4PSQA

Crystal structure of retinol-binding protein 4 (rbp4) in complex with a non-retinoid ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
175
Chain Sequence
b'ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 4
publication title Structure-assisted discovery of the first non-retinoid ligands for Retinol-Binding Protein 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 45
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4psqA00
2GTFX 3TGBA 1BRQA 2G7BA 1I04A 4GE1A 5L8IA 4QZUA 1GKAA 1VYFA 3B2LA 3ELZA 4EDEA 2OVAA 2RQ0A 2ACPX 4Y0PA 1DZKA 4IMNA 5D48A 3CBSA 5F6BA 3TGCA 3CQRA 1GKAB 1N0SA 1KOIA 1OPAA 3EYCA 1DZPA 5D45A 4TKBA 1D3SA 2HLVA 5LKEA 5LJCA 2HYSA 3AKNA 4AZNA 1OBPA 4AYHA 4GNWA 1KT7A 1B4MA 1OBQA 5HCDC 3BS2A 1DF3A 4MVLA 2K62A 1SY1A 5EZ2A 3MBTA 1FE3A 1ALBA 1PMPA 3K3LA 2KTDA 4TQ2A 5JR8A 2X45A 4AZRA 1VYGA 2LBAA 3O22A 1AELA 1X8UA 4LKTA 1E02A 1ZNGA 2FRSA 4I9SA 3D97A 3FMZA 2AT3X 5LJGA 2W2FA 4OS0A 4A8ZA 4I3BA 3U9PC 1EPBA 4N7DA 2CM4A 2WUTA 3P6GA 3FW5A 1SXYA 3FA6A 2X46A 1B0OA 2WWPA 3T1DA 3APUA 4A1YA 3KFGA 2ACOA 1A18A 3F9DA 1PM1X 1OEJA 4QAEA 1KT3A 4PSQA 5IO6A 1P6PA 5DG4A 1IKEA 1KXOA 5B29A 2W2BA 3EBWA 3RSWA 1LPJA 2WEWA 3D96A 4RUUA 2POAA 2FT9A 4IAXA 1U17A 2WR6A 1OEKA 5HCCC 1BJ7A 1YUPA 2QO5A 2OVDA 1HMTA 1QABE 4O9SA 2DM5A 4XMEA 2K23A 1X8PA 1KZWA 2QO6A 1BWYA 1LIBA 2JU3A 4NYQA 2MO5A 4XMGA 3IFBA 5HWZA 1O8VA 1D2UA 3NADA 3S26A 1OPBA 1GXAA 3WJCA 2NNDA 1CJ5A 3STNA 3O19A 1ZNHA 2LBVA 2Q2MA 4EEJA 4OS3A 2FLJA 4GNYA 3UEXA 4ZHDA 2XKLA 4YKOA 1AB0A 1ZNDA 4ZR2A 1MX7A 3FA7A 5F1EA 4ORYA 4ORSA 3WVMA 2JOZA 2CZUA 2ASNX 1ZRYA 1ADLA 2BLGA 2LFOA 1GT5A 2G78A 1EQDA 1B56A 3FW4A 5KHPA 1LKEA 1JBHA 5EDBA 1IFCA 3FEPA 1HBQA 4BOEA 4TKJA 4A60A 4YMYA 4M7MA 3L4RA 3SAOA 4TNNA 5LJEA 5HA1A 3VG3A 1MVGA 5D47A 2FR3A 3BU9A 4YKMA 3STKA 3FR2A 4UU2A 1JJXA 4ORRA 1SXUA 1T0VA 3KQ0A 4AZQA 1DZMA 4TJZA 3NQ3A 1UREA 1MX8A 4K19A 4YBUA 3BY0A 3WJGA 2RD7C 5D8JA 3WJEA 2RCTA 1KGLA 4ORXA 2CM9A 1YP6A 1DZJA 4NP1A 4WBKA 1U18A 2HNXA 4TLJA 1LICA 3U03A 1RLBE 1H91A 1YWCA 2KT4B 3CR6A 3APXA 1KT6A 2FS6A 1BBPA 2OVEA 3CWKA 5HZ6A 1T8VA 2Q9SA 1TW4A 4LZVA 1X8OA 5HCEC 3HWDA 4QYNA 2MM3A 5HA0A 3ZUIA 1U0XA 2AL0X 5HTDA 3PP6A 1GM6A 4NLJA 2CBRA 4YH0A 4ZHCA 4ZHGA 5HZ8A 1SXWA 2QM9A 2AKQA 4QYPA 1BSYA 5FENA 2FTBA 4QGXA 5F7GA 4R0BA 4IB6A 1AVGI 1JYDA 1NP1A 4KIIA 3D95A 3HWFA 2ALLX 1A57A 1BEBA 4RUNA 2WQ9A 3KFHA 3WJDA 3TZSA 4XMFA 3VG7A 1HMRA 1QFVA 2AT8X 1TXLA 1FEMA 4D6BA 3JSQA 1JYJA 3VG2A 2IFBA 3PH5A 3FA8A 1LIFA 3TF6A 3C77X 5EEDA 2ANSA 2HZQA 5KIDA 4MVIA 4YFQA 3STMX 4ZHHA 1SXXA 3BDRA 3CBCA 2W2AA 1IW2A 4YGGA 4EFGA 2WQAE 1GX8A 1CBIA 4DQ4A 5H9AA 1E00A 2O62A 2F73A 3KFFA 5L8NA 2AMMX 1EXSA 3C76X 3FR5A 1QY1A 4HPDA 3KFIA 1GT4A 1DV9A 4YDBA 1QQSA 4YFRA 1LFOA 1X8QA 3TGAA 1OBUA 3FENA 4ALBA 2HZRA 4IMOA 1S2PA 1EPAA 5LKFA 3WBGA 4BVMA 4GRJA 5DPQA 5LJDA 3I17A 5H9KA 4ODDA 3U0DA 3GAQA 4BQUA 1YWAA 2CZTA 5K06A 4Y0QA 2L5PA 1ERBA 3Q6LA 4TKHA 1RBPA 4LZUA 1E5PA 2QO4A 3FA9A 3P6HA 1EALA 1ACDA 2WEXA 3WXQA 1ZNEA 5EDCA 2Q39A 4WFVA 3IA8A 3EM0A 4CK4A 1CRBA 5H8TA 1GT3A 5LJHA 3FR4A 5EPQA 2E4JA 1G74A 3OJYC 4HFOA 5FAZA 1BRPA 3NPOA 3O2YA 3UEUA 1FTPA 4OMXA 5BVSA 4QGWA 2OZQA 3UEWA 1BSQA 4IB7A 1XCAA 5HAEA 4NNSA 5IO7A 4ORWA 1B8EA 1QY0A 1S7DA 4YCEA 1ICNA 1NGLA 1LIDA 4HPBA 2CBSA 3HWGA 4Y0SA 1LIEA 5EEEA 5KICA 3NX2A 3EMMA 1O1VA 1KT4A 3P6FA 1SY0A 3VG4A 4ARHA 2OFRX 1HN2A 1T68X 3B2HA 3NP1A 3BRNA 1HBPA 5H9LA 1EUOA 1IFBA 4YGHA 1G7NA 3PEDA 4IAWA 1BLRA 4YFPA 4ZFXA 5IO5A 4LKPA 1AQBA 1JV4A 4EXZA 5FFHA 3UEVA 3CMPA 2FS7A 2JU8A 3CQNA 4ZH9A 2WSJA 4AZPA 2MJIA 3RZYA 1I06A 4D6AA 3I0AA 5HZQA 4ES7A 1FELA 3APVA 1UZ2X 4YBPA 4GETA 3PECA 2FR2A 3NQ9A 1QWDA 3FIQA 2R56A 4HPCA 4I3DA 5L8OA 4ZJ0A 1MUPA 3EBKA 1XKIA 4XMHA 1G85A 2FWVA 1JZUA 2A2GA 3P6DA 1A3YA 3KZAA 2LKKA 4IB9A 3MVFA 4OS8A 1KZXA 1I4UA 1OEEA 1NP4A 1QG5A 1SY3A 3P6CA 1MDCA 1HMSA 3BX7A 5HBSA 2R74A 4ALOA 5HZ5A 1X89A 4ZH6A 3HK1A 4M6SA 2AT5X 3VG5A 2RA6A 1ZNLA 2L68A 1ERXA 1KQXA 2YG2A 1S44A 3FLLA 1EW3A 2NNEA 1PEEA 3G7XA 1X71A 2XSTA 4QGVA 2L67A 5H9NA 5F6ZA 4XMDA 1CBRA 2GJ5A 3HWEA 2G79A 1LF7A 3BLGA 3P6EA 3NX1A 2NP1A 4QZTA 2A3FX 1VPRA 1PBOA 5HZ9A 1GGLA 2OFMX 4NNTA 5HTEA 4GKCA 1FENA 3BX8A 4I3CA 4AW8A 4DQ3A 1QY2A 1ML7A 1O1UA 2N93A 2HMBA 2PY1A 4N7CA 4YDAA 5AQ6A 1GX9A 2R73A 3BU1A 3DSZA 2LB6A 3WJFA 1LNMA 1BM5A 2P8GA 3WJBA 5D4AA 1ICMA 1QFTA 1TOUA 2Q4NA 5CE4A 3ELXA 4I9RA 1CBSA 4WFUA 1A2DA 4YCHA 4YGZA 1EIOA 2Q2PA 2AT6X 4XMCA 1JJJA 3JS1A 4AZOA 1TVQA 2AH7X 4UU3A 4ZGUA 1G5WA 4OMWA 3B2JA 3FEKA 3ZQ3A 3B2KA 3NR3A 1DFVA 3APWA 4Y0RA 3FELA 4NLIA 1KQWA 3DTQA 1DC9A 2GC9A 3B2IA 1L6MA 4IBAA 2AT0X 2QOSC 3PH6A 4MVKA 1HQPA 2A13A 1ZNKA 3F8AA 4GH7A 1EIIA 1SY2A 1E06A 2RCQA 3C78X 1Z24A 4ZCBA 1GT1A 1YP7A 3QKGA 3BSZE 5LJBA 1CBQA 5B27A 3PPTA 4A1HA 2A2UA 1IKJA 2A0AA 4IB8A 1FDQA 3ZUOA 5F58A 1KT5A 5BVQA 1R0UA 1YWDA 1I05A 4ZHFA 5BVTA 4AZMA 2L9CA 4ORUA 5LJKA 3AKMA 3VG6A 2JN3A 1IIUA 5C0NA 1YIVA 1YWBA 1TOWA 4HPAA 1BSOA 4NYRA 1X8NA 1SA8A 2JU7A 2NNQA 2EU7X
chains in the Genus database with same CATH superfamily
