4PSKA

Mycobacterium tuberculosis reca phosphate bound low temperature structure i-lt
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
308
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 308
sequence length 326
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4pskA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pskA01
4KAXA 1OV4A 3QENA 1EFHA 2CVFA 2G83A 4DDVA 1T6NA 1WE2A 1U2RA 4QJ5A 2IWRA 1X8JA 3R20A 4ESVA 5D3MA 5F9FA 2I4IA 2JLVA 1AM4D 2IYRA 2ZETA 3QF7A 4D0GA 1KIMA 2QA5A 2FZLA 3PUWA 5HE8A 4EPVA 4CEJB 3CH4B 1Z47A 2ZUDA 3R7WA 2B92A 2OFWA 1XRJA 3UIEA 1T0HB 3CRVA 4B74A 3PUYA 4M1MA 3UATA 1MOZA 3GLGE 1R5NA 2WOJA 2ZE7A 1I4TD 3H4MA 3KX2A 5J40A 3CB4A 3NHBA 1YZNA 3OEHA 2VP0A 4B48A 1IXZA 1R0ZA 4TYQA 3GLHE 3L43A 3THWB 4Q21A 4A9AA 2X2EA 621PA 1KAOA 4TSFA 1OHHD 3CKLA 5JSZB 1DAFA 4PPFA 2XXAA 1XD8A 2PLFA 1XFAA 3QXHA 3EPJA 1UBCA 3SBDA 3LD9A 4EJSB 3NEJA 1IXSB 1FX0B 2WPDA 3RSOA 1G6HA 3FKSD 5FTKA 1XZQA 2VF8A 2AX4A 2ORIA 2GJAA 4ASUA 5ELXA 4TMZA 2JIZA 1RFLA 1W4RA 3AGQA 4JSTA 3IPXA 2BMFA 4RJLA 5CM8B 1S2MA 4X8HA 3MWLA 4B44A 1NIJA 4PO1A 2AR7A 2HEIA 2Q9BA 2WV9A 1Q3HA 1G17A 2XTNA 3E2IA 1DAGA 2PT7A 3QY0A 3U4QA 5JEDA 3QPUA 1VIAA 1TQDA 2C9CA 4IDNA 2CK3D 5KPDA 3KXLA 3K8YA 3NVAA 3HJNA 4HEJA 3U44A 2ODEA 4Q1DA 4PC6A 5HCNA 1W36B 2GBLA 3CRW1 1JR3D 3BB4A 1C9KA 3CRMA 1FPMA 4MITA 2D2FA 2NQ2C 2JDID 3AF0A 3LFUA 1RVDA 2GILA 3Q7PA 5JI3E 1WQ1R 2OLJA 4TZ6A 4D6PA 2C9YA 3NG1A 2C5LA 4NL4H 5FPTA 1XX6A 4PSKA 3WMGA 3PVSA 1RIFA 3GJ0A 4LJ5A 2VEDA 1P7CA 3QXCA 3EPLA 3B1VA 1E1QA 2O8BA 3LAWA 1W0KD 3GLGA 1TNDA 4NBSA 4DSNA 1I4LD 2RGNA 2XOKD 3KKPA 2BIFA 4AC9A 1RRFA 2O0HA 3FHCB 3C41J 4U7DA 1E2EA 2ZRCA 3DM9B 4BWYA 1XNJA 3GLHA 1GKUB 3BWDD 2QBYA 3G0HA 4XWKA 2GDJA 5DHFA 3ETLA 3DM5A 3O8RA 1QZXA 3P1JA 4JVSB 2J87A 3HU2A 1EX6A 4M1KA 1FZQA 4TMWA 2CJWB 4B2LA 4KXFB 2ZSDA 3RDPA 1DO2A 2P6NA 1ELOA 1OPXA 3KFXA 2ZJOA 2VHCA 4H9GA 4OI2A 1PZNA 2PZFA 4Q19A 4Z8YA 1O3YA 4KYIB 3HYRA 4X8LA 5KUTA 1KKMA 2O52A 3VTKA 1H8EA 4FXPA 3IQWA 1G5TA 1H8HA 1ZUHA 4OHVA 2PBRA 2ZS7A 1E99A 4HZIA 1UKZA 3BS4A 4ZDJA 5JLJA 4WXPA 3QI2A 1XTJA 1L7VC 4IXMA 3W8RA 1XCGB 4MDFA 1N5KA 1NBME 5E4FA 5CYPA 2O0KA 2VHJA 5JJKA 4S2EA 4A6PA 2CL0X 1FNNA 4B76A 1U94A 1CTQA 2JASA 1DEKA 5BN5A 1HQCA 3PQCA 4IOMA 1VTKA 3I32A 3CRRA 3IDQA 1NLYA 2J59A 2ZM5A 2ZRGA 2WZQA 2D7CA 4EAQA 5KSZA 3A37A 3A58B 3DO6A 4EPYA 1JNYA 1JJVA 1BYUA 2REOA 2NPFA 3UMSA 4PX9A 4L8GA 4Q18A 4TYNA 1E9FA 1SVOA 2C9OA 3ECCA 1W4CA 4H1VA 3DL0A 4OQXA 4C0QC 4P4TA 2IXEA 4BLTA 3ZH9B 4DBLC 3LRPA 4MUAA 4DSOA 5GVSA 2W00A 2BBWA 2YOHA 5LB4A 2OCAA 2OAP1 3R9IA 1UM8A 4GI7A 5IRCD 3SNHA 4A1FA 5JRZA 3W3ZB 3BFVA 4WIAA 2WTUA 1T91A 1NI3A 1VIYA 1XTSA 2ZI3A 1HEIA 1KI4A 4P32A 1S1MA 4A4DA 4MYHA 3IO3A 4B32A 2Q3MA 2OFXA 3NWJA 3P32A 3VMFA 2ZAOA 2ZEJA 4O2RA 1QHIA 3M0EA 5M04A 2IX3A 4NDZA 3A4LA 4AYWA 4KFTA 5AJZA 4FMCF 5EZ6B 5B57C 1NSFA 1PLJA 2IYZA 4MGKR 1XTIA 2W2XA 2FDCA 2RKOA 5D3MB 1QHGA 4HDCA 3ADKA 1N6PA 1G6OA 1KMHA 3WHLA 4DWJA 4PR0A 2A5GA 4HLUC 4TLEA 3A6PC 3VNVA 1DOAA 1TU4A 2ZSAA 3EPHA 1TQ2A 1GNQA 2FZ4A 4P3YA 3R7WB 3LNCA 4MUBA 1N6NA 2EYUA 4CT5A 1U90A 3MD0A 1NBMA 1P9NA 5TARA 2F7SA 3I8SA 3GFTA 2NOAA 1Y3AA 4TT3A 4B71A 1Q1BA 1HA3A 1AA9A 4QHYA 1X86B 2CNWD 4OHXA 4A8JA 1Q1EA 3VFDA 4ACAA 3B9PA 2WIBA 3OFND 4PO8A 4A0RA 2IEYA 2NO9A 5GJBA 4JLNA 1CJMA 3WMFA 1JEDA 4CVNA 3VHXA 2RGCA 2QRNA 4OK3A 1KY2A 2NTYC 3A36A 3PUZA 2BBOA 4Q7JB 5HCIA 3UKDA 2QTFA 4F7WA 1BS1A 3TH5A 1SVMA 3K9GA 5G3ZA 4ZIRA 4AKIA 1XJCA 3RS7A 4TZ0A 3RVBA 3ICEA 1BH2A 2Z4RA 1AGPA 1HT1E 3FWYA 1JI0A 3B2EA 1TX4B 2FEOA 4FMDF 1NN1A 1II9A 1JECA 4FD2A 1TF5A 4Q1CA 3U4QB 4XWOA 1MABA 2G3YA 5KSPA 1NG1A 1LNZA 1TQ4A 4B2IA 3VR6A 3TUIC 1VHLA 3LBNA 1W0JD 3U44B 2GK7A 1MT0A 5FPSA 4UJ5A 1LW7A 4Q1FA 1JEEA 3QKSB 3D3QA 3RRYA 2C78A 1A7JA 2ZYWX 1G64A 2E9SA 2GZHA 3CX6A 3B82A 4OI0A 2ZJYA 3LDAA 4CYMA 2F1HA 1JXMA 4F92B 3M4YA 3U3OA 1Z6TA 1Z07A 1ZU4A 3K0SA 2IYUA 3N2EA 3LV8A 4IVRA 2PL3A 3GQBA 1ZMXA 4G5RA 5FH9A 1NY5A 2O8BB 3GLGB 3HPQA 5FL3A 1M74A 1ONBA 1H65A 3BOSA 3QBVA 4JYCA 1IAQA 2ZANA 4XTRA 1U98A 1U9IC 3JVVA 2EYQA 2DWOA 4GP6A 5JI2E 5JWHA 4GMDA 2PX0A 3GLHB 3WY9A 4GZMA 1GRRA 3QSYA 2QBYB 4G5GA 5FR1A 2NO1A 3PFIA 4V0NA 2Q6TA 3REFA 2H18A 2R2AA 2W6JA 1IN5A 1ZD1A 2CVHA 2OBMA 3SJCA 4QBGB 1D9XA 4KV9A 3CX7A 4UXIA 3W6NA 1LF0A 3T1QA 5B30A 5FOVA 3GJ4A 3WBKA 3EZ2A 3ZQ6A 2VH5R 1MR3F 5EE0A 4QJ4A 4K46A 1DAIA 4ZDWA 3U3RA 5BWMA 4HAVA 4ON9A 2H5EA 2P5TB 2KB0A 4NYJQ 1DTSA 2JJ1D 2IYVA 2NGRA 3ZVRA 4Z8XA 4DVGA 3I62A 1FL9A 1YE8A 3MAAC 4JLJA 4GOKA 2QP4A 4RY2A 3FHTA 3R9XA 4QRHA 4BFYA 1E2QA 1RPZA 3LO5A 2WWXA 2J41A 4B47A 1E1RD 3DOFA 2C2HA 2TMKA 2C8VA 2ORVA 4JLOA 4L9WA 2IUTA 1ZINA 4RFSA 3TSOA 3W5IA 2MSCB 5GJCA 1W1WA 1KSGA 4LCBA 2JCSA 1KO5A 2F9LA 2FGJA 2IHYA 2KWIA 2VP6A 1OB2A 2MSEB 1R0WA 2GJ8A 4QXAA 2ZRPA 1AKEA 4IDHA 3U7HB 2ZPTX 2DBYA 4Q9HA 4Q03A 5JWRA 4PQRA 2JLQA 1QVAA 3CPJB 2N42A 5G41A 4EKDA 5CIQA 4QGGA 2DPXA 3VX3A 4A0FA 4A36A 3TSZA 4ESHA 1NMZA 2YHSA 4PQYA 1ZVQA 2FGKA 4P4UA 1DADA 1I2MA 4Q5IA 2G1JA 4D4KA 4UNQA 3DEFA 1SXJC 2WKPA 2Q21A 3B1WA 4MA4A 4DDWA 3GLIE 3MLEA 1E9CA 3L0PA 1OE0A 2QI9C 