA 3ZTYA 1G8HA 4C0HA 5IJ9A 3VPFA 3T95A 3RK1A 1T0HB 2LKCA 3PFWO 2DWOA 4F9EA 7MDHA 3A9SA 4KG7A 1NV8A 1QZ3A 2KJQA 3GP3A 4RPHA 3LSTA 4CLOB 5JD5A 2CJFA 1JQBA 1T1IA 1U3GA 4OM7A 3DWFA 5F7ZA 3RVRA 4ER6A 3NWEA 1IZ8A 2R1UA 2D5AA 2Z83A 2Z8YA 4DGQA 3DOUA 3EXIB 4ZA2A 5JFGA 1X8XA 1X94A 1BOOA 4S05A 1HDRA 5JH7B 4F4DA 4PIPA 1T6XA 4UCFA 5AXDA 3WI7A 3ZJUA 4LFCB 3A4NA 3QX8A 2B92A 2PQ2A 5G53C 5HKLA 2IV3A 4HADA 4OP2A 3E1GA 3T5BA 1P5JA 1YWGO 4QHTA 1NXPA 1TADA 2JGKA 1TJ3A 2HU5A 2R60A 2ZJBA 4MV5A 3JQ9A 4BNDA 2Q2WA 1LFDB 5ESWA 3TVYA 1BCRA 3O94A 4NBRA 4MGHA 4QXAA 3VGPA 3KCNA 1Z6AA 4XVQA 2YFHA 3EB9A 2YHIB 3GRVA 4LTNA 4AIIA 4I81A 3X1XA 3RYHB 4MGYR 3MTGA 4MULA 4CPDA 3AF5A 4XX0A 1ZHOA 3DBRA 1NA5A 4JLVA 1GCAA 1HORA 1XALA 4FQ5A 4IH9A 3TQQA 4WUVA 3WBBA 1S3GA 1JR4A 4YMVA 2P78A 2QI9C 3EZ2A 5T64A 3UC5A 4AI6A 4PZZA 1XEAA 1LKZA 4YRLA 1WE2A 3CUKA 4KQXA 3LT2A 3AFHA 2GRUA 1SC6A 2JGLA 3FFBA 4V0QA 4Y9TA 4HNGA 2GUWA 2WSYB 2VJDA 3ZE2B 2OHOA 3TZQA 2CJWA 1D0IA 2C2OA 3BMCA 1KPGA 1WDKA 3N53A 3AF1A 3FYHA 1R4NB 4DLAA 1I80A 4CM6A 4F4UA 4TVSA 5IF3A 2BKEA 3DLCA 1OZAA 1P5RA 1Q2XA 3PD7A 4C76A 4IGAA 2AYZA 4X85A 3W2EA 2XYGA 2YFKA 1AB6A 3N0XA 4S04A 1NLFA 1QOPB 2DTXA 3LCUA 2C59A 1KJQA 4RY8A 3W1VA 1L5QA 4XIIA 4A8JB 4GOMD 2ZJ1A 5ALGA 3ZV3A 5HDBB 1LRKA 2ZQYA 4NRDA 4IIVA 5BUZA 4N3NA 3NJRA 1FSZA 4PBTA 4GMDA 3TS1A 3ZHVA 5CBPA 4N0DA 1IY1A 1IBCA 4GDFA 1JXOA 3BWXA 3SLRA 5JU6A 3ZHOA 3O82A 3P2MA 4I4LA 2C2KA 3NRCA 5G2OA 1YQXA 4RIGA 1FYVA 1KIFA 1JBQA 1GIAA 121PA 1WU8A 2AG1A 2JIMA 1G5HA 4LXTA 2CHVA 1G3QA 2Z08A 1E2BA 4JNCA 4IP0A 4O02B 3NPMA 3Q2KA 1CJTC 3QEOA 1DKQA 1IZ9A 1C1HA 1VL5A 1XHFA 4HWGA 4GRIA 3JD2A 3I32A 2IS1A 1O6ZA 3VU9B 4KLNA 4X1IB 3NJ4A 1PEYA 2YN2A 5HIJA 3VI4B 3LY5A 4G0OA 4X92A 4NOKA 4OJTA 4XGKA 5K3BA 3E3LA 