4PSVA

Mycobacterium tuberculosis reca phosphate bound room temperature structure i-rt
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
311
Chain Sequence
b'PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 96
structure length 311
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4psvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4psvA01
4R7ZA 4Q00A 1NJFA 3NEJA 1X8JA 3TSZA 3ZGXA 2QBYB 1VPLA 2IYSA 1NJGA 2ZJZA 3W6PA 4A8JC 1NLYA 1CJTC 1NBMD 4DXAA 3KUDA 4OHWA 4EIWA 3RS4A 4ZPXA 1XEWY 5EXXA 1JALA 1HT2E 1R6BX 2ATXA 4IRUB 2GZAA 4OQFA 1NSFA 5KNDA 1GDDA 3LH5A 2OEPA 3RNLA 2C8VA 3AQ4A 4DLWA 3TR5A 4D82A 2D06A 1J2JA 1H8EA 5FL3A 3WYAA 1FUUA 2WMOB 2ERYA 4G5GA 4BFUA 3R9IA 3TMKA 5EXPA 2O8EA 4R2IA 2NMVA 1MABB 2TMKA 3PITA 2XZPA 1D2MA 2X8AA 2GEVA 1JAHA 2EFEB 3CF2A 1VCIA 2J7KA 2QY9A 1IAQA 3NG1A 1X8KA 2BKEA 2I3BA 3VU9B 2QP4A 3SR0A 1TAGA 2V55B 3LD9A 3RRMA 4CGZA 2FJUA 5ANRB 2QTFA 1SGWA 2N46A 1OH5A 2G9NA 3H1TA 1Z63A 2NGRA 2IXEA 4BLTA 2GILA 1JNYA 3A4MA 1NN0A 3RRNA 3V9PA 1ZAKA 3AF4A 1FMLA 1N0VC 4CVNA 2VHCA 2OUKA 4RD4A 3X2SA 1Z07A 1IY1A 3FFAA 3EPHA 4OK5A 4ZI2A 2QQEA 1XXHA 1DADA 4QM6A 1XMIA 2GCOB 5FOSA 4TLBA 3DMDA 4B71A 1OE0A 3V4RA 4D4MA 1UEJA 3K0SA 3B1ZA 1UKYA 4D6PA 1FX0B 4OHVA 1OFTA 2NO1A 2QMUA 2QTHA 2HDNB 1W5SA 3HJNA 1C9KA 3QOFA 3RHFA 5JWOA 3ETLA 2EFCB 5FUYA 3CR7A 1R8QA 3VR1A 1E0AA 1ZM3A 2NG1A 3QKTA 4KVAA 4PTLA 1KI6B 2Z4SA 2XXAA 1P9NA 5AWFC 1UAAA 5DSZA 1XXHB 2PZFA 3FKSA 1MH1A 4US0R 4DIDA 1WBBA 5JWHA 3BIFA 3Q85A 4A15A 2PEYA 5AUOB 1M7BA 2VSFA 3I73A 4A36A 1OXSC 1Q0UA 3W3AA 2BCJQ 5EE5B 4G5RA 1GITA 4WAUA 3I8XA 2YJTD 1WCV1 1RRCA 2BEKA 2JAQA 2VHTA 3QKSA 1V43A 2REBA 4KCGA 3BS4A 4RKFA 4W9MC 1XZPA 1KO5A 1NMXA 2E87A 3B1WA 2PZEA 1D2NA 4HDOB 2OCAA 2Z0MA 2C03A 1SXJA 1GKUB 3P4XA 2CLDX 1VHTA 3ND8A 2GWHA 1NIJA 1XEXA 4Q4JA 2REOA 5DIFA 2YOFA 1MABA 2G1KA 1UF9A 1KSGA 2F1HA 4RD6A 4URZR 4LPKA 3WMGA 4LJ6A 1NIPA 3EW9A 2KE5A 2D7CA 3LFUA 4IDOA 2AKYA 4B44A 3C4JA 4Q1AA 1I2DA 1CXZA 2RB4A 2PT5A 2LKDA 3CH4B 4O25A 3V4FA 5KNCA 5JRJA 2AHOA 5FOUA 4RFSA 1IOZA 1HURA 4TQUS 5K8TA 4A0HA 3U7FB 3BAFA 3ZD7A 3LRPA 4PANA 4RZUA 3B9QA 4TLCA 1O3YA 4A2QA 2EFGA 1HT1E 4WXRA 3IIKA 1XEXB 4C0LA 1OYYA 4M9SA 2AX4A 2IWHA 4Z51A 3SQXA 2F6RA 1ZIOA 1G5RA 4NYJQ 3W90A 2G0TA 3CM0A 2ZRAA 3K70C 2CNWD 4D4LA 2WZQA 2ZE5A 1L7VC 5FPTA 2WPDD 4JLKA 1NLFA 3SYNA 2ZVQX 1IY0A 2UKDA 4Q4JB 1IONA 5H70A 1SVMA 4TMVA 1D9ZA 1FMJA 3PVSA 1AQYA 4P4SA 1ELOA 3AUXA 1FQJA 4BFVA 4UNPA 2VL7A 4A0FA 2ORVA 2IHBA 5BN3A 1KJYA 4C0QC 1NKTA 3B78A 3RYTC 1Z08A 4GZMA 1EX6A 4QHYA 2BBWA 5KOYA 5GJCA 5FBLB 4C3ZA 2ZJ2A 4F91B 1ODFA 4IFBA 2ZR7A 1TADA 1N3BA 2PX0A 4C2UA 3TLXA 1NY5A 3GLIB 4FINA 1IN6A 1N25A 3QKRB 2PJRA 3RANA 2GJ9A 1OIXA 3U6KA 3ZVNA 1SVWA 2ERXA 3NH9A 3Q5EA 1T9HA 5FBRB 4Z54A 3VR4A 4D81A 2RKOA 2YOHA 3BERA 1E98A 4NYIQ 4FMCF 2FZ4A 4XOIA 2OLJA 4QG7A 2VP5A 3CRMA 1CKEA 4YMTA 2FG5A 4Q02A 3QEJA 3TVDA 3CRRA 1D8TA 4NMMA 4QJ3A 4JJZA 5BN5A 2VTKA 3I1FA 3L0IB 3CWQA 1TPZA 1P75A 4MYTA 1NVVR 2UVQA 2WWYA 2BMDA 3U7GA 3REFA 5TY0A 3NBYC 4QHTA 2C99A 1E32A 3FHOA 2FH5B 3QF4B 3TQCA 4V0NA 4C9BA 1JAIA 1GILA 2J3EA 1FTNA 221PA 2ZAMA 2F7SA 1OKKD 4ESHA 2UZIR 4Z8XA 1TL7C 4LJ5A 2QP3A 3BE4A 2ZRGA 5JZVA 4UNSA 2ZSDA 4V0OA 1M6NA 3WBJA 2NQ2C 1ZM4A 4TMXA 4EDHA 4URWR 4D80A 4DLYA 4DWJA 2QMEA 4OHYA 4MA4A 5JCZA 1NRJB 4BFWA 2PCLA 2R9VA 2X1VA 3UMRA 1EGAA 1NY6A 2WMNB 3E5HA 1E2LA 3GJ7A 3EIQA 1F2TB 3DM5A 2RHMA 2VPPA 3K0CA 1OIVA 4GBMA 1R4AA 5H8WA 1G19A 4L9WA 2ZJAA 2H92A 3LWNA 1XF9A 2GAAA 2PCJA 3U44B 3EARA 2OZEA 2N1BA 4KBFA 2GVZC 4NPHA 1RPZA 1NG9A 4HSEA 2XJ9A 4XSGA 1XMSA 1TF7A 4QGGA 1EK0A 3OAAD 4Q4LA 4FXPA 1U0HC 4ERNA 4EPRA 2VP4A 2P5TB 4F7WA 4ILEA 4BPBA 1QHIA 1VYUA 4Q7LA 3GLGA 1U2RA 2IS1A 1SKQA 4YDHB 3NEYA 3CLVA 1AJEA 2WJYA 2IYWA 3JVVA 4IDQA 1N0UA 1GNRA 3L0OA 2PBRA 4WA7A 4B75A 3E2IA 1LNZA 5FR1A 4HB0A 4P33A 2HCJB 2VHJA 3QQ5A 1N6RA 5DNYB 1G16A 1HUQA 3ZQ6A 4D0GA 4PPFA 3AF1A 3QBTA 3GP8A 4AWXA 4BZXA 3EPJA 4OQLA 2QTVB 1UFQA 5EUQB 3VR6A 4LBWA 3X1ZA 2ZSFA 4I99A 3BH0A 3H86A 2ZRJA 3NC1C 4ZO4A 2OESA 1TF2A 1W46A 2O8CB 1NVWQ 1ZUHA 4LUCA 2WICA 4PQYA 1T3LA 3GFPA 2AWOA 3OE7A 3TAHA 5KPJA 4O3MA 3C15C 4ZIRB 4OI2A 4M1WA 5SZHB 4MRPA 2C9OA 4Q1EA 2HJVA 1Z0JA 2Q0HA 4PHHA 1W36C 3FGNA 4HLCA 1E2KA 3CR8A 2A5YB 3NC0C 1KGDA 1LS1A 4B35A 4LJ8A 1XEFA 2V6IA 5CM9C 