4PSKA

Mycobacterium tuberculosis reca phosphate bound low temperature structure i-lt
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
308
Chain Sequence
b'PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 96
structure length 308
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pskA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pskA01
4QJ3A 3B60A 1AA3A 4TLDA 5KOYA 4ZCMA 2A5FA 1Z2AA 3F8TA 4O2RA 5FUWA 4Z51A 3OHMA 3OZXA 3ICQB 2O52A 2HJGA 3TNFA 1RRCA 2GK7A 3U6BA 5FR2A 1KI6A 3M0EA 3JVUA 3IKJA 4FI3C 1CBUA 1N2CE 4EPYA 2DWOA 4M9XA 3GD7A 2BBOA 4URZR 2GVDC 4Q1DA 4BLOA 3PUZA 3F0TA 1MO6A 4K46A 5FTLA 4M9SA 4KJZA 2DPXA 3K1JA 3KZ1E 3B13B 1KK0A 4FMCF 3I8SA 4V0LA 3ZIAD 1Z0JA 2WJHA 1KDRA 2WWGA 4LV6A 221PA 2XITA 5AUNB 4PO9A 1I4LD 1SVMA 1A2KC 2IS2A 3A6PC 1S0UA 4PR0A 1FMLA 1JQJC 1X1RA 3SHWA 3EAQA 1W5SA 2DFKB 1OHHD 3W90A 4AIIA 4UNSA 4DEYA 1YZGA 1G8YA 2REXB 4Q00A 4Q5IA 4BEJA 1LW7A 1E2JA 3MWJA 3EPLA 4IHQA 3GJXC 3AUXA 1VPLA 2PZEA 4P4SA 1R5BA 3CB4A 4RKEA 3ADCA 4IW3B 3OFNA 4Q19A 2OEPA 5FBWB 3ZVRA 4MQBA 1CS4C 1Q57A 3BORA 4RFVA 1GNRA 4ZDIA 4R71A 2LKDA 3LLMA 4BE7B 4HB4A 1HA3A 3G82C 3SBDA 1DVRA 1MO4A 4M1SA 3IEVA 1XB2A 1EG7A 1CLUA 4ILEA 5HCIA 1NN1A 1OB5A 2IXEA 1S96A 2XEXA 2RGXA 3AP2A 3FPAA 3I1FA 5GVRA 4DDTA 5IF9A 2RGNC 3VR6A 4HEJA 5KO2A 2VP4A 3V4FA 1GDDA 1NN3A 4EAQA 2Q9CA 1A2BA 1ZNWA 5L3RA 1Z6YA 2ZI9A 1RW4A 1SVLA 3K0FA 4LI0A 1EESA 4BFSA 1G17A 3C8UA 4IOKA 4MYHA 2BMJA 3UKDA 3OF5A 1NLYA 4XTCS 4RJLA 1ZNXA 4P4UA 3NXSA 4AKEA 1KI4A 4QNMA 3TVTA 1W7AA 1M6NA 4QBFA 2NIPA 1XMIA 3QBVA 4G5RA 5TB5A 3T1TA 4TTRA 4Q48A 3FMFA 2V6IA 2AWNA 4A8JC 4Q7LA 1QHXA 2J0SA 2FFHA 1ESNA 2F9LA 2Z5FA 2OUKA 4NYMQ 1GG2A 1QHHA 4L9SA 4TL6A 4AG6A 1XEWX 2IUUA 4WVFA 4A4DA 4BLRA 1DOAA 2EFGA 1M2OB 1AN0A 3H86A 4TL9A 1Z0DA 5K8TA 3QG1A 4D82A 3ETLA 2WOOA 4JSYA 5KHOC 2GCNA 1GILA 3NWJA 2E1RA 3DVLA 4U5XA 4WA7A 2GZDA 1I2MA 1QVRA 3C7KA 2VQSA 4LSGA 1N6OA 1RPZA 1VTKA 5JSZA 1W0JA 5CDFA 3X1DA 4TLAA 2WV9A 3Q5DA 3WBKA 2UZ3A 4KU4A 1XF9A 1LV7A 4Q03A 3SR0A 1XEFA 2FDCA 5E7MA 1E32A 1JEDA 3VR5A 3QF7A 5FUYA 1N6PA 3VKHA 2CLCX 4GOKA 1H8HA 2XSZD 4A82A 3L82B 4MDFA 1FMJA 4PPNA 3RS5A 1U0JA 4QJ4A 4CVNA 4F92B 3RANA 3P1JA 3AEZA 3I3SR 4NCNA 2QP4A 3QVVA 1TADA 5ANRB 4LY6A 4ABYA 4RZ3A 2ZRAA 2PCJA 1OIVA 1QHYA 3FKQA 3PUVA 2JJ1D 2X2EA 4HAVA 4B48A 1OYYA 5KNCA 1NVXQ 1W4BA 4AURA 2C9YA 1CIPA 4PZLA 4LYJA 2Q0HA 3LO5A 3R20A 4FW9A 3L8ZA 3C16C 2DCUA 5JECA 2ZRGA 1RC8A 4NDZA 4RZ2A 3KQNA 1GNQA 3W6OA 1G7RA 2V7QD 4TYPA 1P62B 2ZTSA 4FCWA 4BRUA 5KDLA 1Q3HA 3KB2A 1W44A 4B44A 421PA 2ZSDA 1G3UA 4B33A 2ERYA 4MKHA 4M1OA 3NHAA 5FOSA 4LGMA 3THXA 3PEWA 4FMBB 2HT6A 2FEOA 4TYNA 4L5BA 1OT3A 3QIAA 4EDHA 5KPJA 3UMRA 3A58B 1VMAA 2RGAA 4D0LB 4OHZA 1KSJA 3QKRA 1KJWA 2GA8A 4MGZR 2IS1A 1HV8A 3EZ2A 121PA 5F9FA 4GZMA 5H1YA 3F5FA 4JLJA 5H68A 5SZIA 1G7SA 4E07A 3AVVA 2OCBA 5D3MA 3OEHD 1ESMA 1HE8B 3I5YA 3RWMB 4A0FA 4XTRA 2VLIA 3KQKA 4ITRC 2ATVA 1CR4A 4JLAA 4KFSA 2J5XA 2KB0A 3A1UA 2YNMA 4JL5A 4CW7A 2VYFA 3D31A 4AYWA 3BXZA 3T1OA 1LFDB 1YZKA 2ZJZA 2HXSA 2RB4A 4ACBA 5JWOA 4BFXA 5CYOA 3ZD6A 2O0HA 1J70A 4J0QA 1KI7A 3QY0A 2RMKA 4OQFA 1T5LA 3AVPA 3EZ7A 1OPXA 4G3XA 4XVUA 2J46A 1E2GA 4PZZA 5KTYA 3EWAA 4QBIA 1YZTA 1FX0B 3CWZA 5A5GA 3ZS8A 2W00A 4DLSA 2OSBA 4F91B 2CK3D 5TDHA 2PJZA 3A4MA 4Y0VA 1AZTA 2QSYA 2YWHA 2YWEA 2FFBA 3BFKA 2BHRA 1FTNA 4P31A 1DAEA 4PAQA 2IYZA 5DI9A 2JA1A 2OBNA 2GEDA 2WJJA 4B2PA 5L3QA 2O8CA 5EE9A 1DAGA 3T35A 2N1BA 1CF4A 1A82A 4OHYA 2J0UA 3THYB 1WQ1R 1YHNA 2BBWA 5H70A 3I5XA 1FX0A 4W9MC 1Z5ZA 3KJGA 2MSDB 1S8FA 1W0KA 3QXSA 2ZQ5A 1PLLA 4TL7A 5DH9A 3CLVA 1GNPA 4A2PA 1N6NA 3NIBA 4IVQA 2AX4A 2QP9X 3VR3A 1E9EA 2A5GA 4QC2A 2YZ2A 4DCTA 4LRWA 2GHIA 2A5YB 4D6PA 3KKQA 4HB3A 2W6ID 4BWYA 5G3ZA 3TGPA 3IEUA 4NYIQ 1IJFA 3AV0B 4A15A 2WJYA 2BVNA 2VTKA 3UANA 3F3YA 4C30A 2C98A 4DLTA 3NBXX 2GKSA 4TSFA 2WHXA 2VIIA 2O8DB 3RLFA 3FKSD 3QPWA 3K9GA 3ZVNA 1CRPA 3BJIC 2YOHA 1K6MA 4JVLA 3FFBA 1PV4A 1DPFA 4C0LA 3MWKA 3KJHA 2OFXA 4TTPA 5JBQA 2UKDA 1E96A 3ICEA 1S1CA 1KDPA 4OQMA 1H8ED 5H8WA 2GCOA 2QROA 4JIMA 2NPIA 4JBXA 3DDCA 3N5CA 5HTKA 1T4GA 2VBCA 2DR3A 1D5CA 1SVWA 1ZD9A 4WXRA 1U0LA 3B1XA 4A36A 4BZQA 3W6PA 4PX9A 1N6LA 1P4SA 1KI9A 4Q4JB 2WWWA 4XWKA 1U94A 1T0JB 4MITA 5C2JB 3MG9A 5CB8A 4KITB 3QF4B 2O8EA 2GTPA 3FMOB 2HYIC 3WNDA 3GEIA 3TVDA 1E2HA 2CL7X 2DWPA 5DN6D 1TEVA 4B75A 4EJSB 5B58C 2ORVA 3PEUA 2ZS9A 4BLQA 4NU0A 1WCV1 1ZD8A 2W6JA 4QL3A 2ZRIA 3EIEA 2IHBA 4DUGA 2AK2A 1DAMA 4B71A 4GOXA 5BYKA 3UATA 1DS6A 1HE1C 4XWAA 2QAGB 3SJBA 5C4MA 1PVOA 5DIFA 1YE8A 1E0SA 2ORWA 4Q18A 2P5SA 4JMPA 3BIFA 5DO9A 3R7WB 3U60B 3VMFA 4HSEA 4NCKA 2X77A 3MGCA 2ZVQX 4O3MA 4HATA 4KLNA 4HUQB 1OH5A 3EPKA 2OLKA 2X2FA 3LXRA 3QF4A 4U00A 1II8A 4CEHB 5JS8A 4ESHA 1KJYA 3BB4A 4EJSC 2EVWX 4L15A 4BFUA 4TL8A 721PA 4AY2A 5EQTA 3RS2A 1CJMA 4ERNA 4RSGA 2VSXA 3DOFA 3R9IA 3RC3A 1Q1ZA 2YC2C 2GK6A 4PO8A 4EPVA 1CRQA 3ZDQA 3OE7D 1G3MA 1A7JA 2YJTD 4RKFA 4DT1B 4PQRA 1MRSA 2DHRA 1OXTA 4TLCA 4BFWA 4C9BA 1C4OA 4GL2A 1LNZA 3AP3A 1KO7A 4UNRA 4D4JA 4CYMA 3U7HB 5BYJA 3U44A 1JPNA 5AJXA 3GMTA 3OIWA 5DI3A 2OLJA 4B3CA 1KY2A 2HYDA 