2IHBA 3HU3A 4LBVA 1AZTA 4ZI2A 1G4AE 3GJ7A 1RZ3A 4LPSA 5DIFA 3ZGXA 2ZJ5A 4CRWB 4NYIR 1XEXA 5B58C 2IBMA 2ZJ8A 1NN0A 4K8OA 4HUQA 4EPWA 4W5JA 1KMHB 3ZZTA 4IDOA 2PJRA 2BWJA 3QXXA 2ZJ2A 1Q0UA 2OESA 3CR8A 4B73A 3AUYA 3SQWA 4GFDA 1EFUA 1ESNA 4TQAA 1ZCAA 3WNBA 3WRXC 4M8NE 2DY1A 4UJ3A 4OBEA 1GVNB 3C16C 4KSBA 4XD7A 5D3QA 4D25A 5FTNA 2CL7X 2OBNA 2QMUA 1G7TA 2X1VA 4F93B 1O87A 5KTYA 3PJRA 1A82A 3CF2A 2WKQA 1J99A 1GIAA 1R5OA 1X1SA 3NH6A 2QPAA 2GA8A 4NCNA 3UG7A 2G77B 1QHNA 2J3EA 3AUXA 4XOIA 3EIEA 4CEHB 3QNUA 5EUMA 2VHUA 1W5SA 1JAHA 2IYSA 3SFVA 4BFWA 4GP7A 4WZAE 2CCGA 3CRQA 3SJAA 1KI1A 4YMSA 3EWAA 1HQYE 3KTAB 4ZIRB 3QF4A 2DCUA 2QE7A 1OIXA 3ZVNA 3ZIAD 3AKYA 2J0VA 1E94E 2NZJA 3KKQA 2GTPA 2ZROA 5TY0A 1QRAA 3BBPA 3PR1A 4OHZA 3AVUA 2ZJZA 1MABB 3FE2A 1N6LA 1G1MA 4ZKDA 3AKCA 2DR3A 1EFRD 1R10A 1CXZA 4ACBA 1C1YA 5FBVB 5CIWA 5AUPB 3GLIA 4URXR 4HB4A 2CL6X 1FX0A 3VR1A 1EWRA 2Q3FA 3GJXC 3SOPA 1ZC3A 3IHWA 1L8QA 1XTKA 2FJUA 5CM9C 2W6ID 1RRCA 2CXXA 3AF3A 3CX8A 1QHSA 2EFGA 3L82B 1IN6A 1G18A 2ONKA 2GAAA 4BZPA 2HCBA 3S1AA 1LS1A 2OE2A 1SXJD 4GBMA 4KVAA 4Q4JA 2JGNA 3KDSE 2GF9A 3TW8B 2CHVA 3VX4A 1JQJC 4MKHA 2GJSA 2MMCA 4G3XA 4LHZA 2R8RA 3RHFA 5AWFC 1NLZA 1S0UA 1KI9A 1P2UA 1TPZA 1IY1A 1WMSA 5DHAA 3BXZA 2PCLA 4JLPA 1AS2A 3TKLA 4JBYA 1K6MA 4QBFA 3FMIA 3RC3A 1Z0KA 2QRZA 3GEEA 2BMDA 3OHMA 1E4VA 3QE0A 3IIJA 2FX3A 2GCOA 1SULA 2WSMA 3NBYC 5GVRA 1E9BA 2DFKB 4B34A 4JVNA 1XJ0A 5CYOA 1DVRA 3KB1A 3LVQE 3MWJA 2FOLA 3EX7C 2QU8A 3OE7A 2I1VB 5DE3A 2RGXA 5FOWA 4M1OA 1M7GA 1COWA 1KJWA 3UANA 1S3GA 4K81B 4Q7LA 1OKKA 2C98A 2A5JA 2N1BA 3U3KA 1U0LA 4NZYA 2V7QD 1XB2A 2R6AA 2G9NA 5E3HA 3PENA 4KCGA 3NBFA 3P20A 1Q12A 2P0EA 3AVQA 2JJ2A 5FBWB 4RFSB 2F9MA 2GZAA 2ZU6A 2UKDA 4J0QA 5F3WB 2ZYVX 5IHPA 4URZR 2MSDB 4GPTA 3FPAA 4XVQA 5HKKA 1E9SA 4WOPA 2C77A 1CBUA 1E2IA 1KJYA 1W5TA 1Z22A 2NPIA 3OEHD 4NYJR 4E03A 5EXTA 1ZD8A 2JLRA 1G7RA 5HR5A 5E95A 3AP3A 1YZQA 4YXWA 4PO9A 3VHLB 2J5XA 1HV8A 2H8KA 3BD9A 4LJ9A 1IJFA 4NYMR 4OJQA 3RANA 2OT3B 3WP0A 1IN8A 4MRRA 2FFAA 721PA 2B8TA 3U2QA 2XNSA 4YQFA 4ASUD 4PAMA 1FTNA 1W4BA 2ANBA 4EFNA 1W46A 2V6IA 1DELA 4IEEA 3FDIA 3RS0A 4HAUA 1T3SA 2X19A 1G3MA 2AWOA 1QVRA 2J1LA 4B6EA 2R62A 3L0IB 4FMCB 4C0BA 1NLFA 1NMXA 3QIAA 1G7SA 3AF2A 5TVKA 3RSLA 2GVDC 1IJEA 1QHXA 2OHFA 1KDPA 2ZSBA 1DAHA 1UBFA 3LXXA 4JT4A 4QHTA 4M1WA 4UNNA 3UK6A 5CJ2A 3I61A 1VCNA 5IF9A 1U8ZA 1J2JA 5DYIA 2E1RA 3CM0A 4DKXA 2FSFA 5EJEA 4HUQB 3SJZA 1P73A 4DDUA 4FI3C 5DH9A 5JZVA 4YLGA 2FU5C 2BCJQ 4AKGA 3BIFA 1D8TA 1E4YA 1US8A 3MRSA 1ZBDA 5KNBA 3AVYA 1UAAA 4DLVA 2O8EA 2D06A 2RAPA 3CBQA 3I72A 4G1UC 4ZPXA 2FFHA 1II8A 1OFTA 3JZMA 1NMYA 4NE2A 5J5CA 5TDHA 3KJEA 4MRPA 1QBKC 4LZZA 5EZ5A 4DJTA 2GEDA 2IYLD 3V9PA 1SVSA 1E1QD 2H17A 5C18A 1AIPA 4Q4HA 1OXUA 5TXGA 4MKGA 2LWIA 2OG2A 1KJZA 1ZNZA 4URYR 1Z0JA 4DT1A 2D4HA 2AD1A 1YZTA 4JLKA 4URUR 3TGPA 1KGDA 3H86A 3TQCA 4N3NA 5FOXA 3PXGA 1FP7A 1Z0DA 2WWHA 1HY3A 3B5JA 1OYWA 2QP9X 5C1BA 2J0QA 2XSZA 5JHHB 2PH1A 2WIAA 3ZD6A 4HATA 2DFNA 4XIGS 4W5WA 1XJQA 3QF4B 2ZSEA 4FMDB 2OXCA 3LQRA 2A30A 5CDFE 2BMJA 1U8YA 1CR0A 1TTTA 1OF1A 1Q3TA 3TJZA 2I3BA 1KZGB 2OM2A 3SI7A 1CIPA 4DCUA 2CHGA 5GJWC 2VBCA 1A1VA 1H8HD 2ZS9A 5SZJA 4A8JC 4C0JA 4QM7A 2QAGA 4BLOA 4AG6A 2FG5A 4AKEA 2GESA 3GLIB 1R5BA 3LA6A 1AS0A 4LJYA 2AD5A 4FCVA 3C4JA 4O2LA 3J81k 1Q1QA 4EDHA 3W6PA 3GD7A 1HUQA 2C03A 4C9BA 3FKQA 1Z2CA 821PA 3U5ZB 1XPRA 3SYKA 4HZUA 4LSGA 4AWXA 1EGAA 2QZ4A 3SHWA 1PUJA 1A5TA 2HDNB 5IDVA 3I92A 3TR5A 2MMGA 3AKDA 3S1AB 2HJGA 3FB4A 4Q4JB 1E2PA 4WVFA 4KHZA 4GOXA 3AB3A 3LVRE 5EP2A 1K5DA 3ND8A 3V00A 5BN4A 1RYFA 2NO7A 3LH5A 4JLMA 3R9WA 2WM9B 3IEUA 4NHOA 1OW3B 3I3SR 3KKOA 4TLCA 4HAYA 3UWOA 4M1YA 5JMTA 5ANRB 3N5CA 3QKSA 4TL9A 3W5JA 4WA7A 1IN7A 1T9HA 1DG3A 1UBEA 4ERNA 3KQKA 3UPUA 1NY6A 1HT2E 4B3CA 1UBGA 4TTQA 3HU1A 1T5LA 3MCAA 1GNPA 1MH1A 4LHVA 4BLPA 2NZ8A 2GCOB 3HR8A 3DMDA 3K1JA 1XXHE 5E7IA 2AK3A 4JYBA 2PMDA 4ZV4A 2HF9A 2REBA 2NIPA 3L8ZA 4I1VA 4JJKA 2RHMA 4LJAA 5J4HA 4KYUA 5IK2A 5F98A 4B3FX 3K0CC 2ZSFA 4BRWA 2QM8A 3OEED 3ZLJA 5CDFA 2XGJA 4I4LA 1W47A 1P5ZB 4TL6A 2GCNA 4O0MA 3TVTA 1TQ6A 4GSYA 4HSEA 1NIPA 1OYYA 3K9NA 4M2LA 5DI3B 2IYYA 3RS3A 4ZCIA 3SHFA 4DEXA 3PUXA 2C96A 2YYZA 4R2IA 1R8SA 3QKRA 1CS4C 3C15C 4KFUA 1Q44A 1ZNWA 4YMTA 3Q7QA 1FTSA 3D31A 2EWVA 1G20E 3NBXX 1NBMD 3OAAD 3EC1A 3LY5A 1JR3E 3B1XA 2QMHA 4W5HA 3MUFA 1W2GA 2IXGA 4QG7A 3EIHA 5JS7A 2A78A 2ZITA 4G5OA 4KI0A 4MRSA 2ZVPX 1XD2B 4Q1BA 2YNMA 3C7KA 3BERA 2ZU0C 3ZDQA 1J8MF 2W2VA 4PC7A 3UMFA 2WJVA 4TL8A 4OL0A 2ODNA 2W0MA 3NKVA 2CCKA 1M1YE 2VO1A 3LXRA 3T1VA 2FN4A 1ZYUA 2KI5A 4M22A 5K8TA 3BH7A 2YV5A 1IBRA 2BHRA 1ZC4A 3SDZA 3C14C 1TL7C 4FINA 4G5SA 5HPYB 2AFIE 1EG7A 4DLWA 1X1RA 1NF3A 2F1IA 4PC3A 4M0LA 4W7SA 1ZU5A 2OUKA 4LYAA 1G291 3BK7A 3A1TA 3GEHA 3NC0C 4LHXA 1VCOA 5CJPA 3WYFA 1L4UA 2VYFA 5JRJA 4F4JA 1KDOA 2J7KA 1SVLA 2BKEA 4HI0E 3MGCA 3FKSA 1VDZA 1XXHA 4GOJA 4P31A 4NH0A 3GJ3A 4IKEA 2WMNB 1Z2AA 4RD2A 4E5UA 3SZRA 3A1UA 3IIKA 4TLDA 3OIYA 4I1SA 2AXPA 4I1UA 4RZXA 1US8B 2VP5A 1BMFD 2JAQA 4Q9JA 2XZPA 1JJ7A 3K70C 4WZBE 2O8EB 3VKGA 1II8B 3EZ6A 3LLMA 4BZQA 5GJVC 1YR8A 