3F5FA 3LBHA 3AP1A 3BH6A 1I4LD 5G41A 1Z0DA 3GEHA 4YLGA 2A78A 1TEVA 4CEJA 2KWIA 3FPAA 4DLTA 1YZQA 5HE9A 4JYCA 3GLGE 4Q7MB 2H7VA 3PV0A 2JLYA 2P6RA 2GXQA 2OV2A 2RGNA 2OXCA 4LC1A 1ZCBA 3CKLA 4PX9A 1JJ7A 1UADA 2V7QD 1KY3A 3PR1A 4Q4HA 1U99A 2OSBA 1KKLA 3D8BA 3VHLB 5DI3A 1SHZA 5KU1A 4AY2A 3S1AB 1E9CA 4IEIA 1KI6A 3V00A 4X8MA 3IO5A 4EPVA 3MFYA 4XVRA 1NN3A 4IOKA 1JPJA 2IEZA 3AKYA 3F8TA 3LW8A 4QGHA 4AG5A 4BFYA 4Z8YA 1BIFA 3CWZA 2QAGC 3UWKA 3OIYA 2OAQ1 3CF0A 3KKOA 3T15A 4ARZB 3I61A 1T3SA 4B2IA 3D6TB 1YZNA 4LHYA 3MWJA 3T1OA 2IYQA 3UK6A 4ASUA 1F3OA 1GM5A 3CPHA 1UDWA 2QE7A 3F0TA 1E2DA 2ZTSA 1XZQA 4TZ6A 3QXJA 5CLQA 2HUPA 3CBQA 3FVQA 1UBGA 3HYRA 4DIEA 2IXGA 3SYKA 2O0KA 4HZUB 2O52A 5DYIA 4L9SA 5HPYB 1TQDA 3CF6R 5CM8B 4U7DA 1GNPA 1GG2A 4KJZA 4Y0VA 5KPDA 4PQRA 2CK3D 4N1AA 4PQFA 1OSNA 4IOMA 3SBEA 3RRZA 1MV5A 4K8OA 2ODBA 4P4UA 4QGAA 3VQTA 2OILA 1P61B 1SVKA 3EG5A 3A37A 3GJ6A 2BBOA 5JWRA 2R6CA 4HLQB 3VNVA 2ONKA 3KXLA 3QPWA 5K8IA 4A2WA 2IYYA 1NVUQ 1UBFA 4MUAA 1QHSA 1AM4D 2YHSA 2IUUA 2HLDD 4BLRA 2YKGA 2F55A 4EFMA 4EPXA 1K8RA 1PLJA 4HUQA 4MYCA 4KODA 3TVTA 5EZ6B 5TV2A 3U3JA 5F9FA 3THWB 2V8OA 4DCSA 3QXSA 4FMDF 3EXAA 4JBXA 4M1YA 2FV8A 4JYBA 4TTQA 1G8YA 3IHWA 4HLUA 3TKLA 4OBEA 4ON9A 2FPMA 8OHMA 4N0DA 2CBZA 3CZPA 4OI0A 1KZ7B 1NNEA 5FTMA 2ZRDA 1TMKA 5JECA 2H1LA 3B1YA 4KSBA 5FL7D 2GZDA 2QM7A 1EFUA 2VP2A 3GQBA 3PG5A 4QBIA 2FEOA 1E9DA 2D2EA 1RW4A 2J0UB 4C0HA 1IJFA 3NBZC 4JKIA 2QSZA 3TRFA 2J46A 1AN0A 1EFHA 5LD2B 4O2RA 3W6OA 4B3DA 3KFVA 3K9GA 1R8SA 1UBCA 1DAMA 4RD2A 2VF7A 4MQBA 3RS0A 4V0KA 5FH9A 4DC9A 1V5WA 1W36B 1G7RA 3TIFA 2PL3A 1KK1A 1TEXA 3FDIA 3U5ZB 4FIDA 3GMTA 2EYUA 4POAA 1UDXA 2DWOA 1G4UR 5FUXA 4RCYA 1GWNA 2OCPA 2JDIA 3I5YA 3UIEA 4XTCS 2OM2A 3KJIA 5DHFA 1G3RA 4NONA 1QRAA 4XD7A 2DY1A 4RD1A 4UXJA 2FFHA 3BJIC 1E79A 4GSYA 5GJVC 5JLJA 4LYAA 3SJZA 2RMKA 4A9AA 4ZV4A 5HZKA 4C0JA 1R5NA 4PC1A 4M1SA 2WJIA 4JL5A 2ZSEA 1E9RA 2HEIA 4WOPA 4PHGA 1VG1A 2F9LA 3BH7A 3WRXC 1DS6A 4L4UA 3EASA 3K53A 3K09A 2NO7A 1RRGA 1GAJA 1HEIA 1OW3B 2CHVA 1KMHA 1NMYA 3CNNA 3OE7D 2AD5A 2VRWA 5JJKA 2FDCA 1HTWA 3KTAB 4HEJA 3R20A 1JR6A 3ONWA 2V6JA 4OQNA 1U9IC 3SZRA 4TLAA 4R98A 4PR0A 3W5JA 5BYKA 2GTPA 5GADl 1J99A 1GRNA 2ZYWX 1AIPA 2ORIA 3UMFA 1ESNA 1P7CA 1Z6AA 1IJEA 1W48A 2IYUA 2QA5A 2Z43A 4MGKR 1P73A 5FR2A 5JRZA 3IGFA 2QRNA 3BFVA 3WY9A 1T8TA 4IVQA 1NKSA 1FNMA 1XD2B 2QN6A 4EJSC 2J87A 4RY2A 3KTAA 1PV4A 1WE2A 3GFOA 821PA 3IBGA 3FMOB 1Q20A 3KZ1E 4PO9A 3DOEA 4TN1A 2W83A 2R2AA 2ZR0A 4C0KA 2YOGA 5HCNA 1U98A 1GUAA 5EE0A 3MCAA 1IBRA 1G3IA 3D7MA 1G8PA 4IFEA 4M22A 2ZI5A 1CLUA 4BRWA 1YZLA 2ZR9A 2MSDB 1KDPA 5K8LA 2J9RA 2OFWA 3K8YA 2F43A 4G5SA 4CEHA 3AF3A 4TYQA 5HZHA 3R8FA 2GK7A 4QNMA 1XU4A 1S2MA 2J0VA 4U02A 3ADCA 3QSYA 1QHYA 1N2CE 2JATA 2DFNA 4TT3A 2C95A 5TVKA 2KBFA 1CR1A 2ZRFA 1QHXA 1SXJC 4Q7JB 2IS6A 2C5LA 1E9BA 3BB1A 4JLBA 5G3YA 2VP0A 1CR0A 2ZSBA 3REGA 3T5DA 1KY2A 1Z0FA 2CVFA 3QEOA 2V1UA 3LXXA 2QENA 3SQWA 1KO4A 2ODWA 3DEFA 1GRQA 3SE0A 2ZJBA 3R7WB 3RRYA 2VH5R 1AGPA 4LI0A 5J47A 4A1FA 3DZ8A 1XXHE 3KQNA 4B2LA 2Q9BA 3GLHE 4PC7A 1JI0A 4FD2A 2P67A 1E99A 3ECCA 3KDSE 2R8RA 2A5DA 3TW8B 1A7JA 3HU2A 5FOVA 2FFAA 3AKCA 1KYIA 2MSCB 5HKKD 2IS2A 4TTPA 4MITA 5FL7A 5BW8A 4A2PA 2WJHA 2FSHA 4AK9A 3GEIA 5IT5A 2WAXA 1E1QA 1G6OA 4A6PA 2DB3A 2XSZA 3U3OA 2JLVA 1DO2A 1DARA 2J1LA 3FTQA 2AD1A 4M0LA 3UATA 1DE0A 2FNAA 1R7RA 2NO6A 3KQLA 1JEEA 1MO6A 2BMEA 3WHLA 1UPTA 4B3BA 3FMFA 4V02A 3LBNA 2JEOA 3K09C 1FOEB 2JGNA 3Q8XB 2IBMA 3TSOA 2QMOA 3ZIAA 1DPFA 4H1VA 4F92B 1LTQA 4Y0AA 3QY0A 4JLJA 4WZBE 1XD8A 2AXPA 2ZRPA 4LJ9A 1E2IA 3HDTA 4LPSA 4BWYA 4EFNA 4AYWA 1JR3E 1EESA 4FMDB 2MMCA 3OF5A 1E9AA 5TXGA 4F93B 2X2FA 2ZS7A 3WNCA 1S3SA 2CLCX 4PAOA 3WNDA 5JJLA 3CNLA 2OBLA 3ADBA 1RRPA 2W2VA 4BLQA 1F60A 3LLMA 3NTUA 4M1KA 2PEZA 3CPJB 3G5UA 3LBIA 4OKSA 3WMEA 4BFXA 1ZUIA 2OCYC 3AVQA 2ODNA 1E0SA 5GVRA 1E2GA 4TYNA 4CEJB 1PVOA 2P65A 1PUJA 1R0ZA 2AWNA 2QU8A 4CZ2A 2ZJYA 4MDFA 1NBME 1W4AA 3HP1A 4D25A 4JS0A 4PC2A 1I4DD 3A1TA 3MUFA 1P9WA 2QRZA 5CYOA 1XPRA 2R65A 1P60A 4FMCB 4RFVA 4ESVA 2XGJA 1W49A 1E2NA 3EZ7A 2IYLD 3VR2A 2D2FA 3GJ0A 4MKGA 2D7DA 4OK6A 1KAOA 2ZUBA 4URYR 1OFUX 3DOFA 3PEUA 1XCGB 4IEEA 4M9QA 3RAPR 3OIWA 4OK3A 4DLRA 3QF7A 3OEED 4WBSA 1XB2A 1MO4A 4P0TA 5LB2A 4JLOA 4TMZA 3NBXX 1Z3IX 2RGXA 4TL8A 5FOWA 2FSIA 4RD3A 1G7TA 