2ERXA 1G41A 4YMUA 4DCSA 3X1ZA 1HQYE 1Q0UA 2QZ4A 2WVJA 3QBTA 1Z0AA 3O8CA 2IXGA 2CBZA 3I4LA 4UNQA 5SZJA 3LFUA 5JI3E 5FBLB 1IXSB 4EPXA 2CCJA 2V7QA 2CLDX 4LOAA 4Z1MD 1EK0A 3BB3A 2OG2A 1KKLA 2PEYA 3DZDA 4OHXA 4F93B 4D26A 3LBIA 5FL7D 1KI3A 3AQ4A 2FF7A 2HCBA 2XGJA 2QPAA 1G64A 2RKOA 1CJVC 1YQTA 2RH5A 1UBEA 5J4LA 1MH1A 2VP2A 4AYXA 3WNCA 3AKYA 1XU4A 1VCNA 1EFHA 1ZD1A 1RZ3A 1UPTA 3W5IA 4WOPA 3THYA 3U6KA 2O0KA 2XB2A 3WXMA 5GJVC 1X8KA 5G53C 2ZETA 2I3BA 1XPUA 3KXKA 4JVSB 1JB1A 3ND9A 3AH8A 4DHEA 2IYQA 4LHWA 3VX3A 2JLRA 2ZROA 3P26A 3U3MA 3IIJA 3ONWA 3H4MA 1ZM3A 3KDSE 4C0QC 1TQDA 2ZRMA 3SZRA 1SKYE 4GDFA 1UEJA 2BM0A 2C78A 2JLWA 3QQ5A 4IXNA 2QUZA 1QF9A 1GFIA 4KI0A 2HV8A 3R8CA 4OQXA 4FCTA 3BRWD 4HAXA 5CK4A 2ZRNA 1E4VA 3CIOA 4DCNA 3P20A 2O8FB 1FFHA 4C7OB 2H7VA 2NO9A 1FUKA 1EWQA 4OKSA 1DG1G 1X6VA 2A5JA 3DMNA 4HLQB 5TV2A 5J4KA 3B8HA 2I4IA 1E0KA 1ZU5A 3D6TB 4M0LA 2R6AA 3RS3A 5KYKA 1B23P 4UXIA 2O5VA 2QE7D 2DB3A 5AJWA 5E3HA 1JEEA 1RKBA 5J5CA 2F3RA 2OM2A 3I32A 3D7MA 3HU3A 4TLEA 2XZOA 2NOAA 1Q21A 2WKQA 5J47A 1NJGA 1TQ2A 1G8GA 2W2TA 5HE9A 4QGHA 1WXQA 2GF9A 3Q5EA 2QENA 3DL0A 3UXMA 3K70B 4GI7A 3K70D 1ZW6A 1NL3A 3AKDA 2WSMA 4XVQA 2XXAB 1BYUA 4DLUA 3UWKA 5AJVB 5BWMA 2ZXUA 2W0MA 4Z8XA 2G0NA 5KSOA 1GITA 1Q22A 2FWRA 2WWXA 1HT2E 2SHKA 1K5DA 1ZCBA 1MT0A 2H1LA 3QVUA 3WMFA 1IN8A 1AQUA 5HCNA 3PIRA 2QE7A 4G0NA 3MSXA 2G6BA 4M1MA 4IEEA 4Q9JA 3FHCB 2Q9AA 2Z4SA 1VKJA 2CJWA 5KSPA 5BW8A 4WZ6A 3HP1A 4QRHA 1OB2A 5JJKA 5P21A 3BH0A 4HI0E 4I1SA 3B82A 4YMVA 3AF2A 1R10A 3OFND 1FOEB 1G6OA 5DISB 1U8YA 1VIYA 3DM5A 4LC1A 2IYSA 2F6RA 1IN5A 1E1RA 1KO4A 1U90A 5L3SA 4EPWA 5IDVA 4PZYA 2I1QA 3RS0A 2ZRBA 2JCSA 2CXXA 2CJWB 3MMPA 3I73A 2V54A 4TYQA 4I1UA 1Z47A 2BCGY 1W4CA 2PCLA 3N2IA 1E98A 2E9SA 2DWQA 4LX0A 2IYXA 2DFTA 2J7KA 3IBYA 3ZZ0A 4M22A 2QGZA 2FE4A 2QT0A 1KSHA 2FJUA 3LWNA 1G18A 3RVBA 4F4CA 1E2NA 3NBYC 2VHQA 2WIBA 5JEEA 8OHMA 1SXJE 5E7JA 1Y63A 4OI0A 1P9WA 1UFQA 3U7EB 1GRNA 2VA8A 4WZBE 2FZLA 2XTZA 2ZI4A 1AGRA 4U7DA 2W6JD 4WZAE 3W34A 1N5LA 2J87A 2C96A 4TQ9A 3SFZA 4V0NA 1XMJA 2FH5B 3H2YA 4A0HA 5F2EA 2ZE8A 3Q3JB 2GESA 1J90A 4WIAA 1E2DA 1D2EA 4NTZA 4IDOA 2VP0A 5LD2C 2PLFA 2W2VA 1F48A 1VHTA 4G5OA 5G3YA 1F2UA 4JVNA 2QMEA 3AF4A 2WMOB 3X1WA 1AGPA 2ZS8A 3U3JA 4UKDA 4ZI3A 2IUSA 2FGJA 4YXWA 2OZEA 5HZHA 3U3OA 5F9HA 4UQOA 1VYUA 1XTIA 1NF3A 3CF6R 1BH2A 3TW8B 1W4AA 2VPPA 1PJRA 1DE0A 1HQCA 3VTKA 3R8FA 2ZJYA 1UJ2A 1CKEA 1DAFA 1GP2A 3B9QA 1E2PA 4L8GA 4DKXA 4Z8YA 4P4TA 1XCGB 2DY1A 3IILA 3ZVMA 2RGDA 4OHWA 4NKRA 4QG7A 2GF0A 1N5JA 3KUDA 1GL7A 3N70A 3GLHB 3U2QA 4TQUS 2GXAA 4TZ0A 3AB3A 1F60A 3CZQA 4MKFA 3V4RA 2D4HA 4DCVA 2NQ2C 5EXSA 4JLKA 2A2ZA 1II8B 4P3YA 1J8YF 2OILA 2RGNA 4NBSA 4V02A 1SVKA 3REFA 4KV9A 3Q7PA 1TF5A 4NH0A 2JLVA 1T8TA 4JBYA 3O8RA 2GWHA 1LS6A 1ZM7A 3HJNA 4US0R 3TH5A 2GXQA 4B73A 4AG5A 3B2EA 4DBLC 4B43A 1MABB 3LW7A 4Q4AA 4R2HA 1TQ4A 4LJ4A 3RRYA 4ARZA 2R2AA 5BXQC 5FI0B 2JDID 4IEIA 2JLUA 1ZRHA 3U7GA 2IHYA 4RD1A 4W5HA 3GLGE 2RGCA 3IPYA 3BFXA 2N42A 2IXFA 3MCAA 4LBVA 4NONA 3GFPA 5DSZA 4B47A 1VG8A 4F38A 3TK1A 3LVRE 4CZ2A 1M74A 1W1WA 4YONB 4PQYA 1RIFA 4HLDA 2VP9A 2YINC 4YLGA 4S35A 2EFCB 4TT3A 2ZE6A 3BBPA 4DZZA 3ZZTA 3A1SA 2QORA 2IUTA 2Q3MA 2C5LA 4KVGA 4Q4HA 2RGEA 4JSTA 1KZ7B 4JT2A 3GQBA 3NDPA 4PC1A 5EXTA 1R0ZA 2O8BB 5EZ5A 2VSOA 1Z22A 3NH9A 4HDOB 3EWSA 1N6RA 2D3WA 4LWZA 3QPVA 4M2LA 1X86B 1E79A 2O8DA 1R8QA 2WJVA 3CM0A 4OI1A 1WDTA 2C99A 4Q21A 4PFSA 3Q9LA 2GEVA 1E94E 1E1QA 4XSGA 2JJ2D 1OKKA 2ZE5A 3QEJA 1RJ9B 4HAZA 4TSFD 2OXRA 2JJ8A 5KSYA 2ASEA 2QG6A 1N25A 1GVNB 4PAOA 1LVGA 4DVGA 4BPBA 1SGWA 2GJ9A 4HZUA 3C41J 1FZQA 4D0NA 4RFSB 1E9SA 2A78A 3FWYA 1Z08A 4UNPA 3IIKA 3PUYA 1GZSA 3T5GA 2J3EA 4DLYA 1G5TA 1XMVA 2GBLC 5FOVA 4EJSA 2EYQA 3GLIE 5GJWC 3TSWA 3LD9A 4A2QA 3RSOA 4LC0A 4CIDA 1OKKD 1X8LA 5E95A 3JVVA 1E9FA 1M7GA 1ZIPA 2O8CB 1KAOA 1E99A 2GZHA 3PCRB 5GJBA 3QXXA 5TXGA 3QKSB 4G5QA 3BH6A 2QGNA 3LLUA 2B7CA 1CEEA 5UKDA 2R6FA 2R8RA 2GAOA 3VNVA 4IJMA 4Q1FA 3A1VA 4GMDA 3BOSA 4JLNA 4PANA 4W7SA 4QM6A 1XWIA 1FNNA 5EP2A 1S4QA 1DO0A 1P2UA 2FFAA 4NL4H 3FHOA 2CCKA 2UVQA 1N0WA 3W3ZB 4HLUC 4HDQB 1VG1A 2WMNB 3WYFA 2QEQA 4YMTA 2B92A 4DLXA 1F3OA 1W36B 4BFTA 5FBVB 4FWIB 3NBFA 4BZPA 2D7DA 2DYKA 4FINA 1X3SA 4XIGS 1P2TA 2XX3A 4C4PA 1P6XA 1II9A 1DELA 2VHTA 1QHNA 1E2LA 4I1OA 3CX7A 4A92A 2BEJA 2CHVA 5KSZA 1UBGA 3LQQA 2XZLA 1D9ZA 4US2R 4MGIR 4U02A 3B1ZA 4LHZA 3VU9A 4HDCA 4ZPXA 5DI3B 2QTFA 1HUQA 3ZZUA 4N3NA 2JDIA 4B6EA 5JHHB 1PUIA 1W48A 1TF7A 3U44B 1FP6A 1NIJA 2B21A 4GPTA 2PEZA 3EPHA 1TEXA 3EC2A 4LDJA 2P0EA 2ODWA 1KO8A 1US8A 2ECKA 4DB4A 4XOIA 1N6KA 1SXJB 1OJLA 1TL7C 2N46A 5EXXA 3T12A 4AD8A 1LTQA 1KSGA 1KMQA 2QPOA 5CK5A 3I92A 3DOEA 4RCYA 1OSNA 1QZXA 2PZFA 1KI8A 3SN6A 2WZQA 3B5JA 3B7GA 3U61B 4MYTA 5DGXA 1YR9A 1E2MA 3ASZA 3ZH9B 3DM9B 3PQCA 2ZRJA 1VYVA 1NN5A 3IDQA 1N0VC 4FMCB 3R7WA 1E1QD 1JPJA 3OIYA 4NYIR 3RWOA 3SYLA 5CB6A 5JCZA 3I61A 3T5DA 4Q1CA 3DKVA 2AKAB 2JLSA 1ZP6A 3C5CA 1EFRD 3U3RA 2ZR7A 1P72A 4C0AC 4IVPA 1PZNA 1G19A 2G9NA 1OH8A 1AM4D 4C2TA 4Q4AB 1MABA 4JT4A 1LB1B 2JGNA 1NRJB 2DBYA 1L4UA 4LBZA 2JJ2A 1XCPA 2JJ1A 3SQWA 1CJKC 