2GTFX 3TGBA 2OFBA 1N43A 1BRQA 2G7BA 4O3XB 1I04A 3LTWA 4GE1A 5L8IA 4QZUA 1GKAA 1VYFA 3B2LA 3ELZA 4EDEA 2OVAA 2VFCA 5IRWA 2OF9A 2RQ0A 2ACPX 1WUBA 4Y0PA 1DZKA 1NQMA 4IMNA 3CBSA 4O49A 5D48A 5F6BA 3TGCA 3CQRA 3S5VA 5B2AO 1GKAB 1N0SA 5B5GA 1KOIA 1OPAA 3RY1A 3EYCA 4EKVA 1DZPA 4KT5A 5D45A 4Z27A 4TKBA 1D3SA 2HLVA 5LKEA 5LJCA 2HYSA 3AKNA 4AZNA 1OBPA 4WHIA 4OELA 4AYHA 2OF8A 1KT7A 3MM0A 4GNWA 4U8UM 1B4MA 1OBQA 5HCDC 3BS2A 2Y3EA 1DF3A 4MVLA 2K62A 1NC9A 1SY1A 5EZ2A 3MBTA 1FE3A 1ALBA 1PMPA 1KL5A 2KTDA 3K3LA 2RTJA 2GTLM 4NW4A 5JR8A 2X45A 4AZRA 1VYGA 2LBAA 3VE1A 1Y55X 3O22A 1AELA 4BX5B 1X8UA 4LKTA 1E02A 1ZNGA 2FRSA 4I9SA 3D97A 3FMZA 3T2XA 2AT3X 5LJGA 4O3WA 2Y3FA 4BX6A 2W2FA 4OS0A 4A8ZA 2CAMA 4I3BA 3OD9A 3U9PC 1EPBA 4N7DA 2CM4A 1HY2A 2WUTA 3P6GA 2IZGB 1RXHA 3FW5A 1SXYA 2KD2A 2X46A 1B0OA 2F09A 2WWPA 3FA6A 4GJVA 3T1DA 1SRJA 1JIWI 3APUA 4A1YA 3KFGA 2ACOA 4MISA 4Y5DA 1A18A 4BCSA 3RE5A 3F9DA 1PM1X 4INNA 1LCVA 5BYPA 1OEJA 4QAEA 1KT3A 4PSQA 3WZPA 4QQ1A 3RDSA 5IO6A 4FBRA 4FBVA 3X00A 2RTIB 1P6PA 4TQ2A 3ZZVA 2OL6O 4JGLA 5DG4A 1IKEA 1JQPA 3CKGA 1SLEB 1KXOA 5B29A 2MF6A 2W2BA 3EBWA 3RSWA 2IZFB 1LPJA 2AVIA 2WEWA 3D96A 5FQ6E 1SWJA 4RUUA 2POAA 2FT9A 4IAXA 3SZHA 1U17A 2WR6A 1OEKA 5HCCC 1SLFB 2X8FA 3ZWEA 1BJ7A 1VWNB 1YUPA 4EQAC 1VWOB 2KTSA 2QO5A 3ZW0A 2OVDA 1HMTA 1QABE 4O9SA 2DM5A 4XMEA 2K23A 3RY2A 1X8PA 1KZWA 3D4RA 3EW2A 2QO6A 2ZSCA 1BWYA 3ZW0B 1LIBA 5AJBA 1VWFB 2JU3A 3PQUA 2MO5A 4NYQA 3IFBA 4XMGA 1O8VA 5HWZA 3RE6A 4CDEA 1D2UA 3NADA 3S26A 1OPBA 1GXAA 1E2TA 2NNDA 2RTFB 4GK9A 3STNA 3WJCA 1VWAB 1CJ5A 3O19A 1SWBA 1ZNHA 1JMZA 1RSUB 2LBVA 2Q2MA 4EEJA 4Z2OA 4MEEA 1VWHB 4OS3A 1STPA 5HZ8A 2FLJA 4GNYA 2C1QA 3UEXA 4ZHDA 2XKLA 3P24A 1AB0A 4JNJA 4YKOA 3SOTA 1SWQA 1ZNDA 4ZR2A 1SRIA 3FA7A 5F1EA 4ORYA 4ORSA 1LUQA 1Y0GA 3V8UA 2JOZA 3WVMA 2ASNX 2CZUA 1ZRYA 1MEPA 1ADLA 2BLGA 2LFOA 1GT5A 2IZJA 2G78A 1EQDA 1B56A 2X34A 3FW4A 1LKEA 4I95A 3ZW2A 5KHPA 1JBHA 4BX7A 5EDBA 2RTLA 1IFCA 3FEPA 1HBQA 4FGIB 5K67A 4BOEA 4CV7A 2QOMA 4TKJA 4KC8A 1AVEA 4A60A 2OY1O 5HTEA 4BX7B 4YMYA 3VHIA 4M7MA 3L4RA 3SAOA 4ZHHA 4TNNA 3N91A 5LJEA 5HA1A 3VG3A 1SRFA 1MVGA 2GH7A 5D47A 2FR3A 3BU9A 2RTDB 4YKMA 3SLJA 3STKA 3FR2A 2JU7A 2JMBA 3E3CA 1LCWA 4UU2A 1JJXA 4ORRA 1SXUA 1VWJB 5B5FA 1T0VA 3LV4A 3KQ0A 4AZQA 1DZMA 4TJZA 3NQ3A 2PI3O 3RBYA 1UREA 1MX8A 3PK2A 1W5RA 4K19A 4YBUA 2X8SA 3S60A 3BY0A 3VGWA 3WJGA 2RD7C 3FDCA 4U3QA 2RCTA 5D8JA 3WJEA 1KGLA 2A5BA 4ORXA 2CM9A 1YP6A 1DZJA 4BJ8A 3PDFA 2BT9A 4NP1A 4WBKA 4GD9A 1U18A 2HNXA 4TLJA 1LICA 4Y59A 3U03A 1RLBE 1JJUA 1H91A 1YWCA 2KT4B 3OE3A 2BS6A 2FHNX 3CR6A 3APXA 1KT6A 4C5PA 2FS6A 1BBPA 2OVEA 3CWKA 4BX5A 5HZ6A 1T8VA 4CPEA 2Q9SA 2RTOB 1TW4A 1SWOA 4LZVA 3P02A 1SWDA 1X8OA 3PQSA 2I5VO 1SWFA 5HCEC 3MG5A 3HWDA 2RTHB 4QYNA 2MM3A 4MVEA 1PTSA 5HA0A 3ZUIA 2UZ2A 2OY5O 3NQKA 3WYQA 1U0XA 2AL0X 1FJ1E 5HTDA 3HOLA 3PP6A 1GM6A 4NLJA 2CBRA 4YH0A 1LELA 3RDOA 3SLOA 1SXWA 2QM9A 2AKQA 4QYPA 1BSYA 2IZEB 2RTCB 4GGTA 5FENA 2FTBA 4QGXA 5F7GA 4R0BA 1VWEB 4IB6A 1AVGI 1JYDA 2IZCB 1NP1A 2M4LA 3D95A 3HWFA 4KIIA 2ALLX 4Z2VA 1SRGA 1A57A 1BEBA 1X8NA 4RUNA 2WQ9A 3RWXA 2GTLN 3KFHA 3WJDA 3WZQA 3TZSA 2OFAA 4XMFA 3VG7A 4FQBB 1HMRA 1QFVA 2AT8X 1TXLA 3SZIA 1FEMA 4D6BA 3JSQA 4JO6A 1JYJA 5AEOA 3VG2A 1VWMB 1HQQA 1RXJA 2IFBA 3PH5A 3FIDA 1SWSA 5B3MO 2QCBA 3VU1A 3RDUA 3FA8A 1LIFA 1UYNX 2ZAGA 3KVNA 3TF6A 3C77X 2X56A 5EEDA 2ANSA 4CDCA 2HZQA 5KIDA 3CKFA 4MVIA 2F01A 2X4MA 5B11O 2RN4A 2MHDA 2G5LA 2HKDA 4YFQA 4CDDA 3STMX 2C1SA 1SXXA 2QMIA 3BDRA 3CBCA 4U9CA 2W2AA 1IW2A 1RSTB 4YGGA 4EFGA 2WQAE 1GX8A 4Z6JA 1CBIA 4DQ4A 5H9AA 1E00A 2OL7A 2O62A 4I6SA 2F73A 1SLDB 2OL8O 1GX3A 3KFFA 5L8NA 1RAVA 1EXSA 2AMMX 1KL3A 1SWPA 3C76X 3FR5A 2RTRB 1QY1A 5JD2A 3Q34A 4HPDA 3AEHA 1GT4A 3KFIA 1DV9A 4YDBA 1QQSA 1N4JA 5CSEA 3RDXA 4YFRA 1LFOA 2IZHB 1X8QA 3TGAA 1OBUA 3FENA 4ALBA 1VWQB 2HZRA 2WPUA 4IMOA 1S2PA 1EPAA 3ZW1A 5LKFA 3WBGA 4BVMA 4GRJA 5DPQA 5LJDA 3I17A 2I5ZO 5H9KA 4ODDA 3ZW1B 3U0DA 1MK5A 3GAQA 4BQUA 1YWAA 3FYFA 1LDOA 2CZTA 4GZVA 5K06A 4YVBA 3JQOA 4Y0QA 2L5PA 1ERBA 2KW1A 3Q6LA 4TKHA 1RBPA 2BHVA 4LZUA 1E5PA 2QO4A 2RTQB 3FA9A 3P6HA 1EALA 1VWGB 1ACDA 3RKGA 3ZI8A 2WEXA 3WXQA 1ZNEA 5EDCA 2Q39A 4WFVA 3IA8A 1VWBB 3EM0A 4CK4A 1SWUA 4IRWA 5CHKA 1CRBA 5H8TA 5AJCA 1GT3A 1SWRA 5LJHA 3EW1A 1STSB 3FR4A 2E4JA 1G74A 3OJYC 3HPEA 4HFOA 5EPQA 1HXLA 3MX7A 5FAZA 1BRPA 3NPOA 3O2YA 3UEUA 1FTPA 4OMXA 1N9MA 5BVSA 4QGWA 2UYWA 2OZQA 3RDMA 3UEWA 1BSQA 5L3YA 4IB7A 1Y52X 1XCAA 2IZIA 4ZHGA 5HAEA 1K3BA 4NNSA 2RTAA 3VE2A 4ID2A 4CSBA 4ORWA 5IO7A 1B8EA 1QY0A 1S7DA 4NV7A 1EI5A 1HXZA 1ICNA 1NGLA 4YCEA 3HTYA 1LIDA 4HPBA 2CBSA 3HWGA 4Y0SA 5K68A 4DCBA 1LIEA 1NBXA 3AUMO 5EEEA 1SWKA 4ZGFA 4U46A 5B10O 1I78A 5KICA 1VWKB 3NX2A 3EMMA 1O1VA 2IZLB 1KT4A 3P6FA 1SY0A 2FGSA 3VG4A 1WBIA 4ARHA 3S5XA 5FQ7E 2IZAA 1HN2A 1T68X 2OFRX 3B2HA 3T6LA 4CPIA 1VWRB 3NP1A 3BRNA 1HBPA 5H9LA 1EUOA 4Z2PA 4ML7B 1IFBA 2OY7A 4YGHA 1G7NA 3PEDA 4GU8A 4IAWA 4HWMA 3VPJE 1BLRA 2BC3A 1SWEA 2G8CO 4L1NA 4O3YA 4YFPA 4ZFXA 4LKPA 5IO5A 1AQBA 1JV4A 2RTMA 4EXZA 5FFHA 3UEVA 3CMPA 2FS7A 1N7YA 2JU8A 3CQNA 4O4UA 4ZH9A 2WSJA 4AZPA 4JHQA 2MJIA 3RZYA 1I06A 2X32A 1SWCA 4D6AA 3I0AA 5HZQA 3SLTA 1FELA 3APVA 1UZ2X 4O4XA 4ES7A 4GETA 2BS5A 4YBPA 3PECA 2FR2A 3NQ9A 1QWDA 3FIQA 2R56A 4FBOA 1KL4A 2MWHA 2VFBA 4HPCA 4I3DA 3WYPA 5L8OA 2IZBA 4ZJ0A 1MUPA 4U8UN 3EBKA 1VWCB 1XKIA 4XMHA 1G85A 2FWVA 2X8TA 1JZUA 2A2GA 3P6DA 1SWTA 3LHNA 2JGSA 1A3YA 3KZAA 2LKKA 4IB9A 1VWDB 2RTNB 2Y32A 3MVFA 4OS8A 5IRAA 1KZXA 1I4UA 1OEEA 5IRUA 1NP4A 1QG5A 1SY3A 3P6CA 4ON1A 3T2WA 1MDCA 2VDFA 1HMSA 3BX7A 5HBSA 2R74A 4ALOA 5HZ5A 2AF5A 1X89A 2OVSA 4LQZA 3HK1A 1VYOA 4ZH6A 4M6SA 1Y53X 2AT5X 1Y9TA 3VG5A 2RA6A 1LDQA 1OSPO 1ZNLA 2L68A 1ERXA 1KQXA 2YG2A 1S44A 3NBXX 3FLLA 1EW3A 2NNEA 1PEEA 2RTGB 3EC5A 3G7XA 1I9HA 1N9YA 1K24A 1X71A 2XSTA 4KC7A 1NDJA 2L67A 5H9NA 3SZJA 3OBLA 4BX6B 1VWPB 4QGVA 5F6ZA 4XMDA 1CBRA 2GJ5A 2OY8A 3HWEA 2G79A 1LF7A 1DF8A 3BLGA 3P6EA 3NX1A 3WZOA 2NP1A 1SWLA 2A3FX 4QZTA 1VPRA 2C4IA 4BBOA 1SREA 1PBOA 