1KK0A 3ND9A 1XEWX 1MKYA 1PLLA 2ZE7A 1RJ9A 2ZI3A 3PQCA 4AYTA 1ZP6A 3SBDA 1B0UA 3AVOA 3EAQA 4E09A 4B43A 4TSFA 4GZLA 3KJEA 4IOJA 2Q9AA 1X1SA 1ZM9A 3O8RA 5J4LA 4MH0R 3UWOA 2WWXA 1QG2A 2ZE6A 5ELXA 1UKVY 1S9DA 2GNOA 2IS4A 2HYDA 5JMTA 3QG1A 5GJWC 2ZI7A 4TZ0A 3QG5A 3WNBA 4LBZA 4QJ4A 2WSSA 4M9ZA 1E1RA 1ONBA 4TYPA 2F1IA 3M4YA 2A5GA 4Q4AA 2IX3A 2BMFA 4HB3A 4HZIA 1LF5A 2JLWA 2XTNA 4EQ6A 2D62A 2O8BB 2LWIA 3BBPA 5JI3E 1EWQA 4KHZA 3T5GA 4L16A 4XD7D 3SJAA 3WP1B 2XOKA 1G291 1OJLA 1UJ2A 4BFTA 4DEYA 2QROA 4OYHA 1GKYA 1BS1A 1G17A 1N6HA 1OIWA 2Z4RA 3AKEA 3RWOA 2ZJ8A 2GKSA 1IN7A 3J81k 2PLRA 1HV8A 4Q1BA 5FPSA 2NZJA 2JLQA 3EZFA 4HAYA 2PH1A 1QBKC 3SS8A 4NCHA 5JHGB 3IQXA 3BGWA 2DWQA 1VYVA 3GD7A 3MG9A 4V0MA 3B8HA 3LLUA 5EZ5A 2IK8A 5KDOA 2MSEB 2AR7A 5H68A 4GMXA 3M0EA 4PAMA 1F48A 2C96A 1WMSA 4FCWA 4HB2A 5B30A 1X3SA 4WIAA 1Z83A 3Q3JB 2ZIAA 3I3SR 3AEZA 4R2HA 5E7IA 1E2HA 1KHTA 4LHWA 1A5TA 3U2QA 4ZKEA 1RVDA 3VKWA 1ZU5A 2XSZD 3T1TA 2OXRA 5C4MA 5KDDA 2V3CC 2R62A 4E03A 4KYIB 3LX5A 2OLKA 1BMFA 1E2QA 2NOAA 2ZJOA 1DAEA 1H8HD 3RABA 4GMDA 4TL9A 4MUBA 1G7CA 2DPXA 4LDJA 2W6JA 1FP6A 1E0JA 1JBKA 3H84A 4HAZA 4AYXA 5BXQC 1RKBA 3H4MA 2FMXA 1G1MA 1IXZA 1TNDA 2F43B 2KSQA 3U4QB 5EP3A 1E4VA 1LW7A 1H8HA 3VKGA 1XNJA 4C7OA 3GFTA 4MGYR 2RGCA 2O8CA 4Q19A 4WZAE 2A5FA 3LV8A 2W6JD 2Z6VA 2JLRA 3LQQA 4V03A 2BKUA 1JPNA 4H1UA 3KJHA 1PLKA 1COWD 3BB4A 1KOFA 3KB1A 721PA 1IXRC 4D2IA 4E22A 1XCPA 4AKHA 3F3YA 3SOPA 3UXMA 4LWZA 1OHHD 5B2ZA 4C2TA 5KSPA 5B58C 1U9IA 2O8FB 4GOKA 5B57C 4KVGA 3VR5A 3VU9A 3W34A 1BH2A 1Z5ZA 1E4YA 2QPTA 2DWPA 3O8BA 4E07A 1COWA 5CLLA 2QAGA 4BZPA 2JJ2A 1WP9A 4JL8A 1GL9B 1W0JD 1KDOA 4NHOA 2P3SA 4F4JA 3GLGB 4B48A 1SKYE 2QE7D 1XD9A 4IVRA 3EPLA 4LJYA 2P0EA 3P27A 4HDCA 1KAGA 1XX6A 1XD2A 4I1SA 1XTKA 3R7WA 1KI1A 2XZLA 2PLFA 2QGZA 3IPXA 4DUGA 4NU0A 2JJ2D 3CUEF 1IXSB 4X8OA 5G53C 2O8DA 3UPUA 4GPTA 4A4DA 3CRW1 1EFTA 2CK3A 1RYHA 4DBLC 1NVVQ 1SZPA 1G18A 2RGBA 4IOLA 2G3YA 4EJSA 3HWSA 1CF4A 3UMSA 2ZYUX 4PPNA 2VA8A 1R2QA 4IDHA 4PC3A 4LBVA 1PJRA 2IA5A 4RJLA 5JS8A 2EVWX 4KYUA 3LDAA 4LK2A 4DLSA 4KI0A 1Q1BA 1M34E 4HZUA 4YONB 3LX8A 4IDNA 4NYIR 2ZYTX 5C2JB 1ZBDA 3MJHA 4D4KA 2XTZA 3NDPA 4TWZA 3Q72A 5AUNB 4DT1B 4G0NA 3SC3A 5JHHB 3D31A 2WBLC 4LY6A 1ZC4A 4B33A 1E1QD 4G3XA 1Z06A 4GP6A 2ZXUA 3RDPA 1P4SA 1Z6TA 3LQRA 3T1VA 1VIYA 1TU4A 3C5CA 4FMBB 1E9SA 3U3KA 1OT3A 3IO3A 4BLOA 5KSZA 2ANBA 4MKFA 1L2TA 4MRSA 2ZS8A 3EA5A 3AF0A 1Z6YA 3IPYA 1E1RD 5E7MA 3S1AA 1S9HA 2J59A 2F1JA 5JS7A 4GRAA 5IF9A 1U90A 2BJWA 3IIJA 2XX3A 3U3MA 5F98A 1XPUA 5AUQA 3A6PC 3MWLA 3L8ZA 3ZIAD 1YZGA 4MYHA 4Q5IA 3I62A 1N6OA 3B6EA 4TL7A 2C04A 5EXTA 1TQ2A 1XWIA 3CPEA 5C46F 2XOKD 2Q3HA 1CRQA 1EG7A 2BVNA 2WWWA 1TQ4A 1XMJA 1FP7A 1W44A 4RFSB 3VNUA 1CRPA 5CDFA 4NP6A 2RGEA 2WM9B 4QOSA 4D0NA 4QM7A 1HE8B 3BWDD 5A5GA 5L3QA 2WIAA 2V7QA 1T8UA 1P2SA 4DJTA 1M74A 1TX4B 3KKNA 2DHRA 4OI4A 1DO0A 2ZAOA 1KSHA 4M53A 4P3YA 3TAUA 5IK2D 5TARA 1SULA 4LV5B 3QPVA 4DEXA 1UKZA 3KX2A 1QHHA 2KBEA 3MLEA 3NVAA 1SHKA 1E9FA 1JR3D 3SFZA 4BEJA 5EE1A 4A6XA 4EKDA 2IUTA 2PX3A 2QQ0A 3KFXA 1LS6A 2EYQA 4LYFA 1N6NA 5IK2A 4E5UA 1E96A 2CJWA 2QZ4A 2O8DB 1RFLA 2A5JA 3VX3A 4HI0E 3IUYA 3GLFE 2YYZA 2ZPTX 4HUQB 4XTRA 4JLNA 5DYGA 4UNRA 2VLIA 4OL0A 3T35A 1LFDB 1RJ9B 3ZVLA 1T0HB 2ATVA 2J0QA 2GAOA 1J7KA 1E9EA 1MRNA 3KKMA 1GIAA 1QHHB 3OIVA 1P2VA 2NIPA 2CMKA 4BUJA 5FOXA 1KI2A 1A2KC 3DDCA 3KQUA 1M7HA 1SKYB 4W5WA 2BM1A 5J4KA 4PZZA 3C16C 4JLDA 1AGRA 3ZYCA 3TSWA 3B1VA 2ZI9A 5HR5A 1W2GA 4IXNA 4ACAA 4EPYA 2IF2A 1F5NA 1P9RA 2GBLA 2WOOA 1AKYA 1G8GA 3QPUA 4IXMA 3ZJYA 3HU1A 2CE2X 2NZ8A 4A0GA 2ZM5A 5AR1A 3U60B 2J0UA 1DAKA 1HA3A 2KB0A 3RS3A 2X19A 1OH7A 1Z47A 2WTUA 4LX0A 3HPQA 5DHAA 2WWFA 3MRSA 3ZZ0A 4YQFA 4YXWA 4MKHA 4RD0A 5DISB 3TE6A 4AURA 2BMJA 3I5XA 1GSIA 2V9PA 1WDTA 3MSXA 3AVVA 3GCGA 3QBVA 5KSYA 1X86B 1VCOA 3FHCB 5CITA 1G64A 5E4FA 1XJ0A 2WSSD 4HAUA 5IRCD 4UJ3A 5UKDA 3NKVA 3SJBA 4KLZA 1ANKA 4U00A 5FTKA 3VTKA 3R8CA 2NO9A 4JKYA 2IW3A 2ZRNA 4B74A 2GJSA 1N6PA 1ZNXA 4NCNA 3BXZA 3C5HA 1Z8FA 1F2UA 4N3NA 2HXSA 2BM0A 3Q7PA 5SZKB 2ZRKA 4AIIA 2GK6A 3BK7A 4GFDA 3X1WA 5GVSA 1OF1A 2NPIA 2QL6A 3B9PA 4V0LA 4ZDIA 2BC9A 2WPDA 5FTJA 3SU8A 2AXNA 2JDID 1R0WA 4RZ2A 3IDQA 3IKJA 2FOLA 4B34A 1P6XA 4TTRA 1K5GA 3MJRA 2VP9A 4CEHB 3THXB 2ZRMA 4AD8A 5EP1A 1E2MA 1E79D 3UANA 1OXTA 2O5VA 