2GJKA 1KI6B 1XZQA 4CT5A 4G1UC 1LS1A 3QPUA 4RFSA 1P60A 3GJ5A 1AS3A 2C95A 3HPQA 2XJ4A 2REBA 2X1VA 1ZU4A 3CNNA 3H84A 4NP6A 1IOZA 2ZAMA 3MJHA 3S1AB 3CBQA 5BQ5A 3CH4B 4JLPA 1G3RA 4BLPA 5F3WB 4HAWA 5LPNA 1TAGA 2H5EA 2PMKA 4M4SA 2JLQA 5EE0A 2H8KA 4KBGA 4OI4A 1HYQA 3PEVA 1G291 1AK2A 3O8BA 4IFBA 2KJQA 4FD2A 5M04A 3RS7A 2MSCB 2C03A 4MA4A 2A5DA 4ASUA 4RD3A 1NIPA 1O87A 2IYTA 1YZLA 2PBRA 2J1LA 2QTHA 2W0SA 5BN4A 1WBBA 4M1WA 2O8BA 3GEEA 3K0SA 3VKWA 3TR5A 4F4JA 1ZM4A 4C0KA 3NBZC 2IX3A 4ZDWA 2ZYVX 1BYIA 2G83A 1QHHB 2D06A 2PT7A 1WP9A 3SE0A 3WHLA 4Q7JB 1MV5A 4RY2A 1G7TA 3UPUA 1G20E 4F7WA 2EU8A 3HWSA 3SOPA 3OAAA 4BZXA 1NVWQ 3RAPR 2ZUCA 1N6IA 1R2QA 1QHSA 1YJ5A 2JLXA 3I72A 3OEEA 1UADA 4B3DA 5EUMA 5HPYB 3FVQA 4A6XA 1H8HD 5D3QA 3N2EA 3RRMA 2ZM5A 2WKPA 1JXOA 4MUAA 1P7CA 1ELOA 3WNBA 1Z29A 3X1YA 3D3QA 2X19A 1ZNYA 4RD2A 2GXSA 2OXCA 1JALA 1XTQA 1GRQA 3MUFA 2AFHE 2QL6A 4IRUB 4RZUA 3TKLA 2ZRLA 4CEIB 1P2SA 4P33A 4MKGA 1Q1EA 4KYUA 4CEJB 2IEYA 2QI9C 2L0XA 3DHWC 4X8HA 2TMKA 1COWD 4BLSA 2HF8A 4JJKA 1Q12A 2B7BA 1Q44A 3AVXA 1T91A 4V03A 2FPLA 2XNSA 2XAUA 4ZDKA 4YMWA 2GCOB 4LJ9A 2ZRCA 2BKEA 4QKQA 3LY5A 2E87A 4QHYA 4CDGA 5L3SB 4ACAA 2GZAA 3GLIA 4O25A 1KY3A 4I81A 2YVUA 3A1WA 4ZI2A 1NBMA 2QQ0A 1H65A 4MRRA 521PA 3AF0A 1AJEA 2H16A 2V1UA 2NO6A 4YC7A 4JLBA 1G5PA 2QAJA 1K5GA 3CRMA 5IK2D 3IQWA 2FNAA 4WW0A 1JR6A 3K0CC 4UJ5A 4OK3A 3VU9B 4EFMA 1NMXA 2CNWA 1E1RD 3GEHA 2CL6X 3LAWA 2AXPA 3RRNA 1R7RA 3GJ0A 3TUIC 3PR1A 5TY0A 5DE3A 1G7CA 3RYTC 3TMKA 2WWIA 2YC4C 2OBMA 1UDWA 5FPSA 1B0UA 1DO2A 2UZIR 1YKSA 3A4NA 4GZLA 4X8LA 1ZAKA 2IYWA 1FTSA 2ZYUX 3CZPA 4WAUA 3RNLA 5IRCD 2EFEB 4Q47A 4X8MA 5AUOB 1CULC 2G1JA 3KQUA 4NZYA 2EW1A 3C14C 3FTQA 1TX4B 4P32A 2I1VB 4LZZA 5FOUA 3HYTA 2IBMA 1JQLB 1CXZA 4XVRA 1NJFA 1NY5A 1RYHA 3QENA 5LBIA 1UF9A 4PC3A 5KPDA 1OW3B 2PT5A 1YRAA 5FBQB 3GLFA 1II0A 3CWQA 4KXFB 2WPDA 4K81B 4E22A 4AKHA 3X1XA 2F55A 3P32A 4D0GA 5KNBA 1CR2A 1DAIA 4YDHB 2IS6A 3SEAA 3LH5A 3PITA 1W2HA 3EC1A 4NYMR 4DLWA 1Y3AA 2J45A 1Q1QA 1UKVY 4XSHA 3MRSA 2PJRA 4BASA 3PUWA 1JAHA 4G5GA 4L16A 3WYGA 1E2QA 4M9ZA 1VCOA 2BC9A 2WOJA 4HYYA 4JLMA 3AVQA 4DDUA 2AL7A 2LCFA 1EFCA 2OE2A 1RRPA 1W36D 4LPSA 1VECA 1Z6AA 4ZIRA 2ODNA 3VR1A 3NHBA 4RD0A 2RAPA 2GVZC 5EP3A 5C18A 1IBRA 2R62A 5JWRA 1W47A 1VG0B 3U4QB 3SYKA 3VFDA 1W0JD 4HZUB 4D4MA 2V1XA 3K0EA 4OQNA 4MRNA 2Q3HA 3EG5A 4KSCA 3M6AA 4AYTA 1NSTA 4JYBA 2NMVA 3TLXA 1S3SA 4DEXA 4CGZA 3T34A 2NO1A 3EZ6A 3CRVA 3V00A 2D74A 5DHAA 2H17A 4QHSA 1MKYA 5HKKA 4MUBA 3BD9A 3L0OA 4DUGD 1P2VA 4W5JA 1E9BA 3IQXA 5DHFA 3JZMA 2NGRA 5EP4A 3TSZA 2FOLA 2ZU6A 5C46F 2A7QA 4NCHA 2WWFA 5JJLA 4TWZA 4URYR 4EQ6A 1DTSA 1VCMA 5HE8A 4HB0A 1AA9A 4TLBA 4URUR 1SQ5A 4IKEA 4N1AA 4Q1BA 4QJ5A 2ZE7A 1IN6A 3BFVA 2ZIAA 2OCAA 1CR1A 5CLQA 1NNEA 1US8B 3W9YA 3GJ6A 2ZITA 4B3BA 4QGAA 1UBFA 3KKOA 4LK2A 1BKDR 3DEFA 4QBHA 5JS7A 1TQ6A 1OLOA 3ZIAA 1W46A 4A8JA 2ZJ5A 4C7OA 1M34E 1TUEA 2O0JA 3HPRA 4GSYA 1EXMA 3TUZC 1OFHA 4RD4A 4PC6A 4ZKEA 1S1MA 2ZYTX 4OJQA 1Z6GA 4Z1MA 4ASUD 1L2TA 4TTQA 3TQCA 5BN5A 2PX3A 3OESA 5GADl 2IA5A 2PH1A 1DADA 5DN6A 3EW9A 3MJRA 3G0HA 1A4RA 4UXJA 4RZXA 5JHGB 2W83A 1Z28A 1HEIA 1KMHA 3AVWA 3CNOA 1E9DA 3K09A 4KFTA 1P3JA 3B85A 4KAXA 4CEIA 1DEKA 1I4TD 3THXB 3K9LA 3K9HA 3CH5A 2QMHA 3QNUA 3LA6A 2V9PA 5J40A 1UAAA 5AR1A 4C2UA 3QE0A 3T1QA 4URXR 4P4SB 1SKQA 2ZI6A 3SJAA 1D8TA 5CLLA 1RRGA 2OFWA 4FXPA 1SXJD 1XCMA 4H1VA 4A0GA 2AKYA 3ZQJA 1NG9A 3GJ8A 4IOMA 2FX3A 1UDXA 4PPFA 1EGAA 3MAAC 3OIVA 2ZANA 2ZVPX 4Q66C 3EIQA 2R6CA 3VR4A 1KO1A 4LHXA 5CJPA 3RRZA 1YRBA 4B32A 2Z43A 1JECA 3IHLA 3W6NA 1QG2A 2WICA 1K8RA 4AK9A 1N0UA 5FFMA 5JJIA 2FFQA 4MRSA 2YV5A 4CRWB 1CP2A 1WBDA 2G1KA 2OT3B 4Z54A 1ZM9A 3BS4A 3ZS9A 2ZSFA 1D6JA 1M8PA 1FP7A 2OV2A 4LCBA 4V0KA 2YOGA 1HTWA 1J99A 3SI7A 2P65A 4AC9A 2CHQA 1Q1BA 2ZSBA 2HT1A 1YR7A 1NI3A 3R9XA 4EFNA 2KBFA 2QN6A 3WYAA 2WSSA 2FV8A 1BS1A 2XJ9A 2VL7A 5HR5A 4FIDA 4E03A 2BOVA 1AS0A 4O0MA 2OCYC 3CF2A 4IVRA 4EQ6B 4ESVA 3BAFA 2ORIA 3CONA 4BQSA 5JI2E 1T3SA 4RCZA 1XTRA 3B1YA 4FCVA 4URWR 4E5UA 1XEXA 2IYLD 3KTAB 4CEHA 4DLRA 5EUQB 1T6NA 3B78A 2YOFA 3UMFA 5FPYA 3CX6A 4BFZA 5B64A 3TRFA 5EE3A 3AKEA 3FOZA 2GXUA 2QA5A 2ZRHA 5EXPA 1L8QA 2R65A 4M53A 2BDTA 3ADKA 2JLYA 2FPMA 4DDWA 3E2IA 3RHFA 4ON9A 3SJZA 1TTTA 4ARZB 4TYYA 3AM1A 1OFTA 1W0KD 2ZJ2A 4LHYA 3SYNA 1UEIA 5L8VA 2ONJA 1P9NA 1T0HB 2GDJA 5SZHB 1TMKA 4JLVA 3KXIA 4AKGA 2VHCA 3K0FB 3BB1A 3VR2A 4Q1AA 4LPKA 4JJZA 3ZLJA 1VDZA 2J0QA 1WF3A 4A1FA 1JR3E 1XZPA 3AKCA 3CF0A 4S2EA 1LF5A 1XP8A 1UM8A 3IHWA 1G21E 1N5KA 3QI2A 3GJ4A 2JLZA 1VCIA 2ZYWX 1U0HC 3THOA 4PSVA 4OYHA 3FYHA 1KIMA 1V5WA 5JZVA 2VRWA 1ZMXA 3MWLA 4MDEA 2FSFA 3CRQA 4A9AA 1UKYA 4GOJA 1T3LA 1N3BA 1ZNZA 4BUJA 4L4UA 3B6EA 4B34A 4IOLA 3LNCA 3PVSA 1UKZA 2VHJA 3FKSA 4M21A 2VH5R 3GLFB 4JVMA 3GLFE 4EUNA 3SFVA 3NEYA 3CNLA 3HU1A 1S3GA 1KAGA 3IO3A 2HF9A 3QEOA 1OXXK 1W5TA 4M9QA 2O8FA 1OXSC 4B2LA 5JCPA 1GOTA 2FA9A 2JEOA 4DSUA 3IIMA 3VAAA 1ZUIA 1NLFA 3HR7A 1KI1A 2IK8A 2J59A 3NEJA 4JKYA 3U4QA 3IGFA 1SHZA 4N0EA 3ZQ6A 1U99A 1ZC4A 3BGWA 3BERA 1R8SA 4IDNA 4TMVA 3TSOA 3PG5A 2ATXA 3IPXA 2OAP1 3UIEA 3Q85A 1J2JA 3E5HA 