5HZ9A 1GGLA 2BSZA 2OFMX 4GDAA 4GKCA 4NNTA 4O4OA 1FENA 3BX8A 4I3CA 4AW8A 4DQ3A 1QY2A 1ML7A 1JMXA 1SWHA 1IJ8A 1AVDA 2RTEB 1O1UA 2FHLA 3WOVA 2N93A 1SLGB 1UYOX 2HMBA 2PY1A 4N7CA 4YDAA 5AQ6A 1GX9A 2R73A 2JW1A 3BU1A 3DSZA 4U8UO 2LB6A 3GE2A 1LNMA 3WJFA 1BM5A 1PBYA 2A5CA 1SMPI 3H3IA 4GJSA 2P8GA 4MIRA 3VHMA 5D4AA 3WJBA 1ICMA 3F6ZB 3VHHA 1QFTA 1TOUA 4GUZA 2GTLO 2YMSA 2Q4NA 5CE4A 3ELXA 4I9RA 4IABA 4KH8A 1CBSA 1SWGA 4WFUA 4O4SA 1A2DA 3D9WA 1MOYA 4YCHA 4YGZA 4GGRA 4COTA 2Q2PA 2AT6X 2FKJA 1STRB 1SWAA 4XMCA 1EIOA 2DJFA 3JS1A 4AZOA 1VWLB 1JJJA 1TVQA 1RXKA 4CPFA 2AH7X 4UU3A 1Y9LA 4OKAA 4ZGUA 3T6FA 4OMWA 1G5WA 2A8GA 3B2JA 3FEKA 3ZQ3A 1SRHA 3B2KA 3NR3A 4GGZA 3QQ2A 1DFVA 4QNIA 4NV8A 2FKGA 4O3ZA 5IXGA 3HOEA 3APWA 2RTBB 4Y0RA 5FQ8E 3FELA 2ZAIA 4NLIA 1KQWA 3DTQA 1DC9A 2GC9A 3B2IA 1L6MA 2IZKA 4L3RA 4IBAA 1W6FA 2AT0X 4PJ2A 2QOSC 2LA7A 2Z4IA 3PH6A 4MVKA 1HQPA 4I60A 2A13A 1ZNKA 5CYBA 4DNEA 2Z4HA 3F8AA 4GH7A 4KCAA 1EIIA 1SY2A 1E06A 2OYBO 1KFFA 2RCQA 3C78X 4QRLA 1Z24A 4ZCBA 1GT1A 1YP7A 3QKGA 1MM9A 3BSZE 5LJBA 2RTPB 1CBQA 1VWIB 5B27A 4Z28A 3PPTA 1SWNA 5F2BA 4BGFA 2RTKA 3UAQA 1LCZA 3RDQA 2A2UA 2X55A 4A1HA 1IKJA 2A0AA 4IB8A 4B55A 4CPHA 1FDQA 3ZUOA 5F58A 1KT5A 5BVQA 1R0UA 4GDZA 3WZNA 1W4TA 1YWDA 1I05A 4CPHB 4ZHFA 2DJGA 5BVTA 4AZMA 2L9CA 4ORUA 5LJKA 3AKMA 3VG6A 2JN3A 1IIUA 5C0NA 1YIVA 1YWBA 4OEMA 4CDFA 1TOWA 2IZDB 4HPAA 1BSOA 4NYRA 1NQNA 1SA8A 1MX7A 2NNQA 2EU7X 4ZHCA
chains in the Genus database with same CATH topology
2GTFX 3TGBA 1BRQA 2G7BA 4O3XB 1I04A 4GE1A 5L8IA 4QZUA 1GKAA 1VYFA 3B2LA 3ELZA 4EDEA 2OVAA 2RQ0A 2ACPX 4Y0PA 1DZKA 4IMNA 4O49A 3CBSA 5D48A 5F6BA 3TGCA 3CQRA 3S5VA 1GKAB 1N0SA 1KOIA 1OPAA 3EYCA 1DZPA 4KT5A 5D45A 4TKBA 1D3SA 2HLVA 5LKEA 5LJCA 2HYSA 3AKNA 4AZNA 1OBPA 4WHIA 4AYHA 4GNWA 1KT7A 4U8UM 1B4MA 1OBQA 5HCDC 3BS2A 1DF3A 4MVLA 2K62A 1SY1A 5EZ2A 3MBTA 1FE3A 1ALBA 1PMPA 3K3LA 2KTDA 4NW4A 4TQ2A 2GTLM 5JR8A 2X45A 4AZRA 1VYGA 2LBAA 3VE1A 3O22A 1AELA 1X8UA 4LKTA 1E02A 1ZNGA 2FRSA 4I9SA 3D97A 3FMZA 2AT3X 5LJGA 4O3WA 2W2FA 4OS0A 4A8ZA 4I3BA 3OD9A 3U9PC 1EPBA 4N7DA 2CM4A 2WUTA 3P6GA 3FW5A 1SXYA 2KD2A 2X46A 1B0OA 2F09A 2WWPA 3FA6A 3T1DA 1JIWI 3APUA 4A1YA 3KFGA 2ACOA 4MISA 1A18A 3F9DA 1PM1X 4INNA 5BYPA 1OEJA 4QAEA 1KT3A 4PSQA 4QQ1A 5IO6A 4FBRA 4FBVA 1P6PA 3ZZVA 4JGLA 5DG4A 1IKEA 1KXOA 5B29A 2W2BA 3EBWA 3RSWA 1LPJA 2WEWA 3D96A 5FQ6E 4RUUA 2POAA 2FT9A 4IAXA 1U17A 2WR6A 1OEKA 5HCCC 2X8FA 3ZWEA 1BJ7A 1YUPA 4EQAC 2KTSA 2QO5A 3ZW0A 2OVDA 1HMTA 1QABE 4O9SA 2DM5A 4XMEA 2K23A 1X8PA 1KZWA 3D4RA 2QO6A 1BWYA 3ZW0B 1LIBA 5AJBA 2JU3A 3PQUA 2MO5A 4NYQA 3IFBA 4XMGA 1O8VA 5HWZA 1D2UA 3NADA 3S26A 1OPBA 1GXAA 3WJCA 2NNDA 1CJ5A 4GK9A 3STNA 3O19A 1ZNHA 2LBVA 2Q2MA 4EEJA 4OS3A 2FLJA 4GNYA 3UEXA 4ZHDA 2XKLA 3P24A 1AB0A 4YKOA 3SOTA 1ZNDA 4ZR2A 1MX7A 3FA7A 5F1EA 4ORYA 4ORSA 3V8UA 2JOZA 3WVMA 2CZUA 2ASNX 1ZRYA 1ADLA 2BLGA 2LFOA 1GT5A 2G78A 1EQDA 1B56A 3FW4A 5KHPA 1LKEA 4I95A 3ZW2A 1JBHA 5EDBA 1IFCA 3FEPA 1HBQA 4FGIB 4BOEA 4CV7A 4TKJA 4KC8A 4A60A 4YMYA 4M7MA 3L4RA 3SAOA 4TNNA 3N91A 5LJEA 5HA1A 3VG3A 1MVGA 5D47A 2FR3A 3BU9A 4YKMA 3STKA 3FR2A 2JMBA 3E3CA 4UU2A 1JJXA 4ORRA 1SXUA 1T0VA 3LV4A 3KQ0A 4AZQA 1DZMA 4TJZA 3NQ3A 3RBYA 1UREA 1MX8A 4K19A 4YBUA 2X8SA 3S60A 3BY0A 3WJGA 2RD7C 5D8JA 4U3QA 2RCTA 3WJEA 1KGLA 4ORXA 2CM9A 1YP6A 1DZJA 2BT9A 4NP1A 4WBKA 1U18A 2HNXA 4TLJA 1LICA 3U03A 1RLBE 1H91A 1YWCA 2KT4B 3OE3A 2BS6A 3CR6A 3APXA 1KT6A 2FS6A 1BBPA 2OVEA 3CWKA 5HZ6A 1T8VA 2Q9SA 1TW4A 4LZVA 3P02A 3PQSA 1X8OA 5HCEC 3HWDA 4QYNA 2MM3A 4MVEA 5HA0A 3ZUIA 3NQKA 1U0XA 2AL0X 5HTDA 3HOLA 3PP6A 1GM6A 4NLJA 2CBRA 4YH0A 4ZHCA 4ZHGA 5HZ8A 1SXWA 2QM9A 2AKQA 4QYPA 1BSYA 5FENA 2FTBA 4QGXA 5F7GA 4R0BA 4IB6A 1AVGI 1JYDA 1NP1A 2M4LA 3D95A 3HWFA 4KIIA 2ALLX 1A57A 1BEBA 4RUNA 2WQ9A 3RWXA 2GTLN 3KFHA 3WJDA 3TZSA 4XMFA 3VG7A 4FQBB 1HMRA 1QFVA 2AT8X 1TXLA 1FEMA 4D6BA 3JSQA 1JYJA 5AEOA 3VG2A 2IFBA 3PH5A 3VU1A 3FA8A 1LIFA 2ZAGA 3TF6A 3C77X 5EEDA 2ANSA 2HZQA 5KIDA 4MVIA 2RN4A 2MHDA 4YFQA 3STMX 4ZHHA 1SXXA 2QMIA 3BDRA 3CBCA 4U9CA 2W2AA 1IW2A 4YGGA 4EFGA 2WQAE 1GX8A 1CBIA 4DQ4A 5H9AA 1E00A 2O62A 4I6SA 2F73A 3KFFA 5L8NA 2AMMX 1EXSA 3C76X 3FR5A 1QY1A 4HPDA 3KFIA 1GT4A 1DV9A 4YDBA 1QQSA 4YFRA 1LFOA 1X8QA 3TGAA 1OBUA 3FENA 4ALBA 2HZRA 4IMOA 1S2PA 1EPAA 3ZW1A 5LKFA 3WBGA 4BVMA 4GRJA 5DPQA 5LJDA 3I17A 5H9KA 4ODDA 3ZW1B 3U0DA 3GAQA 4BQUA 1YWAA 3FYFA 2CZTA 4GZVA 5K06A 3JQOA 4Y0QA 2L5PA 1ERBA 2KW1A 3Q6LA 4TKHA 1RBPA 2BHVA 4LZUA 1E5PA 2QO4A 3FA9A 3P6HA 1EALA 1ACDA 3RKGA 3ZI8A 2WEXA 3WXQA 1ZNEA 5EDCA 2Q39A 4WFVA 3IA8A 3EM0A 4CK4A 1CRBA 5H8TA 5AJCA 1GT3A 5LJHA 3FR4A 5EPQA 2E4JA 1G74A 3OJYC 4HFOA 5FAZA 3MX7A 1BRPA 3NPOA 3O2YA 3UEUA 1FTPA 4OMXA 5BVSA 4QGWA 2OZQA 3UEWA 1BSQA 4IB7A 1XCAA 5HAEA 4NNSA 3VE2A 4ID2A 4CSBA 4ORWA 5IO7A 1B8EA 1QY0A 1S7DA 1EI5A 1ICNA 1NGLA 4YCEA 3HTYA 1LIDA 4HPBA 2CBSA 3HWGA 4Y0SA 1LIEA 5EEEA 4ZGFA 5KICA 3NX2A 3EMMA 1O1VA 1KT4A 3P6FA 1SY0A 3VG4A 4ARHA 3S5XA 5FQ7E 2OFRX 1HN2A 1T68X 3B2HA 3NP1A 3BRNA 1HBPA 5H9LA 1EUOA 4ML7B 1IFBA 4YGHA 1G7NA 3PEDA 4GU8A 4IAWA 4HWMA 3VPJE 1BLRA 4L1NA 4O3YA 4YFPA 4ZFXA 5IO5A 4LKPA 1AQBA 1JV4A 4EXZA 5FFHA 3UEVA 3CMPA 2FS7A 2JU8A 3CQNA 4O4UA 4ZH9A 2WSJA 4AZPA 2MJIA 3RZYA 1I06A 4D6AA 3I0AA 5HZQA 4ES7A 1FELA 3APVA 1UZ2X 4O4XA 4YBPA 4GETA 2BS5A 3PECA 2FR2A 3NQ9A 1QWDA 3FIQA 2R56A 4FBOA 4HPCA 2MWHA 4I3DA 5L8OA 4ZJ0A 1MUPA 4U8UN 3EBKA 1XKIA 4XMHA 1G85A 2FWVA 2X8TA 1JZUA 2A2GA 3P6DA 3LHNA 1A3YA 3KZAA 2LKKA 4IB9A 3MVFA 4OS8A 1KZXA 1I4UA 1OEEA 1NP4A 1QG5A 1SY3A 3P6CA 