2OCBA 5DE3A 2IYZA 1FPMA 2WV9A 4TL6A 4A92A 1RE0A 2CHGA 3GLIA 3FHTA 1Q21A 5J4HA 1CIPA 1XCMA 4QKQA 1CU1A 2AFIE 3N5CA 4KITB 3E70C 2Z83A 3MWKA 2QPOA 3O47A 4LHXA 4Q9LA 2H18A 1II0A 4OHXA 4C0AC 4R9UC 3SI7A 2E1RA 5L3SA 4UNNA 3LY5A 5HKKA 2QBYA 5AUPB 1G8HA 4PZYA 2JJ1A 2FEMA 2VSOA 2R6AA 3TUIC 1TU3A 4DLUA 1XP8A 2GESA 3MGCA 3B1XA 1W2HA 2ZVPX 1UEIA 1VCMA 2FN4A 3QF4A 2W2XA 2VHUA 4B76A 4IJMA 2O8FA 5FUWA 1PZNA 3AVUA 2XTMA 2QM8A 2ZEJA 3WYFA 1RIFA 4A8JB 5HTKA 4TYWA 2A3RA 3CB4A 1QVRA 4DLXA 1M2OB 2G6BA 2YWFA 1S0UA 5HCIA 1H65A 1N6LA 2HT6A 3TGPA 1WB9A 1E2FA 2BV3A 4XVUA 3N2EA 3GPLA 2IT1A 3KKPA 4NL4H 2FA9A 2ZITA 4ZCIA 3QXCA 1BOFA 1F2TA 1P2UA 4HB4A 1DVRA 3EZ9A 2QAJA 3IHLA 4DLZA 2CL0X 3QKRA 2OAP1 3AVTA 2J0SA 2JLZA 4YMUA 4WW0A 5K8UA 5SZJA 2DFTA 4NBSA 4JBWA 3ZQJA 2CDNA 4OI1A 2RH5A 5AJZA 3ZZUA 3K70B 2BBSA 4Q66C 1N5JA 2BHRA 3AB3A 2R6GA 5KDLA 4DSTA 1DTSA 2GJAA 5CB6A 4JZKA 1U8ZA 2REXB 5CB8A 1OXUA 1OLOA 3EPKA 1QVAA 2XITA 4QBHA 4S35A 4TT3D 1E69A 2JASA 1KSJA 1Q22A 3D3QA 3P4YA 1JEDA 3EZ6A 4K46A 1RC8A 2GF9A 1AA3A 1VG9B 1AZSC 3AVXA 1RRFA 1D2EA 1W4CA 1N5KA 2RGAA 5KTYA 1AKEA 1YJ5A 1E3MA 2GDJA 3L0PA 3FKSD 2J7PD 2KJQA 3THOA 4DCVA 1US8B 1E2EA 4OJQA 2CL6X 3U6BA 1G5TA 5F2EA 3DVLA 2FPKA 2QPAA 4UNQA 2C77A 3W3ZB 5TMPA 1K5DA 4CT4B 1GL6A 3DZDA 1ESMA 1YRAA 1NBMA 1GRRA 4RVCA 4M1TA 4Q47A 2O8EB 4UJ5A 4AKIA 3WP0A 5SZIA 4ZI3A 1J90A 4MDEA 4D4JA 3CONA 1DG3A 2GJ8A 3OFND 5L3QB 4LHVA 2I1VB 3GJXC 4CIDA 4KFSA 2QNRA 1AK2A 4EPWA 3EWSA 1YE8A 3WRYC 2D74A 4BLPA 5KO2A 4G01B 3UG6A 2AL7A 2WWGA 1Z0AA 1U0LA 3I92A 3TQFA 4HYYA 4XWKA 3OFNA 3QKSB 3B13B 4P4TA 4Q4HB 3M1IA 5EQTA 3U7HB 4Q48A 2CCJA 4CDGA 2GETA 4L15A 1YRBA 1CS4C 3GLHB 4JT4A 1A1VA 1T6NA 4LJ4A 4R71A 2YWEA 1OPXA 1CR4A 1OXXK 4A0RA 4B2PA 1S8FA 1ZMXA 1KI9A 2SHKA 5EXSA 1CULC 1LV7A 4KLNA 3K0FB 1TF5A 4F4IA 2ZI4A 1WF3A 3OZXA 4GOXA 3UG7A 2GHIA 4O0MA 4M8NE 1EFRA 4NKRA 5FBVB 4OJKA 4D0LB 1M1YE 4JVMA 1YR9A 3QKUA 2LKCA 3K9LA 3PUZA 4W5JA 2IC5A 4FWIB 1KDTA 5FTNA 1NL3A 4I1VA 4JBYA 3G0HA 1D6JA 2P6NA 4LJAA 3LNCA 1A2BA 4EQ6B 3U7EB 3CRQA 1LF0A 4DSUA 1Q1ZA 4D26A 3FYHA 4U5XA 5LDDC 3C8UA 4B3CA 3JZMA 5DO9A 4WXPA 3QIAA 2ZRHA 2RGGA 1YHNA 4QFMA 4TQ9A 4YMWA 3VHXA 4CYMA 2F9MA 5D3MB 3ZLJA 3GLHA 4LOAA 1K6MA 1XTQA 4K81B 3QVVA 4PFSA 2CCKA 1MRSA 2OG2A 1JR3A 1SXJE 3PXGA 5FTLA 1CP2A 3AV0B 1QZXA 3HR8A 1G21E 3CW2A 1GTVA 3LA6A 3N70A 5L3SB 4ZDWA 1KIMA 4JIMA 3OEHD 5BN4A 2GCNA 3SN6A 2ZROA 1VECA 1VTKA 2GVDC 1W7AA 1OV4A 4B6EA 4URVR 3FOZA 1FUKA 4JSYA 2G88A 1KDRA 3A36A 2CJWB 2K5UA 4GL2A 3FB4A 2R6DA 3OESA 2Z5FA 4Q1CA 1Q57A 1P5ZB 2BOVA 2BBTA 4DB4A 2ZQ5A 1GNQA 3QXHA 2H8KA 1VG8A 2A9KA 2CL7X 5DN6D 2WJJA 1MR3F 1OYWA 2QSYA 2R44A 3QXXA 4B3FX 2D3WA 4QRHA 1CJUC 2FZLA 5KUTA 2V4ZA 2WKRA 2NPFA 1ZJ6A 1Z6XA 1F2UB 1OHHA 3AVYA 1ZYUA 1I4TD 2YC4C 3E1SA 4LCBA 1OKKA 4QJ5A 5F3WB 4JL6A 3SEAA 1Q44A 2ASEA 1NP6A 2CE7A 2ZUCA 3KJGA 1AQUA 4PXAA 4B47A 5KSOA 4C7OB 1XPOA 2WAYA 2FFBA 2F3TA 3B5JA 1EXMA 1CEEA 5TDHA 2CLSA 1W47A 4ZKDA 4QHSA 1ZNZA 3W9YA 5EJEA 1OH8A 1IN4A 3R9XA 3FFBA 3ADKA 1NVXQ 3A1WA 3A4LA 3LXRA 3W8RA 1FTSA 5DH9A 3EC2A 2EQBA 5LD2C 1G3MA 4ABYA 3B2EA 1G4AE 4HLUC 1OB5A 4S2EA 1OFHA 3U3RA 3THYB 1GVNB 3K1JA 4IDPA 2B21A 3C7KA 2ZYVX 4MRNA 1II8A 5C18A 5JBQA 4PHTA 4TLDA 4W5HA 1YVDA 4DSOA 5KNBA 3PEVA 3EA0A 5FFMA 3T34A 3TR0A 1VDZA 4TYYA 4JLMA 1G20E 1Z2AA 4QC2A 2ONJA 3AH8A 2GF0A 4CW7A 2ANCA 2ZETA 1W0KA 3PCRB 4M9XA 3BFKA 1KNXA 1R5BA 1ZD8A 1DBSA 4L5BA 3WBKA 3K9HA 3ASZA 3FMPB 2N42A 2XEXA 4XWAA 1VCNA 2JIZD 3AM1A 1JQJC 1Q1QA 2W6ID 5JI2E 3SHFA 1B23P 2X77A 1SVOA 4W7SA 5JSZB 2BWJA 2OE2A 1U81A 1T5LA 1ZU4A 3SFVA 4N0EA 2KI5A 1NF3A 4I1UA 1S1CA 1YKSA 5EE3A 2D4HA 2W0MA 1IHUA 4M2LA 2XZOA 3SDZA 1RYFA 1II8B 4Q7KA 3WMFA 5FI0B 2W6IA 4NH0A 4PHFA 4US1R 4Z1MD 1G8FA 1KO7A 3HPRA 1NN5A 2E9SA 2FGJA 1H8ED 4LV6A 2FF7A 3R9WA 3X1YA 4PZLA 4A82A 2B92A 4DDTA 3RVBA 4M1MA 4F4CA 1YU9A 3CH5A 3G82C 2AN9A 1G41A 2WVJA 1VMAA 4XWOA 3I8SA 1UKEA 1KO8A 3GJ8A 1S3GA 4JLAA 4NYMQ 2ZE8A 3WYGA 1P3JA 4ZIRA 2G0NA 3K70D 4TQAA 2VHQA 3TBKA 1KI7A 5GJBA 2EWWA 2Q3FA 5J4VA 3ZVMA 2UZ3A 2FSFA 1XJQA 4IKEA 3TUJC 5E95A 1L8QA 1YZUA 3H0KA 1CR2A 2XJ4A 1ZD9A 4II7A 3U44A 1Z22A 4QBFA 1IN8A 1WQ1R 2VBCA 3ICQB 6Q21A 3AVPA 1R0YA 4KAXA 4RZ3A 3QI2A 2OHFA 4OHZA 4L8GA 1DAIA 4BRUA 4RKEA 5LB4A 2DCUA 2WOJA 1W1WA 3K0CC 4XH9B 5FUVA 3A1UA 5J40A 4Q9HA 2B8TA 