4KLZA 3O8DA 1M1YE 3TJZA 3AUYA 1JNYA 4L9WA 1GAJA 2CL0X 2ZSEA 3AVYA 2IYUA 2ZS7A 3KX2A 4IFEA 5CITA 4PPQA 2F43A 2IYRA 3KJIA 5JRZA 1XTJA 4BEBA 1ZBDA 3UMSA 5IHPA 4A2WA 2AXNA 3BWDD 3QKSA 4KFRA 4B2IA 2CK3A 4B3XA 3RS4A 3KQLA 2MMGA 3PXGA 2PMDA 1IHUA 2PLRA 4KYIB 2JASA 3HU2A 4QGGA 4E09A 2MMCA 4PHTA 2F1RA 3REGA 1Z0KA 2GJSA 3NG1A 4IXMA 4CEJA 2KWIA 1NBME 2D2EA 4POAA 2QBYA 1LY1A 1XXHE 3WY9A 1N6HA 2QM8A 2CDNA 3B1VA 3E70C 1H8EA 2G77B 2QU8A 1G4UR 3ND8A 1VHLA 3EA0A 4D25A 2AD5A 1X8JA 3L2OB 1BMFA 4LBWA 3EX7C 2A3RA 4DSNA 1S2MA 2GCPA 5CIQA 1RJ9A 1XEWY 3VQTA 4NCIA 1KO5A 3SBEA 3O47A 4F4IA 3GLHE 1XX6A 2ZJBA 3WBJA 2QAGA 1Z83A 2CCGA 4XH9B 3EZ9A 5FH9A 1AZSC 1P73A 4N0DA 3CPEA 5C1BA 1I4DD 3GP8A 1TU3A 1ANKA 2OHFA 5D3MB 4OI2A 2QTVB 4C3ZA 3TE6A 2XXAA 2G88A 1IY1A 2R6GA 4LHVA 1SVOA 3DMDA 3A37A 3U7FB 2HCJB 1G16A 1E0AA 821PA 1I2DA 1CR0A 2VEDA 3GJ3A 2BIFA 4Q4LA 2JAQA 3L43A 1IXRC 3EASA 1F2TB 1NKSA 2Y8EA 2DFNA 1Q3TA 4DDVA 1EX7A 2ZR0A 4Q02A 3RSLA 3TBKA 1SXJA 2WWHA 1AKYA 4PQFA 2Z83A 5C4GB 3UK6A 5B57C 5TMPA 2V6JA 3SDZA 3J81k 2XTNA 3SNHA 2WKRA 3PJRA 3THWB 3CPHA 4W5WA 1NG1A 6Q21A 4B3FX 1U8ZA 1R5NA 1V43A 1UBCA 3BK7A 3WHKA 1WE2A 3QKTA 4QFMA 4LYFA 2ZAOA 4DLVA 4ZO4A 2FSGA 5FI1B 3M4YA 3NC1C 1ZUNB 2IW3A 3S1AA 1HH4A 1OYWA 621PA 1KK2A 2J7PD 4OL0A 1XMSA 2YWGA 3LQRA 3THWA 2PX0A 3Q72A 2QT1A 1ONBA 4I4LA 2VP6A 5EP1A 3TIFA 3WMGA 1JR3A 3SU8A 2XSZA 3KKMA 2P6UA 1XJQA 4EFLA 4KCGA 3K0AA 3PFIA 4RD6A 4DCUA 2CVHA 4DB2A 2YKGA 4RVCA 1JJVA 2XNDD 3QJYA 3SHFA 3K0CA 3KJEA 3SQXA 1KK3A 5FBRB 4BECA 1E9CA 2CE2X 1XPRA 1Z3IX 3CPJB 1GTVA 1PLJA 4EPRA 3OIUA 2R6DA 2DFLA 3U3KA 3CW2A 1GSIA 1NY6A 1T9HA 1RVDA 2YYZA 4JZKA 5JWHA 1KSFX 1R0YA 5JSZB 2MSEB 1XXHA 2IC5A 1JR3D 2IS4A 4HAYA 4HAUA 4US1R 1NMYA 4M1YA 3DO6A 4PHHA 3W8NA 1GL6A 4Q9KA 3ADDA 1U8AA 4TMZA 3TQFA 1CJTC 2ANCA 1JJ7A 5B30A 4G01B 3T1VA 2B6HA 3QXCA 1D9XA 3WP1B 2K5UA 4OQLA 5HKKD 1U9IA 4TT3D 1HURA 4K8OA 4QOSA 1MOZA 1OHHA 2ZEJA 2ZI5A 3TAHA 2OESA 5KDOA 2LKCA 3IUYA 3ASYA 1KDOA 1OIWA 1XD2B 2ZREA 1NBMD 1JXMA 4TYWA 2FSHA 1U9IC 2RHDA 3CO5A 2ODEA 1OV4A 3P4XA 5FPKA 3EXAA 5TARA 2RCNA 4Q7MB 3AF1A 2ZPTX 4BRWA 5CIWA 1GUAA 2V55B 1NLZA 2QAGC 3B9PA 4C0SA 1GL9B 5CYPA 2BKUA 1M7HA 1ZM2A 2QM7A 3H0KA 2AN9A 3UWOA 1IN4A 4PTLA 3KXLA 4IOJA 4ZDJA 1DG3A 2J9RA 3AGPA 4QBGB 4EKDA 2FEMA 3UG6A 5IT5A 5ELXA 3ZD7A 1XXHB 2J0VA 1EWRA 2BCJQ 2BBSA 2BJWA 2IYYA 5AJZA 2GEUA 4DWJA 4URVR 2HDNB 5GVSA 2PZGA 3MWYW 5AUQA 3GLIB 1GKYA 1HT1E 2P5TB 3DZ8A 2BMDA 5L3QB 3BH7A 4BLTA 1NVVR 2KI5A 4HB2A 4R9UC 1DBSA 2QRNA 3E1SA 1OF1A 4LJ8A 5EZ6B 2F3TA 5FTJA 1KKMA 3SJCA 3TR0A 5JMTA 4V0ME 4QGFA 2GILA 3K9NA 4DSOA 1SKYB 4PC7A 4NMMA 2D7CA 2WIAA 3HR8A 2X8AA 1S9HA 4MH0R 1KNXA 4DLZA 2HUPA 2NG1A 3KL4A 3QXJA 3KFXA 1GWNA 1COWA 1SZPA 2AHOA 4HUQA 3TW4A 1GIAA 3AP1A 3FHTA 3M1IA 1G8PA 1TNDA 3KKPA 1KHTA 1DAHA 1G3IA 2G0TA 2H18A 3EPJA 4PPGA 4AWXA 2CVFA 1KDTA 2ZUBA 1C9KA 3PV0A 2P2LA 1A1VA 2D2FA 5AJYA 4BFYA 1KNQA 4A0RA 1G4AE 1AKEA 2A30A 2V3CC 3KTAA 5J4HA 1IONA 5CDFE 3FB4A 4WXPA 2ZR9A 2XB4A 4Q4HB 4DXAA 1NSFA 1XFAA 4IDPA 4LYAA 2CNWD 2FSIA 2W2XA 1XRJA 5K8LA 2C04A 1J7KA 2J7PA 2R9VA 3Q8XB 4Q01A 1L4YA 1BO6A 2ZJ8A 1YZUA 2BMEA 3C15C 4LV8B 4XD7A 5IK2A 2BV3A 1ZC3A 5FTMA 1GM5A 1IM2A 4XWOA 1QHGA 4R2IA 4OJKA 1OH6A 3WMEA 4NCJA 4TMXA 1F2TA 4PHGA 4M1KA 3AVOA 2RHMA 4FWTA 4Q9LA 1OFUX 2BJVA 3OEED 4UNNA 4JL8A 4C0JA 2OCPA 3QUSA 2BM1A 5FL7A 1VIAA 2Q9BA 1QG4A 1OH7A 1KTVA 2NTYC 2RGGA 3OAAD 2ZUDA 2ONKA 2AR7A 3AVUA 2QY9A 1G9XA 1OXUA 1E2KA 1SHKA 1R0XA 1IAQA 2P67A 3B1WA 3KFVA 4NHOA 4ZIRB 1XD8A 3MD0A 1XJ0A 3NH6A 1ZVQA 1W4RA 1QBKC 1ZIOA 4FN5A 3K0AB 4GBMA 2QBYB 4LJ7A 1F2UB 1Q20A 2V8OA 3KB1A 3V9PA 3GLGB 3A36A 1QVAA 2FG5A 2IWRA 1ZCAA 1JBKA 1Z6XA 2F7SA 2Q6TA 5F98A 4XJXA 3AF3A 2BBTA 4WBSA 2V4ZA 4C0HA 1OFIA 3GFTA 1X1SA 2WPDD 1KGDA 3GLHA 4II7A 4NYJR 1Z0FA 2C9OA 1G1MA 4KO8A 3FFAA 3P27A 4LBYA 3T06B 5FOTA 3ZGXA 1GKIA 4D81A 2F1IA 3I8XA 2VF8A 5LDDC 3IBGA 5EE1A 2XOKA 1AQYA 3LBHA 2EQBA 3CUEF 1ZUHA 4AI6A 4TQAA 2XNDA 3WRXC 1R4AA 3LV8A 2C8VA 2F43B 2WJGA 3ZJYA 2VF7A 1FQKA 1R6BX 1R0WA 3QXHA 4C0BA 2QQEA 3R9WA 1KI2A 2BEKA 1E3MA 1IY2A 5FPTA 4Q9HA 1JAIA 2YWFA 1YVDA 2B8WA 3L0SA 2QPTA 3OE7A 1YR8A 4NPHA 1BMFD 4OK6A 3GLGA 2WWYA 5CM9C 3LW8A 1DAKA 2IF0A 4Q9IA 5FUVA 4UXHA 4B6FA 3K70C 1PLKA 2WJIA 3EARA 3GFOA 3CR7A 1G6HA 1E6CA 4BGDA 1LF0A 3VKGA 2ZRDA 2ZJOA 2HLDA 2JIZD 3EA5A 4LV5B 1MO3A 1RRFA 2BWJA 2VO1A 3TAUA 1W49A 3NDBB 2Q3FA 4R98A 1EFTA 4DRZA 3K09C 2NZJA 1KYIA 2Q21A 1E79D 2ZU0C 4GMXA 3VHLB 4CF7A 4KBFA 4A8JB 3GPLA 3FE2A 3SS8A 1Z8FA 3CRW1 1XNJA 4DT1A 3LXXA 1CJUC 1KJZA 2G3YA 3JZAA 1W2GA 2WM9B 3BC1A 4OK5A 1EX6A 2GETA 4FMDB 4JL6A 4PXAA 5FOWA 1CU1A 2WAXA 4QHTA 1KMHB 2HJVA 4DIDA 4DIEA 3Q7QA 1C1YA 1EFRA 3VNUA 2CLSA 1Z0IA 2OFOA 1Z63A 1XJCA 2FN4A 1E0JA 5A0FA 3FDIA 4MGYR 2GNOA 4B3GA 4Y0AA 1Z07A 3WRYC 5A4JA 1F6BA 3NVAA 1YR6A 3NC0C 4JYCA 1NP6A 4LJAA 3ADBA 5EE5B 1IQPA 1N5IA 2Z4RA 1JI0A 1RE0A 4MRPA 3VHXA 3T61A 3HYRA 1ETUA 2HXYA 2Z6VA 1AIPA 4MKIA 3EZFA 1E69A 1TUIA 4YDSA 5B2ZA 4BFVA 2AFIE 2EWVA 2OAQ1 4KSBA 2F1HA 4D2IA 2NZ8A 1AS2A 3C4JA 3NTUA 4G5SA 1QRAA 1P9RA 3MFYA 3PENA 3A8TA 5TVKA 4DSTA 4AKIA 2VHUA 