4ON1A 1MDCA 1HMSA 3BX7A 5HBSA 2R74A 4ALOA 5HZ5A 1X89A 2OVSA 4LQZA 3HK1A 4ZH6A 4M6SA 2AT5X 1Y9TA 3VG5A 2RA6A 1ZNLA 2L68A 1ERXA 1KQXA 2YG2A 1S44A 3NBXX 3FLLA 1EW3A 2NNEA 1PEEA 3G7XA 1X71A 2XSTA 4KC7A 2L67A 5H9NA 4QGVA 3OBLA 5F6ZA 4XMDA 1CBRA 2GJ5A 3HWEA 2G79A 1LF7A 3BLGA 3P6EA 3NX1A 2NP1A 4QZTA 2A3FX 1VPRA 1PBOA 5HZ9A 1GGLA 2OFMX 4NNTA 5HTEA 4GKCA 4O4OA 1FENA 3BX8A 4I3CA 4AW8A 4DQ3A 1QY2A 1ML7A 1O1UA 3WOVA 2N93A 2HMBA 2PY1A 4N7CA 4YDAA 5AQ6A 1GX9A 2R73A 2JW1A 3BU1A 3DSZA 4U8UO 2LB6A 3GE2A 1LNMA 3WJFA 1BM5A 3H3IA 1SMPI 4MIRA 2P8GA 3WJBA 5D4AA 1ICMA 3F6ZB 1QFTA 1TOUA 2GTLO 2YMSA 2Q4NA 5CE4A 3ELXA 4I9RA 4IABA 4KH8A 1CBSA 4WFUA 4O4SA 1A2DA 4COTA 4YCHA 4YGZA 1EIOA 2Q2PA 2AT6X 4XMCA 1JJJA 3JS1A 4AZOA 1TVQA 2AH7X 4UU3A 1Y9LA 4ZGUA 1G5WA 4OMWA 3B2JA 3FEKA 3ZQ3A 3B2KA 3NR3A 1DFVA 4QNIA 4O3ZA 3HOEA 3APWA 4Y0RA 5FQ8E 3FELA 2ZAIA 4NLIA 1KQWA 3DTQA 1DC9A 2GC9A 3B2IA 1L6MA 4L3RA 4IBAA 2AT0X 4PJ2A 2QOSC 2LA7A 2Z4IA 3PH6A 4MVKA 1HQPA 5CYBA 2A13A 1ZNKA 2Z4HA 3F8AA 4GH7A 4KCAA 1EIIA 1SY2A 1E06A 2RCQA 3C78X 4QRLA 1Z24A 4ZCBA 1GT1A 1YP7A 3QKGA 3BSZE 5LJBA 1CBQA 5B27A 3PPTA 3UAQA 4A1HA 2A2UA 1IKJA 2A0AA 4IB8A 1FDQA 3ZUOA 5F58A 1KT5A 5BVQA 1R0UA 4GDZA 1YWDA 1I05A 4ZHFA 5BVTA 4AZMA 2L9CA 4ORUA 5LJKA 3AKMA 3VG6A 2JN3A 1IIUA 5C0NA 1YIVA 1YWBA 1TOWA 4HPAA 1BSOA 4NYRA 1X8NA 1SA8A 2JU7A 2NNQA 2EU7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTF X;  3TGB A;  1BRQ A;  2G7B A;  1I04 A;  4GE1 A;  5L8I A;  4QZU A;  1GKA A;  1VYF A;  3B2L A;  3ELZ A;  4EDE A;  2OVA A;  2RQ0 A;  2ACP X;  4Y0P A;  1DZK A;  4IMN A;  5D48 A;  3CBS A;  5F6B A;  3TGC A;  3CQR A;  1GKA B;  1N0S A;  1KOI A;  1OPA A;  3EYC A;  1DZP A;  5D45 A;  4TKB A;  1D3S A;  2HLV A;  5LKE A;  5LJC A;  2HYS A;  3AKN A;  4AZN A;  1OBP A;  4AYH A;  4GNW A;  1KT7 A;  1B4M A;  1OBQ A;  5HCD C;  3BS2 A;  1DF3 A;  4MVL A;  2K62 A;  1SY1 A;  5EZ2 A;  3MBT A;  1FE3 A;  1ALB A;  1PMP A;  3K3L A;  2KTD A;  4TQ2 A;  5JR8 A;  2X45 A;  4AZR A;  1VYG A;  2LBA A;  3O22 A;  1AEL A;  1X8U A;  4LKT A;  1E02 A;  1ZNG A;  2FRS A;  4I9S A;  3D97 A;  3FMZ A;  2AT3 X;  5LJG A;  2W2F A;  4OS0 A;  4A8Z A;  4I3B A;  3U9P C;  1EPB A;  4N7D A;  2CM4 A;  2WUT A;  3P6G A;  3FW5 A;  1SXY A;  3FA6 A;  2X46 A;  1B0O A;  2WWP A;  3T1D A;  3APU A;  4A1Y A;  3KFG A;  2ACO A;  1A18 A;  3F9D A;  1PM1 X;  1OEJ A;  4QAE A;  1KT3 A;  4PSQ A;  5IO6 A;  1P6P A;  5DG4 A;  1IKE A;  1KXO A;  5B29 A;  2W2B A;  3EBW A;  3RSW A;  1LPJ A;  2WEW A;  3D96 A;  4RUU A;  2POA A;  2FT9 A;  4IAX A;  1U17 A;  2WR6 A;  1OEK A;  5HCC C;  1BJ7 A;  1YUP A;  2QO5 A;  2OVD A;  1HMT A;  1QAB E;  4O9S A;  2DM5 A;  4XME A;  2K23 A;  1X8P A;  1KZW A;  2QO6 A;  1BWY A;  1LIB A;  2JU3 A;  4NYQ A;  2MO5 A;  4XMG A;  3IFB A;  5HWZ A;  1O8V A;  1D2U A;  3NAD A;  3S26 A;  1OPB A;  1GXA A;  3WJC A;  2NND A;  1CJ5 A;  3STN A;  3O19 A;  1ZNH A;  2LBV A;  2Q2M A;  4EEJ A;  4OS3 A;  2FLJ A;  4GNY A;  3UEX A;  4ZHD A;  2XKL A;  4YKO A;  1AB0 A;  1ZND A;  4ZR2 A;  1MX7 A;  3FA7 A;  5F1E A;  4ORY A;  4ORS A;  3WVM A;  2JOZ A;  2CZU A;  2ASN X;  1ZRY A;  1ADL A;  2BLG A;  2LFO A;  1GT5 A;  2G78 A;  1EQD A;  1B56 A;  3FW4 A;  5KHP A;  1LKE A;  1JBH A;  5EDB A;  1IFC A;  3FEP A;  1HBQ A;  4BOE A;  4TKJ A;  4A60 A;  4YMY A;  4M7M A;  3L4R A;  3SAO A;  4TNN A;  5LJE A;  5HA1 A;  3VG3 A;  1MVG A;  5D47 A;  2FR3 A;  3BU9 A;  4YKM A;  3STK A;  3FR2 A;  4UU2 A;  1JJX A;  4ORR A;  1SXU A;  1T0V A;  3KQ0 A;  4AZQ A;  1DZM A;  4TJZ A;  3NQ3 A;  1URE A;  1MX8 A;  4K19 A;  4YBU A;  3BY0 A;  3WJG A;  2RD7 C;  5D8J A;  3WJE A;  2RCT A;  1KGL A;  4ORX A;  2CM9 A;  1YP6 A;  1DZJ A;  4NP1 A;  4WBK A;  1U18 A;  2HNX A;  4TLJ A;  1LIC A;  3U03 A;  1RLB E;  1H91 A;  1YWC A;  2KT4 B;  3CR6 A;  3APX A;  1KT6 A;  2FS6 A;  1BBP A;  2OVE A;  3CWK A;  5HZ6 A;  1T8V A;  2Q9S A;  1TW4 A;  4LZV A;  1X8O A;  5HCE C;  3HWD A;  4QYN A;  2MM3 A;  5HA0 A;  3ZUI A;  1U0X A;  2AL0 X;  5HTD A;  3PP6 A;  1GM6 A;  4NLJ A;  2CBR A;  4YH0 A;  4ZHC A;  4ZHG A;  5HZ8 A;  1SXW A;  2QM9 A;  2AKQ A;  4QYP A;  1BSY A;  5FEN A;  2FTB A;  4QGX A;  5F7G A;  4R0B A;  4IB6 A;  1AVG I;  1JYD A;  1NP1 A;  4KII A;  3D95 A;  3HWF A;  2ALL X;  1A57 A;  1BEB A;  4RUN A;  2WQ9 A;  3KFH A;  3WJD A;  3TZS A;  4XMF A;  3VG7 A;  1HMR A;  1QFV A;  2AT8 X;  1TXL A;  1FEM A;  4D6B A;  3JSQ A;  1JYJ A;  3VG2 A;  2IFB A;  3PH5 A;  3FA8 A;  1LIF A;  3TF6 A;  3C77 X;  5EED A;  2ANS A;  2HZQ A;  5KID A;  4MVI A;  4YFQ A;  3STM X;  4ZHH A;  1SXX A;  3BDR A;  3CBC A;  2W2A A;  1IW2 A;  4YGG A;  4EFG A;  2WQA E;  1GX8 A;  1CBI A;  4DQ4 A;  5H9A A;  1E00 A;  2O62 A;  2F73 A;  3KFF A;  5L8N A;  2AMM X;  1EXS A;  3C76 X;  3FR5 A;  1QY1 A;  4HPD A;  3KFI A;  1GT4 A;  1DV9 A;  4YDB A;  1QQS A;  4YFR A;  1LFO A;  1X8Q A;  3TGA A;  1OBU A;  3FEN A;  4ALB A;  2HZR A;  4IMO A;  1S2P A;  1EPA A;  5LKF A;  3WBG A;  4BVM A;  4GRJ A;  5DPQ A;  5LJD A;  3I17 A;  5H9K A;  4ODD A;  3U0D A;  3GAQ A;  4BQU A;  1YWA A;  2CZT A;  5K06 A;  4Y0Q A;  2L5P A;  1ERB A;  3Q6L A;  4TKH A;  1RBP A;  4LZU A;  1E5P A;  2QO4 A;  3FA9 A;  3P6H A;  1EAL A;  1ACD A;  2WEX A;  3WXQ A;  1ZNE A;  5EDC A;  2Q39 A;  4WFV A;  3IA8 A;  3EM0 A;  4CK4 A;  1CRB A;  5H8T A;  1GT3 A;  5LJH A;  3FR4 A;  5EPQ A;  2E4J A;  1G74 A;  3OJY C;  4HFO A;  5FAZ A;  1BRP A;  3NPO A;  3O2Y A;  3UEU A;  1FTP A;  4OMX A;  5BVS A;  4QGW A;  2OZQ A;  3UEW A;  1BSQ A;  4IB7 A;  1XCA A;  