2IUSA 2CK3A 4IW3B 4BFSA 3MSXA 2G0TA 2WBLC 4Q4HB 2X2FA 1Z29A 2QROA 5J4VA 1JR3A 3GJ5A 4DT1B 4OI4A 1N6IA 1X6VA 2JDIA 3C8UA 2WJGA 1WA5A 3IQXA 5TB5A 5SZIA 3EIQA 2WJYA 2HLDD 5AUNB 4AYTA 3F8TA 3NDPA 4C0HA 4BGDA 3AH8A 1Z6YA 3DMNA 2C04A 1PLKA 1MRSA 4TL7A 3R8CA 2ZYUX 2PLRA 1YQTA 1W0KA 2QTVB 2RH5A 4DIDA 2XOKA 4Q9IA 1GP2A 1ZM7A 2QT0A 4IOLA 5TV2A 1GTVA 1XEFA 4D0NA 1G16A 4JLBA 3V4FA 1HTWA 2HV8A 3FFBA 2AXNA 2VA8A 4KFSA 4LY6A 5KNDA 8OHMA 5L3SB 4PXAA 1IHUA 1XWIA 2QAGB 1Z6GA 2ZRFA 5J47A 1T8UA 2JLXA 2QMEA 4GL2A 1EWQA 2GKSA 2BJVA 1KMQA 1VCMA 3RYTC 4YMUA 1KY3A 3CNOA 4LJ6A 3DKVA 3AVPA 1OXXK 2CE7A 1AN0A 3FMPB 4FW9A 4CEHA 2J46A 3E1SA 4W9MC 4HZUB 5KYKA 2ZRBA 3RWMB 3U3JA 2DB3A 3KTAA 3WNCA 4RD6A 2FF7A 2H57A 1KDRA 4HDOB 4JL5A 3KQHA 1E0AA 2WOOA 1P62B 4HAZA 4LPKA 4U00A 1OH5A 4R9UC 3BC1A 4ARZB 3QJYA 1M34E 2XB4A 1ZM2A 3A1SA 4HLCA 2V6JA 3QKTA 1NNEA 1VYUA 1XMVA 2BBTA 2PMKA 1AJEA 3CWZA 1HURA 2QMOA 1CF4A 2GXUA 4EJSC 4RD0A 3E5HA 5FPKA 1P9WA 2VPPA 1YR9A 1YJ5A 4DUGD 4QFMA 3SFZA 4D80A 1G3UA 2EVWX 1B23P 4LHYA 2HT6A 2OEPA 4NP6A 1CU1A 1VPLA 3K70D 1E9EA 3PIRA 5FL7D 4HLUA 2GHIA 2GXQA 1R7RA 4NMMA 4ZCMA 4PAQA 1UKYA 5J4KA 3WXMA 1MV5A 4JMPA 2B7CA 1R6BX 3GLFE 1P75A 4HDQB 1S3SA 4M9QA 1GL7A 3ZJYA 5EP4A 1KO4A 4QGAA 2PEZA 1FMLA 2GNOA 3FYHA 4CEIA 4URVR 4V0LA 3EC2A 4FWIB 4L5BA 1CR1A 4RVCA 3TRFA 4IOKA 4MRVA 1W36C 1XU4A 4Q4AA 5LDDC 3AVWA 1U0HC 3QKRB 2XNDA 1X8KA 2HYDA 2GAOA 2WWIA 1LS6A 3TIFA 1G8YA 4RSGA 2SHKA 3TR0A 1TU3A 2AKAB 5JEEA 4MYUA 4Q9KA 1OFHA 1E0SA 1Z0AA 2P6UA 3W34A 2J45A 1QHYA 2BCGY 3L8YA 5AUQA 2UVQA 1Z3IX 2XTMA 1CJTC 3L0OA 1XBTA 2LCFA 4JLDA 4BFXA 1OIVA 2RGAA 2XB2A 3A4MA 2V1XA 3QG1A 1R0YA 4DLRA 2WSSA 2ZVQX 4ZKEA 1ZUNB 3A1VA 1UDWA 5HZKA 2V3CC 2GEVA 1GAJA 3ONWA 4IVQA 2HXYA 2NO0A 4B43A 3RWOA 1VG8A 1TADA 1GM5A 1CRPA 3AEZA 3BGWA 4JLVA 3VR2A 1R0XA 4PC1A 1N3BA 5DGXA 1X8LA 2QE7D 1G41A 2CNWA 3KXIA 1E32A 4M9ZA 5F2EA 2I1QA 3P4YA 3REGA 2JA1A 2ZRNA 1KI6A 4POAA 4I1OA 2VSXA 1DARA 5LPNA 4GRAA 2VTKA 1D5CA 4LYHA 3RC8A 3KUCA 3SN6A 4LC0A 5JS8A 4BFUA 1R8QA 1UDXA 2KBEA 3DDCA 3K9LA 4TN1A 5K8LA 3LWNA 1Q1ZA 1Z5ZA 5CK5A 1JALA 221PA 2ZRLA 1F5NA 1XXHB 4C30A 3AP2A 2VIIA 5EE3A 1SVIA 1NN3A 4Z1MD 1XMIA 3X1YA 3GLFA 1MO5A 1ESMA 1LFDB 2A5DA 4OK6A 4XSGA 3ZZ0A 2WAXA 2R6DA 4Z54A 2FNAA 4CF7A 1R4AA 1GUAA 1II0A 2ZI9A 4BQSA 3AVVA 1ZM3A 4FCWA 4HB2A 5JHGB 2G6BA 2XEXA 3CF6R 2FSHA 4OKSA 5CB6A 5K8IA 1W48A 1J90A 1F60A 3NIBA 5AJWA 3KQUA 1OIWA 4IDQA 5KHOC 3THXB 3FVQA 2VSFA 2J7PD 1RC8A 4A2PA 3HYTA 1GKYA 2VL7A 4B35A 3GP8A 2IS2A 3IIMA 3MWYW 4B6FA 4MRNA 2CLCX 5LD2B 1CR4A 3CPEA 4P4SA 4FCTA 4DLSA 1OH7A 1W36D 1N6OA 3UMRA 3QVUA 4AYXA 4BZXA 5LBIA 4PFSA 3WYAA 4US2R 4PAOA 3QUSA 4EQ6A 1ZRHA 4B2PA 2A5FA 2VP4A 1S8FA 3W90A 5E7JA 4LK2A 2GZDA 2ZRDA 1OXVA 1WF3A 2HJVA 2H92A 2ECKA 2WKRA 4QKQA 1NKSA 5JCZA 5IT5A 3B7GA 2QNRA 1SKYE 4P0TA 2GJ9A 1YRBA 1NVWQ 4OQNA 3CWQA 4HLQB 4UNSA 1ZNYA 4UNPA 4DCNA 2R6FA 5KU1A 1CKEA 1LY1A 1CJUC 2V54A 1TMKA 4UQOA 1LV7A 1OXSC 4LV5B 1FUUA 3WMEA 3JZAA 2IUUA 2HYIC 1Q21A 3RNLA 2LKDA 1GILA 2REXB 4D0LB 1E69A 1RKBA 3Q5EA 1MRNA 3SS8A 4C0SA 1N5JA 5K8UA 4R2HA 1D9ZA 4XVUA 3ADDA 1KAGA 3MJRA 3CONA 1ZCBA 2XJ9A 2JJ1A 3BAFA 4X8MA 3WNDA 3I1FA 1UF9A 4PHFA 2O8CA 1E2GA 4QGHA 1UFQA 2ODBA 1UADA 4V0OA 4DCVA 1XD9A 2P2LA 5KDLA 3KFVA 1UEJA 4N1AA 3TQFA 2XTZA 3LW7A 3GCGA 1W49A 2QAGC 4DSTA 2YC2C 4G01B 4BFTA 1E1RA 1OT3A 1VHTA 3DHWC 3U61B 3PITA 1E2KA 3SJBA 5AJVB 1QG2A 2P5SA 4LI0A 1NVUQ 5SZKB 2QY9A 3QG5A 5FPHA 3LBIA 1EESA 4KBGA 3SU8A 2WJIA 5AUOB 4MQBA 4LJ8A 4TMVA 5EUQB 1W2HA 1XF9A 2OLKA 4N0EA 1FNMA 2JEOA 2QPOA 3GFOA 1E2JA 2IYQA 2OSBA 5FOSA 4IXNA 4B3GA 1NVVQ 2ZUCA 3PEWA 1E9RA 3AM1A 3KJGA 1SQ5A 2ZIAA 4KU4A 4M1TA 1ZNXA 4CEIB 2D7DA 1FUKA 1XMSA 2ZE8A 5A5GA 1TAGA 1Q22A 3H84A 3P27A 3EASA 2VP9A 2GBLC 4Q4AB 1M2OB 1SGWA 4DB4A 4MKFA 3U6KA 1P72A 3QPWA 5FTJA 4ZDIA 4IVPA 4PSVA 4DIEA 1VG1A 3IHLA 2QL6A 3FGNA 5BXQC 3JVUA 3BH6A 3IPYA 4JKIA 5JFGA 3ADBA 3ZVLA 4DLTA 2OZEA 4EUNA 3R8FA 1HE1C 4CW7A 1U9IA 3D7MA 3W9YA 5DNYB 3BRWD 4BEJA 3PUVA 2Q3HA 3TE6A 2QGZA 5AK0A 2RGNC 1P9RA 1TEVA 4OYHA 2CBZA 1SZPA 1SXJE 3TNFA 2ZAMA 1Q20A 2QSZA 3B9QA 1SVWA 2AFHE 4LBZA 4PHHA 1IY2A 5DI3A 1ZW6A 5DISB 4EIWA 3EWSA 4DCTA 4OHYA 1AA3A 1E0KA 5P21A 3T1OA 5EE5B 2VRWA 4L15A 2RGEA 1OJLA 2ZRHA 3VKWA 2VHTA 1S9DA 1ZJ6A 4KVGA 5TMPA 4BFZA 2QEQA 4TTPA 2BJWA 2NMVA 1IN4A 1JB1A 3AF1A 5H68A 3SYLA 1NVXQ 3TBKA 1NJFA 5JJLA 2O8FA 1FQKA 1KI6B 4V0ME 3GEIA 5C2JB 2QPTA 2H16A 3O8DA 3F5FA 1M6NA 3KJIA 1KK2A 2R65A 4O25A 4B3DA 4KO8A 2ATXA 1OH6A 1GRQA 2CLSA 1AGRA 3G82C 4TSFD 3MMPA 1XD2A 2WJHA 3NEYA 3L2OB 1WBDA 1KI8A 4JIMA 3K09A 1CJKC 1AQYA 4F38A 1WRBA 3GLFB 2JATA 2XAUA 1NRJB 2WPDD 4LX0A 4TWZA 1OFUX 2IEZA 4DSUA 3T5DA 3ZIAA 3ICQB 2ASEA 4G0NA 4OQFA 1SVKA 2WJJA 5BYKA 1E9AA 1KO1A 1ZP6A 3B8HA 3EARA 2ANCA 2JIZD 3UWKA 5EP3A 5SZHB 3TAHA 1UJ2A 4HYYA 4JLAA 1E98A 1ZIPA 4NCKA 2ZE5A 3MJHA 3F3YA 2XZOA 3K0FA 4BLQA 2F43A 3KQLA 2ZR9A 4B3BA 2IL1A 2P6RA 4LDJA 5JCPA 5DSZA 3I5YA 1UEIA 4XH9B 2JLYA 4P4SB 1E3MA 1P60A 2C95A 3FMOB 5J4LA 2V9PA 5FUXA 3H1TA 3WBJA 5B2ZA 4A0HA 5LB2A 4EQ6B 2QORA 3O47A 5DLQC 2ZJBA 1M7HA 1SXJA 4L16A 3C5HA 