1TPZA 2KSQA 2OBLA 2QMOA 1U98A 2YHSA 4LUCA 1GKUB 3RC8A 2IF2A 1G5RA 1G8HA 3AGQA 4HZIA 5JEDA 5SZKB 4V0MA 4D4KA 2BMFA 3KKNA 4TZ6A 4TMKA 1T8UA 1XPOA 4GP7A 4UJ3A 3CX8A 1KZGB 2VSFA 2FZ4A 2QMUA 2QP3A 5EJEA 4ZV4A 5DYIA 4MGKR 3DKPA 1MRNA 2W6IA 3HDTA 1VG9B 2GRJA 1YU9A 2ANBA 2CMKA 4A6PA 1XTSA 1RFLA 2RGBA 3T15A 2JATA 2O8EB 1KOFA 2ZRFA 3D8BA 1XTKA 3LVQE 2F9MA 2B8TA 4CT4B 4MRVA 4HLCA 5CJ2A 3QKUA 2C9CA 1SVSA 2FGKA 3L0IB 5E7IA 2WTUA 3ECCA 2IWHA 1FL9A 3LDAA 4IDHA 3FMPB 1F5NA 3A1TA 4QXAA 3TUJC 5JFGA 4YMSA 3U5ZB 3CR8A 3UG7A 2CEAA 5LB2A 3P4YA 1IXZA 1WMSA 1J8MF 4H1UA 3RABA 1NVUQ 3IO5A 1T5IA 1WB9A 2ZI3A 4LJ6A 1O3YA 4PC2A 1Z6TA 1FNMA 4PSKA 4ZCLA 2QRZA 5J4YA 3NKVA 1SVIA 1ZINA 3C5HA 3CRRA 4PHFA 2WSSD 2W58A 1CTQA 3WP0A 4ZCIA 2XZPA 3H1TA 4NYJQ 5FPHA 2EFDB 1XD2A 4FMDF 2EFHB 5K8IA 1OXVA 2A9KA 2HLDD 2JIZA 4QNRA 4EPTA 3VX4A 4KODA 2GJ8A 5JLJA 2Z0MA 4EIWA 1WRBA 4ZKDA 5DNYB 5K8UA 5JRJA 5KDDA 2IYVA 2REOA 5AK0A 1TU4A 4QM7A 2P6NA 1OE0A 4X8OA 4V0OA 1D2MA 2IL1A 4PAMA 3FMIA 4LYHA 1UKEA 1R5OA 3SC3A 1G8FA 1NMZA 2WBLC 1VYTA 4JBWA 5FL3A 3GJ7A 1KK1A 1PUJA 2F1JA 4YXWD 2LWIA 1W36C 3QOFA 3KUCA 2HEIA 1YZNA 3EIHA 3K8YA 2QSZA 4JLDA 1WA5A 2PL3A 1NKTA 1MO5A 4H9GA 1XDBA 2J41A 4GFDA 4GP6A 4P0TA 2EYUA 5AWFC 1FQJA 3LRPA 2FPKA 2XTMA 4PO1A 1U81A 3CKLA 4MYUA 4PSAA 4R7ZA 4I1VA 1M7BA 2AD1A 1G3QA 2GAAA 5AUPB 4TN1A 2ZRKA 2WAYA 3RDPA 2OO7A 2NO7A 5L3VA 2NPFA 1ODFA 1FPMA 1ZJ6A 2VP5A 2GJAA 1IN7A 4KHZA 4LJ5A 4GRAA 1SULA 2C77A 4Q1EA 2XOKD 2ZI7A 5BN3A 4Q7KA 5E4FA 1HY3A 1IY0A 1NVVQ 2KBEA 1Z06A 1S9DA 3LX8A 2EWWA 3QKRB 5FUXA 1XD9A 2FU5C 3L8YA 5CM8B 4KFUA 4DJTA 1A5TA 2P6RA 2FMXA 2IEZA 1NN0A 2IT1A 5DYGA 5KU1A 1FW6A 3AVTA 5FOXA 4YQFA 1E2IA 3FGNA 5DLQC 5FR1A 4XD7D 4DC9A 5FTNA 4HUTA 3QG5A 3MLEA 4JLOA 4TMWA 4D80A 4IDQA 5LB4A 5FTKA 3GCGA 3X2SA 4GT1A 4NE2A 4TMTA 2QNRA 2H92A 1E4YA 4HLUA 1QHIA 1QDEA 3W5JA 3DPUA 1OIXA 5KUTA 4JKIA 4I99A 3PEYA 3BE4A 1IJEA 5HZKA 2KE5A 1MR3F 2CHGA 4KVAA 4OHVA 3W8RA 1L7VC 2AK3A 2P3SA 1DARA 4OBEA 2CE7A 5KNDA 3LX5A 5GJCA 2AWOA 4JS0A 4LJYA 1P5ZB 3ZVLA 1E2EA 3ZYCA 1GRRA 3G5UA 1Z2CA 5G41A 4GNKA 1BIFA 2ZRPA 4O2LA 1XBTA 3QSYA 2ZSAA 5LD2B 1U2RA 4M1TA 4B74A 2H57A 2R44A 3A4LA 1FUUA 3W3AA 2C2HA 3I62A 1E2FA 1P75A 1D2NA 1E9RA 1EFUA 1YZQA 1ZYUA 4M8NE 4B76A 4Q4JA 1E9AA 2ODBA 1XEXB 3PUXA 1TF2A 3LBNA 3KQHA 2ZJAA 1P61B 2J0UB 3K53A 4MYCA 1T3HA 5G40A 1BOFA 3OEHA 4D4LA 1RYFA 2D62A 2NO0A 3L0PA 4B35A 1SXJC 2GBLA 5J4VA
chains in the Genus database with same CATH superfamily
2F62A 1SXQA 1DINA 1MQSA 1AA3A 2Q3EA 5AM4A 3HL0A 5KOYA 4ZCMA 1C81A 2EARA 2FY8A 1XCBA 3F8TA 5FWYB 4Z51A 3O93A 5KTSA 5HK8A 3W5CA 2QUAA 2HGZA 1YDMA 3R3VA 2HJGA 3GARA 3O9ZA 4J43A 2SCUA 3FRIA 5I7VA 3NUGA 4FFNA 5LYYA 4A0QA 3U6BA 2DKOA 4BTEA 3JVUA 5IM4A 1Y5NA 3I1IA 1N2CE 1UXKA 1EZZA 3L6CA 3E8XA 4FP9A 4CKCA 4EPYA 5D3ZA 4NFHA 3BFJA 4PLGA 1PZMA 3L9WA 3N2KA 4URZR 4AWBA 5CFNA 4BLOA 3PUZA 4AY5A 4GU5A 4G97A 1WETA 2YW2A 3PLRA 1RI5A 4FMCF 2IJGX 5DU2A 3MS4A 3COZA 1NW3A 1GR0A 1JQBA 3EVGA 1Z0JA 3L4BC 4WBXC 3TNYA 1ILWA 2Z3WA 1KEKA 1CUSA 1X7WB 3D7SA 3QW2A 3DB1A 4ZZ2A 1O6CA 2FMFA 1SVMA 2MHCA 2OVFA 1A2KC 5GM2A 1KBOA 2I8LA 1NXWA 2WHPB 1S0UA 4EG0A 4PR0A 1FMLA 2CJYA 3E22A 3W5DA 3EAQA 4NK4A 4PYMA 1OHHD 1MZPA 5JPDA 1IXYA 4NX2A 4JXZA 1HDYA 2E18A 1FY2A 1IN1A 1YZGA 3VZSA 1YHYA 3VBEA 1E2JA 3I53A 5FYDA 2C88A 4IRMA 3HSKA 1O6BA 1SXPA 2PL1A 3TWOA 2PZEA 4N0PA 4BEWA 2HKIA 4Z4FA 2XHZA 2XZDA 3ANSA 5CX4A 2VPYA 3QUQA 3OFNA 2Y2VA 3UICA 3ZVRA 1CS4C 1Q57A 2HWUA 3MHPA 4IVNA 1UPBA 1Z36A 3LBFA 2J33A 3DEJA 4GD3Q 1H5QA 1DVRA 4N5MA 5K1ZA 4H17A 4M1SA 3KSRA 2IGTA 1CZHA 2C8LA 3FUCA 5F1YA 1DDOA 3DGEC 4BCCA 2BEVA 3QLUC 5GVRA 3I1FA 2OBYA 2FW6A 4DDTA 3TGWA 2RGNC 4MVJA 2VP4A 2GCIA 3DEZA 1PO7A 3ZHVA 3DC2A 2Q9CA 1WM1A 3HGTA 2H4ZA 1A2BA 1GSOA 5T4HA 2VS1A 3VSAA 3HXOA 1Z5UA 2ZI9A 3M89A 4KQWA 1EESA 2BF4A 1PZXA 3MIZA 1G20A 5ADVA 2OHVA 4QDKA 3T0GA 1NW5A 3DFUA 3OZUA 1C1HA 4P4UA 4G8BA 2H85A 4PYOA 4R40A 4UVGA 1KI4A 5DCUA 5KTOA 2UXDB 1FRQA 2BEWA 1ZISA 2ID7A 5TGDA 3E9RA 3S6JA 2C4TA 2X0JA 5DWQA 1TDJA 3QBVA 2O0LA 1D09A 4EY3A 3M34A 4Q48A 3IMEA 1JIUA 1MEJA 3CNBA 3L4SO 2VJDA 3LCCA 3O9MA 1XRLA 3ESXA 4N7BA 4AP5A 1AA6A 1WIWA 4GEKA 2QU7A 3W2TA 2F9LA 2CXNA 4IV5A 3KFLA 7GPBA 3CNQS 1RZUA 5IKOA 3GUCA 2GCGA 1A50B 3IXMA 5DRYA 3H11B 4WD3A 2AC7A 1QPBA 1INLA 5I7WA 1QHHA 4WY8A 4TL6A 3A9RA 2Q5FA 5D6OA 4A4DA 3PGLA 4P54A 5HIMA 1VYHA 3NV7A 1DOAA 1RPNA 3QE9Y 4K2HA 3ROZA 2MINB 3H86A 4GZ3A 5FWYA 1Z0DA 2ZYAA 3QG1A 5CDUA 4QG3A 1DUVG 3PTAA 3GQBB 2ZJFA 1LI7A 2VLBA 2WOOA 3ETGA 4KVFA 4L3OA 1UMCA 4KACA 1DKUA 4WA7A 4HH1A 3ZBUA 3DJFA 4PLVA 1VMIA 1RR6A 1NOKA 3PC8A 5LNK1 1T4DA 4X64B 3EFOA 3N75A 3AMVA 4TLAA 2HBRA 3IVGA 4ZVRA 4QO7A 3VVBA 3WLQA 3IBTA 1LV7A 4JP1A 4BYMA 4ZO8A 4EABA 1U4OA 4F7DA 2QXUA 1YJAA 1LK0A 1ODSA 2UVPA 1P0IA 4LXGA 3WGMA 2FDCA 2OZPA 1T1SA 3VR5A 3NTRA 4O4HB 5FUYA 1U6KA 1PJAA 4EQZA 4BDSA 2VNSA 4PVDA 2XSZD 1E7SA 4INPA 1N8KA 1O95A 5TQJA 3T0IA 4A6EA 5KJ6A 2JFNA 5MGNA 1JFTA 3IT3A 1P77A 3AEZA 2QP4A 2COEA 1SXGA 3EF1A 1TADA 4ITVA 4DR2B 3DC7A 4V0RA 2WZCA 2ZRAA 6ABPA 2BDEA 3GAAA 4NAHA 3CLSC 2C2GA 3DKIA 3PUVA 2JJ1D 2X2EA 