5HAE A;  4NNS A;  5IO7 A;  4ORW A;  1B8E A;  1QY0 A;  1S7D A;  4YCE A;  1ICN A;  1NGL A;  1LID A;  4HPB A;  2CBS A;  3HWG A;  4Y0S A;  1LIE A;  5EEE A;  5KIC A;  3NX2 A;  3EMM A;  1O1V A;  1KT4 A;  3P6F A;  1SY0 A;  3VG4 A;  4ARH A;  2OFR X;  1HN2 A;  1T68 X;  3B2H A;  3NP1 A;  3BRN A;  1HBP A;  5H9L A;  1EUO A;  1IFB A;  4YGH A;  1G7N A;  3PED A;  4IAW A;  1BLR A;  4YFP A;  4ZFX A;  5IO5 A;  4LKP A;  1AQB A;  1JV4 A;  4EXZ A;  5FFH A;  3UEV A;  3CMP A;  2FS7 A;  2JU8 A;  3CQN A;  4ZH9 A;  2WSJ A;  4AZP A;  2MJI A;  3RZY A;  1I06 A;  4D6A A;  3I0A A;  5HZQ A;  4ES7 A;  1FEL A;  3APV A;  1UZ2 X;  4YBP A;  4GET A;  3PEC A;  2FR2 A;  3NQ9 A;  1QWD A;  3FIQ A;  2R56 A;  4HPC A;  4I3D A;  5L8O A;  4ZJ0 A;  1MUP A;  3EBK A;  1XKI A;  4XMH A;  1G85 A;  2FWV A;  1JZU A;  2A2G A;  3P6D A;  1A3Y A;  3KZA A;  2LKK A;  4IB9 A;  3MVF A;  4OS8 A;  1KZX A;  1I4U A;  1OEE A;  1NP4 A;  1QG5 A;  1SY3 A;  3P6C A;  1MDC A;  1HMS A;  3BX7 A;  5HBS A;  2R74 A;  4ALO A;  5HZ5 A;  1X89 A;  4ZH6 A;  3HK1 A;  4M6S A;  2AT5 X;  3VG5 A;  2RA6 A;  1ZNL A;  2L68 A;  1ERX A;  1KQX A;  2YG2 A;  1S44 A;  3FLL A;  1EW3 A;  2NNE A;  1PEE A;  3G7X A;  1X71 A;  2XST A;  4QGV A;  2L67 A;  5H9N A;  5F6Z A;  4XMD A;  1CBR A;  2GJ5 A;  3HWE A;  2G79 A;  1LF7 A;  3BLG A;  3P6E A;  3NX1 A;  2NP1 A;  4QZT A;  2A3F X;  1VPR A;  1PBO A;  5HZ9 A;  1GGL A;  2OFM X;  4NNT A;  5HTE A;  4GKC A;  1FEN A;  3BX8 A;  4I3C A;  4AW8 A;  4DQ3 A;  1QY2 A;  1ML7 A;  1O1U A;  2N93 A;  2HMB A;  2PY1 A;  4N7C A;  4YDA A;  5AQ6 A;  1GX9 A;  2R73 A;  3BU1 A;  3DSZ A;  2LB6 A;  3WJF A;  1LNM A;  1BM5 A;  2P8G A;  3WJB A;  5D4A A;  1ICM A;  1QFT A;  1TOU A;  2Q4N A;  5CE4 A;  3ELX A;  4I9R A;  1CBS A;  4WFU A;  1A2D A;  4YCH A;  4YGZ A;  1EIO A;  2Q2P A;  2AT6 X;  4XMC A;  1JJJ A;  3JS1 A;  4AZO A;  1TVQ A;  2AH7 X;  4UU3 A;  4ZGU A;  1G5W A;  4OMW A;  3B2J A;  3FEK A;  3ZQ3 A;  3B2K A;  3NR3 A;  1DFV A;  3APW A;  4Y0R A;  3FEL A;  4NLI A;  1KQW A;  3DTQ A;  1DC9 A;  2GC9 A;  3B2I A;  1L6M A;  4IBA A;  2AT0 X;  2QOS C;  3PH6 A;  4MVK A;  1HQP A;  2A13 A;  1ZNK A;  3F8A A;  4GH7 A;  1EII A;  1SY2 A;  1E06 A;  2RCQ A;  3C78 X;  1Z24 A;  4ZCB A;  1GT1 A;  1YP7 A;  3QKG A;  3BSZ E;  5LJB A;  1CBQ A;  5B27 A;  3PPT A;  4A1H A;  2A2U A;  1IKJ A;  2A0A A;  4IB8 A;  1FDQ A;  3ZUO A;  5F58 A;  1KT5 A;  5BVQ A;  1R0U A;  1YWD A;  1I05 A;  4ZHF A;  5BVT A;  4AZM A;  2L9C A;  4ORU A;  5LJK A;  3AKM A;  3VG6 A;  2JN3 A;  1IIU A;  5C0N A;  1YIV A;  1YWB A;  1TOW A;  4HPA A;  1BSO A;  4NYR A;  1X8N A;  1SA8 A;  2JU7 A;  2NNQ A;  2EU7 X; 
#chains in the Genus database with same CATH topology
 2GTF X;  3TGB A;  2OFB A;  1N43 A;  1BRQ A;  2G7B A;  4O3X B;  1I04 A;  3LTW A;  4GE1 A;  5L8I A;  4QZU A;  1GKA A;  1VYF A;  3B2L A;  3ELZ A;  4EDE A;  2OVA A;  2VFC A;  5IRW A;  2OF9 A;  2RQ0 A;  2ACP X;  1WUB A;  4Y0P A;  1DZK A;  1NQM A;  4IMN A;  3CBS A;  4O49 A;  5D48 A;  5F6B A;  3TGC A;  3CQR A;  3S5V A;  5B2A O;  1GKA B;  1N0S A;  5B5G A;  1KOI A;  1OPA A;  3RY1 A;  3EYC A;  4EKV A;  1DZP A;  4KT5 A;  5D45 A;  4Z27 A;  4TKB A;  1D3S A;  2HLV A;  5LKE A;  5LJC A;  2HYS A;  3AKN A;  4AZN A;  1OBP A;  4WHI A;  4OEL A;  4AYH A;  2OF8 A;  1KT7 A;  3MM0 A;  4GNW A;  4U8U M;  1B4M A;  1OBQ A;  5HCD C;  3BS2 A;  2Y3E A;  1DF3 A;  4MVL A;  2K62 A;  1NC9 A;  1SY1 A;  5EZ2 A;  3MBT A;  1FE3 A;  1ALB A;  1PMP A;  1KL5 A;  2KTD A;  3K3L A;  2RTJ A;  2GTL M;  4NW4 A;  5JR8 A;  2X45 A;  4AZR A;  1VYG A;  2LBA A;  3VE1 A;  1Y55 X;  3O22 A;  1AEL A;  4BX5 B;  1X8U A;  4LKT A;  1E02 A;  1ZNG A;  2FRS A;  4I9S A;  3D97 A;  3FMZ A;  3T2X A;  2AT3 X;  5LJG A;  4O3W A;  2Y3F A;  4BX6 A;  2W2F A;  4OS0 A;  4A8Z A;  2CAM A;  4I3B A;  3OD9 A;  3U9P C;  1EPB A;  4N7D A;  2CM4 A;  1HY2 A;  2WUT A;  3P6G A;  2IZG B;  1RXH A;  3FW5 A;  1SXY A;  2KD2 A;  2X46 A;  1B0O A;  2F09 A;  2WWP A;  3FA6 A;  4GJV A;  3T1D A;  1SRJ A;  1JIW I;  3APU A;  4A1Y A;  3KFG A;  2ACO A;  4MIS A;  4Y5D A;  1A18 A;  4BCS A;  3RE5 A;  3F9D A;  1PM1 X;  4INN A;  1LCV A;  5BYP A;  1OEJ A;  4QAE A;  1KT3 A;  4PSQ A;  3WZP A;  4QQ1 A;  3RDS A;  5IO6 A;  4FBR A;  4FBV A;  3X00 A;  2RTI B;  1P6P A;  4TQ2 A;  3ZZV A;  2OL6 O;  4JGL A;  5DG4 A;  1IKE A;  1JQP A;  3CKG A;  1SLE B;  1KXO A;  5B29 A;  2MF6 A;  2W2B A;  3EBW A;  3RSW A;  2IZF B;  1LPJ A;  2AVI A;  2WEW A;  3D96 A;  5FQ6 E;  1SWJ A;  4RUU A;  2POA A;  2FT9 A;  4IAX A;  3SZH A;  1U17 A;  2WR6 A;  1OEK A;  5HCC C;  1SLF B;  2X8F A;  3ZWE A;  1BJ7 A;  1VWN B;  1YUP A;  4EQA C;  1VWO B;  2KTS A;  2QO5 A;  3ZW0 A;  2OVD A;  1HMT A;  1QAB E;  4O9S A;  2DM5 A;  4XME A;  2K23 A;  3RY2 A;  1X8P A;  1KZW A;  3D4R A;  3EW2 A;  2QO6 A;  2ZSC A;  1BWY A;  3ZW0 B;  1LIB A;  5AJB A;  1VWF B;  2JU3 A;  3PQU A;  2MO5 A;  4NYQ A;  3IFB A;  4XMG A;  1O8V A;  5HWZ A;  3RE6 A;  4CDE A;  1D2U A;  3NAD A;  3S26 A;  1OPB A;  1GXA A;  1E2T A;  2NND A;  2RTF B;  4GK9 A;  3STN A;  3WJC A;  1VWA B;  1CJ5 A;  3O19 A;  1SWB A;  1ZNH A;  1JMZ A;  1RSU B;  2LBV A;  2Q2M A;  4EEJ A;  4Z2O A;  4MEE A;  1VWH B;  4OS3 A;  1STP A;  5HZ8 A;  2FLJ A;  4GNY A;  2C1Q A;  3UEX A;  4ZHD A;  2XKL A;  3P24 A;  1AB0 A;  4JNJ A;  4YKO A;  3SOT A;  1SWQ A;  1ZND A;  4ZR2 A;  1SRI A;  3FA7 A;  5F1E A;  4ORY A;  4ORS A;  1LUQ A;  1Y0G A;  3V8U A;  2JOZ A;  3WVM A;  2ASN X;  2CZU A;  1ZRY A;  1MEP A;  1ADL A;  2BLG A;  2LFO A;  1GT5 A;  