4QGFA 4C7OB 1KTVA 3BORA 2RGBA 1SHZA 3ASZA 3CNLA 3CLVA 4EFLA 2X77A 4Z51A 4TLAA 5G53C 1WB9A 3RRZA 1VYTA 2GF0A 1E6CA 1YZLA 3RABA 4NPHA 3VR3A 3Q5DA 2EQBA 3T06B 2QG6A 2HXSA 3GMTA 1IOZA 3DKPA 4ZDKA 2A2ZA 4V0MA 3U60B 1KYIA 4Q1AA 5B64A 1P61B 5A0FA 2YWGA 3TUJC 4IDPA 2ERXA 1GG2A 3ZD7A 2EW1A 1D6JA 1G5RA 1QDEA 3CPHA 2NG1A 4M1SA 3F0TA 1IONA 1CULC 2BMEA 2OFOA 2ATVA 1WBBA 1KSHA 4F4IA 4TMXA 1FMJA 4M53A 2F1RA 3I8XA 3W6OA 1NG9A 1SKQA 4JL8A 4HAXA 3K53A 4TYYA 3PEUA 1NN5A 3D6TB 1F3OA 4QBHA 4QBIA 2O8CB 4TQUS 2D74A 2Z43A 3X2SA 1W7AA 1H8ED 2V7QA 1KSFX 1ZIOA 5L3SA 1D2MA 2B7BA 4E22A 2RB4A 4ABYA 1DAKA 2IWHA 4C0KA 1XP8A 5L3QA 2GEUA 3H0KA 3EXAA 4PHTA 1T0JB 3Q72A 2F55A 3IGFA 3KKNA 4LGMA 1N5IA 4KODA 3TLXA 2YOFA 3TVDA 4DB2A 3WHKA 4AI6A 4DLUA 4Q4LA 2OCBA 4CDGA 2DFTA 1DAEA 1VG9B 4BPBA 3QEJA 4ARZA 2BM1A 4WW0A 5BQ5A 1KNQA 3EG5A 5EE1A 2ZYTX 4C0AC 4CZ2A 4DZZA 4L4UA 4A0GA 4C0LA 2IS6A 1DG1G 1SHKA 2H7VA 2V8OA 4RCYA 2YKGA 4C2TA 4OJKA 1SKYB 5DN6A 3DVLA 1HYQA 4DLXA 1IXRC 1B0UA 2HCJB 4BRUA 2WICA 3AP1A 5H70A 5L3RA 4N0DA 1JPJA 2O5VA 3Q85A 3NDBB 2F1JA 4IOJA 1E79A 3C5CA 2DHRA 3K0EA 2A3RA 2G88A 4NCJA 2A9KA 2IYWA 2DWQA 1NVVR 2FPKA 1YVDA 4WXRA 4R7ZA 1WXQA 2HUPA 4IFEA 2FV8A 2BEKA 1GKIA 1NP6A 2GXSA 2IYTA 3WYGA 1BIFA 2OILA 1G3QA 2ZI5A 5UKDA 1R2QA 1P2SA 2CEAA 5CLQA 4M9XA 4II7A 5CITA 3GJ6A 1PUIA 3EZFA 3FOZA 3RRMA 4QL3A 4M4SA 4OQMA 2ZE6A 1NJGA 2ZQ5A 2ODWA 2FSIA 4KITB 2ZI7A 2ZI4A 4Q7KA 3N70A 3I5XA 3B1YA 3FMFA 4DLYA 3IKJA 3X1WA 4D4JA 2OCYC 2PCJA 3LBHA 2O8FB 1OLOA 4TT3D 3EAQA 4DLZA 1OSNA 3A1WA 2O8DA 3AV0B 2YWEA 2WHXA 1YHNA 3U7EB 3T15A 1U99A 5FR2A 1E0JA 3BB1A 4Q48A 3TUZC 3T35A 2RMKA 4M9SA 4BLSA 1M8PA 1L4YA 1G8HA 5AJXA 2KJQA 3TAUA 1N25A 4MYTA 2IYXA 1VKJA 3T5GA 4GNKA 3THYA 2HT1A 2YWHA 1F2UA 1FQJA 2V4ZA 3B85A 1ZD9A 4QC2A 3OIWA 1ANKA 3CNNA 3I4LA 5FTMA 3ZYCA 1W44A 2J0UA 1U8AA 2V1UA 1OHHA 2PEYA 3MFYA 3QXSA 3UG6A 5FUVA 5EXSA 3K0FB 4LUCA 3LX5A 1QHHA 2F43B 2NO6A 2BEJA 2ZTSA 4GMXA 3W8NA 1YRAA 2Z83A 521PA 4HLDA 1JPNA 1RW4A 2JLSA 3LLUA 4HB3A 5FBQB 2OO7A 4IEIA 4PC2A 4F91B 3ADCA 4C4PA 5A4JA 4X8OA 1V5WA 3SC3A 4R71A 1Z06A 3B60A 1BOFA 5L3VA 3QXJA 1KSJA 4QNRA 5FTLA 2YWFA 3T12A 3U7FB 1SXJB 4TYPA 3NBZC 4S35A 1GNRA 1MKYA 1AKYA 2ZREA 2PZGA 4V02A 4PHGA 2WWWA 2WWFA 1G4UR 1N5LA 1ZAKA 2RCNA 5L8VA 2B8WA 4FN5A 2QQ0A 1YKSA 3BFKA 4MH0R 1T3HA 4PZYA 3BH0A 5KSYA 4OI1A 1ZM9A 2FFQA 1AZSC 3THXA 1HH4A 4Q02A 1N0UA 2QAJA 1S4QA 4IJMA 2OAQ1 2FWRA 3CH5A 4FIDA 4NYIQ 3EA5A 4EPTA 1VYVA 3ND9A 3QPVA 1WCV1 4FWTA 3DZDA 4CIDA 4EPRA 2JLWA 1N6KA 2XNDD 4ZI3A 2W6JD 3X1DA 2VSOA 5FUYA 2FFBA 4V03A 2A7QA 1DE0A 3AVTA 3U3MA 3B1ZA 2IF0A 3GPLA 3Q8XB 3OEEA 2CCJA 1QF9A 2PT5A 5KNCA 1EX7A 2CDNA 3B6EA 2XJ4A 4TMKA 1ETUA 3O8BA 2QENA 1EFCA 2W83A 4BASA 4LYFA 4P33A 4GDFA 5CLLA 5FUWA 1XEWY 4IFBA 1P6XA 1KO7A 2GETA 3ASYA 1YR7A 4JBWA 3EZ7A 1RYHA 2EU8A 4V0KA 5L3QB 2WSSD 4QOSA 4D4LA 1RE0A 2OCPA 1PVOA 3NTUA 3T61A 5HE9A 121PA 2IS4A 3OAAA 3T34A 2R6CA 2QTHA 1JAIA 4Q01A 1J7KA 4R98A 2ZR7A 3RAPR 2Z4SA 4HUTA 1F6BA 5KSOA 5H1YA 1TUEA 1FOEB 3OZXA 5AJYA 1E96A 1KHTA 3WP1B 4C2UA 2QP3A 4NCIA 4JJZA 4JT2A 3U6BA 2YOGA 3NH9A 2UZIR 2XXAB 1S96A 5JWOA 4YC7A 3K0AA 2D2EA 1HE8B 4UKDA 4CT4B 4GT1A 2QGNA 2KBFA 1KZ7B 1YZGA 3K9HA 4NCHA 3QQ5A 4UNRA 4WBSA 1BKDR 2KE5A 3B78A 4HAWA 5F9HA 2ZJAA 1KK1A 2QT1A 3CUEF 2ZUBA 5BN3A 5HTKA 3QBTA 1NL3A 1GSIA 2V55B 1LTQA 2BKUA 5FOTA 4B75A 5KDOA 4HB0A 3HP1A 3WRYC 4EPXA 4MGZR 5CB8A 2C99A 2ZRJA 1KI7A 3KUDA 3RRNA 2Q0HA 3RS5A 3RS4A 1GDDA 1D2NA 2W0SA 3AF4A 421PA 4A2QA 4YMVA 2XZLA 1P4SA 1X3SA 3HWSA 1C4OA 4PANA 3TW4A 3B13B 1E2NA 2RHDA 2Y8EA 3VNUA 1XPOA 3DPUA 3OIUA 4G5QA 1J8YF 5BW8A 1G21E 1Z83A 1G8GA 3FHOA 4BLRA 4PZZA 3A4NA 2Q9AA 1MO3A 1BMFA 2CMKA 4AD8A 4U02A 1F2TA 2AL7A 1PJRA 4RZ3A 2PZEA 4F4CA 1XDBA 2B21A 1CLUA 2YINC 4LBWA 4LYJA 1D2EA 5G40A 3ZQJA 2BOVA 3TK1A 3IBYA 5DO9A 4C3ZA 4EFMA 5JJIA 2DYKA 1G5PA 2EFEB 4US0R 2IS1A 2Z0MA 3K0CA 4Q00A 4RZ2A 2ZI6A 4U5XA 4PPGA 4XD7D 1F48A 2O8DB 1YR6A 4LHWA 3PG5A 2Z5FA 4JZKA 4YONB 2HLDA 2AWNA 1ZUIA 4Y0AA 1N6RA 4Y0VA 1XEWX 2OV2A 3G5UA 4JS0A 4QNMA 4Q7MB 2ONJA 3M1IA 2FE4A 2G1KA 4CGZA 2QSYA 5DI9A 3AVXA 1A2BA 3VR5A 1QG4A 1RJ9A 2F3RA 1YZKA 2AKYA 1L2TA 2BDTA 2KSQA 2QUZA 3P4XA 3SBEA 1DS6A 2XITA 1OB5A 1XPUA 1DO0A 1PV4A 2GRJA 3THYB 4MKIA 1G9XA 1F2UB 2FPMA 5FBRB 1G7CA 6Q21A 4DC9A 3EPKA 1TF2A 3AGPA 4RCZA 2J0UB 3Q3JB 2H1LA 4XWAA 2ERYA 4D26A 1LB1B 3OFNA 4O3MA 3SQXA 5KO2A 5FBLB 3CZQA 4ITRC 3MG9A 2CLDX 4NTZA 5C46F 4Q9LA 3NXSA 2GCPA 1QHHB 3KB2A 4MGIR 3CZPA 2AN9A 1AQUA 1N0WA 2IC5A 2WAYA 1GITA 3FFAA 1KO8A 3BFXA 4NYMQ 1G19A 3K09C 3FTQA 2K5UA 1EXMA 4D82A 1A4RA 1G8FA 2BV3A 2YZ2A 3CIOA 4RD4A 2CHQA 2L0XA 4LC1A 4JSYA 2IF2A 2Q9CA 4YDSA 2FH5B 3VU9A 1T5IA 2J0SA 3IILA 5KDDA 4A15A 1IQPA 3IO5A 3EZ9A 3Q9LA 4DEYA 2FSGA 3HDTA 1UPTA 2R44A 3A8TA 4KLNA 2JJ8A 3KJHA 5E7MA 1W0JA 2D62A 1A2KC 4NKRA 3L0SA 4Q1EA 3PCRB 1EK0A 1XCPA 2UZ3A 3BE4A 3I73A 1BYIA 1Y63A 1Z0IA 2O0JA 4DUGA 1U81A 4XTCS 2JLUA 4NU0A 4LWZA 2R6GA 3P26A 2CE2X 4WZ6A 2VP2A 1Z6XA 4I99A 4LBYA 3BB3A 4DXAA 4YDHB 2AHOA 4PZLA 5FL7A 4KBFA 1JQLB 3M6AA 5JBQA 1WDTA 2GK6A 3DOEA 1I4DD 4M21A 1E2HA 4QM6A 5FFMA 