5KNCA 5DASA 1OYYA 3SG0A 1NVXQ 3AESA 4B40A 4YRRA 4ND2A 4N7MA 2ZGVA 2C9YA 3EODA 1UBJS 4PZLA 2NP7A 1ZUWA 3FUTA 4IPTA 2P1RA 1SOVA 1UKCA 4RZ2A 2ZWMA 3CEHA 1U2DC 3ZU2A 5IPFA 1GNQA 3OPYI 2BFCB 3GP3A 3VOAA 4TYPA 5JDCA 1P62B 2Q3LA 2ZTSA 3VHXB 5ITSA 1W44A 1FFCA 3IELA 2N47A 1LU9A 3MOSA 2EV9A 4M1OA 2FFRA 3NHAA 3LVFO 4F5YA 2X58A 5HRUA 1QV6A 1AKQA 1PK7A 1P7ZA 2O2YA 2OP1A 2PMBA 4FMBB 4KIJA 3HYLA 5I8WA 5JNLA 4TYNA 3DTYA 3KBBA 1DFIA 1OT3A 2AKEA 5KPJA 3UMRA 4MLZA 4QPZA 2PKWA 2RGAA 1U8FO 3GOHA 3F6EX 4OHZA 1KSJA 3EGDB 3QKRA 3VU1A 4MGZR 4EHNA 2IU4A 4O2BF 4QECA 2DWCA 1XL0A 2HK9A 5H1YA 3V1YA 5F9FA 5E3IA 4JLJA 5H68A 5AJHA 2OWEA 3IDAA 3D4BA 2VRBA 3TE7A 4BO5A 1EHCA 1XV5A 4Q05A 4BNXA 4TXJA 4ABTA 1ESMA 3R41A 1RJEA 2B69A 2CXTA 2H1CA 3IJRA 4XTRA 4ZTUB 2G1UA 1BFDA 5C8VA 1Q84A 1VSUA 1XYVA 4P7JA 5IP5A 4EHLA 1U2TA 2YNMA 1WULS 2YDXA 3R74A 2P8SA 1LFDB 3FWHA 3UJAA 4BN4A 4LF4B 2ZJZA 1K8QA 5JWOA 2BFEB 4BFXA 4MO2A 3H8JA 3PWTA 1J70A 1JP7A 1IOVA 1PFUA 4HQLA 1YZ3A 1MB3A 1IHOA 2P1DA 2JFVA 1PEDA 2MYUA 4YJ2F 4G0ZA 4G3XA 4LRYA 3BL6A 4PZZA 5KTYA 2PRSA 1A1SA 3U4CA 3RSCA 2R25B 3HJBA 1U7PA 4K6HA 2CLIB 5GV8A 5A5GA 2OSBA 3NI2A 1BVUA 3P71T 4BTLA 1KZ6A 2C8KA 3PDCA 3R44A 3J81A 1XFDA 1AZTA 2ZKLA 4CLRA 2YWEA 2OO3A 2EIHA 3M1LA 3PQ2A 2R7AA 2IYZA 2VRNA 2JA1A 4CM9D 2OBNA 5FLEX 1O2DA 5ALXA 3EVCA 3ZHYA 1PTJA 3K5IA 4PX3A 4I8DA 2Q4BA 2JAWA 3GRPA 2IYPA 3MUEA 3ZNNA 4DLNA 4YRNA 4CLOB 4II2A 4RK4A 1YS1X 2WP8J 1HNWB 3THYB 3ZHCA 5F77A 1YHNA 2BBWA 2IP1A 3BRCA 3OY7A 4HGYA 4V38A 1A7UA 4DMRA 3NS7A 1M2KA 2VTEA 5K99A 4NAVA 4TL7A 4UBOA 3QXSA 3T9AA 4A10A 5B6IA 1G1AA 3IE1A 3HO8A 5JCXA 1PIWA 3QFSA 3CLVA 1Z38A 4A2PA 1H3NA 2ZIUB 2R8XA 2FZWA 2YJGA 1B6GA 3G85A 5AHRA 2A5GA 4QC2A 5G1PA 5C35A 1DZIA 4LRWA 2W48A 2GAJA 1CUIA 3U7QB 4DCTA 1M0EA 4OFZA 4Q4DA 4RPHA 3MQFA 1L7RA 4R83A 3EYAA 2H1OA 3BXHA 1HZJA 2W6ID 3JCZA 3M83A 2IELA 4U7WA 5G3ZA 4L2IB 1N2CB 2BVNA 3F3YA 4FDTA 3B6KA 5AYVA 4RF2A 2WYUA 4Y98A 1GQYA 1WP4A 4FGKA 2F8LA 1I0LA 3R3JA 4ETNA 3H5TA 1O77A 2VIIA 5KWEA 1AQLA 2IUYA 4DDKA 2YOHA 4JVLA 4YH1A 1BRTA 1DPFA 1GU7A 3MWKA 1K5HA 1ECLA 1URPA 4K9PA 4P98A 3GJZA 1E96A 1B8PA 1JLKA 1X2BA 2JNWA 1Z8NA 1KDPA 3ORSA 4JP8A 1VJCA 4OQMA 4ZHSA 2GX6A 3OURA 4GX5A 4R9RA 4JIMA 2NPIA 3USZA 4JBXA 4G1EB 3ZTYA 4LZAA 4HWGA 4DADA 2XCQA 1NUSA 4U2FA 5JYCA 5HTKA 3FNRA 3SC2A 2YIJA 5JYBA 5JW6A 2VBCA 4C0XA 3BBLA 1D5CA 3SIWA 4XDHA 3TNLA 5K6AA 1A8IA 2FPGB 3B1XA 4H16A 4C0WA 4BZQA 1R18A 3QA3E 3TJRA 4HWRA 1N6LA 1E61A 2QTAA 2ENUA 3KSMA 2Q6OA 1N5MA 2GN0A 1AB5A 4CN9A 4ERXA 3GELA 5C2JB 4FD3A 2ZW9A 3VYWA 2P9QA 4J2HA 4EEXA 2HU7A 2UYHA 4X84A 5KOJA 1RLUA 1CYDA 3KAKA 3QF4B 3MJ4A 3IP7A 4RLQA 4OCZA 3F8WA 1TC1A 1ZH6A 3G8YA 1DV2A 3ZHRA 4DV2B 2HYIC 4B8YA 3TVDA 1E2HA 2PL9A 2CL7X 2D59A 3NTOA 5AHXA 3PD0A 3PEUA 3ZKAA 1MJFA 1V35A 1ZD8A 4AJKA 4QLAA 4H31A 1X7DA 4DUGA 4MMXB 4Q15A 5JNSA 1L7NA 3UATA 1D4ZA 1DS6A 5C4MA 1NE2A 1MPXA 4ZAXA 1YE8A 1AK9A 1TOAA 3HEBA 3UCFA 4Q18A 5DO9A 5TGZA 3CR3C 3EQ8A 3JRXA 5EJ9A 1XVIA 3QVOA 3CZAA 1NAHA 4NCKA 4O3MA 3FI9A 2WJAA 3AZOA 2FG7C 2OLKA 2X2FA 3LXRA 2TMGA 3WGJA 5CR9A 5JS8A 3BB4A 4Q3OA 1JN0A 2EVWX 2XQVA 4GKAA 4QDZA 2PE5A 3RS2A 1HDIA 1P1HA 3BWEA 3DWFA 3AR4A 3N58A 1RP7A 4RSGA 4QXRA 4ZVSA 2VSXA 3DOFA 4WV3A 4DCGA 4F5DA 4PO8A 1J06A 1T36B 2WP0A 4WERA 1QLJA 4CKWB 4RKFA 2XRYA 3WL3A 4PQRA 3L5OA 3UW3A 5A05A 1TYAE 5M5BA 3DL2A 1EFLA 1ORHA 1P18A 3RJ5A 1YBHA 4M0MA 2PUCA 4NJOA 3G8AA 2XEDA 4MB6A 1RSZA 1JPNA 1NDHA 1X7YA 4KXLA 3U44A 1QRDA 4RM3A 3ZDFA 1NXPA 1KY4A 1RAAA 2AN1A 2OLJA 3BJZA 4QT0A 2G9UA 3R5SA 1SOWA 4J7CA 4WNAA 1OA1A 2JI4A 4FBLA 1FNCA 4DCSA 3PPWA 3RVDA 3B6IA 3JARB 3CZCA 1UBOS 4GL4A 1U7XA 2C2YA 2Q1UA 2HWYA 2WVJA 3K5WA 1Z0AA 3MAJA 3QBTA 4IJ5A 4W1QA 4OX9Y 4BEVA 2WTAA 2X9GA 1NFRA 3I4LA 3TTUA 3LFUA 4GXTA 3QMWA 1ES9A 4HRAA 3O92A 2E89A 2VK8A 2H9YA 2V7QA 1QZZA 4Z1MD 1NXQA 3DZDA 1KKLA 2VTDA 4OHXA 1CIVA 3WS7A 3CCBA 4F93B 1F2VA 5BP7A 1GZUA 1M83A 1KI3A 5TGTA 2FF7A 4B6OA 3NTVA 3OKCA 3ODGA 9LDBA 2ENWA 1UMBB 5J4LA 2XUDA 3KWJA 5F51A 4KREA 1ECGA 1L5ZA 2XVYA 1SEPA 1SNYA 3AKYA 3WNCA 2QRKA 3AZPA 1C8KA 2V7EA 3NGMA 1W5EA 2XCLA 4CMHA 1P39A 2H2FA 4P80A 4N3AA 3KKZA 3OOWA 1DEOA 4KLCA 1XPUA 4OGFA 3IOBA 1PTKA 4KW7A 5KB3A 5BUZA 1JB1A 3T4UA 1TM3E 5EYPA 3Q98A 4UD2A 2NTJA 4MNTA 1TVKA 1U02A 3I2KA 4MYSA 4OU4A 3M3PA 2PZMA 1XELA 4OAPA 5DNUA 1I5OA 1MX9A 1EDEA 1EA7A 4JNCA 3FZEA 2IHTA 3KDSE 3TOCA 4C0QC 1HOTA 1TQDA 2WJPA 4KQGA 3K30A 3BRQA 3FJ1A 3RUHA 1SKBA 1VBFA 1BVRA 3RADC 5FBKA 1QJCA 2HJRA 2P78A 3LK6A 4U2BA 5DNAA 5HA5A 5LLTA 3ZQKA 4CM6A 1YIAA 3SFTA 2EEPA 1QUFA 3F9CA 3R8CA 4OQXA 1Y9JA 4RXTA 2QTZA 2A3NA 2I0FA 4HAXA 4ESOA 4ENTA 3V1NA 5CYFA 4AKTA 3AXSA 4CIAA 4P84A 2O8FB 2FMKA 4P7GA 3OVMA 3VPFA 1MJGA 3AO0B 4QODA 4NU5A 1E3IA 1UFVA 1X6VA 5DCWA 3TLMA 5HDBB 1B6RA 3B8HA 4OF4A 4J0IA 3NIDB 1SJ9A 3B6MA 1DKQA 4FYMA 2XGMA 3NIGB 1NRXA 3BCRA 4Z1OA 1W8DA 4J1NA 4UXIA 1WOYA 5B58T 5DF1A 1WUIS 3ZY4A 2MSLA 4LEIA 1MX1A 4AUEA 4TWBA 1SQSA 1XU9A 3NTQA 2F3RA 3EDMA 5KQSA 3ZVKA 2QG9A 3SAJA 1R1DA 2XZOA 2NOAA 4G84A 5J47A 1NJGA 5I51A 1TQ2A 3LJKA 3LX6A 1I7NA 2W2TA 4KEAA 1ADCA 1SCUA 1WSBA 3AFMA 3VDRA 3K9CA 