2IZJ A;  2G78 A;  1EQD A;  1B56 A;  2X34 A;  3FW4 A;  1LKE A;  4I95 A;  3ZW2 A;  5KHP A;  1JBH A;  4BX7 A;  5EDB A;  2RTL A;  1IFC A;  3FEP A;  1HBQ A;  4FGI B;  5K67 A;  4BOE A;  4CV7 A;  2QOM A;  4TKJ A;  4KC8 A;  1AVE A;  4A60 A;  2OY1 O;  5HTE A;  4BX7 B;  4YMY A;  3VHI A;  4M7M A;  3L4R A;  3SAO A;  4ZHH A;  4TNN A;  3N91 A;  5LJE A;  5HA1 A;  3VG3 A;  1SRF A;  1MVG A;  2GH7 A;  5D47 A;  2FR3 A;  3BU9 A;  2RTD B;  4YKM A;  3SLJ A;  3STK A;  3FR2 A;  2JU7 A;  2JMB A;  3E3C A;  1LCW A;  4UU2 A;  1JJX A;  4ORR A;  1SXU A;  1VWJ B;  5B5F A;  1T0V A;  3LV4 A;  3KQ0 A;  4AZQ A;  1DZM A;  4TJZ A;  3NQ3 A;  2PI3 O;  3RBY A;  1URE A;  1MX8 A;  3PK2 A;  1W5R A;  4K19 A;  4YBU A;  2X8S A;  3S60 A;  3BY0 A;  3VGW A;  3WJG A;  2RD7 C;  3FDC A;  4U3Q A;  2RCT A;  5D8J A;  3WJE A;  1KGL A;  2A5B A;  4ORX A;  2CM9 A;  1YP6 A;  1DZJ A;  4BJ8 A;  3PDF A;  2BT9 A;  4NP1 A;  4WBK A;  4GD9 A;  1U18 A;  2HNX A;  4TLJ A;  1LIC A;  4Y59 A;  3U03 A;  1RLB E;  1JJU A;  1H91 A;  1YWC A;  2KT4 B;  3OE3 A;  2BS6 A;  2FHN X;  3CR6 A;  3APX A;  1KT6 A;  4C5P A;  2FS6 A;  1BBP A;  2OVE A;  3CWK A;  4BX5 A;  5HZ6 A;  1T8V A;  4CPE A;  2Q9S A;  2RTO B;  1TW4 A;  1SWO A;  4LZV A;  3P02 A;  1SWD A;  1X8O A;  3PQS A;  2I5V O;  1SWF A;  5HCE C;  3MG5 A;  3HWD A;  2RTH B;  4QYN A;  2MM3 A;  4MVE A;  1PTS A;  5HA0 A;  3ZUI A;  2UZ2 A;  2OY5 O;  3NQK A;  3WYQ A;  1U0X A;  2AL0 X;  1FJ1 E;  5HTD A;  3HOL A;  3PP6 A;  1GM6 A;  4NLJ A;  2CBR A;  4YH0 A;  1LEL A;  3RDO A;  3SLO A;  1SXW A;  2QM9 A;  2AKQ A;  4QYP A;  1BSY A;  2IZE B;  2RTC B;  4GGT A;  5FEN A;  2FTB A;  4QGX A;  5F7G A;  4R0B A;  1VWE B;  4IB6 A;  1AVG I;  1JYD A;  2IZC B;  1NP1 A;  2M4L A;  3D95 A;  3HWF A;  4KII A;  2ALL X;  4Z2V A;  1SRG A;  1A57 A;  1BEB A;  1X8N A;  4RUN A;  2WQ9 A;  3RWX A;  2GTL N;  3KFH A;  3WJD A;  3WZQ A;  3TZS A;  2OFA A;  4XMF A;  3VG7 A;  4FQB B;  1HMR A;  1QFV A;  2AT8 X;  1TXL A;  3SZI A;  1FEM A;  4D6B A;  3JSQ A;  4JO6 A;  1JYJ A;  5AEO A;  3VG2 A;  1VWM B;  1HQQ A;  1RXJ A;  2IFB A;  3PH5 A;  3FID A;  1SWS A;  5B3M O;  2QCB A;  3VU1 A;  3RDU A;  3FA8 A;  1LIF A;  1UYN X;  2ZAG A;  3KVN A;  3TF6 A;  3C77 X;  2X56 A;  5EED A;  2ANS A;  4CDC A;  2HZQ A;  5KID A;  3CKF A;  4MVI A;  2F01 A;  2X4M A;  5B11 O;  2RN4 A;  2MHD A;  2G5L A;  2HKD A;  4YFQ A;  4CDD A;  3STM X;  2C1S A;  1SXX A;  2QMI A;  3BDR A;  3CBC A;  4U9C A;  2W2A A;  1IW2 A;  1RST B;  4YGG A;  4EFG A;  2WQA E;  1GX8 A;  4Z6J A;  1CBI A;  4DQ4 A;  5H9A A;  1E00 A;  2OL7 A;  2O62 A;  4I6S A;  2F73 A;  1SLD B;  2OL8 O;  1GX3 A;  3KFF A;  5L8N A;  1RAV A;  1EXS A;  2AMM X;  1KL3 A;  1SWP A;  3C76 X;  3FR5 A;  2RTR B;  1QY1 A;  5JD2 A;  3Q34 A;  4HPD A;  3AEH A;  1GT4 A;  3KFI A;  1DV9 A;  4YDB A;  1QQS A;  1N4J A;  5CSE A;  3RDX A;  4YFR A;  1LFO A;  2IZH B;  1X8Q A;  3TGA A;  1OBU A;  3FEN A;  4ALB A;  1VWQ B;  2HZR A;  2WPU A;  4IMO A;  1S2P A;  1EPA A;  3ZW1 A;  5LKF A;  3WBG A;  4BVM A;  4GRJ A;  5DPQ A;  5LJD A;  3I17 A;  2I5Z O;  5H9K A;  4ODD A;  3ZW1 B;  3U0D A;  1MK5 A;  3GAQ A;  4BQU A;  1YWA A;  3FYF A;  1LDO A;  2CZT A;  4GZV A;  5K06 A;  4YVB A;  3JQO A;  4Y0Q A;  2L5P A;  1ERB A;  2KW1 A;  3Q6L A;  4TKH A;  1RBP A;  2BHV A;  4LZU A;  1E5P A;  2QO4 A;  2RTQ B;  3FA9 A;  3P6H A;  1EAL A;  1VWG B;  1ACD A;  3RKG A;  3ZI8 A;  2WEX A;  3WXQ A;  1ZNE A;  5EDC A;  2Q39 A;  4WFV A;  3IA8 A;  1VWB B;  3EM0 A;  4CK4 A;  1SWU A;  4IRW A;  5CHK A;  1CRB A;  5H8T A;  5AJC A;  1GT3 A;  1SWR A;  5LJH A;  3EW1 A;  1STS B;  3FR4 A;  2E4J A;  1G74 A;  3OJY C;  3HPE A;  4HFO A;  5EPQ A;  1HXL A;  3MX7 A;  5FAZ A;  1BRP A;  3NPO A;  3O2Y A;  3UEU A;  1FTP A;  4OMX A;  1N9M A;  5BVS A;  4QGW A;  2UYW A;  2OZQ A;  3RDM A;  3UEW A;  1BSQ A;  5L3Y A;  4IB7 A;  1Y52 X;  1XCA A;  2IZI A;  4ZHG A;  5HAE A;  1K3B A;  4NNS A;  2RTA A;  3VE2 A;  4ID2 A;  4CSB A;  4ORW A;  5IO7 A;  1B8E A;  1QY0 A;  1S7D A;  4NV7 A;  1EI5 A;  1HXZ A;  1ICN A;  1NGL A;  4YCE A;  3HTY A;  1LID A;  4HPB A;  2CBS A;  3HWG A;  4Y0S A;  5K68 A;  4DCB A;  1LIE A;  1NBX A;  3AUM O;  5EEE A;  1SWK A;  4ZGF A;  4U46 A;  5B10 O;  1I78 A;  5KIC A;  1VWK B;  3NX2 A;  3EMM A;  1O1V A;  2IZL B;  1KT4 A;  3P6F A;  1SY0 A;  2FGS A;  3VG4 A;  1WBI A;  4ARH A;  3S5X A;  5FQ7 E;  2IZA A;  1HN2 A;  1T68 X;  2OFR X;  3B2H A;  3T6L A;  4CPI A;  1VWR B;  3NP1 A;  3BRN A;  1HBP A;  5H9L A;  1EUO A;  4Z2P A;  4ML7 B;  1IFB A;  2OY7 A;  4YGH A;  1G7N A;  3PED A;  4GU8 A;  4IAW A;  4HWM A;  3VPJ E;  1BLR A;  2BC3 A;  1SWE A;  2G8C O;  4L1N A;  4O3Y A;  4YFP A;  4ZFX A;  4LKP A;  5IO5 A;  1AQB A;  1JV4 A;  2RTM A;  4EXZ A;  5FFH A;  3UEV A;  3CMP A;  2FS7 A;  1N7Y A;  2JU8 A;  3CQN A;  4O4U A;  4ZH9 A;  2WSJ A;  4AZP A;  4JHQ A;  2MJI A;  3RZY A;  1I06 A;  2X32 A;  1SWC A;  4D6A A;  3I0A A;  5HZQ A;  3SLT A;  1FEL A;  3APV A;  1UZ2 X;  4O4X A;  4ES7 A;  4GET A;  2BS5 A;  4YBP A;  3PEC A;  2FR2 A;  3NQ9 A;  1QWD A;  3FIQ A;  2R56 A;  4FBO A;  1KL4 A;  2MWH A;  2VFB A;  4HPC A;  4I3D A;  3WYP A;  5L8O A;  2IZB A;  4ZJ0 A;  1MUP A;  4U8U N;  3EBK A;  1VWC B;  1XKI A;  4XMH A;  1G85 A;  2FWV A;  2X8T A;  1JZU A;  2A2G A;  3P6D A;  1SWT A;  3LHN A;  2JGS A;  1A3Y A;  3KZA A;  2LKK A;  4IB9 A;  1VWD B;  2RTN B;  2Y32 A;  3MVF A;  4OS8 A;  5IRA A;  1KZX A;  1I4U A;  1OEE A;  5IRU A;  1NP4 A;  1QG5 A;  1SY3 A;  3P6C A;  4ON1 A;  3T2W A;  1MDC A;  2VDF A;  