3EJ6A 5EQDA 4ES6A 5KNDD 3U4MA 2C4TA 4FT2A 1GN8A 2WF6A 2C2HA 2IIBA 3DFIA 1P1HA 3FKSD 2GTIA 4LISA 2G9NA 4KREA 1REQB 2FA9A 1U5BB 3DWGA 3KXDA 3PJRA 2AFHA 3RVMA 4A5SA 3BZUA 1FFBA 1WW8A 3DKKA 1Q1QA 2DHCA 2RGYA 3K9BA 4Q01A 2ERXA 2ZAMA 3H8VA 3LQ1A 5DW0A 5IAJA 4TLEA 5EKTA 5BSVA 4FD2A 3WGIA 3WOHA 3R3UA 1BVRA 1II8B 4MIEA 5DM0A 3A1NA 3D3EA 3N5KA 4YFYA 5BOVA 4MVJA 2DF8A 4NZZA 3A3YA 4LTMA 1LA2A 2ODPA 2YQ5A 3WNZA 4PY2A 4E11A 2HWUA 5CDSA 3UO8B 4I1IA 1C7ZA 2QSUA 4ZT3A 2OECA 3GLUA 4PLVA 1H4QA 4S1PA 2AZXA 1B3RA 3UK7A 4KO3S 1N6LA 4Q7EA 3V4PB 1PT9A 3P2KA 2RI1A 4NNJA 2QUKA 2WTNA 3L7CA 4H6VA 5T4HA 4Q12A 4P08A 1ZU4A 3HB4X 1UBTS 2YDYA 5DLQC 3SHWA 5ICFA 4D6PA 5T5QA 4JASB 4TYMA 5AVOA 4K9DA 1GKIA 1PR2A 3DAYA 1RQGA 4ZOQI 1JDBC 3LC1O 5IVIA 4HZIA 3GHYA 3AZQA 4FOPA 5DGHA 3RASA 4YXFA 4C5AA 1IPHA 1RXUA 1WWKA 1GCUA 4IIUA 1U63A 3CJRA 3FNQA 3VH4A 1WBDA 2CK3D 4DUGD 2DEUA 2EFYA 3JVIA 5KU1A 5AKZA 4YPVA 1JEYA 3QX3A 3PC6A 1R37A 2XOXA 4GBJA 4QOSA 4WJKB 4TT8A 4WUTA 1YZYA 4E2YA 1YKGA 2X3YA 4EQ6B 3EAFA 1K6EA 4PR3A 1TM1E 1QE0A 3WIOA 4LK2A 2JASA 1FXWA 1L4GA 4KUHA 1LK5A 1RBZA 3OF2A 3PD0A 3QUAA 4MV8A 1FX0B 1UK8A 4M46A 2N75A 4XJVA 4XRGA 1SXJA 3ZHZA 2C4VA 2YH2A 3WG9A 1HTTA 2YRFA 3RUAA 5I9NA 5JXIA 2QIPA 3T6KA 1SCJA 2Y92A 3LG2A 4MR7A 5LQNA 1TVKB 1XRLA 3R5JA 4R8VA 3RTDA 3HG7A 4MUGA 4B4UA 4BQFA 3LF1A 2ADMA 4M4SA 2W5UA 4XCVA 3L7YA 5FUXA 1FFGA 1RABA 3B1JA 2O2JA 5KX5F 5EVJA 2F1JA 1YO6A 1JU3A 2V6MA 3CRRA 3I3OA 4GX2A 3E2MA 3K9GA 4HX9A 4PZEA 5KX5A 2LTAA 3HM2A 4N01A 3PJGA 1VHTA 4K9SA 3WQQA 5K05A 4PG4A 5I4CA 1PJ8A 1WB6A 1E2UA 2XGOA 4R41A 4U7PB 5HGXA 2I34A 3FWZA 2COKA 3PPWA 4RCYA 1YDGA 4QYTA 5HKKD 4I1PA 2XB8A 4XIGS 1Z4OA 1X3LA 3OT1B 2C04A 3IUEA 4M0DA 3UMRA 4LJLA 4DIUA 4EBFA 5HF5A 2QUAA 2QZ9A 3JY6A 5LA6A 