3DBIA 3ZK8A 2JRLA 2NZYA 1WKCA 4X1OA 3K70D 3DBHA 1ZGCA 3AKDA 5TIIA 1QYVA 1KE1A 2JCGA 1RQNA 2V98A 4BXOB 1EVIA 2QRLA 3G1TA 3HVHA 5EZQA 5FWDA 4EGAA 5BWMA 1QX4A 4Z8XA 4GMKA 1GU1A 5KSOA 4DABA 1RYEA 5I45A 1DB3A 5KTKA 2C7QA 1BQEA 1S8OA 3ZCRA 5JNVA 1ADFA 4YMIA 4BVHA 2GO1A 3NR2A 4ND1A 4P86A 1SRQA 3CVOA 1IN8A 1X2EA 5L3ZA 4G0NA 2F00A 3MSXA 1A96A 2IY9A 3OFSA 1APBA 1FJXA 4KR2A 1JHDA 1MLDA 4IEEA 2Q9AA 5LR6A 2G82A 5A6SA 3T3OA 1VKJA 3M9WA 4JEHA 3RTEA 2IOHA 5I5EA 3PGXA 1M3SA 2QIPA 4WLOA 1U2DA 3O31A 3W5SA 3FDZA 3OOSA 2XY4A 3B82A 3CGWA 3MRTA 4I1SA 3QBJA 2GM3A 4P81A 4D7AA 1C7ZA 3AUJB 3WWYA 2WWVD 2Y77A 3DM5A 1VIYA 1U3CA 2ZLBA 3DZGA 2IPMA 3I9FA 3MT9A 1D03A 4KR0A 2F6RA 5JARA 5L3SA 4LVNA 4EPWA 4PZYA 3RS0A 2ZRBA 2JCSA 2UVPB 3A4VA 4Y6GB 2C57A 4BAUA 5DX0A 1XROA 4NPAA 5KTTA 1DCTA 3E4CA 5JZSA 4OHKA 3FSRA 3MTDA 3PR2B 3QKWA 1KR5A 3GFSA 3CV3A 4RZSA 1E98A 2AJDA 2DWQA 2DFTA 1PR2A 3LVBA 2NM0A 3O84A 2C5AA 3IBYA 4M22A 1KFJB 4FFDA 4X93A 3YASA 2FE4A 2CXHA 1BMDA 2FJUA 3W5BA 2A1UB 1G18A 3IJEB 3LWNA 1E2NA 3NBYC 2P2SA 2WIBA 2GMWA 3OU7A 4MMZB 5KQMA 1SXJE 2VDJA 4XFDA 4K7JA 3WGKA 3I09A 2VA8A 3AR8A 2MU1A 1UWLA 4CDMA 5BSFA 3DE3X 5TQ2A 2I6GA 3OTWA 4UBIA 1UM9A 1EKXA 2XTZA 1V6AA 2QAIA 2ZI4A 1IBMB 3LPAA 4JLWA 5BOSB 1T9GR 5AO9A 3ZWPA 3O3OB 2XZTA 2FH5B 5EKTA 2WF6A 5JSYA 2QXYA 1DV1A 1V5EA 1J90A 2MJLA 4WIAA 4X1KA 1ZVJA 1NM5C 1EGVB 4IDOA 4IXDA 4G56A 1H2WA 1ZGAA 1F48A 2OB1A 3H4IA 3OJ0A 4Q3BA 2B5WA 5CLFA 2QLMA 3D6VA 4LMPA 4EVSA 5CDSA 5LXTB 4HPXB 1JIIA 3O4JA 2JGEA 4FJ2A 2AMFA 2WMOB 3I6MA 3X1WA 1Z5NA 1ZJYA 1AGPA 3JXEA 4PS1A 3U3JA 1LH0A 4R1UA 4UKDA 4ZI3A 2A88A 2XRZA 5EWJB 1PR3A 5IZCA 4QU5A 3FNHA 4AZSA 1MH9A 2B37A 3HB4X 1JA1A 4RK5A 2FPOA 2C3OA 1VYUA 3PJGA 3R7LA 3M33A 4MUGA 5G4KB 4DC0A 3WB9A 3KYJB 2YCBA 3R8FA 3M6MD 3TQSA 2ZJYA 3M4ZA 2BEVB 3B9QA 2E5FA 4UTOA 4L8GA 3U7JA 3X1KA 3ZCQA 1LPAB 2VZ0A 4P4TA 4DKXA 2WJZB 4AJHA 3IILA 1D8AA 2RGDA 4K9QA 4ZYZA 4MTCA 4OHWA 4NKRA 2IV2X 2V6FA 4RWZA 4BBZA 4EARA 2PUHA 4KXYA 5EWMB 1T6XA 1FRZA 3N70A 3Q0IA 4DM7A 4GXQA 3U2QA 4TQUS 4XYBA 4B5LA 4EI9A 1QFSA 3TW0A 2VPWA 3HCBA 1IVSA 1GEEA 5LOVB 1RAIA 2Y4OA 1HXHA 2G0AA 2A2ZA 2FOIA 4ZYUA 1R4MB 3HN2A 3EIUA 3QNMA 4Q1VA 1II8B 4P3YA 1OZ0A 3WRXA 2OILA 2AG1A 1PZGA 4NBSA 4AJ1A 3DMTA 4I9GA 1XOIA 3REFA 1Z7YA 3LKZA 3Q7PA 4N47A 2IPXA 2XPCA 3SM3A 5I9SA 1ZM7A 4Z9AA 3TH5A 3H1AA 1SIWA 2E48A 4MWEA 4AG5A 1F1JA 3B2EA 1X7HA 2AGVA 3LGAA 1TJNA 1VI2A 5H9WA 2FCAA 2Q2WA 2R2AA 3GFVA 3ONNA 3PX3A 4ZT5A 3EBPA 1NT2A 1UPAA 2OGTA 3J80A 4NQZA 1RQGA 1ZRHA 1RC1A 2ECOA 4WDQA 3W3AD 1T25A 5JXHA 3IPYA 2QS9A 3A06A 2N42A 3OQIA 2QD5A 4NONA 5JPIA 5C32A 5CFOA 3PWKA 3FG9A 4HQ0A 5ICFA 2B20A 2ZDQA 3TK1A 1FTYA 3GAZA 4ZCSA 3EEOA 5J1SB 2I76A 3WQHA 5JSUA 4WGGA 4EA7A 3TOSA 4PQYA 1QRSA 1RIFA 4JELA 1IYZA 2YINC 1VKZA 4QXQA 1C9DB 1OZAA 1U9CA 3K6RA 4XIJA 3W6ZA 3LUAA 3OCZA 4LTNA 4XB1A 3SHOA 4ZFNA 1C9EA 2C94A 4G36A 2C31A 4LJLA 2C5LA 4JQZA 5BN4B 2PKCA 3HZOA 4TV8B 2I3AA 5HEKA 3THRA 4H6WA 3UAGA 1YCDA 4JSTA 4F8JA 3IURA 2UYOA 1U7DA 2RC5A 2W43A 3ISVA 5EXTA 3D2LA 3WQBA 4D6YA 5K03A 1OGIA 2MR5A 4NNOA 3BSYA 4OVKA 4LWZA 3PHLA 1X86B 4LCEA 2FUKA 4MJLA 1R8QA 2VJMA 3CM0A 3GT7A 1YU6A 1Z13A 2C99A 4QAQA 4OI1A 4D98A 2ID4A 2GEVA 1B3BA 5EAIA 3SOZA 4CQMB 3GG9A 1U3UA 4G9BA 2PFKA 4ZEWA 1TYEB 4HAZA 1SIOA 1GPUA 3CIFA 5KSYA 1N25A 2FSVC 1GVNB 5IAKA 3FNGA 5I9TA 4DVGA 4BPBA 2XTJA 2XUHA 1FZQA 4D0NA 3ZBQA 2WFMA 4RGBA 3SBXA 4DM4A 2W6ZA 2Q3JA 1QQTA 2ZBDA 4UNPA 4LF7B 3IIKA 3ONVA 5DYWA 4BV3A 4DIKA 1G5TA 1XA4A 4DLYA 2BFPA 3JAKB 4EY5A 4UTRA 2PAFA 2V7UA 3HBNA 5ITZB 4QQNA 5FOVA 4G0QA 4H7EA 3VAYA 5GJWC 1ZKDA 5BWLA 3RSOA 5AVTA 4PCVA 1Q0QA 1J6UA 2YMQA 1R8YA 1HDXA 3JVVA 1M7GA 3FCOA 2JRCA 2VJPA 1XZLA 3UO8B 3WE7A 3LHSA 4HNUA 3QXXA 3ZV5A 2O06A 1AMNA 1SBYA 3L7KA 3LLUA 1F12A 1IZ9A 5DN9A 1M8GA 2R7MA 4EF6A 1USKA 2IE0A 2FN9A 3MNFA 3ZGLA 4EVRA 2OD9A 1TAHA 1U0NA 2GAOA 4LN1A 2BE7A 3WFJA 1FVOA 4IJMA 4PWZA 1Y4SA 1W19A 1XWIA 3R7FA 3O8LA 4CMAA 1NLMA 4D92A 3TI7A 3R8XA 3W5VA 2WTEA 1DOZA 3RASA 4QSHA 3RYFA 2JAUA 4RAQA 2CCKA 3GDHA 1N0WA 5AHWA 5FF9A 3HJHA 4FFWA 2WMNB 1GQ2A 2QEQA 1F3OA 4OPMA 2D7DA 1NXOA 4H7FA 2W2MA 3LL4A 4FINA 1SKUA 3AG6A 1OI4A 3BJEA 3TW8A 1X3SA 4WN9B 4XIGS 3TYXA 1MJGM 3ZGOA 1Y81A 2I29A 1P6XA 1II9A 1VSTA 2SECE 5IJXA 3RYHB 1V9SA 2GEKA 1KAQA 2CHVA 3H3FA 1Q7CA 4NRDA 1LQUA 5PGMA 1D9ZA 2HI0A 3OJFA 4AN1A 4EMSA 3ZE6A 2WNIA 3LZDA 2NXCA 1QU3A 4HDCA 1AH2A 2R5FA 3QFCA 4HDKB 1EDOA 2QTFA 4OFBA 1HUQA 3IESA 4DXDA 4UOEA 3KOYA 1PUIA 3V1TC 5ECDA 1W48A 3HL4A 1FP6A 4OBWA 1I2BA 2B4RO 5E0KB 5LDHA 2XCSB 1YFZA 3EPHA 4KPEC 3WAGA 3FTCA 3AEQA 2X8JA 4BMDA 4DR5B 4BO4A 3K72B 1TL7C 1RHKA 2N46A 1WXIA 2W2NA 5EXXA 5CIYA 1LJ8A 4GOOD 1KSGA 2F3QA 1KMQA 2QPOA 4RCYA 1PG2A 1HKUA 2PZFA 2QRUA 3C6BA 3NPAA 1SCUB 1REQA 5DHUA 3F71A 2XMGA 5DGXA 1A4IA 1J00A 4ER3A 2OXTA 1M8KA 1WPQA 1E1NA 1ODIA 1FVXA 2RI6A 4L4XA 3DDSA 4IX9A 4L78A 4CIWA 1N0VC 3HFRA 3KYCB 4G37A 3SDBA 4BQEA 5BMVF 1M0WA 2IPNA 1NR5A 3P2KA 1W30A 2JVKA 1GZ5A 1E1QD 3LP6A 4XGQA 3SYLA 1FNBA 1OGJA 4OJMX 1E1YA 1DTWA 3T5DA 3HUEA 1IB0A 2Q5CA 3IUNA 4EB3A 4CM5A 4AQYB 5LQAA 5HILA 3C5CA 4MQ4A 3EDQA 4C0AC 