1HMS A;  3BX7 A;  5HBS A;  2R74 A;  4ALO A;  5HZ5 A;  2AF5 A;  1X89 A;  2OVS A;  4LQZ A;  3HK1 A;  1VYO A;  4ZH6 A;  4M6S A;  1Y53 X;  2AT5 X;  1Y9T A;  3VG5 A;  2RA6 A;  1LDQ A;  1OSP O;  1ZNL A;  2L68 A;  1ERX A;  1KQX A;  2YG2 A;  1S44 A;  3NBX X;  3FLL A;  1EW3 A;  2NNE A;  1PEE A;  2RTG B;  3EC5 A;  3G7X A;  1I9H A;  1N9Y A;  1K24 A;  1X71 A;  2XST A;  4KC7 A;  1NDJ A;  2L67 A;  5H9N A;  3SZJ A;  3OBL A;  4BX6 B;  1VWP B;  4QGV A;  5F6Z A;  4XMD A;  1CBR A;  2GJ5 A;  2OY8 A;  3HWE A;  2G79 A;  1LF7 A;  1DF8 A;  3BLG A;  3P6E A;  3NX1 A;  3WZO A;  2NP1 A;  1SWL A;  2A3F X;  4QZT A;  1VPR A;  2C4I A;  4BBO A;  1SRE A;  1PBO A;  5HZ9 A;  1GGL A;  2BSZ A;  2OFM X;  4GDA A;  4GKC A;  4NNT A;  4O4O A;  1FEN A;  3BX8 A;  4I3C A;  4AW8 A;  4DQ3 A;  1QY2 A;  1ML7 A;  1JMX A;  1SWH A;  1IJ8 A;  1AVD A;  2RTE B;  1O1U A;  2FHL A;  3WOV A;  2N93 A;  1SLG B;  1UYO X;  2HMB A;  2PY1 A;  4N7C A;  4YDA A;  5AQ6 A;  1GX9 A;  2R73 A;  2JW1 A;  3BU1 A;  3DSZ A;  4U8U O;  2LB6 A;  3GE2 A;  1LNM A;  3WJF A;  1BM5 A;  1PBY A;  2A5C A;  1SMP I;  3H3I A;  4GJS A;  2P8G A;  4MIR A;  3VHM A;  5D4A A;  3WJB A;  1ICM A;  3F6Z B;  3VHH A;  1QFT A;  1TOU A;  4GUZ A;  2GTL O;  2YMS A;  2Q4N A;  5CE4 A;  3ELX A;  4I9R A;  4IAB A;  4KH8 A;  1CBS A;  1SWG A;  4WFU A;  4O4S A;  1A2D A;  3D9W A;  1MOY A;  4YCH A;  4YGZ A;  4GGR A;  4COT A;  2Q2P A;  2AT6 X;  2FKJ A;  1STR B;  1SWA A;  4XMC A;  1EIO A;  2DJF A;  3JS1 A;  4AZO A;  1VWL B;  1JJJ A;  1TVQ A;  1RXK A;  4CPF A;  2AH7 X;  4UU3 A;  1Y9L A;  4OKA A;  4ZGU A;  3T6F A;  4OMW A;  1G5W A;  2A8G A;  3B2J A;  3FEK A;  3ZQ3 A;  1SRH A;  3B2K A;  3NR3 A;  4GGZ A;  3QQ2 A;  1DFV A;  4QNI A;  4NV8 A;  2FKG A;  4O3Z A;  5IXG A;  3HOE A;  3APW A;  2RTB B;  4Y0R A;  5FQ8 E;  3FEL A;  2ZAI A;  4NLI A;  1KQW A;  3DTQ A;  1DC9 A;  2GC9 A;  3B2I A;  1L6M A;  2IZK A;  4L3R A;  4IBA A;  1W6F A;  2AT0 X;  4PJ2 A;  2QOS C;  2LA7 A;  2Z4I A;  3PH6 A;  4MVK A;  1HQP A;  4I60 A;  2A13 A;  1ZNK A;  5CYB A;  4DNE A;  2Z4H A;  3F8A A;  4GH7 A;  4KCA A;  1EII A;  1SY2 A;  1E06 A;  2OYB O;  1KFF A;  2RCQ A;  3C78 X;  4QRL A;  1Z24 A;  4ZCB A;  1GT1 A;  1YP7 A;  3QKG A;  1MM9 A;  3BSZ E;  5LJB A;  2RTP B;  1CBQ A;  1VWI B;  5B27 A;  4Z28 A;  3PPT A;  1SWN A;  5F2B A;  4BGF A;  2RTK A;  3UAQ A;  1LCZ A;  3RDQ A;  2A2U A;  2X55 A;  4A1H A;  1IKJ A;  2A0A A;  4IB8 A;  4B55 A;  4CPH A;  1FDQ A;  3ZUO A;  5F58 A;  1KT5 A;  5BVQ A;  1R0U A;  4GDZ A;  3WZN A;  1W4T A;  1YWD A;  1I05 A;  4CPH B;  4ZHF A;  2DJG A;  5BVT A;  4AZM A;  2L9C A;  4ORU A;  5LJK A;  3AKM A;  3VG6 A;  2JN3 A;  1IIU A;  5C0N A;  1YIV A;  1YWB A;  4OEM A;  4CDF A;  1TOW A;  2IZD B;  4HPA A;  1BSO A;  4NYR A;  1NQN A;  1SA8 A;  1MX7 A;  2NNQ A;  2EU7 X;  4ZHC A; 
#chains in the Genus database with same CATH homology
 2GTF X;  3TGB A;  1BRQ A;  2G7B A;  4O3X B;  1I04 A;  4GE1 A;  5L8I A;  4QZU A;  1GKA A;  1VYF A;  3B2L A;  3ELZ A;  4EDE A;  2OVA A;  2RQ0 A;  2ACP X;  4Y0P A;  1DZK A;  4IMN A;  4O49 A;  3CBS A;  5D48 A;  5F6B A;  3TGC A;  3CQR A;  3S5V A;  1GKA B;  1N0S A;  1KOI A;  1OPA A;  3EYC A;  1DZP A;  4KT5 A;  5D45 A;  4TKB A;  1D3S A;  2HLV A;  5LKE A;  5LJC A;  2HYS A;  3AKN A;  4AZN A;  1OBP A;  4WHI A;  4AYH A;  4GNW A;  1KT7 A;  4U8U M;  1B4M A;  1OBQ A;  5HCD C;  3BS2 A;  1DF3 A;  4MVL A;  2K62 A;  1SY1 A;  5EZ2 A;  3MBT A;  1FE3 A;  1ALB A;  1PMP A;  3K3L A;  2KTD A;  4NW4 A;  4TQ2 A;  2GTL M;  5JR8 A;  2X45 A;  4AZR A;  1VYG A;  2LBA A;  3VE1 A;  3O22 A;  1AEL A;  1X8U A;  4LKT A;  1E02 A;  1ZNG A;  2FRS A;  4I9S A;  3D97 A;  3FMZ A;  2AT3 X;  5LJG A;  4O3W A;  2W2F A;  4OS0 A;  4A8Z A;  4I3B A;  3OD9 A;  3U9P C;  1EPB A;  4N7D A;  2CM4 A;  2WUT A;  3P6G A;  3FW5 A;  1SXY A;  2KD2 A;  2X46 A;  1B0O A;  2F09 A;  2WWP A;  3FA6 A;  3T1D A;  1JIW I;  3APU A;  4A1Y A;  3KFG A;  2ACO A;  4MIS A;  1A18 A;  3F9D A;  1PM1 X;  4INN A;  5BYP A;  1OEJ A;  4QAE A;  1KT3 A;  4PSQ A;  4QQ1 A;  5IO6 A;  4FBR A;  4FBV A;  1P6P A;  3ZZV A;  4JGL A;  5DG4 A;  1IKE A;  1KXO A;  5B29 A;  2W2B A;  3EBW A;  3RSW A;  1LPJ A;  2WEW A;  3D96 A;  5FQ6 E;  4RUU A;  2POA A;  2FT9 A;  4IAX A;  1U17 A;  2WR6 A;  1OEK A;  5HCC C;  2X8F A;  3ZWE A;  1BJ7 A;  1YUP A;  4EQA C;  2KTS A;  2QO5 A;  3ZW0 A;  2OVD A;  1HMT A;  1QAB E;  4O9S A;  2DM5 A;  4XME A;  2K23 A;  1X8P A;  1KZW A;  3D4R A;  2QO6 A;  1BWY A;  3ZW0 B;  1LIB A;  5AJB A;  2JU3 A;  3PQU A;  2MO5 A;  4NYQ A;  3IFB A;  4XMG A;  1O8V A;  5HWZ A;  1D2U A;  3NAD A;  3S26 A;  1OPB A;  1GXA A;  3WJC A;  2NND A;  1CJ5 A;  4GK9 A;  3STN A;  3O19 A;  1ZNH A;  2LBV A;  2Q2M A;  4EEJ A;  4OS3 A;  2FLJ A;  4GNY A;  3UEX A;  4ZHD A;  2XKL A;  3P24 A;  1AB0 A;  4YKO A;  3SOT A;  1ZND A;  4ZR2 A;  1MX7 A;  3FA7 A;  5F1E A;  4ORY A;  4ORS A;  3V8U A;  2JOZ A;  3WVM A;  2CZU A;  2ASN X;  1ZRY A;  1ADL A;  2BLG A;  2LFO A;  1GT5 A;  2G78 A;  1EQD A;  1B56 A;  3FW4 A;  5KHP A;  1LKE A;  4I95 A;  3ZW2 A;  1JBH A;  5EDB A;  1IFC A;  3FEP A;  1HBQ A;  4FGI B;  4BOE A;  4CV7 A;  4TKJ A;  4KC8 A;  4A60 A;  4YMY A;  4M7M A;  3L4R A;  3SAO A;  4TNN A;  3N91 A;  5LJE A;  5HA1 A;  3VG3 A;  1MVG A;  5D47 A;  2FR3 A;  3BU9 A;  4YKM A;  3STK A;  3FR2 A;  2JMB A;  3E3C A;  4UU2 A;  1JJX A;  4ORR A;  1SXU A;  1T0V A;  3LV4 A;  3KQ0 A;  4AZQ A;  1DZM A;  4TJZ A;  3NQ3 A;  3RBY A;  1URE A;  1MX8 A;  4K19 A;  4YBU A;  2X8S A;  3S60 