3X1ZA 4E09A 4C7OA 1RRPA 1V43A 2HF8A 4PQFA 1Z28A 2QM7A 4ILEA 4AK9A 3GFPA 1MO4A 2ORWA 2ZS8A 3VQTA 5GADl 1NKTA 1XTRA 1YZUA 2Z6VA 3OE7D 3ZS8A 3ZS9A 2BM0A 1COWD 1RRGA 4DHEA 3QVVA 4BFVA 3MWKA 4OQLA 2QN6A 3AQ4A 4FMBB 1OKKD 4JVLA 3VAAA 2FPLA 2PJZA 3X1XA 2YJTD 3N2IA 4JKYA 3O8CA 3VKHA 3OIVA 4URWR 1VMAA 1KK0A 4BEBA 5J4YA 1GFIA 1Z63A 2P67A 1P3JA 1KK3A 2JJ2D 4IRUB 3OF5A 1AS3A 2GVZC 3PEYA 4MYCA 1N6HA 4JL6A 4A8JB 4D2IA 5HKKD 3IEVA 2JLZA 3K0AB 1P2VA 2F6RA 2OBLA 4LV8B 4KLZA 3ZZUA 3SE0A 4CEJA 4YXWD 1ZM4A 3TMKA 2LKCA 3OESA 1I2DA 1VCIA 3ZVMA 4IHQA 5DYGA 4PPNA 1K8RA 1CR2A 4A2WA 4KSCA 4YMWA 2F3TA 1DBSA 5AR1A 3SR0A 3AVOA 3NC1C 3EW9A 4XSHA 1E9DA 2EFDB 2RGGA 4AG5A 1TEXA 4BECA 1CEEA 3THWA 1JBKA 5JSZA 5FPYA 1OXTA 2IW3A 4RD3A 1T3LA 1U0JA 4JBXA 1GRNA 2IXFA 2BVNA 4Z1MA 4AKHA 4EJSA 4NONA 1TUIA 1DPFA 1XTQA 2J9RA 4KJZA 5EP1A 1JR6A 1N0VC 5FOUA 4AY2A 4A92A 2EFCB 4TMTA 3NHAA 4L9SA 1KKLA 1F2TB 1VG0B 3KZ1E 4UXJA 4LOAA 2N46A 1FW6A 1J70A 4US1R 1E2FA 5H8WA 2GWHA 2ZRMA 5C4MA 1BO6A 1KDTA 5EE9A 3CR7A 4OHWA 4AIIA 4QJ3A 2J7PA 3H2YA 3UXMA 1GZSA 1E2MA 5JECA 2QQEA 4TYWA 1VECA 4DDTA 1XZPA 3KXKA 2WVJA 1ODFA 5G3YA 2WMOB 1N2CE 1WP9A 3W3AA 2DFLA 2D3WA 2OXRA 1Z08A 1G3IA 1GWNA 1E2LA 1YU9A 1RJ9B 1JXOA 4XVRA 3BJIC 2XSZD 3IUYA 4ZO4A 1Q57A 3VR4A 1UKVY 4UXHA 1LF5A 3CO5A 3KQNA 5FI1B 2ZRAA 3LX8A 2VHQA 1CP2A 3IBGA 2FMXA 1FFHA 1KI2A 2B6HA 4H1UA 2GXAA 3RS2A 4LJ7A 5EXXA 2GJKA 4A82A 4E07A 4B33A 2XX3A 4Q66C 4RD1A 2YC4C 2X8AA 4PTLA 2A5YB 4LJ4A 3KKMA 3SEAA 5HZHA 1S1CA 4B3XA 3HR7A 1Z8FA 2BBSA 3E70C 4MGYR 2DWPA 1FP6A 5KOYA 2FEMA 2EWWA 3AKEA 1W4AA 3QOFA 4TLBA 2CJWA 5KPJA 4RKEA 4D4MA 3T1TA 4RKFA 4DRZA 2IA5A 3VU9B 2ZR0A 4MDEA 1T8TA 2W2TA 1S9HA 2PX3A 3CF0A 1EFTA 1Z0FA 1IY0A 2FA9A 4LRWA 3GJ8A 2IT1A 1EFRA 2P3SA 2AK2A 3THOA 1UKEA 3LQQA 1PLLA 5EQTA 1LVGA 4TQ9A 2EFHB 4Q47A 4AURA 2ZRIA 1DAMA 2VF7A 4D81A 2WWGA 3DZ8A 1K5GA 2W6IA 4GZLA 4BE7B 4BUJA 5DN6D 2YVUA 4XJXA 1XMJA 2VQSA 4LV6A 3K70B 4I81A 1CJVC 2RGDA 4KFRA 1XCMA 3PEVA 4PPQA 1G3RA 1M7BA 5C4GB 1GL9B 2R9VA 5CK4A 1E79D 3V4RA 1GL6A 2ZRKA 3LW8A 1KNXA 5FI0B 4OK5A 4TTRA 4RZUA 1KOFA 3QEOA 1P2TA 2IK8A 3SYNA 4A6XA 1MO6A 4DCSA 1KI3A 3D8BA 3HPRA 2E87A 1G8PA 5EXPA 4RFVA 1XEXB 1TF7A 2W58A 5IK2D 1GOTA 3U7GA 3TSWA 1OFIA 4ZCLA 1NSTA 3EA0A 1IM2A 4QHSA 2G0NA 1E2DA 1T4GA 2BC9A 5LD2C 4JVMA 5BYJA 2ZXUA 2WWYA 3PV0A 4WAUA 1CRQA 1Z6AA 1OH8A 4PSAA 3KL4A 3CW2A 2VLIA 1AK2A 2P65A 3RLFA 3QKUA
chains in the Genus database with same CATH superfamily
4LKOA 1R4NA 3O7WA 4PTZA 3QENA 1XEAA 1Y3FE 1K5PA 3HR4A 4MW4A 2NNWB 2HRCA 1U2RA 1JIXA 3HGMA 4X9XA 4ESVA 3R20A 4XQ0A 4EBBA 1ZGHA 3DBLB 4MP3A 5D3MA 3W77A 2I4IA 3KXDA 5AVZA 3KJNA 1QM5A 4HS4A 2C0PA 2JAUA 3PUWA 5HE8A 4CI0B 5K2OA 5ES4B 3AL0C 1Z47A 1ITZA 4E11A 1UJBA 3WLTA 1QCZA 4ZKDA 3OHSX 1Q2XA 1T0HB 3LQ4A 5K4AA 3LCVB 3H1FA 4XARA 1PBTA 3ND7A 4F46A 1HLPA 4EW2A 3E7XA 3JR3A 3KX2A 5J40A 4UBKA 1ID8A 1BDBA 3OEHA 1IXZA 3NGMA 4D92A 3B1FA 3C6KA 4L9AA 2ON6A 4QTXA 4DQXA 2NTVA 2PUJA 5A04A 4JCOA 4E0BA 3THWB 2JZOA 4PCVA 3GPIA 4Q21A 5BSMA 5JSZB 2JFQA 1W6UA 1Y5MA 2ICAA 3AWDA 1RXSA 4JB3A 4XFDA 1NF9A 4FOLA 3JQRA 1GAEO 1JIUA 2PLFA 2R6JA 3X2FA 3L6EA 4CUKA 1UBCA 3SBDA 1LV8A 3LD9A 1AQNA 1UJCA 4JI4B 3FPHA 3NAGA 1FX0B 3REQA 1RABA 3MFQA 2C07A 2IIVA 3C24A 1SG0A 2QN8A 3FGPA 5FTKA 1XZQA 2VF8A 3CEMA 1DWOA 4YRZA 3H4VA 2ORIA 3KJFA 4UZEA 3W06A 3L79A 2Q2WA 4ASUA 1FK8A 4ZRNA 4L76A 5IULC 5ELXA 1RFLA 3T94A 4INPA 2ZB3A 5A7HA 1L7OA 4R5HA 2C5EA 4ZYVA 4RJLA 5GQSA 1CP3A 3OWXA 4GE3A 5LWQA 2PTGA 3OZIA 3GRRA 2J85A 5CTJA 5JSHA 5LJLA 4PW0A 1VFNA 1H05A 2DHEA 1CT9A 2P35A 1V11A 3ABRB 3E2IA 1VPVA 5C81A 4AZ0B 1VIAA 4RYLA 4RY9A 4HDRA 4KXQA 5LA6B 4OSOA 4QUHA 3ULKA 2G5TA 2IU4A 4KPUA 3O0DA 2CK3D 4HPWA 1KOLA 4GLFA 4LK3A 4HAIA 4LZPA 3KXLA 1EDZA 3K8YA 3NVAA 2LUOA 3SF8B 2DPMA 4Q1DA 3O2JA 1P17A 3DE3X 4KIGA 2BFDB 4NAVA 1D2AA 4J91A 4Q7QA 3GRFA 2DCMA 1C9KA 5LL6P 1Y6FA 2J3IA 1P1KA 2C92A 3EC7A 4HQ0A 2GILA 2ACEA 2Q5HA 5CXQA 1OASA 3QPBA 3K9CA 2C5LA 4NL4H 5FPTA 2EZTA 2HZBA 4QUJA 3H9BA 3WMGA 2DKFA 4HDNA 2QSUA 1R5JA 1RYDA 4ZCTA 2RD2A 4LJ5A 3OOWA 4FS8A 3OOYA 4PLFA 3TW0A 1P7CA 3QXCA 4J0JA 2BLLA 1XL0A 2YZMA 3FOFC 1I4WA 3BE6A 3B1VA 3LAWA 3N6VA 3OPNA 3P9YA 4YRLA 2VAVA 4PFKA 3PKZA 1JU3A 5TGDA 1DG9A 1HDIA 3GBVA 2BIFA 4E5YA 2HGZA 2YV2A 3KB8A 3X1MA 5KWEA 3C48A 1H2YA 2ZRCA 4BWYA 1ZWKA 1CYDA 1XNJA 2EZ8A 4GKKB 1UFOA 3P0IA 2JK1A 3CUUA 4M54A 1Y4AE 4UD6A 1KQGA 4XWKA 4DIMA 3PLAE 1YE5A 1WPXA 3DM5A 4PLTA 4B6PA 4JVSB 4CCYB 1SBNE 1DAOA 1L5FA 3FY4A 4B80A 3DG9A 4DKJA 2JZNA 4PNEA 1CERA 2XMGA 1H1DA 4U63A 1E77A 3AY7A 3KR1A 4TMWA 1IEVA 4KXFB 2AEEA 3PRKE 1IJBA 1ELOA 4JUAA 5EFOA 3P5SA 2VHCA 1CV2A 3PFCA 4KUGA 5IBQA 4WNAA 5KYYA 1O3YA 5KUTA 1UANA 4FZ3A 3VR4H 3UUFA 3C43A 5IDWA 4H15A 4YWJA 1G5TA 5C8YF 4OHVA 4WESA 5LOVF 4LNAA 4HZIA 4F3YA 4ZDJA 1L5YA 1XTJA 1AURA 2Z8XA 1XVUA 3QI2A 4QICA 3TLCA 3DEKA 4JJEA 2AOVA 5F1OA 4G6ZA 1VBFA 3M4JA 3W8RA 4B6SA 4BB5A 4DV3B 1F06A 4W82A 4E2ZA 3BDVA 3QVGA 1GPMA 2ZSHA 4AF8A 3G5AA 1CVIA 1Z0ZA 3G49A 3ZDYB 2CL0X 2O2XA 4B76A 1OGYA 1U94A 1CTQA 3FNEA 2BRUA 1BJRE 1K08A 1J8QA 1SK8A 1SQFA 3CRRA 2J59A 2JIQA 5DXFA 