2ODEA 4BFSA 3NHAA 1T5IA 2GEUA 2R6FA 3VR3A 3B7GA 1S1MA 4NTZA 3EZ2A 4KFTA 4O2LA 5DI3B 4ARZA 1JXMA 2OBMA 4Q9KA 1SVLA 3DO6A 3O8CA 4DZZA 1D5CA 3CRVA 3IQWA 1OXVA 1WXQA 2I4IA 2PZGA 4RSGA 4BASA 5BWMA 5D3QA 2BIFA 4B6FA 4US2R 5L3RA 1DEKA 4DCTA 1N5IA 2IYRA 1G3UA 3RSOA 2ZRCA 1FX0A 3DHWC 3M6AA 1RZ3A 3MMPA 5BQ5A 1AS2A 2CEAA 3AGQA 4LZZA 4JSTA 1S96A 1IY2A 4BECA 1I2MA 1P72A 1G7SA 4GNKA 2GXUA 4Q21A 5FPHA 1DAGA 4GI7A 4EPTA 4KO8A 2ZUDA 3DM9B 4JLVA 1KJZA 3Q9LA 3AP3A 1G6HA 2O0HA 1KKMA 2ZJ5A 2VP6A 4IVPA 2FSGA 4MGIR 1G5PA 4DDVA 4KXFB 3BFXA 2EWVA 1NN1A 4LGMA 3EWAA 3QVUA 2BJVA 5CDFE 4BGDA 2GXAA 3BD9A 4OQXA 3WHKA 1JECA 5CIQA 4NCKA 3QUSA 2XNSA 2DYKA 1FW6A 4FI3C 2G77B 1ZRHA 1W4RA 1XBTA 3RS2A 3L2OB 2WIBA 3BRWD 1T91A 1OFIA 5FPKA 5G40A 3L43A 1CBUA 5JFGA 1L4YA 1EFRD 1AS0A 1EX7A 3MWYW 2QG6A 5LBIA 4PAQA 1U8AA 4YDSA 2A7QA 5EE9A 3CO5A 1AZTA 1NMZA 2XAUA 4JLPA 2BEJA 1AS3A 2A2ZA 1YZTA 3AKDA 3GLIE 3JZAA 1DAHA 2B8WA 4DKXA 1S4QA 3P20A 4UKDA 3OIUA 1HYQA 1R0XA 2YV5A 2BDTA 3PUWA 5AJXA 1QF9A 2RGNC 1EFCA 4CEIB 2H17A 4Q01A 3A8TA 4HLDA 2XNDD 2Q3MA 1LVGA 2J41A 4C0BA 5JEDA 3L0SA 2WJGA 5L8VA 3PENA 4AKGA 1FZQA 3MAAC 2HF9A 4PC6A 4YC7A 4GDFA 4ZCLA 3JVUA 3VAAA 3QE0A 1HQCA 1WBDA 3RC8A 1XTRA 3K0FA 4ASUD 4GP7A 1QG4A 4EFLA 1YR7A 1KI4A 4JVLA 3A1VA 1GFIA 5IDVA 3OEHA 2JLUA 1XTSA 1WA5A 4ZDKA 2HF8A 3BC1A 4B3GA 4BEBA 4HAVA 3KB2A 4Q18A 2OFOA 2QMHA 3AUYA 3NBFA 4NDZA 3QENA 2VO1A 4Q1DA 4C30A 4DRZA 2JJ8A 3QJYA 4J0QA 4NZYA 3T61A 4IW3B 1ZVQA 3VKHA 1SXJB 4C0SA 4QGFA 2JLSA 3ASYA 5CIWA 3TJZA 2J45A 2OO7A 2GEDA 4FCVA 2DFLA 1VKJA 4PO1A 5FPYA 4DCUA 3THWA 4BFZA 3SYLA 2Q9CA 4HUTA 4BLSA 3GJ4A 1M7GA 4AG6A 1FL9A 4YXWD 1R10A 5AJVB 4LC0A 2YINC 3BORA 5AK0A 1MT0A 2B6HA 3GJ5A 3NXSA 3RLFA 2CVHA 3SJCA 4V0ME 4BZQA 1ZD1A 3RWMB 2L0XA 2CCGA 2MMGA 2NO0A 3MD0A 3VMFA 4DLVA 1MO5A 3L82B 5JCPA 3K9NA 5EUMA 1U0JA 1R5OA 3CNOA 4Q4AB 5EP4A 5B64A 1W4BA 1T4GA 1Y63A 1ETUA 3P26A 5G3ZA 2HV8A 5J4YA 3A58B 1YR6A 5M04A 1BYIA 5J5CA 3NWJA 1WRBA 1P62B 3BB3A 3KL4A 2CXXA 2FWRA 5EP2A 3EIHA 3TH5A 1NI3A 521PA 3KQKA 3K0EA 3EC1A 3QNUA 2B7CA 1DAFA 5FI1B 1ZM2A 4NCJA 1Q3HA 3AP2A 4IHQA 3HR7A 4MYUA 1IQPA 1O87A 2DFKB 1KI8A 3CX7A 5TB5A 4EAQA 2H5EA 2YVUA 2DR3A 4HDQB 4PSAA 4DCNA 3NDBB 4ACBA 1Z0IA 1HY3A 4Q9IA 2IYTA 2ZANA 4Q1FA 2I1QA 4BQSA 2EW1A 4JVNA 3EIEA 3OAAA 1TUIA 3B60A 3PUVA 4CT5A 5LPNA 3TK1A 2P5SA 2H16A 4QXAA 3HYTA 5KYKA 1VG0B 4I81A 5C4GB 621PA 1J70A 3K0AA 4WVFA 1OH6A 3GLFB 3IIMA 4TMKA 2AK3A 4FWTA 3NIBA 2XB2A 1TTTA 3EX7C 3U4QA 3CIOA 2WJVA 4LHZA 3DKPA 1EWRA 3RS7A 1SVSA 4EJSB 2A30A 3LW7A 3AVWA 5E7JA 1ZC3A 3T1QA 1P2TA 1Y3AA 2C98A 2JLXA 2HCBA 4HAXA 1XFAA 4XIGS 3DKVA 1X1RA 2GJKA 5IHPA 2PMKA 3KQHA 1II9A 3FMIA 1BYUA 4Q03A 1NSTA 3LO5A 4FCTA 5A4JA 3T06B 4PPGA 1TQ6A 2PMDA 4F38A 1ZINA 3T12A 2RAPA 1JQLB 1G9XA 2ZSAA 4X8LA 2W00A 4AI6A 4KV9A 5A0FA 1HE1C 2ZI6A 2WKPA 4KSCA 2HT1A 3A4NA 4GOJA 2C9YA 4Z1MA 2FPLA 4UXIA 5JSZA 1CJVC 3SHWA 1MO3A 1BO6A 4X8HA 3A1SA 3Q5DA 2J5XA 1ZW6A 4TMTA 3DL0A 2QAGB 3LVRE 1U8YA 2FU5C 3C41J 4XJXA 2GA8A 3H2YA 5KHOC 2XXAB 1KK3A 2C2HA 3PEYA 2P2LA 2X2EA 2YC2C 2IYXA 4I4LA 3TW4A 4QL3A 2IEYA 2OT3B 1ZNWA 4FW9A 3NHBA 1C1YA 1CJMA 1US8A 2EU8A 4H9GA 2VF8A 1KTVA 1T3HA 2BCGY 3AGPA 1W0JA 1X6VA 2IXFA 1F6BA 1HQYE 3ZH9B 421PA 2V1XA 2B7BA 4M4SA 4DHEA 5HE8A 5DI9A 1Q12A 2C9CA 1MOZA 2YZ2A 4TLEA 5H1YA 4MKIA 4M21A 1ZIPA 2ZU6A 3PFIA 1IN5A 2ORWA 3TNFA 1E0KA 1YQTA 3GEEA 4Q9JA 1VYTA 4DUGD 2AFHE 4XVQA 2FGKA 3KXKA 4OQMA 1XTIA 2EFDB 4WZ6A 2OFXA 4PO8A 2ZRIA 1KSFX 4GT1A 4MRVA 3UKDA 2F1RA 4DSNA 2DBYA 2ECKA 5AJYA 3KKQA 2ZREA 1KJWA 2QEQA 4G5OA 5CJPA 1C4OA 1N6IA 1QHNA 4ITRC 3C14C 4PSKA 2ZS9A 2IF0A 1L4UA 1M8PA 4NYMR 1T0JB 4DT1A 1SVIA 3U61B 2YWHA 1CJKC 3W8NA 3W6NA 4LYJA 4DDWA 1Z0KA 1FNNA 3PIRA 3OEEA 2RGDA 5CYPA 1U94A 3OHMA 3LAWA 3VX4A 1KMQA 2GCPA 1DELA 4LV8B 3ADDA 1XJCA 3LVQE 1E2PA 2WSMA 1D9XA 4NE2A 2QT1A 1QDEA 3NH6A 2IL1A 3HU3A 3RS5A 4MRRA 3CX8A 1GZSA 1ZCAA 4TSFD 4TMWA 1J8YF 1SXJD 2F3RA 2GZHA 4LBYA 1X8LA 2V54A 2VQSA 4CEIA 1HH4A 1J8MF 2FE4A 3N2IA 1LB1B 5CK4A 2IUSA 1NLZA 2QGNA 4PSVA 2CNWA 4P4SB 4QBGB 3RSLA 1W36D 2PT7A 4QNRA 5F9HA 3PUXA 2G83A 1W5TA 2WWIA 3CZQA 2Y8EA 2ZRLA 1QHGA 3DMNA 3X1XA 3ZVRA 4YMVA 4P31A 1ZNYA 2NTYC 4JJKA 2QT0A 2WKQA 1CTQA 1KMHB 2AKAB 1ZM7A 2CHQA 3L8YA 2RHDA 3VFDA 3P1JA 1XTJA 2Q21A 2Q6TA 2QP9X 2YWGA 2XNDA 3B82A 4B73A 