4P58A 1U7ZA 9MHTA 1U1EA 4H77A 5CGZA 4BGIA 4JJ7A 1X86B 1MOPA 3JD1A 1X2EA 4ZDIA 1SKYB 4L28A 9ATCA 3NAMA 1P0CA 4HTFB 4LMAA 4H7PA 4A8HA 5I9LA 1U2ZA 5B3JC 4MW4A 2CJWB 1C7IA 3NM6B 3TOZA 1A5ZA 4KMOA 3MEQA 2UYHA 3COPA 3HY3A 3TNLA 1CEQA 2HH9A 4DIFA 1VCHA 2JATA 3C1OA 1H05A 2F8MA 2JFYA 4G1VA 3PZBA 1P60A 3V1NA 4QKQA 5ALPA 2J30A 4L0DA 3ZHXA 1SBHA 1YZFA 3DV9A 1AKTA 2D8AA 2VWPA 3C7DB 3HYRA 4X71A 3WNVA 4R81A 3ZQUA 1H1LB 5CXUA 1B8OA 3N76A 2XWPA 2P67A 3DD1A 5DP2A 1LTQA 1UADA 3ZY6A 1SWVA 3T99A 1YDFA 4WGGA 3L7LA 3LHKA 2PSHA 2PSDA 1N5LA 3QHPA 4HGPA 3ITDA 2J3DA 1XJ0A 1Z35A 2VNHA 1O5TA 4ZAFA 3PKZA 4H0CA 4TWBA 5C32A 2AEJA 1VDZA 4MQ5A 4O4JF 3RG8A 5HUHA 1Z18A 2Z09A 2R6R1 2OM2A 4C4OA 3K72B 5T41A 1XVIA 5JQWA 2RHHA 4GM0A 1V9SA 4EOGA 2DECA 5AVTA 1E2IA 1EWYA 2DC1A 2QMEA 3RF7A 4CODB 2JGJA 1SCUA 3PA8A 3LBNA 3AEUB 1EGQA 2OORA 3DBOB 5DTRA 3VOBA 5JHHB 1XVVA 3GAAA 4FFBA 3H42B 3PDJA 4GZ5A 1CZLA 1TX4B 5TSDA 2WWWA 2WE7A 2WFZA 5AVJA 1U2SA 2UXDB 2X4IA 1I6LA 3IUJA 3ZHYA 3IRVA 1N8SA 3OJ0A 4JI1B 1MABA 4WN3A 2GLXA 3RANA 1EFAA 1IBLB 1PUJA 3Q40A 4JYMA 1JBKA 2HU8A 2WMOB 4CV0A 1R8XA 3C4JA 4WLOA 2N1BA 1SH7A 2ZWOA 3SLKA 1DFHA 1ZVMA 1W30A 4UVIA 3SEFA 1W85A 1AXGA 2H52A 5AVUA 1U7HA 1I24A 1CJBA 4YLEA 5G0UA 3NHJA 1TMYA 4BX0A 3MYYA 2O52A 4WOKA 3T5AA 2B7CA 4PZ9A 5DVZA 3UJ7A 2HM7A 1T2EA 3FOAA 3LIIA 3V2UA 3K70C 2IVZA 4POAA 1ORVA 2C8JA 3Q7EA 4FZ3A 4LV6A 3NHRA 4D81A 3H1BA 3HBFA 4OK3A 5ALHA 4AROA 1WDLA 3BBPA 3OIYA 4EEKA 2G72A 1LLCA 3HU3A 1T2CA 4HATA 4DABA 3K2QA 2J3HA 3MMNA 1WY5A 1QP0A 4NCJA 4E1BA 1FRNA 5HF9A 5TC4A 2YXBA 1X1AA 4COOA 4Y2RA 4ETMA 2PRZA 1KNQA 3DR3A 3GRPA 3OM8A 2XB6A 3RT9A 3WGLA 1P1BA 2RARA 1C3EA 4G63A 4WWHA 4A8TA 1TAHA 3C39A 3LAWA 2HJWA 5EIBD 1U81A 1GLGA 4PZPA 4YRKA 4C4PA 4DC1A 3SHVA 1SQGA 