1NFRA 2D7CA 2ZBDA 5KSZA 3D0RA 1N2CB 1N7JA 3QE4A 1KPGA 2X9QA 2WM3A 1NYRA 2JGAA 4QOEA 5CD1A 5DV9A 5HIMA 2NPFA 2DR0A 3LP8A 3SZ3A 4ROTA 3A0UA 1U1CA 4L8GA 5CNIA 3UMVA 3N2KB 3WDKA 3WLLA 1E9FA 2AI3A 3IDSA 1SVOA 2C9OA 1QPZA 1QF7A 4H1VA 4G9EA 4OKIA 3BCHA 3NIWA 4ISCA 2OZPA 4CBVA 1SVUA 3UXEA 3BYZA 4BLTA 5DTEA 3LRPA 1VL8A 3EEQA 5GVSA 5LMZA 1RWNA 1SBIA 1PR0A 4TV8F 4BWVA 4HGZA 2FQ1A 2HSJA 1LC0A 1R4MA 4JB8A 4MR7A 1R50A 4AKSA 3P2MA 2B99A 5CBKA 1C50A 2G63A 1QSGA 4WIAA 4ZZ0A 3PGLA 1DPGA 3Q5GA 4X1KB 1LUAA 1NI3A 1VBMA 1VIYA 1WCIA 1HEIA 1KI4A 2ZI3A 2YRWA 3BCRA 5IBCA 3QE3A 3FLMA 1QGED 2C42A 1J9EA 4J1SA 4MYHA 4BJ3A 5CU7A 3NWJA 2GMWA 4NWIA 1U8CB 2ZTLA 2ZAOA 1AKTA 2ZEJA 1QHIA 1Y9ZA 1WW2A 2ZW9A 3DEAA 5DPMA 1L4FA 3A4LA 4IYRA 5AJZA 1GPYA 2DWUA 4FMCF 5EZ6B 5TGZA 1PLJA 5A2GA 3FM9A 5ECWA 4MQFA 2GR9A 3RYIA 3PF8A 4XE5A 3WLSA 3HNPA 2FDCA 1O89A 1TM5E 3MC1A 1E4OA 4JEUA 1B00A 1E7MA 1IG3A 1N2EA 1ULZA 2UYQA 3ER6A 1ZSVA 2V6FA 1Q1GA 1H22A 4S1VA 1GQQA 4PR0A 2A5GA 5COBA 1P7PA 4YYZA 4YT8A 1TU4A 4I1IA 2ECPA 4PLGA 3AC0A 1E3IA 3G0CA 4P3YA 4AJPA 4ZHSA 3LNCA 4EI8A 2GLXA 2ZT8A 1LPOA 2EYUA 4UE6A 3V1YA 2WT8A 3RVLA 1A9SA 2PG3A 4ARSA 2OYCA 3GFTA 4CU5A 5F2NA 3E9MA 4XR4A 4BO2A 4B71A 2LDXA 1Q1BA 4NS4A 4QELA 2GARA 1A69A 3OPMA 4A8JA 2WIBA 3DFFA 3OFND 1YKFA 2NO9A 4JLNA 1XN1A 1CJMA 5H9VA 4AS1A 1JEDA 3DTVD 2QRNA 1K5HA 4FFRA 4EUSA 2V0GA 4BV3A 4YAUA 4X00A 4W8GA 4D8WA 1SBQA 3M70A 5IDQA 2LRHA 3QPDA 2QTAA 4KPFC 3H13A 3IV9A 5BNIA 3TH5A 1NXXA 3K1TA 4KQHA 4Z5XA 3K9GA 2NSHA 1UMCB 1H23A 2QGFA 3UK1A 2RHWA 3RVBA 2E3JA 1V9CA 2XQKA 5ALJA 3WS7A 4QXQA 3R6GA 4FYKA 4Q4DA 1VP3A 2OBFA 2ST1A 2FEOA 4FMDF 4TPKA 1WCYA 3R9KA 1TCCA 2GUGA 3BSFA 2N9UA 2W2MA 3KK0A 1Z4IA 4Q1CA 5B3AA 3WKCA 2Y71A 5K3DA 3U4QB 3BSYA 1P74A 1Y5RA 2G3YA 3ICVA 1NG1A 1TQ4A 4XYGA 5JLAA 1RXYA 3W79A 3VR6A 1HX7A 5I7UA 3G6KA 3LBNA 3ENQA 4OGLA 2BFCA 2WILA 5HOEA 3U44B 2GK7A 3F5MA 4O4LA 4JR0A 2D1QA 1N2OA 1R00A 3VKFA 1MAVA 4K86A 3DEJA 2SECE 4UJ5A 3VPBA 4BWFB 4EG1A 4J49A 2QJOA 4NG5A 1D2CA 4CKXA 2YL2A 5INTA 3EW7A 1L1QA 1G64A 3G17A 3GUYA 2ZJYA 1WDWB 3JR7A 3O8QB 4QOGA 4CYMA 2QZ9A 4FTWA 3NONA 3U19A 2WJAA 3M4YA 2GFIA 3KOYA 4UUQA 1ZU4A 1QX3A 4QECA 2OV4A 2EJWA 2GEJA 4A2CA 3LV8A 3T3EA 5IH7A 4G5RA 2O8BB 1NY5A 2H2AA 1GGJA 2Q46A 3UV3A 3ZWNA 3JQ9A 3GLGB 1Y4UA 2WSYB 5IJXA 1L7RA 4KXVA 2NZVG 3KVVA 3VH2A 3QVXA 1Z45A 3BOSA 2EL9A 2ZANA 4XTRA 1U9IC 4AZTA 4XYLA 4YMGA 4L4ZA 1VJTA 1BWRA 4DRXB 5JWHA 3WY9A 3GLHB 3QSYA 3C3XA 3LUFA 4MYDA 1L5KA 3WKBA 3Q12A 1DV2A 1TZMA 1ZI8A 2LR0A 2DECA 2R2AA 4LISA 3X43A 1ZD1A 5IXJA 4N0MA 1YS7A 2O7NA 1GPUA 3CG4A 3K5HA 3TVYA 4ZZ1A 1NR5A 1F0YA 4DCMA 4E5KA 2JVIA 5B30A 1K4YA 1TAHA 3GJ4A 4KSYA 4PPYA 4U6SA 4V1CB 2RBGA 1UZMA 5AXCA 3TZQA 3VSCA 2IZ7A 2EJVA 4QJ4A 4AMYA 4K46A 1UAGA 3U3RA 5JDCA 3Q2KA 2I4NA 4ON9A 2IHKA 2QR3A 3OF2A 3I6ZA 1V1JA 3TNLA 5DASA 4NYJQ 3RAJA 4D8TA 1DTSA 2JJ1D 2IYVA 1D0IA 1LRLA 2WIDA 2O9JA 1NURA 2HD4A 4RY2A 5SY9A 3FHTA 1HE4A 3A1CA 2C5FA 4BFYA 3K1ZA 1V2GA 1E1RD 4IDFA 2WYOA 1WTAA 2QZJA 3WWYA 2TMKA 2C8VA 2ORVA 4JLOA 1RQLA 3W5IA 3L8EA 2MSCB 1ZOOA 1Y5IA 3LUJA 4HNQA 4YAEA 1C1HA 1VOTA 3D5TA 3WK8A 5K3FB 3NFYA 4EMSA 5D1NA 4ESOA 4F0JA 1TM7E 2JBHA 2V8BA 1Y8RA 3FZQA 4NJOA 2MSEB 1EHCA 2Q4TA 5JD3A 3SK0A 2I7DA 3UAWA 3R0ZA 2ZRPA 1AKEA 4OJNA 3UAVA 4BMSA 3U7HB 3BXXA 4AXXA 2ZB2A 4TV8A 2A1UA 2DBYA 3C3EA 3H5AA 3WSTA 3ZGZA 3UYLA 4Q03A 4KLRA 4GF5A 3WLFA 4L95C 1YZHA 1FS5A 3EGXB 4I50A 1LEHA 3DUFB 1V95A 4RPLA 4URFA 3IULA 1Z26A 2RONA 1UINA 1GQ2A 1PR2A 2OHJA 4ESHA 5KJ1A 4ZV9A 1NMZA 2VT2A 3K4PA 4FGKA 3ML1A 4YO7A 4XDGA 3L5KA 3BILA 1I2MA 2G1JA 3FWHA 1K7FB 4UNQA 1SXJC 3QTLA 4MA4A 4UHBA 4DDWA 3D7NA 3BWCA 3GLIE 3MLEA 1CUJA 1GSOA 2QI9C 4LXUA 3TTYA 2IHBA 1EXWA 4YJ2A 2GCEA 2VDQB 3OQIA 2PQMA 3O4JA 3QYPA 3S0JA 4DV5B 3OQOA 3PSAA 4LPSA 5DIFA 3ZE1B 1PV2A 4BQIA 8GPBA 3C1AA 4H31A 5EJFA 2QRLA 4HUQA 2ZJ7A 1KMHB 3BMOB 3HEBA 1PS0A 5KYWA 2BWJA 4HDSA 3NIDB 3SR4A 4GR4A 2H7YA 5KVSA 4MKRA 1BGVA 1I32A 5HX7A 5K7SA 3EF0A 4TQAA 3WG9A 4E94A 1TD9A 3MMXA 4ZXFA 2QX6A 2X3UA 2FJPA 3H3XA 4N7BA 1HKHA 1ZGBA 1OWLA 3A2MA 2FY8A 3ZPXA 2KHZA 2X3FA 3ACBA 2VEOA 2I99A 1TJ4A 3H1BA 1GVNB 2QI9F 3ODPA 1XZ8A 1J5PA 1FSPA 1WMBA 4E1BA 2OBNA 5ABPA 2VFAA 1G7TA 1VKHA 2HLPA 2X1VA 3GD5A 4UEOA 5KTYA 1SKMA 3PJRA 2GVNA 2IY7A 2WKQA 4B3RB 4EEZA 1R5OA 1WUIS 3EFBA 3CCCA 3SOOA 2QPAA 3VHXB 3UPTA 2GA8A 2J48A 3FOCA 4CNBA 1H2EA 4NCNA 1DT5A 2G77B 4GZ3A 1ESDA 1W87A 1Z25A 2B83A 3IBCA 3QYAA 1TLFA 1CF2O 2XE7A 3QNUA 2O1SA 1W5SA 4RTPA 4FXOA 4GP7A 2HJHA 1O08A 3KOOA 1WEKA 4U0JA 5AKEA 3V80A 2HRRA 1X1QA 3NVKI 2C9MA 2QE7A 3PB3A 1BS9A 1MGPA 4IS3A 3R7DA 1ONPA 4AY4A 5B6IA 3E5MA 2ISQA 3OT1B 3RHTA 2PHZA 4I0WB 5DN9A 1LBQA 2VK8A 1VPEA 5FP0A 4QEZA 3AVUA 5TMBA 1ZN9A 3JSAA 2PZLA 1J49A 2Y1OA 5FJJA 1BXRA 2DQKA 3WGIA 1EFRD 4G2TA 4FQ5A 5FBVB 5EZQA 1LNSA 4URXR 1SUIA 1YHYA 1EUDA 3ELYA 3VR1A 4JUCA 3GJXC 3OX2A 4ALKA 3IHWA 1G2PA 3PDIB 5CM9C 2PKCA 3VYRB 4Q3LA 3MRVA 3CX8A 3ETEA 3MCWA 2XMBA 5KYVA 3A4IA 3WRYA 2P2NA 4Y9TA 2ZIFA 2H1FA 1NXTA 5ITZA 1JV2B 4LZWA 4LYYA 2C8KA 2G70A 2GAAA 1T8WA 2HCBA 3OTGA 4QAJA 4BZPA 5AP9A 4NULA 4E14A 3IQIX 4GBMA 4Q4JA 