3RC3A 3AF2A 1E2JA 1KO1A 1BKDR 4YMSA 4DVGA 5D3MA 1XRJA 2H57A 1GP2A 4KFUA 3W5IA 3IEVA 3ZDQA 4RCZA 2WHXA 2C78A 2GXSA 4HAWA 2PJZA 4G5QA 3FKQA 1JXOA 5CJ2A 3BOSA 2QI9C 4PPQA 2HYIC 2JIZA 3WXMA 1KZGB 3DPUA 3PUYA 4NCIA 1DG1G 2ZU0C 2ZRBA 4ZDJA 4RZXA 4KBGA 1GOTA 2IWRA 3I72A 1GKIA 3O8DA 3I32A 1A4RA 5BYJA 1JJVA 1Z29A 2EFHB 5DLQC 2AK2A 2JJ1D 1N5LA 2FFQA 2JA1A 4KU4A 1Z6GA 1UM8A 3Q7QA 4ZCMA 1Q1EA 3ZD6A 1XMVA 4M1OA 2JCSA 2W0SA 4DDUA 2IHYA 1GL7A 2OBNA 5FBWB 3CX6A 2VEDA 1VIAA 4G1UC 2LCFA 5C1BA 2O0JA 3B85A 1LY1A 4JVSB 1BMFD 2W2TA 4HATA 3SNHA 4CF7A 1VHLA 2VIIA 2W58A 4NYJR 1FFHA 4MGZR 1UBEA 1PUIA 5AJWA 121PA 5DN6A 4AC9A 4URXR 4A8JA 4C4PA 4URUR 4UXHA 2QUZA 3IBYA 2YNMA 1KK2A 3FWYA 2VSXA 1NG1A 2HLDA 3THYA 2HXYA 1YR8A 5JEEA 1SQ5A 3ZS8A 1KI3A 4LJ7A 1AA9A 4XSHA 5FOTA 3P32A 1ZUNB 1Z2CA 2GBLC 3X1DA 4UQOA 4B3XA 4KFRA 1XDBA 1FQKA 4AKEA 4P32A 5FBQB 3ZZTA 1Q3TA 5CK5A 4FN5A 4LSGA 1E6CA 2VYFA 3THXA 4I1OA 3IEUA 2HJGA 3KXIA 3PJRA 4JMPA 2O8BA 5DGXA 1E94E 1TUEA 2WWHA 3K0AB 3GJ3A 2FX3A 3I4LA 4LYHA 4EUNA 5L3VA 4B32A 3ICEA 2IYVA 3PEWA 2GCOA 3KUCA 2GRJA 4BE7B 1N6KA 1OB2A 1JB1A 3TUZC 3FE2A 2G1JA 3ZS9A 2P6UA 4DB2A 5E3HA 3GLFA 2QORA 2XB4A 3IILA 1KNQA 1N0WA 1YZKA 2J7PA 5JJIA 4CRWB 1A82A 4JT2A 1Z28A 1IM2A 5P21A 1W0KD 4LRWA 1DOAA 2RCNA 1G3QA
chains in the Genus database with same CATH superfamily
4MO2A 1AKVA 1NJFA 3NEJA 5FNVF 3ZXIA 1X7ZA 2IBSA 3DDNA 4F71A 3EWIA 5J2TF 4DNQA 4EIWA 4DXAA 3DAOA 1K6IA 4WESA 3RS4A 2P9CA 4KWCA 4F2GA 2C7RA 3G59A 1JFVA 1JALA 3BICA 3OY7A 3A3OA 4XJTA 1YL6A 1I32A 4IRUB 2GZAA 3PGJA 5DBEX 1OX4B 3T5MA 2EP8A 4QDUA 2O5RA 3LLSA 5KNDA 3PVCA 1SY7A 5K45A 2YWXA 3BXFA 3ENKA 4LE1A 3MYRA 1RTTA 3OICA 5ALFA 4NSNA 4DLWA 4EA6A 1ZK1A 1WULS 3L05A 1GTL1 4TSRA 3VVMA 3I64A 4ZEOA 4H1TA 4DQLA 4OHCA 1FUUA 3WRXA 1T9GR 3ETHA 2WQ7A 1DDGA 2EJUA 4V0RA 4G5GA 4MVJD 3TMKA 4PCLA 5EGNA 2O8EA 1IMOA 4RELA 2NMVA 1MABB 2IUFA 2TMKA 1IY8A 2NACA 4PAWA 4Q3LA 3UCFA 1D2MA 7MDHA 5LIPA 3C43A 1JAHA 1G2IA 1ENOA 1QIKA 4ZGBA 1VCIA 4DPLA 4M8SA 1IC6A 1IAQA 1X8KA 5GINE 2QP4A 3ITEA 1NW9B 5JH7B 1L4EA 5GGXA 10MHA 3LK6A 1SUSA 3KZMA 4ENRA 2G9UA 4X95A 2D1RA 1SGWA 3PE3A 1OH5A 1NYRA 1S8NA 2GEBA 2G9NA 5KMGB 2NUAA 3AETB 1CIVA 2WWTA 1AUXA 4JB2A 4WOKA 4A6EA 1UCFA 1Y42X 3OPYA 1BX3A 2NGRA 2I2BA 5EJ4A 1EQAA 3LCVB 5HF6A 1GYPA 1XE3A 1FQOA 4X45A 3PE4A 4B4UA 2QN9A 1PJ4A 4G6ZA 2QLTA 4HDKB 4RHFA 1DIAA 4OXRA 2CDRA 3X2SA 4CVNA 4DARA 4YUYA 4IMIB 1DC7A 1ZA2A 3JYHA 5SYMA 3SJUA 3TQQA 3ZCSA 1QP0A 1XZKA 2AFVA 1TZ2A 1LU9A 4JI7B 4NXMB 2AZTA 3DJYA 2UXDB 1H1LA 1KDZA 4TLBA 7AT1A 1VRCA 2PUJA 4D4MA 1UEJA 3K0SA 1AK9A 1EM8A 3PIDA 3R6LA 1K2VN 3VPDA 1HNWB 5JS1A 4OHVA 5C4IA 2PL1A 3GLQA 5EIAA 2QMUA 2O3UA 3C7DB 4Y98A 5EOVA 5CEFA 3OSUA 3AEYA 2QGFA 1C9KA 4OBXA 1JHXA 3UKJA 3WJ1A 3ETLA 2QLJA 1GYRA 5CG1A 5IAGA 1IULA 3VR1A 1PSDA 5AM2A 4MVYA 2QJFA 1JAYA 3QKIA 1QFJA 2AOUA 3UT5B 4B7ZA 4EF4A 4LJRA 1H2WA 5BRNA 2NP6A 2OORC 3QWFA 5CLGA 2YIVX 1XXHB 1IZ8A 3QU5A 1RD4A 2GBIA 3K6SB 1BU5A 1P8AA 1PFGA 1QVVA 3BIFA 3WSTA 2PEYA 2VSFA 3ZY6A 1LNSA 3L0CA 4EEXA 2CXRA 5AW2A 1XAJA 4XSVA 3ICWA 3MUOA 5IJ0A 5HW0A 3GWGA 4MW7A 2J4CA 2QN3A 4YASA 3OF3A 2IELA 1VP3A 2IIQA 2JAQA 3ESRA 2VHTA 1PGJA 3GCDA 2REBA 2HLNA 2M6SA 2UZ1B 4K9LA 4W9MC 4YJKA 1NMXA 3LFHA 5AW9A 4GICA 4E88A 4KGZA 2C03A 4PWZA 1GKUB 1KFEB 4OJYA 5LQMA 3N6RA 3IE2A 4WJLA 3NAGA 1P5HA 4YR9A 4Q4JA 1OBHA 3K4HA 4YJHA 3SQOA 3K9FC 2FQXA 4RK5A 1GYQA 4CKWB 1KSGA 3GUCA 3U4DA 1IZ7A 1WO8A 2RONA 4BZWA 1GQYA 2XMDA 4PYRA 5G4KB 5HZGA 1Q50A 1GZHB 3ODGA 4F7DA 1NIPA 3RIGA 2PGNA 1RXCA 1V5GA 3DUFA 1AV7A 3CINA 3K2BA 3WRVA 4AJNA 5CB4F 4JJFA 2AFRA 2LKDA 2VAMA 3IDZA 2BEUB 1W88B 3K73O 3KLOA 5FOUA 4IDAA 1I30A 1D4OA 2GFQA 4HQ6A 4TM7A 4XDGA 4A0HA 4UNIA 4HOYA 4QO7A 4XM1A 4AF6A 2AC2A 2X0RA 3LRPA 2AI2A 2EF0A 4WMLA 4EARA 4QOGA 1SUBA 3CLSD 3GAAA 3DAFA 1EAYA 1IQRA 2WNSA 2EFGA 1HT1E 4RK1A 4WSOA 4A2QA 3ZCUA 1XEXB 2ORYA 1V95A 3HFRA 1Z13A 2R1TB 1EXDA 3ADPA 4BQPA 2M1XA 4LWOA 2W48A 1G5RA 2IZ5A 4YN3A 3W90A 4W7IA 1XMXA 3KWMA 4L0QA 1FE8A 4DRXA 1GAEO 2EJTA 4RL4A 4G8JA 2YYYA 4R0MA 4JODA 2WPDD 4QVKA 3OE5A 4YLYA 1IY0A 3GCZA 2UKDA 2XCQA 4Q4JB 1RSZA 2JHCA 4KQMA 3VYTB 5KINB 1DCMA 2DM6A 2FW7A 1D9ZA 3MWDB 5CHEA 1AQYA 4MOWA 4C88A 1CY6A 3D64A 4JLSA 3AUXA 2ISCA 3DF9A 4PZCA 3SVZA 2AXEA 3LT1A 3U7IA 3UJBA 3TXYA 2UYQA 3EFHA 3GFFA 3CCFA 