2ZUWA 1AUXA 3CPEA 3B7PA 5EGSA 3KC2A 1QMGA 3HY4A 4C78A 3Q85A 2XPCA 1HI9A 1QWSA 4Q1BA 2AMJA 4CL2A 2XUIA 3QK7A 4XGQA 3IODA 2YMQA 3I8OA 3OPQA 3B3GA 2L0XA 4NATA 4RPKA 3MD9A 1GQOA 2VZ8A 1BROA 4KKXB 3FR7A 4FUQA 5EJEA 1QV6A 1AG9A 1C3XA 3KVVA 3PEEA 3EASA 4JJ4A 1OVMA 1THGA 3MQ2A 3RS4A 2L18A 1VPWA 1N2IA 4IUYA 3GF4A 1MCZA 1ORIA 3HHEA 4FGJA 2L69A 4ZQIA 1H4SA 1AS0A 1KP3A 3ORSA 3RABA 4TVKA 3OX1A 3QV1A 4CUZA 5B3JA 3BE6A 3COYA 2AB0A 1UJ5A 1U1GA 2VAXA 4LJ6A 4O2RA 4HZUA 1Z3IX 1LW6E 2C2GA 3EIEA 3I23A 2O8FB 1Z62A 1VL8A 3OU7A 1F17A 3CB2A 4P32A 1X14A 4PHGA 3GRZA 4R3WA 2H51A 3GP5A 1Q84A 3F6SA 3F4BA 4B75A 4N41A 2BEUB 2HSJA 2AWOA 5BVGB 1LI4A 1R10A 5BVHB 2XZPA 4KQGA 2PV7A 1T6BY 1RZVA 4ZTBA 1S6YA 2AG0A 3EXFB 4LVNA 2JKYA 2ORYA 1ISGA 3W8DA 1W5BA 4MGIR 5DOVA 4TTVA 3SG0A 3ZWNA 1XNQB 2EIHA 5TMBA 2QP9X 5IARA 4LYEA 4C4TA 2DKFA 4IIYA 4L8YA 3A1SA 3WISA 4F71A 4Y2SA 5CDTA 3JQ7A 1DDIA 2OXRA 4FWIB 4LJ5A 1C3LA 5K8JB 1KFCB 1CR2A 1YBHA 3M1LA 1E5LA 2H1FA 3B2QA 2WB4A 3R23A 5J2TF 1NP7A 3KEMA 3GGPA 3FLBA 4Z4EA 1PR1A 5A2GA 3PTAA 2FEAA 3ZHTA 1NRJB 2BH2A 5J5VA 4G4IA 2NSHA 3GT4A 3BC1A 4NFLA 1APBA 3KKMA 3IAXA 1KEPA 1T3TA 1QYWA 2YWRA 3ANMA 1Q7GA 2JAHA 1Z0IA 2HDWA 3DBIA 5DHSA 3IR6A 3TXAA 2TMYA 3PB3A 5H70A 4JBLA 4RV9A 1FDSA 1UFVA 5LBTA 3W8NA 5A6VA 2Z8XA 2CLOB 4P7JA 4UZEA 3HRKA 4MVJD 2IY7A 2VUHB 1T2VA 2J0EA 3ETCA 1XTPA 2PJZA 1A5SB 3TCNA 2M6KA 1UPUA 2ASVA 2IIQA 5G1PA 1U28C 5JWRA 1G38A 1BA3A 5H82A 3WK6A 4ZMRA 3L9XA 1DKPA 1K2WA 1G5RA 2E2WA 4QOEA 2DWUA 4QT0A 5F21A 3SMVA 4G4GA 1RXYA 2F3QA 3UV3A 1B3BA 2JJ1D 1ZJYA 4O4JB 4CLRB 2ZXUA 1PYOA 2X4DA 1WSWA 2AG5A 4BNHA 1PR5A 4QQKA 2BT4A 5DOZA 4RXMA 4A10A 4CDNA 3DNPA 1Q21A 1DKOA 3OCZA 4QBKA 3K0CC 3ZK8A 4R71A 1PZGA 3OE7D 2HNAA 3ONNA 3ZH2A 4IXDA 4WADA 4DUGA 4MW2A 