5CB4A 2P68A 3IC5A 3TW8B 3VX4A 4Y1GA 5JASA 5KAMA 2GJSA 1M2HA 4QYSA 1PFYA 5JAQA 2JGDA 5IT9A 1RWWA 3RW9A 3MXTA 3STYA 4QDUA 2Z58A 3V8EA 3HM2A 1S0UA 1KI9A 4W7HA 3FZEA 1L9XA 4UARA 3SP1A 3VISA 2GKGA 1FU8A 3L4EA 5J43A 1IPFA 2W90A 5IAEA 1Y0BA 2PCLA 3BXZA 1Y1LA 4JLPA 3FIJA 3NUQA 1VI6A 1M76A 1WUKS 1XZCA 4KO1S 5AXAA 1HQDA 2BEUB 3URMA 3WA6A 3O1IC 4GG1A 1CZNA 4RIGA 3FUTA 2IYPA 3ZWMA 3ROMA 1DFHA 1VGRA 1I80A 2QTWB 3GEEA 4MV7A 1OQAA 1S8NA 3DOJA 1WDLA 3PQ2A 3VVMA 4BMCA 2P9CA 3VI4B 4M9CA 2FX3A 2EEZA 5A4FS 1BDIA 1RBZA 2HIGA 1MENA 2PRJA 4JVNA 4M46A 5IH3A 5CYOA 4DMKA 2Q3LA 2ZJ4A 3MWJA 4N76A 5HF5A 1U7PA 3DP9A 4A0SA 1V47A 4C2BA 1BGXT 3VOBA 2PT9A 3E5NA 3WGZA 4MQ5A 4M1OA 1OYVA 1KJWA 1S3GA 2IXDA 5DW3A 3N39C 4Q7LA 2JAPA 1OKKA 3DL4A 3TXYA 4WBXC 4FFOA 3BHIA 3H0EA 1XB2A 1U2QA 4FNGA 2PGOA 2ZZNA 3PENA 5A2QA 3NBFA 1NQXA 1Q12A 5A3RA 2JARA 5KQSA 3SGLA 1U63A 1G0OA 1DEXA 4RYDA 5DVZA 1JQEA 3ENKA 1LPSA 3PDHA 5FBWB 5GGXA 4GR9A 3W1EA 3ESCA 4N5LA 1B74A 3VDQA 4YRSA 1V5FA 3SZUA 3Q87B 5IHPA 5EY5B 1KOJA 2MSDB 2NACA 3FPAA 3WKAA 4E2YA 5HKKA 2QLTA 4WOPA 2E89A 1W5TA 1KJYA 1LDGA 3CZ5A 4NOMA 1FLDA 7AT1A 2GDZA 3ZE8A 1ZD8A 2JLRA 3EIWA 1M6VA 4E5NA 1C3OB 4EVRA 3PX7A 4DDKA 2BW0A 3EQ7A 3L7DA 3OMWA 4EYKA 3BMCB 1U4NA 2WV7A 1QRUA 2BGIA 3H5OA 1YZQA 2PA0A 1RHRA 2WUEA 3OPYB 4YWHA 3VHLB 3BD9A 1GPJA 1TCUA 3KEQA 4AJNA 4J2HA 2FZGA 3KPVA 2P5YA 3SIPA 3O82A 2YZNA 1T9ZA 4MI1A 2QVCA 4R9RA 721PA 2FFAA 5JD6A 1MNAA 1RJEA 3KEMA 4DY4A 1CUHA 2PUBA 4YQFA 3AIOA 3DJYA 2JAOA 1STOA 2IPLA 2OM6A 2YWCA 3HDGA 4EMBA 2ANBA 2CBXA 4E1VA 2V6IA 3NHKA 2X40A 4RCVA 4DV4B 1A4UA 2BFBA 3EGDB 3MGKA 3D5QA 3NV9A 3ORHA 4IEEA 3RS0A 1I7DA 2X19A 3BMQA 3GPCA 3NVDA 4KXYA 1GYQA 3NJ4A 5HTOA 4R0MA 1QQBA 1NLFA 1NMXA 4CV3A 1BVYF 2VYVD 4OP2A 3QIAA 1UC9A 5KVCA 3PNKA 1PHPA 3FTNA 3HVKA 1DAHA 2CXTA 1HMPA 3HA2A 4M1WA 4UNNA 3VTFA 1VCNA 2ASVA 1O95A 4W9NA 2O2SA 1ADBA 4YASA 2I2CA 2PWBA 3M6WA 5MN4A 1EUCB 2JJQA 3RVJA 4BQEA 4BV9A 2PZBA 2OG1A 1W1IA 4F45A 1YD7A 1PWZA 4YLGA 5IN4A 2PIDA 2V3WA 5ES3A 3WGKA 5H80A 3FCAA 1OAAA 1E4YA 4NNOA 2NVWA 3MRSA 4FZRA 5KNBA 1CY4A 1UIMA 3CT4A 3QOWA 5HFJA 4ZPXA 1AKWA 4G1UC 2FFHA 1C29B 1OFTA 1BRTA 1U7OA 2NVUA 3L7YA 3U9TA 2BTOA 5EEHA 5J5CA 3PDCA 4CDRA 2ZYHA 5JBNA 1QKJA 1UJMA 3IQFA 1KF0A 2BEWB 2ID4A 4DJTA 1NVKA 1J25A 1ZESA 1SVSA 3FKJA 1E1QD 5C18A 4IRMA 2VG8A 1NVDA 1Y48E 3PPYA 4D79A 1SNYA 3G1UA 1KGSA 2OG2A 4NEHB 4YRQA 1ZJ5A 3F6BX 2GBGA 1TUBA 2JFWA 5EWMA 4G1CA 1QH0A 2HMWA 3TQCA 4HQLA 1Z7GA 1Z0DA 3EZXA 3IEIA 3QTTA 4MUIA 3TRDA 3CUTA 1D5WA 1UZUA 5G4LA 4JYZA 1MJGM 5LWHA 4IKPA 3ZD6A 4XJSA 3BSWA 3ESRA 4PCLA 4OXKA 3L5OA 1XJQA 3C3KA 2ZSEA 3QF4B 2IOYA 1G66A 3LQRA 4QTTB 5C5IA 3MBIA 2BMJA 5LZ4A 1CR0A 3F4BA 2CFRA 1OF1A 5AI5A 4EI9A 3AFIA 3NTRA 4C4TA 2I3BA 1CDEA 3P2JA 2REQA 1OZHA 5GJWC 1Z7WA 3SIXA 2Y9PB 2VBCA 1LSUA 2OBBA 5SZJA 2OGSA 4J4TA 5ER9A 3GUHA 2VUHB 3NTLA 4RIIA 4AKEA 1MOSA 2ERCA 4NE9A 1UBNA 4N3BA 1FDUA 1W85B 2BAGA 4O2LA 3DBOB 3BRSA 1O96A 2J3KA 2BFEA 1VHWA 4K8RB 4C9BA 1VMKA 2JH3A 1Z2CA 2P6OA 4MS3B 3SIRA 3U5ZB 1XPRA 3I2HA 4F97A 2AKEA 2WE7A 4NEGA 4JJ6A 3Q15C 4AWXA 2QZ4A 2O1EA 4OXRA 2HDNB 1A5TA 3PFBA 4QLAA 5AW9A 3I92A 5I9MA 3S1AB 4DC0A 3O8OA 1FYDA 1UCFA 3A6JA 1W5AA 3RM3A 3W9UA 4Z99A 3WLPA 4EG3A 3LUGA 4H1WA 1CY2A 4OB7A 4BNGA 5BNZA 3AZOA 5EP2A 4G09A 2NSLA 5J1SB 2PANA 2CDRA 4CMAA 4N5IX 3R9WA 3IEUA 4U2GA 1I51A 5A7GA 4C4RA 1OW3B 4XX0B 4UAJA 4GX0A 3OUUA 1IVNA 1IZYA 1N1MA 3ZH2A 5CDSA 2N75A 5GGYA 1DEHA 4YHHB 3QVSA 1QQ6A 2JGKA 2Q4EA 3EEFA 4LXYA 5ANRB 3N7UA 2H7XA 4OQDA 2IP2A 1Q7RA 3N5CA 4TL9A 4WA7A 1DG3A 5M29A 3KQKA 3UPUA 1YMQA 3ORFA 1RLTA 4TQGA 1UBGA 4I9UA 4UUOA 3HU1A 3ZQKA 4B3CA 4Z4CA 3MCAA 3IQEA 4NRDA 4J7UA 2WKWA 4LHVA 4D9CA 1QBGA 2GCOB 1BX1A 3DTTA 4ROSA 3DMDA 1TQHA 2XF8A 3K1JA 4GGMX 4I5IA 3U0BA 5E7IA 2AK3A 3DLPX 1UT6A 2NIPA 4I1VA 1ZOSA 2R751 4WADA 3HO6A 2ZCJA 2RHMA 2JFBA 3VYUB 1O0BA 4RF4A 4KYUA 5IK2A 3H0CA 2ZTMA 4LRTB 5ERXA 3R7NA 3OEED 4BRWA 5CDFA 1F2VA 5KNCD 1RC1A 1SAYA 1JAZA 1W47A 4EVSA 3ZG6A 4H60A 1IOLA 4OMDA 3F78A 2ZT6A 2FCAA 2GCNA 4GPBA 5ALLA 3TVTA 4AP9A 4HSEA 1F14A 1OYYA 2EW8A 3FB1A 4GXNA 3IXQA 2IYYA 4KE7A 1M10A 3O7MA 1ICEA 3SHFA 4F71A 5C7OO 2C96A 3DWEX 2CNKA 1R8SA 4PSCA 3WMRA 3UJ8A 3RIXA 5LC1A 2Y66A 2QTNA 4KFUA 1ZNWA 2ZSUA 2F8MA 3Q7QA 1FTSA 2EWVA 4AS3A 1WUHS 3NBXX 5EN4A 1JQAA 2H1IA 1LK0A 3BK2A 3LY5A 1NE2A 2WDZA 4LJSA 3CO0S 3NJRA 4JI0B 3DLBA 1W2GA 3OJ0A 3Q7EA 1VL0A 4QG7A 3UVEA 2QLLA 3L8HA 1N32B 5EUBA 1Y81A 4UM5A 2P0YA 4J7AA 2JCYA 5L9AA 2DFDA 3C3PA 4G5OA 4MRSA 1XD2B 4WNYA 3OZSA 2XB9A 1T4DA 1WZEA 3DP7A 1J8MF 5JQGF 4MUEA 3UMFA 2JIMA 4UBMA 4OL0A 2XZDA 4M1QA 2JL1A 1IZZA 4WECA 3NKVA 4QSMA 2AMLA 1M1YE 1PQYA 2DBZA 2VO1A 3DVAA 2ZJ6A 1CIJA 1ZK2A 1PU2A 3BH7A 2WHPB 4IGIA 4R8SA 4Y9DA 1GPH1 3S2GA 2M2IA 3GRVA 5CNJA 5IFKA 1R8JA 4CJXA 5LMNB 1C1XA 4RA6B 2AFIE 3S28A 3T41A 4R81A 4DLWA 1NQOA 1G5IA 4DM7A 1ILEA 3J7AC 4PC3A 1PHRA 3ISTA 3P9NA 4GPD1 2O3QA 3TL2A 5J1TB 2A9QA 2HADA 3L93A 4GMFA 4IHJF 3SQMA 5H4GA 4LYAA 2B5VA 1G291 4HQFA 1CWUA 3GEHA 1KQ3A 4N3AA 2GJ4A 3DAFA 2J7KA 1SVLA 4DNXA 1G8SA 1VDZA 4GOJA 2DHQA 1A98A 3EODA 3KVYA 4K9SA 2L19A 2WMNB 