1KJYA 1L9KA 1NKTA 3B78A 1P7YA 1WD5A 4MVCA 4C0QC 1UJ6A 3RYTC 3RBZA 3PICA 5KNDD 5ISMA 1EK5A 1DT3A 4GZMA 1FZTA 4F8EA 2O19A 1L7PA 4QHYA 5C53B 3GHHA 5FBLB 1P7VA 5ALWA 4BRSA 5JSQA 2CD9A 3O4HA 5HK8A 3A06A 1Z88A 3SHVA 1O54A 1N3BA 1XJWA 1SD5A 2V98A 3AY6A 4KMRA 2FHPA 4IV5A 5CB0A 5L9AA 3IP7A 4C2UA 2LVBA 3ESBA 4R2JA 3DW1X 1J4AA 3QKRB 4S1OA 2HIAA 3A2NA 3INYA 3VPAA 2PLWA 4Z54A 1QRSA 4Z2YA 1RPNA 5D1HA 3MEQA 3NEAA 1H2ZA 4UAJA 1CVLA 4A5OA 4D81A 3K96A 1AY0A 1R6DA 3V4VB 1DUIA 2FZ4A 2WMDA 2ZJ1A 4XOIA 5JXHA 2Q0XA 1ZHHA 1D1SA 2H5IA 2VP5A 3CRMA 2B4RO 4Q02A 4N6NA 3M3DA 1RHUA 2J09A 3FWNA 3Q6NA 5A62A 4QJ3A 3X2EA 1JI3A 1PR5A 4G0ZA 2GERA 3L0IB 2FG6C 1H66A 3CWQA 1JH8A 1NJ2A 3ABOB 5HG0A 5IAAA 1ARZA 5DASA 1C7FA 4FSDA 5BUZA 3C3DA 2BMDA 2GYUA 3FPJA 4TTIA 4LXYA 3ZCVA 1U02A 4DJDC 2G8NA 3G2IA 4XE5A 2BGMA 4S05A 4RVSA 1I3MA 2C3UA 3FHOA 4LX8A 1XRRA 4MUMA 5JAUA 4YWHA 5F51A 1JAIA 4RX1A 3FGZA 3CIFA 1GILA 4FILA 3AHDA 221PA 1QGUB 2ZAMA 1E3TA 1OKKD 3RTDA 5DT2A 4YJ3F 4Z8XA 1TL7C 2NM0A 4ESHA 1E5QA 2XUKA 4XB6B 4AX4A 2XNCA 4O4IF 2V0NA 4JUCA 2HRBA 1M6NA 1H4TA 2NQ2C 5KMGA 5AVUA 5I3ZA 2DUJA 2RI6A 3GV0A 4UPVA 4TMXA 3TZKA 1TLLA 3VTFA 4D80A 2Y66A 5AD1A 4OHYA 2JFBA 4MA4A 1FYDA 3WWZA 1D4FA 2NW6A 3O7WA 3U80A 3G68A 3GZ4A 3LHSA 4A8HA 4BFWA 1CJCA 2X42A 4HG2A 2H52A 3DYBA 5ALKA 5A1JA 1QU3A 1EGAA 1NY6A 2WMNB 3NTQA 3WGTA 4FSHA 2PZ8A 3DM5A 3ZZNA 5JANA 4AKSA 1R4AA 3I0MA 2CLKB 5L3ZA 1Q0SA 2ZJAA 2H92A 2QHXA 5KWIA 3ER8A 5DYYA 4DCPA 4AJKA 3LWNA 4TRNA 4BNYA 3INNA 3EARA 5FKJA 3H65A 3WGIA 4JC4A 2GVZC 3O8OB 4HQNA 4J9UE 4KKVA 4I5IA 4HSEA 5LSAA 1VIMA 1ETHA 1XMSA 1XRPA 5CFNA 2AC4A 4N3CA 1YL5A 2HOQA 3OAAD 3PQ8A 4ERNA 3TLZA 4Z7NB 3UV6A 4HFNA 4EPRA 3BMXA 3SZOA 2GS9A 1DX4A 1C41A 2NYVA 2P5TB 1D04A 2PS3A 4RDCA 5AKGA 2XUDA 4YJ2F 2R3SA 1SCNE 4EHDA 4F7WA 4BPBA 4RJTA 2KS6A 1UOOA 2YH2A 3F3SA 5BNIA 1M6YA 4DREA 2IS1A 3DO8A 2H6EA 4LVOA 2JW5A 4YDHB 5AI6A 3NEYA 4EHJA 1NE2A 3KOWA 3JVVA 4LF7B 1AJEA 4E4RA 1GNRA 2PBRA 4QGBA 2CHEA 4DILA 4LKRA 3R9XB 3GN2A 2H00A 4IJ5A 3GPDG 2R6JA 2VHJA 3QQ5A 2FUCA 4D0GA 4RYDA 5K3OA 5EZSA 4PPFA 1KZ4A 1U11A 3TLGA 3QBTA 3R7SA 2CJXA 2YZ7A 4D8XA 4EO4A 1USGA 2QVXX 4QFCA 4DA4A 1HL7A 3HCEA 1JEQA 4ZTUB 5LXTA 2WQZA 2C7GA 3K9BA 5CXSA 2Q4DA 2X0FA 1V8ZA 3SS9X 1D3AA 2C9BA 3BH0A 3CUYA 3H2BA 5FRDA 1Q17A 1L4MA 2HY7A 3QFSA 2BHLA 2WYWA 1C81A 1Z18A 4FC7A 1W46A 2O2SA 1NVWQ 4ZV9A 4DJAA 1N7GA 2O8CB 1XQ1A 4MS1B 3TN7A 7ABPA 3B48A 1T0IA 3OE7A 2AWOA 3U9SA 3JXEA 1W30A 3TAHA 2APJA 3SOOA 1O5OA 3A6JA 2Q0SA 3T4EA 1EGVB 1BXRA 3DBHB 4KQCA 1V5IA 1A71A 3QWBA 4MRPA 1BD4A 3E82A 5SZHB 2Z98A 1DGQA 1Z0JA 2M1ZA 3LUBA 3M33A 5GV7A 4FFRA 1Y9JA 4PHHA 2J3LA 3RU7A 3VKVA 1E2KA 3CR8A 2A5YB 2AUTA 1QS0B 2DPYA 1LS1A 1EEHA 4LJ8A 5CM9C 3LBHA 4JP8A 4QTXA 3BH6A 1RMTA 4XDHA 3ZDFA 4F11A 1Y3FE 3A4IA 1Z4KA 3GEHA 3ZU2A 2X13A 3EZGA 1TEVA 4RK0A 5LKAA 1T8WA 4OLAA 1VJCA 2KWIA 3FPAA 3MERA 1YZQA 4L8VA 4RHTA 5CM2Z 4AIRA 4P35A 3MFQA 4BNDA 5DEOA 3BN3A 6CHYA 3L41A 4MUXA 2PN1A 5TQ2A 3ABIA 4IIJA 4KV7A 2P6RA 5DNAA 3L5OA 1DBRA 3CKLA 3QHQA 2V7QD 4HTFA 3D8BA 2WTXA 3JVDA 1XZMA 2NV2B 3DOHA 1CQIB 2XCOA 3INTA 3MIIA 3EFOA 1LK7A 4F5EA 2CZQA 1E9CA 1N0IA 3AF5A 5JDCA 4IEIA 5TQ0A 2HF7A 3E9QA 4FFWA 2XUGA 4AG5A 1ODLA 2PHZA 7YASA 4ZZ2A 2AR0A 4INJA 1BIFA 3UWKA 3FN4A 4DJ5X 2OAQ1 1B8OA 3FTPA 3KKOA 5KJ6A 3I61A 1I6LA 5I47A 3D6TB 2OB1A 4M0DA 4LHYA 2VJCA 2HJHA 1XMQB 1P33A 3OQPA 1F3OA 4UU7A 1UDWA 2JGKA 2ZTSA 4K9QA 1XZQA 3IKMB 3E58A 1NI4A 3VPCA 4ZHSA 1T1IA 3QXJA 2PUVA 1FF9A 4IF6A 3L8HA 3OURA 1ZD4A 2WUEA 3R3YA 1FA9A 1I7QB 4I9NA 2Z2IA 2A0UA 3P9YA 1PEYA 2ZB2A 4ZOCA 5I7FA 5LIRA 1XUOA 1XZ8A 4L9SA 1T8SA 4U7DA 5L6MB 4DYHA 2BEVB 2VJAA 1J39A 3NM4A 2LR0A 4GU5A 4J9VA 4KZKA 4MR7B 4N1AA 2FR0A 5HXAA 2K6GA 4TV8A 4QWMA 4K8OA 3VQTA 4OOEA 4P4UA 1GO2A 3HNPA 3QXGA 2OILA 2Q46A 2B4TO 3KD2A 1I6KA 3EG5A 3PHHA 4IY1A 5JWRA 2CHUA 2R6CA 4HLQB 3KXLA 4UCWA 5FTWA 1TK3A 4UQPA 3FBTA 3BJZA 1UOPA 4WFQA 4A2WA 5DM60 2WNIA 5IEBA 4BBAA 2GRUA 3F6RA 3HXMA 2YKGA 1EHCA 1H22A 3MJTA 4C1NA 2EZ9A 1K8RA 3OCCA 5BSWA 5K8CA 3TMYA 4HUQA 4I55B 1Z7BA 3R8XA 4CKBA 1RI4A 4XB2A 2QVGA 4FQ5A 4F9TA 2PNFA 3V4OA 5AI5A 3THWB 4AMBA 2GYWA 3NPMA 1CUYA 2V8OA 4LMRA 4X94A 1ZCJA 3R9KA 5DZSA 2E48A 2IZ1A 1TTQB 2Q3LA 4B4VA 2ZWMA 1KZ9A 1G8YA 1EWKA 1WCWA 3IHWA 2FWNA 3Q10A 4H6PA 4HLUA 1KEUA 3RFFA 4ON9A 4BVGA 8OHMA 