3VDXA 1PZNA 2RJOA 1EWYA 1LPPA 2ZDGA 4BNYA 1AM4D 1DL5A 1Z3CA 4Q4AB 3DNMA 4MICA 1MABA 2QIOA 3D6FA 5T3UA 3GNTA 3RFVA 4ZREA 2C5SA 2JGNA 3G17A 3KVOA 1NRJB 2HQRA 2XQJA 1FRNA 3QA9A 3HKCB 2CV2A 3PQEA 4CT5A 1ZGZA 3FIUA 3ZDYB 4G1UC 2I2BA 3QPUA 2ETVA 3GJ5A 2XJ4A 1OAOA 3ZK7A 2CHFA 3ILVA 3F9IA 1FBTA 3I6YA 4HX2A 3KPUA 3LLCA 1IOZA 3T9EA 3CBQA 1DKOA 4BLPA 5LPNA 2PA3A 2PMKA 2WW8A 4M4SA 4QQFA 3ROPA 4CL3A 2H8KA 3ZY3A 2ZIZA 3GFGA 4X7BA 1HYQA 2ZZMA 1WZEA 2P0YA 3O8BA 4ZOCA 3L7CA 3IHTA 5EYPB 4YAKA 2M6KA 4L6AA 1YVRA 5U4XA 1JT9A 4RHYA 2GERA 5FKJA 3ZOKA 1GV0A 5LSAA 2H4WA 4ASUA 4EF5A 3WO1A 4N76A 2IYTA 1ISJA 1FYVA 4NE7A 3VZPA 4DYDA 1Y6GA 5BN4A 2KLHA 1RLTA 2HJHA 1VI6A 4DUZB 2BR5A 3HJGA 1XK6A 1ZM4A 2ARKA 3EQ9A 2JEYA 2QL9A 1M2OA 3HADA 4EVQA 4ZDWA 2IX3A 5T7BA 2FEWB 1BYIA 2WE7A 4ZK2A 2G83A 4LE1A 4PY2A 3RFUA 2PT7A 5B1EA 4Q7JB 4ND4A 1MV5A 3N39C 3EYWA 4UBNA 3KALA 4P4GA 5CVTA 1CCWA 1J0EA 1IIBA 3PC2A 4NMHA 2EU8A 3HWSA 2ADFA 1VJTA 1RBQA 3OAAA 1L1QA 1HLPA 1KP3A 4C5AA 1YO6A 1H9CA 3ZZNA 4ZMRA 2ZUCA 4R6WA 3H9QA 3B5EA 3WWOA 1MVOA 3PQ7A 3CG4A 3LT2A 4MAAA 1JEQB 2GI4A 1PVDA 3RGWS 1FVFA 2DUNA 4UFOA 5IDXA 4UHHA 3WDSA 1H8HD 5E6SA 3BSSA 4PV7A 4EW3A 2C3PA 5I7RA 5HVNA 4YWJA 1M2JA 3D8NA 4UM9B 2PV0A 1E63A 1I7PA 1KORA 3A1EA 4DUYB 1RACA 2LD4A 3D3QA 1QP7A 3WA6A 1PJCA 1FDUA 3FRJA 4R51A 2JFFA 5IJZA 4A5SA 1RABA 1DC4A 2GD1O 2H1HA 3QU7A 4Z4QA 1UXGA 2YWRA 1AT1A 4UEJA 4CM4A 1G20B 1VE6A 5I7FA 1CYEA 2GO7A 4IRUB 3ASUA 1QAQA 4RZUA 4JXKA 3KUXA 5LZ5A 3ZHTA 3OLYA 4ZHQF 1MTZA 4P33A 2D2XA 4ZTZB 1LK5A 1TIPA 2CJPA 3FFTA 1EEHA 1P4AA 1T36A 3DHWC 3GPBA 3IOMA 5CH5A 4OHMA 4X8HA 4PLFA 4OXNA 3NHWA 3DV0B 4GYWA 4OHRA 3VTZA 1GGHA 3KXDA 4AT1A 5JV5A 1M8FA 4QYMA 3RT7A 3ZUGA 1YF3A 2D54A 4TWIA 2C4MA 1J2UA 2XAUA 4H3KB 4CGYA 1PS0A 5DYTA 2BZ1A 1U8EA 1MENA 4CMIA 2E87A 2DX7A 4ACAA 2GZAA 1RHMA 1Z6QA 2R8YA 2WYHA 3ND5A 4O25A 5E6RA 2YVUA 3T4PA 3QJGA 4CKBB 4DFDA 4ZI2A 1Y3IA 521PA 1QZ3A 1YHZA 2C2ZA 3PYMA 4KGVA 2NO6A 4R3NA 4AJ9A 3KB6A 4CNBA 2YXPX 3SZOA 1EX9A 3BHMA 3R6TA 5E3JA 3TQOA 4MI6A 3V34A 5A5EA 1JR6A 3OCVA 1X9GA 4PAWA 1EQUA 4FX5A 4JI2B 4IIJB 1E4EB 2GN4A 1GADO 1L4MA 1NMXA 2CNWA 4IZOA 3AR2A 5T41A 3GEHA 5ILOA 3RRNA 1TGVA 1FVHA 2CF5A 1USVA 1W88B 4L0QA 3ECSA 4QOFA 3PR1A 3VZBA 1ECJA 1OAOC 4EW1A 4LY0A 4B7UA 5C9ZA 3CRNA 3CEMA 2OBMA 3RB8A 1I24A 4ZT6A 1DO2A 1YDWA 3A4NA 3DR5A 4GZLA 4M0EA 4Y1EA 3MTGA 3A1FA 4EK9A 1Z5VA 4W7HA 2NNWB 1J21A 1NE7A 2ZYUX 2C7BA 3E3OA 5AVVA 1TVEA 1CULC 2ECFA 4NZYA 3FLBA 3BEDA 3GVHA 1LBQA 1PL0A 1X1CA 1HDEA 2I1VB 3QEMA 2POQX 1N9GA 4LZZA 5FOUA 4YAJA 1H85A 1EJ0A 2R60A 3PD1A 1RYHA 5DBHX 2GPJA 5DBOA 3A6FA 4PC3A 1VFNA 1E8NA 4BDTA 4MW5A 3NDJA 4DYHA 3GLFA 1II0A 4Z7OB 1Z5PA 2ZT8A 1TZ2A 2WPDA 5I9MA 1QB8A 2Q2NA 4LOHA 1SB9A 2F55A 3OLCX 1J2RA 3CZMA 5KNBA 3JQ7B 2PR7A 4HNAB 4KBYA 2IS6A 4R5MA 3MWGA 3EC1A 1CV2A 3GAFA 3MZ0A 1N2IA 4LTMA 2AEEA 5TPZA 1Y3AA 4XSHA 3RSSA 1X74A 2XE8A 4GLBA 4C6TB 1THZA 1TVMA 1Y6JA 3TRDA 1SKAA 3ET5A 3IEKA 4WUVA 1UDAA 1VCOA 4JQYA 2R47A 4MB2A 3WAJA 4N41A 4HYYA 4MK4A 4BGEA 1KDZA 3SJ7A 4JLMA 3GUHA 2LCFA 2XT9A 2VWGA 1RRPA 5BR4A 1UMKA 4LPSA 2HNAA 4PZ0A 3MT7A 1PDWA 1NVBA 2NV6A 4FYPA 3OEWA 4OKNA 1SHJA 1IUOA 2GVZC 1IBRA 4ARSA 5C18A 5DTEA 1BWRA 3SYKA 4K0RA 4E14A 1YACA 4DGQA 1H0KA 2BH9A 2I4NA 2V1XA 2CXOA 3K0EA 4RZQA 3EG5A 4DQVA 3WK9A 5IASA 2VJQA 3LIIA 1MTOA 2D5AA 3A6JA 3M6AA 3NFYA 4KSCA 2NMVA 4RTPA 4DEXA 4CGZA 4REQB 3V4VB 2ILTA 2G1AA 3VPXA 3EZ6A 1OFGA 3CRVA 2P41A 2D74A 4I2VA 5DHAA 1R27A 4QHSA 5AM2A 1L1EA 5JCOC 5JISA 4GO1A 4FM9A 3FUUA 4CXMA 4D42A 4NU6A 1ONOA 4KMSA 4MUBA 1CUYA 4Y9TA 3TLBA 2O14A 4PINA 3L0OA 1FSZA 3CX4A 4CF4A 3TD9A 4MKRA 3AILA 3E6AA 2HWXA 3IQXA 4GYJA 5K0TA 5A7HA 5EFOA 3JZMA 1WXGA 3V8VA 1V7PC 4BU0A 2EJUA 1O95C 3JALA 3TSZA 2DQZA 1P8JA 3G02A 2A7QA 4C4TA 4F3YA 3JD2A 4B8WA 1SU8A 3BILA 4J9VA 4S1VA 1K7FB 1VGVA 4NZPA 3IP8A 3ULKA 4HB0A 4PNHA 3BGOS 4FSXA 4URUR 5IJ9A 1SQ5A 1A9RA 3QX7A 4L5CA 3AR7A 1PSWA 2DQSA 5JD5A 5JH7F 2ZE7A 2ZIAA 3EDCA 2OCAA 1CR1A 3BCSA 1NNEA 3N87A 1M6WA 3GJ6A 5DTIA 4GOLD 4JD5A 3H1EA 3EIOA 1R15A 3LDHA 1JT2A 4B3BA 1PVVA 5KYGA 2ZP1A 3LDGA 2L2QA 1UBFA 4DV6B 4X0EA 1GNVA 3VDNB 1DC5A 2VYCA 3ORQA 2VNIA 4JUBA 5T3YA 3U4AA 1T5SA 3G9TA 3QEBZ 3N6RA 1MRZA 2XCUA 5L6MB 1PGQA 1WEHA 4F5EA 4GSYA 2QI9F 3VOSA 4ER7A 3IKTA 4K9KA 3E58A 2CMDA 1JZTA 1YOBA 4ZKEA 2HIMA 1S1MA 4PE5B 2VQ6A 4M86A 4OJQA 4ASUD 2GEFA 4WBNB 4A91A 3TQCA 4DJ5X 4BNKA 4P3NA 2BKVA 2PX3A 5FNVF 1QS0B 4I66A 5G0TA 4ZZ1A 3GCDA 2D2VA 3G0HA 5JSKA 4N48A 4W99A 1QK4A 3F6PA 3RGGA 2OGUA 1HE4A 2RDMA 1ZL0A 3LC7O 1Q6ZA 1GZ3A 3V8BA 2HCRA 4F3KA 3JU3A 1Y9DA 4EY8A 4KFTA 3LY7A 3H6KA 2UZ1B 1QPZA 1W6RA 4KAXA 2I4MA 5K51A 4ENPA 1D0IA 3T52A 4QQRA 2ZWAA 2ZR8A 3CKMA 3HXQA 3FUXA 5KWIA 3LA6A 2V9PA 1UAAA 4FHDA 3PYXA 3IOYA 1LPSA 5CW1A 3M82A 2H4YA 4WUTA 5AR1A 4LFAB 4ENWA 1JHUA 4RIIA 1UINA 2Y6VA 4ZO7A 1Q83A 1W25A 4BJ5A 4PN3A 4D8UA 1TK2A 3OFJA 3CINA 4FYVA 3ST7A 1D8TA 1L7BA 1RRGA 3PQ8A 2VDUE 5AKZA 4C04A 5C34B 4XR4A 3W9BA 4KXWA 2F9FA 1L7MA 2CXSA 2XYHA 2XB6A 3CLRC 4H1VA 4YRMA 5G0SA 4X90A 1DXQA 3HABA 3MAAC 3OIVA 2Y6UA 4KDEA 3UJDA 3EIQA 4OHOA 5ICSA 1YRBA 1T6YA 2Z43A 1JEC