A;  3BY0 A;  3WJG A;  2RD7 C;  5D8J A;  4U3Q A;  2RCT A;  3WJE A;  1KGL A;  4ORX A;  2CM9 A;  1YP6 A;  1DZJ A;  2BT9 A;  4NP1 A;  4WBK A;  1U18 A;  2HNX A;  4TLJ A;  1LIC A;  3U03 A;  1RLB E;  1H91 A;  1YWC A;  2KT4 B;  3OE3 A;  2BS6 A;  3CR6 A;  3APX A;  1KT6 A;  2FS6 A;  1BBP A;  2OVE A;  3CWK A;  5HZ6 A;  1T8V A;  2Q9S A;  1TW4 A;  4LZV A;  3P02 A;  3PQS A;  1X8O A;  5HCE C;  3HWD A;  4QYN A;  2MM3 A;  4MVE A;  5HA0 A;  3ZUI A;  3NQK A;  1U0X A;  2AL0 X;  5HTD A;  3HOL A;  3PP6 A;  1GM6 A;  4NLJ A;  2CBR A;  4YH0 A;  4ZHC A;  4ZHG A;  5HZ8 A;  1SXW A;  2QM9 A;  2AKQ A;  4QYP A;  1BSY A;  5FEN A;  2FTB A;  4QGX A;  5F7G A;  4R0B A;  4IB6 A;  1AVG I;  1JYD A;  1NP1 A;  2M4L A;  3D95 A;  3HWF A;  4KII A;  2ALL X;  1A57 A;  1BEB A;  4RUN A;  2WQ9 A;  3RWX A;  2GTL N;  3KFH A;  3WJD A;  3TZS A;  4XMF A;  3VG7 A;  4FQB B;  1HMR A;  1QFV A;  2AT8 X;  1TXL A;  1FEM A;  4D6B A;  3JSQ A;  1JYJ A;  5AEO A;  3VG2 A;  2IFB A;  3PH5 A;  3VU1 A;  3FA8 A;  1LIF A;  2ZAG A;  3TF6 A;  3C77 X;  5EED A;  2ANS A;  2HZQ A;  5KID A;  4MVI A;  2RN4 A;  2MHD A;  4YFQ A;  3STM X;  4ZHH A;  1SXX A;  2QMI A;  3BDR A;  3CBC A;  4U9C A;  2W2A A;  1IW2 A;  4YGG A;  4EFG A;  2WQA E;  1GX8 A;  1CBI A;  4DQ4 A;  5H9A A;  1E00 A;  2O62 A;  4I6S A;  2F73 A;  3KFF A;  5L8N A;  2AMM X;  1EXS A;  3C76 X;  3FR5 A;  1QY1 A;  4HPD A;  3KFI A;  1GT4 A;  1DV9 A;  4YDB A;  1QQS A;  4YFR A;  1LFO A;  1X8Q A;  3TGA A;  1OBU A;  3FEN A;  4ALB A;  2HZR A;  4IMO A;  1S2P A;  1EPA A;  3ZW1 A;  5LKF A;  3WBG A;  4BVM A;  4GRJ A;  5DPQ A;  5LJD A;  3I17 A;  5H9K A;  4ODD A;  3ZW1 B;  3U0D A;  3GAQ A;  4BQU A;  1YWA A;  3FYF A;  2CZT A;  4GZV A;  5K06 A;  3JQO A;  4Y0Q A;  2L5P A;  1ERB A;  2KW1 A;  3Q6L A;  4TKH A;  1RBP A;  2BHV A;  4LZU A;  1E5P A;  2QO4 A;  3FA9 A;  3P6H A;  1EAL A;  1ACD A;  3RKG A;  3ZI8 A;  2WEX A;  3WXQ A;  1ZNE A;  5EDC A;  2Q39 A;  4WFV A;  3IA8 A;  3EM0 A;  4CK4 A;  1CRB A;  5H8T A;  5AJC A;  1GT3 A;  5LJH A;  3FR4 A;  5EPQ A;  2E4J A;  1G74 A;  3OJY C;  4HFO A;  5FAZ A;  3MX7 A;  1BRP A;  3NPO A;  3O2Y A;  3UEU A;  1FTP A;  4OMX A;  5BVS A;  4QGW A;  2OZQ A;  3UEW A;  1BSQ A;  4IB7 A;  1XCA A;  5HAE A;  4NNS A;  3VE2 A;  4ID2 A;  4CSB A;  4ORW A;  5IO7 A;  1B8E A;  1QY0 A;  1S7D A;  1EI5 A;  1ICN A;  1NGL A;  4YCE A;  3HTY A;  1LID A;  4HPB A;  2CBS A;  3HWG A;  4Y0S A;  1LIE A;  5EEE A;  4ZGF A;  5KIC A;  3NX2 A;  3EMM A;  1O1V A;  1KT4 A;  3P6F A;  1SY0 A;  3VG4 A;  4ARH A;  3S5X A;  5FQ7 E;  2OFR X;  1HN2 A;  1T68 X;  3B2H A;  3NP1 A;  3BRN A;  1HBP A;  5H9L A;  1EUO A;  4ML7 B;  1IFB A;  4YGH A;  1G7N A;  3PED A;  4GU8 A;  4IAW A;  4HWM A;  3VPJ E;  1BLR A;  4L1N A;  4O3Y A;  4YFP A;  4ZFX A;  5IO5 A;  4LKP A;  1AQB A;  1JV4 A;  4EXZ A;  5FFH A;  3UEV A;  3CMP A;  2FS7 A;  2JU8 A;  3CQN A;  4O4U A;  4ZH9 A;  2WSJ A;  4AZP A;  2MJI A;  3RZY A;  1I06 A;  4D6A A;  3I0A A;  5HZQ A;  4ES7 A;  1FEL A;  3APV A;  1UZ2 X;  4O4X A;  4YBP A;  4GET A;  2BS5 A;  3PEC A;  2FR2 A;  3NQ9 A;  1QWD A;  3FIQ A;  2R56 A;  4FBO A;  4HPC A;  2MWH A;  4I3D A;  5L8O A;  4ZJ0 A;  1MUP A;  4U8U N;  3EBK A;  1XKI A;  4XMH A;  1G85 A;  2FWV A;  2X8T A;  1JZU A;  2A2G A;  3P6D A;  3LHN A;  1A3Y A;  3KZA A;  2LKK A;  4IB9 A;  3MVF A;  4OS8 A;  1KZX A;  1I4U A;  1OEE A;  1NP4 A;  1QG5 A;  1SY3 A;  3P6C A;  4ON1 A;  1MDC A;  1HMS A;  3BX7 A;  5HBS A;  2R74 A;  4ALO A;  5HZ5 A;  1X89 A;  2OVS A;  4LQZ A;  3HK1 A;  4ZH6 A;  4M6S A;  2AT5 X;  1Y9T A;  3VG5 A;  2RA6 A;  1ZNL A;  2L68 A;  1ERX A;  1KQX A;  2YG2 A;  1S44 A;  3NBX X;  3FLL A;  1EW3 A;  2NNE A;  1PEE A;  3G7X A;  1X71 A;  2XST A;  4KC7 A;  2L67 A;  5H9N A;  4QGV A;  3OBL A;  5F6Z A;  4XMD A;  1CBR A;  2GJ5 A;  3HWE A;  2G79 A;  1LF7 A;  3BLG A;  3P6E A;  3NX1 A;  2NP1 A;  4QZT A;  2A3F X;  1VPR A;  1PBO A;  5HZ9 A;  1GGL A;  2OFM X;  4NNT A;  5HTE A;  4GKC A;  4O4O A;  1FEN A;  3BX8 A;  4I3C A;  4AW8 A;  4DQ3 A;  1QY2 A;  1ML7 A;  1O1U A;  3WOV A;  2N93 A;  2HMB A;  2PY1 A;  4N7C A;  4YDA A;  5AQ6 A;  1GX9 A;  2R73 A;  2JW1 A;  3BU1 A;  3DSZ A;  4U8U O;  2LB6 A;  3GE2 A;  1LNM A;  3WJF A;  1BM5 A;  3H3I A;  1SMP I;  4MIR A;  2P8G A;  3WJB A;  5D4A A;  1ICM A;  3F6Z B;  1QFT A;  1TOU A;  2GTL O;  2YMS A;  2Q4N A;  5CE4 A;  3ELX A;  4I9R A;  4IAB A;  4KH8 A;  1CBS A;  4WFU A;  4O4S A;  1A2D A;  4COT A;  4YCH A;  4YGZ A;  1EIO A;  2Q2P A;  2AT6 X;  4XMC A;  1JJJ A;  3JS1 A;  4AZO A;  1TVQ A;  2AH7 X;  4UU3 A;  1Y9L A;  4ZGU A;  1G5W A;  4OMW A;  3B2J A;  3FEK A;  3ZQ3 A;  3B2K A;  3NR3 A;  1DFV A;  4QNI A;  4O3Z A;  3HOE A;  3APW A;  4Y0R A;  5FQ8 E;  3FEL A;  2ZAI A;  4NLI A;  1KQW A;  3DTQ A;  1DC9 A;  2GC9 A;  3B2I A;  1L6M A;  4L3R A;  4IBA A;  2AT0 X;  4PJ2 A;  2QOS C;  2LA7 A;  2Z4I A;  3PH6 A;  4MVK A;  1HQP A;  5CYB A;  2A13 A;  1ZNK A;  2Z4H A;  3F8A A;  4GH7 A;  4KCA A;  1EII A;  1SY2 A;  1E06 A;  2RCQ A;  3C78 X;  4QRL A;  1Z24 A;  4ZCB A;  1GT1 A;  1YP7 A;  3QKG A;  3BSZ E;  5LJB A;  1CBQ A;  5B27 A;  3PPT A;  3UAQ A;  4A1H A;  2A2U A;  1IKJ A;  2A0A A;  4IB8 A;  1FDQ A;  3ZUO A;  5F58 A;  1KT5 A;  5BVQ A;  1R0U A;  4GDZ A;  1YWD A;  1I05 A;  4ZHF A;  5BVT A;  4AZM A;  2L9C A;  4ORU A;  5LJK A;  3AKM A;  3VG6 A;  2JN3 A;  1IIU A;  5C0N A;  1YIV A;  1YWB A;  1TOW A;  4HPA A;  1BSO A;  4NYR A;  1X8N A;  1SA8 A;  2JU7 A;  2NNQ A;  2EU7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...