2W43A 4UTOA 3BMNA 5I4KA 4RWEA 5H0IA 3CKKA 5EJIA 4RPHA 2FW6A 3A1UA 3IIEA 2CJYA 3OMXA 1TA0A 3G1TA 4BS9A 3G2NA 1EGMB 1BE1A 4IPTA 5HHTA 4IH4A 4BPRA 3PE6A 3D8RA 1BEUB 1DIRA 3W78A 2ZT7A 5I7RA 3KEGA 4X45A 1UKAA 2CT8A 5HBGA 4DADA 2ZIUB 2YV4A 1B8NA 1ZGGA 3HJCA 3F9IA 3MUNA 3BDAA 4G0YA 4WLFA 1JVNA 5IJ9B 2IUSA 2CK3A 2IELA 3CLKA 4IW3B 2PZ8A 2XI4A 1FRFS 2X2FA 1Z29A 1YQDA 3R74A 2F4VB 4E4YA 2QROA 2AH5A 2NUPA 5JFTA 4NLLA 2BGMA 3GJ5A 4OGFA 3RVSA 3BGIA 4OI4A 3EFOB 5EPOA 1X6VA 3OTHA 3UCFA 3C8UA 5BV8A 5KOHA 1IM5A 1YMVA 3IUNA 2VBFA 3KU1A 3A11A 1PFGA 5ALWA 5EWJA 3GT4A 3WI7A 3F8TA 4QU5A 4GECA 4C0HA 1TO1E 3KXPA 2ZIEA 1PLKA 1YR1A 3MINB 3N7AA 4TL7A 3UWPA 3M3DA 2PLRA 4TTVA 1LXCA 1YQTA 3ZY4A 3DDZX 2QTVB 2GHQA 5K0FA 4CODB 3NHJA 2QT0A 5TV2A 1YQ9A 1XEFA 4CKWA 2UYGA 3JQAB 3ZY6A 1UR5A 2XVYA 2IYEA 5JS2A 1HTWA 2HV8A 2MINB 3FFBA 4LY6A 4E6EA 4FFDA 4KREA 3O0TA 1Z5PA 1RP1A 1UWVA 3D2CA 5L3SB 4S2UA 1Z6GA 2ZRFA 2PGDA 2JLXA 1T43A 2QMEA 4AJIA 4I36A 2VH2A 4QLBA 2SCUA 4C78A 1KMQA 2OPBA 3RYTC 4K6CA 4YMUA 1KY3A 1PS8A 1QV7A 2ZP1A 1M6HA 4CEHA 2YMMA 3DC2A 2W6NA 1RKQA 2E2WA 4U2KA 4B5LA 2J46A 1XLTC 5HIAA 1OVGA 4XLTA 3WNVA 4HZUB 1CUDA 1JKFA 1XTVA 3H2BA 3WNCA 1VC2A 4FHFA 4HOYA 3B52X 3PGXA 4RD6A 3M82A 4R69A 5DT2A 1GGHA 1ZY2A 4HDOB 3I2KA 3HFJA 4JL5A 4L5YA 4YRRA 5EXDA 2IIBA 1P62B 1YBFA 4HAZA 3G8DA 1E0AA 5IJZA 1WB6A 3N2GA 5BN4B 5DK6A 1M8KA 4ARZB 3QJYA 1M34E 2HFKA 3CURA 4M0PA 3T7RA 1P77A 4B81A 3BBLA 3GVIA 3O75A 4YUXA 3QLUA 4UCXA 3QX3A 2PRIA 2PMKA 4ZOLB 3JD2A 1E4EA 4QT4A 1CF4A 5J5AA 4RD0A 3UWSA 2O8NA 3RRXA 3N0XA 3OZGA 4QQRA 1SZCA 1YR9A 4HDMB 5ALIA 5T67A 2JGEA 5AKZA 4IMPA 3ITNA 2BFWA 5JMPA 3NALA 1B23P 4LHYA 1QRSA 2XODA 4M0CA 3L6CA 1CU1A 1VPLA 2ORYA 3A14A 3EIFA 4RADA 3PIRA 1TVCA 1X13A 4HLUA 4UMFA 5FL7D 1ZVVA 2BGGA 1R7RA 4NMMA 4EFKA 10MHA 4DIBA 2LE0A 2E6KA 1UKYA 2HREA 4YQYA 3ELUA 3ETCA 4JMPA 4XUEA 3N2LA 4BY9E 2J3JA 4JNKA 3TLGA 1ESZA 3GLFE 5KJFA 2QM3A 1S3SA 4M9QA 3WLHA 4BC0A 2PKEA 2Z8ZA 5HKLA 1BW9A 2MDTA 4YMLA 3LT4A 4Z9FA 4C0WA 5L40A 1BHO1 4CEIA 3DZJA 2QMQA 4URVR 2YCLA 5EIAA 3O84A 3GX1A 4JHXA 2FI1A 4L5BA 1BCSA 4MVWA 4RVCA 4G23A 5LCXA 4MRVA 1MU0A 3R40A 3TRFA 2GD2A 3AB7A 1I0IA 3C6ZA 3KC2A 3QKRB 1V45E 1LDYA 1CZOA 2HYDA 1XTPA 2FG6C 3GLTA 4RSGA 4X95A 2B5OA 4OA8A 5ALQA 3R8XA 2SHKA 3URKA 2BL4A 3HNRA 3WIVA 3TLMA 5ADVA 5C0OE 4B3JA 3K9WA 4Q9KA 1OFHA 1KJNA 4O02B 3UHJA 1ABEA 2BCGY 2CUTA 1EWTA 5AUQA 2QD3A 1KZ4A 2HBZA 3LPAA 2HIHA 2PUWA 2XTMA 1ODCA 3U5TA 3IQGX 1FFEA 3AXTA 3RVDA 4F5ZA 1YC5A 2IDKA 1YC2A 4HP8A 5LA6F 1HETA 2XUOA 3TKYA 2NXCA 1KFCB 1R8XA 3EDYA 3OEWA 1R0YA 3N0WA 4ZKEA 3R3XA 2ZYAA 4D1YA 3E9CA 3HP4A 4DQLA 2XBMA 2J33A 3ONWA 1U02A 4B43A 3RVKA 2GAIA 1GPAA 1MOQA 4ZQCB 2ZWVA 4ZTBA 1WPGA 4KTVE 1CRPA 2WT4A 4JLVA 1X70A 3HSYA 4ALJA 1R3UA 1V48A 3S6JA 2PUHA 4J07A 4WCFB 3DGEC 5AKGA 1X8LA 5HUHA 3ZU6A 4YRIA 2C7QA 2WQ7A 4YP5A 5HGXA 2C5BA 2W6QA 1E32A 3HUFA 3MMSA 3CC8A 3LUHA 3N76A 2LDBA 1MG5A 2ZRNA 2BONA 2P3OA 3ESXA 3OTWA 3REGA 1HQKA 2JFOA 3M6FA 3WWOA 1DARA 1H42A 3DTVA 5T3UA 2VTKA 1D5CA 4RC9A 3PNBA 4LC0A 2CD9A 4O1IA 3AEYA 5K8LA 1HPLA 4Y30A 4DW8A 4KKVA 5BQFA 1JALA 1RU3A 2FJ0A 1XXHB 5B1DA 2Q5LA 1WV0A 4QWMA 4V0QA 4Z1MD 4TYMA 3LE8A 2VNKA 3W2HA 4OK6A 4D8VA 3D7KA 1HRKA 3HYSA 1P9OA 1PKXA 5IBPA 4DM3A 4Z54A 1AXEA 4XX1A 4CF7A 3EUWA 1GUAA 1LX7A 3U7QB 4BQSA 3AVVA 1ZM3A 1I3CA 3PDWA 4HB2A 4TLEA 1QGZA 2IFTA 4HF7A 2G6BA 1V3VA 5JAMA 3IB6A 2PR2A 3ANMA 5K8IA 1W48A 5DNDA 2IYOA 3WISA 1J90A 2RG1A 5ECGC 2G36A 1WWKA 5D6OA 1GTL1 1TO2E 5LR6A 1N3YA 3AG5A 2EX0A 3NS7A 1BDMA 4L8LA 1ORIA 4J0IA 5KHOC 3THXB 1J07A 1DEOA 3GFGA 2J7PD 3OH8A 4IL5A 1DQPA 3PNMA 4IQ0A 4MV4A 4UM9D 3G2MA 5GOTA 3IIMA 3MWYW 5HDBB 1U2ZA 2BZ1A 4Z2YA 3TD2A 2BZ0A 3GNSA 4Z4HA 5LD2B 4GE0A 4P4SA 2PWAA 3KP1A 5EIBD 1KEWA 2NT3A 3G23A 2Q7XA 3IUJA 4IICA 2FMFA 2E49A 2FPIA 3WYAA 1WX1A 1KJQA 2XTJA 3NHSA 1ZRHA 4LKRA 4E21A 4MUMA 4E30A 4US2R 3GGOA 1OD6A 5TJHA 3W90A 4M9UA 4U2DA 1OXVA 4BQPA 1WXEA 1H0RA 2H92A 2QX4A 3DMFA 4NDAA 2HBQA 4AWAA 1YI8A 1NKSA 4K6OA 5JCZA 1E5TA 1JSCA 2ZBPA 5EL0A 2WFAA 4HNVA 1IPEA 3DVRX 5BYBA 2PMBA 1NVWQ 2BKAA 4OQNA 2WAMA 5IFLA 4HLQB 3RS8A 4DCNA 3GI1A 4AZVA 1M1ZA 3HDQA 5KU1A 2DLDA 1CJUC 2RHBA 4UQOA 5GTDA 3FUXA 3ASVA 3QW2A 2IUUA 2QN3A 1GILA 3OKPA 3VSDA 1FEZA 4ZO8A 3UYKA 4NG4A 3GHHA 2AZ4A 1WHTB 3JWEA 1N8TA 1RRVA 3LCCA 4NQZA 3TTTA 4DA8A 3W4IA 3SS8A 3RROA 5J2TB 5K8UA 4O4HB 1RHKA 1JVSA 2XCQA 3UXYA 5AT1A 1D9ZA 3QPCA 4ZZIA 1AGYA 2EATA 1UMDA 1CRLA 3KYCB 3VVCA 3CLTC 2O57A 1EIZA 2JJ1A 2R8XA 3D64A 3WNDA 4ZMRA 1E8MA 5AW6A 3ZJTA 2WTXA 2O8CA 4KX5A 1UC5B 3M9LA 2LV8A 3F4KA 4YAJA 4QGHA 1VJCA 1KYTA 3QK7A 5CVDA 5GZ6A 4A7PA 4YJDA 2P2LA 2WG1A 5J63A 4N1AA 4GM1A 2QYSA 2YC2C 3IA7A 1E1RA 4ZI7B 1YXMA 1E92A 4N6NA 1AY0A 2HRDA 4LF4B 3U61B 1NSYA 4I5EA 4KWIA 5T7BA 3PITA 1YB6A 5CJJA 1YQUA 3DCYA 5FDFA 1YBMA 3E3NA 3O91A 4KN5A 3LC1O 1JG4A 3DZCA 4LI0A 3LXUX 1QQTA 2AJCA 3IVGA 3QG5A 4ITUA 1I7QB 2W22A 4MQLA 3JQ6A 5DEOA 1EWVA 3G2HA 2VDOB 4KBGA 1K92A 2WJIA 5I9SA 3SU8A 3TFOA 2CV0A 2NYRA 1QIKA 5BSTA 3P0RA 4KQIA 1HZZA 4N0EA 4C89A 2QPOA 3V7UA 3WV5A 4I14A 2OQ2A 4YRBA 5I3ZA 3IPCA 1GA1A 4K9QA 2PM8A