5KYXA 2J4CA 1MR3F 3MBOA 3TRJA 2PSEA 4K9KA 3H2ZA 4ROSA 3ZE7A 3M9WA 4U02A 4URWR 2ZIAA 4JU9A 2Y0CA 4YUVA 2H5LA 3ND8A 3PNVA 4MVXA 5FF9A 5TEVA 1U7TA 3CN7A 4HG2A 4DOMA 4ZJZA 4WCVA 5CG2A 4CM3A 3OO0A 4L1KA 3TCXB 1M5UA 4FGUA 3KHTA 4BQNA 2XQGA 4MWTA 4YUYA 3IVCA 1WU7A 2ZYVX 3DFKA 1CW2B 1DAPA 3QUTA 3D3NA 3M4YA 4KX5A 4UPDA 5CVVA 2JGEA 4PBRA 1UXOA 3HCWA 1VLQA 3ORRA 5E7JA 4J90A 3ZIAA 4FU0A 2JIBA 1GG5A 4Y0VA 2FAXA 3PYXA 3W90A 4YJ2B 4YCCA 3RS9A 5J47A 3LPCA 1E1RA 5L95A 3N7AA 3ZK9A 1S4MA 3LGSA 4KIFA 3FD8A 3KTDA 4KQKA 4P4NA 4F85A 1D0VA 4EMBA 2I66A 4JJ6A 5B64A 1DBWA 2CHEA 1TRKA 5FI1B 3CZPA 2FFJA 1NSYA 2OZLA 3NDJA 2KWIA 2MSEB 3GP8A 4V2IA 1FLNA 1RXSA 2PMKA 3MCUA 3P2EA 1UBSB 5BQFA 1TYDE 2VVTA 2YV1A 2HMVA 4F5ZA 1WM1A 4CM4A 4BJ6A 1SCDA 4ZKDA 1SBTA 2YRXA 4BWGA 2QVYX 3K9QO 3LWBA 2ZT7A 3OCYA 4H59A 1DBQA 1VG8A 2GGSA 1Q91A 1LW7A 1L8QA 1NKTA 2WHPA 3DQPA 1RJWA 2PGNA 1UKYA 1WR8A 1LNSA 4GKBA 4KFUA 4P36A 5JQGF 2OGUA 1Z9BA 2G08A 1JJIA 3DF7A 3ECAA 3LUCA 3QWFA 1U2GC 3VAAA 1JDJA 4CVNA 5A3JA 3AHIA 4MVWA 2C9DA 3SHFA 2Q3LA 2R7LA 2WFLB 3EULA 3WFZA 3AWDA 2ANBA 1KJ9A 4Y6QA 1PKEA 1MAVA 2DOKA 1B6RA 5FBLB 2I4LA 1MOSA 1YS7A 2HRCA 2YHIA 3T5DA 1TMGE 4RVHA 1KKLA 2BFWA 2G07A 2PD3A 2EP5A 3G23A 3FPCA 4IEEA 2ABWA 3HR7A 4BAGA 3OTOB 3RVDA 4J9VA 2EERA 1II0A 5AKYA 1QFXA 1Q0ZA 3KSRA 4UFPA 2AT1A 1JIQA 4BNDB 5JNWA 2O1EA 2VOEA 3N5CA 1IXRC 1QO0D 2JRBA 2I4TA 3QVMA 2O2CA 4MQ4A 4MUHA 1PJLA 4F21A 3Q41A 1A5AB 3BT7A 1JFRA 2DBQA 3VR1A 2IS4A 3S44A 1PT7A 1ESDA 2Y76A 1R8QA 2XIQA 3OQJA 1K3TA 3B1FA 4NKRA 3TQRA 3S2ZA 1X15A 4IOMA 4JJAA 3VUFA 1GYPA 1DJQA 3W6UA 5JBNA 5KYYA 4J1NA 3WGKA 5KREA 3ZD7A 5T7BA 1Y5RA 3M5DA 4OQFA 1EVKA 4ID3A 2DSNA 4KJXA 4YRMA 2EL7A 3GUCA 3I8SA 3FB1A 1Z0ZA 2DPHA 3OZFA 3UENA 4C3VA 1EVYA 5LOVB 3IAUA 3ZJTA 3GLVA 3NKVA 3ZVRA 2V7WA 2FWMX 1EUCA 4KNWA 4YUZA 3ER6A 3OWHA 5KTMA 3IQWA 4NS1A 2VNKA 3J7TA 1U0RA 4QGGA 3VDRA 5FHRA 3CIOA 1TECE 4IHJF 3HUEA 3FBWA 2P9HA 3AX6A 5ICEA 5IC4A 4O29A 4JKIA 3VC2A 3NP7A 5AW2A 4KXUA 1V16A 2OXEA 2QXUA 4HEHA 4DBLE 2JFHA 4D7AA 1QX4A 3CF4A 2Q8QA 3BGDA 3LUKA 2PCJA 5EWMA 2SECE 1F4LA 4EDHA 4JYZA 2FU5C 3I2GA 2FPIA 1EE9A 2IZ5A 4YACA 4BNKA 3C3JA 2SKCA 2FVYA 1DE0A 2HOQA 2ZJFA 3R5SA 1TQ6A 4HLUC 2ST1A 3LLUA 3L0DA 3O9ZA 1QYXA 1UAAA 4LIPD 1BE6A 3TD9A 5B1DA 4GYWA 3BX1A 2GT1A 4GXNA 4XASA 1ZOPA 4EVQA 2E37A 5DLDA 1KTVA 1X1TA 4DSZA 1K5DA 2OP0A 1DJOA 3EXG1 1M5TA 3SBEA 1IVSA 3GA5A 1Q6YA 5C8YA 2C8LA 3QWBA 4NJEA 3C14C 4IGFA 3CLSC 4J3FA 3WAKA 1UMCB 1GFWA 1V37A 4GBGA 4Q05A 4DG8A 5GMOA 4IPTA 3C74A 3KQMA 1IRIA 2QYSA 4B3FX 1MV8A 3MWYW 1N9ZA 3GFVA 3VJKA 3NETA 4AWBA 4DA0A 3D3WB 3T0IA 3AFIA 3OQ1A 1SUSA 4M21A 2YY5A 3I0NA 4XDHA 2Y27A 3ZCUA 4MUAA 6REQB 3F98A 1OV4A 4OA8A 3KJXA 4D2IA 3AR7A 4K7JA 4QDKA 4WASA 3X1KA 3ZEIA 2GZMA 3PVSA 2DULA 2R4UA 1NIPA 1NIJA 4ECEA 3K16A 5KWSA 4J0KA 5CFOA 1ZNZA 3UMBA 4GM1A 4YNBA 5EZYA 3U5ZB 1FMJA 1VJGA 2PBFA 2H1IA 1OC2A 3L6EA 1J33A 5KWJA 3MB8A 1HDZA 3Q0EA 5JZOA 4WKPA 5A7HA 3CSSA 2BR3A 2ERYA 1KDOA 2M6RA 1Q0SA 3AKDA 4LN1A 1UC8A 1X6VA 1CB7A 2CMFA 1QFYA 3LL7A 2R6FA 4ZVKA 3TFWA 4F3CA 4DAEA 5JEEA 1RYDA 3EIUA 3BGVA 5ENVA 1QR2A 3WIEA 2CL0X 1IDN1 4PYRA 4FMDF 1KE1A 5IULC 5BSGA 1YHZA 4FFRA 5TQ0B 3KQPA 4D96A 5IKXA 4B46A 5U4XA 1EB8A 2B35A 3IMKA 2XTMA 5AVSA 4DV7B 3DO8A 1VMIA 3KQOA 3EIOA 3EQ9A 1G55A 3N0RA 3JWGA 2GJ8A 4IICA 1U2DA 1IXYA 2IYZA 2UZAA 4IO1A 3WP1B 1Z8DA 4GI2A 3S5UA 2WTUA 4RVSA 2VWGA 1N3IA 4IQ0A 3RUDA 1BGWA 2BN4A 4MGZR 2XUPA 4E4TA 3OZAA 421PA 1QYVA 3GEGA 3JW8A 3CJQA 4ZCSA 1IEWA 1U5AA 4QRHA 1ECJA 1E2EA 2R6ZA 2HHLA 3H0KA 3A0RB 4KDEA