2QXUA 1DV1A 2VA9A 4QNNA 4X20B 1POXA 3CZPA 4OP2A 4XCVA 3T95A 4OI0A 1W4ZA 4DSAA 5CFQA 3LP6A 2PUBA 3FUTA 1E1KA 1VJGA 2IHKA 2ZRDA 4GZ5A 2QN8A 2I2FA 2QS9A 3FUXA 5FL7D 3U39A 3WLKX 4ER3A 5LN1A 2IPOA 1WXWA 3GQBA 3KCNA 4QBIA 4EY8A 2VHWA 2H1VA 3OIDA 2J0UB 4OVKA 1GNSA 4C4ZA 3F3MA 1IJFA 3FZQA 2QSZA 3GPIA 4XRRA 1R74A 4DUZB 2QW1A 4BCBA 3MSCA 4D43A 5LD2B 4O2RA 1BC5A 1Y8QB 1U8CB 2XUFA 1PWEA 1RQ2A 4Z4EA 4RD2A 3RS0A 1RC0A 4DC9A 3CJQA 1NZDA 3PQ3A 4DDMA 1Q16A 1A2OA 2DT5A 3TIFA 1GTSA 1QDLB 3AYXB 4XYMA 2EYUA 1UDXA 2DWOA 1QQ5A 1G4UR 2FFJA 3BIJA 1DOZA 2BW0A 3PYXA 4GXNA 4RCYA 1DBIA 4C7KA 1AMUA 2ICAA 1X7WA 3F2VA 3FHLA 2YDXA 4XCQA 5IKOA 1G5IA 4AWBA 3JQBC 2OM2A 4KO1S 4QPJC 5DHFA 5BOVA 2RH4A 2ZIZA 1O95C 1A4IA 1C30B 1CUEA 3R3ZA 1XTVA 4RD1A 1FDRA 1ZIDA 4MR9A 3PNKA 4UXJA 4ZAVA 4FYJA 2BGRA 4LYAA 3SJZA 4C08A 3W5CA 1J0XO 4PC1A 4M1SA 4TWRA 4E1VA 1HLPA 4X1YA 1XHFA 2HEIA 2OA0A 2VZEA 1GZ4A 1VG1A 1L1RA 2ZT5A 1NW8A 1NVTA 3OWHA 4GX1A 2VSQA 4PHGA 3H5IA 4IFIA 1SRRA 4Y2QA 3WRXC 5JARA 3C3XA 4BOYA 3K53A 4HNGA 2EBFX 1DG9A 1JQAA 3CWCA 1KA9H 4C22A 3NCTA 1OU0A 2WIGA 1PKEA 3TM4A 2NXEA 3ED5A 4HKTA 3NRCA 1FJ2A 4E1AA 4CMCA 5JAHA 5JJKA 3HHEA 4G67A 4NV1A 4J3FA 5IPFA 2R1VB 2PKXA 4EB3A 4LY9A 2PG3A 3CVWA 1MW9X 3FCUB 3CUVA 4ZQHA 5T8KC 5AKEA 4PR0A 4EVSA 5CH8A 5BYKA 5GADl 4EFKA 1THTA 3BCUA 4UMDA 4G1CA 4BX9A 1AIPA 4GKBA 1KH3A 5FBKA 1TPYA 4CN8A 2ZKLA 3OOJA 1ESNA 5E9AA 2Z43A 1W48A 2MOKA 3FNEA 3O8QA 4BJHB 1P73A 3NT4A 2V6FA 2QRNA 3RVJA 1ACLA 1FTQA 3A10A 2W2KA 3PGVA 4A5SA 4EJFA 1KP3A 2X8BA 4IVQA 5C8YB 1FNMA 1WBJB 3H5OA 4EJSC 4GF5A 4DPKA 2VQFB 3ROQA 3TNLA 1MEOA 1WE2A 2ZJ0A 3N05A 2PMCA 3ZOKA 4OF4A 3FMOB 4R1UA 1B2LA 1CB7A 4TN1A 4ZT3A 5EJIA 3WISA 2W83A 1GEGA 1J0EA 1E7YA 4REMA 4C0KA 5HCNA 1P2BA 2WI8A 3BA6A 1ZL2A 3JU3A 5DM4A 1PR9A 3O4IA 1KFCB 3JQPA 1C3VA 2JZNA 1V26A 2N3ZA 5AK6A 3UB4A 3D7MA 1LVHA 1QP4A 2X8LA 1ZNQO 2RI0A 4DOMA 3OCZA 2ZI5A 4BRWA 1JIQA 1YZLA 4DA7A 1V96A 1R15A 2V6GA 3H2KA 2YWRA 4ZAXA 4G5SA 1RDFA 3GIDA 4CLOB 4CM9D 1MO2A 5HZHA 1GG8A 1M67A 1SWVA 3KZOA 1GSAA 3P2EA 3RKRA 3V5NA 1GGJA 1W94A 1H4QA 3K0KA 1N2CA 5JV5A 4MLPA 1U2TA 3C7TA 2CYCA 4HDAA 4K9DA 4YCAA 2Q3CA 2HCRA 4HBGA 4B83A 4TT3A 4YP7A 5EHIA 2V7EA 2KBFA 4RF5A 2XF8A 1JYEA 4A7PA 1YE5A 2C4MA 1IXKA 2JZOA 2QNBA 2VQ3A 1PDOA 4OLHA 1S3IA 2WHPA 1B76A 3KUKA 1FDVA 1VXOA 2MHCA 2GYYA 2VP0A 1CR0A 3I34X 3I6YA 4YT5A 4PLTA 4NXNB 1SNYA 2ZSBA 1LPPA 3T5DA 3T3MB 1KY2A 4I0WB 3IRUA 1PQPA 4RLSA 3O38A 3M9LA 4B79A 3RAGA 2EL7A 1KO4A 1Z75A 4OYRA 2Q4RA 5DWDA 3I9FA 1VCHA 3GMSA 3SE0A 1JS1X 5FWXB 5GM1A 4B9EA 4JHXA 4NS1A 1N32B 2FUNB 3W2HA 3DE6X 3H9JA 3QEMB 4JNCA 3WL5A 1PK9A 1S2IA 3E61A 1P4JA 4V39A 2OZPA 4A1FA 1XXHE 4R7TA 3R7LA 3ZXUB 5E2AA 3FDZB 1XKXA 1FFAA 4KK4A 4YUZA 1JI0A 3I1JA 4FD2A 5GOTA 1J20A 4IV8A 1SUAA 2O2XA 2XUPA 3UJCA 3HN7A 3W4KA 1X7GA 2A5DA 3FRIA 5GMOA 1A7JA 3EG9A 3LP5A 1N4AA 2RARA 3I6IA 3GLSA 1KYIA 1Z12A 2MSCB 5HKKD 2FLKA 4H7KA 4TTPA 3BHJA 1JT2A 1ECLA 3IULA 4TTVA 4E1BA 2UZ1A 3UMYA 3DDSA 1ZOIA 1MNAA 5BW8A 1QAOA 4TUYB 5FWXA 4AK9A 1IL0A 5CCEA 3E9ZA 4OD0A 3PNPA 1T4BA 4Q3CA 1I1HA 3PXCX 4A6PA 1MAVA 2DB3A 5DBOA 3KUXA 2XKJE 3U3OA 2ZTVA 2MT9A 1Z37A 4OUDA 2JLVA 2W9XA 1MOSA 4JP2A 2W6NA 4M0LA 3MK31 5ALEA 4BKPA 2O7NA 2IDJA 3ASVA 5LP6F 2OC9A 3HXQA 2ZZMA 1R3DA 1G5FA 1J8FA 3V8RA 1PNQA 5JRZA 1BMQA 1NAIA 4TKLA 4YRRA 4B3BA 4BB0A 4E51A 2KMLA 2Y9PB 3MXOA 3LBNA 3P71T 1EVKA 4P82A 2E89A 4PCVA 3WYNA 3GQBB 1FOEB 1KEEB 3SD7A 2QMOA 1DPFA 3RK1A 4Y6SA 1MB3A 3Q11A 3V8NA 4YRKA 3QY0A 1UMKA 4R51A 3PQFA 2CUKA 2I2WA 2AXPA 4LJ9A 4XGQA 1MA3A 4CPDA 1VLZA 1QCCA 4LFCB 3RYCA 1W75A 3Q3VA 4G0PA 4BWYA 4EFNA 4J4BA 5B1YA 4O1HA 3C6BA 3BXGA 4ZVQA 3UXYA 1NVMB 4FMDB 4TKVB 2CUTA 4K86A 5KYVA 4PCAA 3SF8A 1WKVA 3M70A 1AQLA 3GEPA 1JHYA 1XZEA 1FYVA 2XGSA 4F93B 5JZOA 2ZS7A 2Q50A 1CUDA 3PQ2A 2GN9A 4N49A 5U1PA 2ECPA 3DTVA 3CNLA 4XR9A 3GG2A 3ADBA 1RRPA 5CNJA 3M4XA 5BSTA 2RJOA 5JSFA 3NTUA 1U2EA 5BQFA 1COZA 4MULA 4IKOA 5JCOA 2O2DA 3G5UA 4ZVPA 1FFEA 2H07A 1DRUA 3WMEA 2QRUA 1WG8A 3Q8LA 4MTLA 4BFXA 1PNVA 3UHOA 4CM4A 1K7CA 5GVRA 4G1EB 1Z4IA 3WDSA 2YICA 2FPGA 4P4LA 1PUJA 1CYEA 4EL5A 1W4AA 1YK0A 3BL8A 3UPDA 4AJ9A 3HP1A 3OKCA 4U5QA 2FP4A 1LNQA 1MNQA 2TS1A 1P9WA 4JY7A 2ODPA 3BK1A 4FMCB 3O3MB 1G98A 4RFVA 2QWXA 1L0BA 3W3AD 2A9QA 5F1KA 4C5BA 1KJ8A 1HE3A 1K9SA 4LXGA 4OK6A 1NASA 1U5BA 3IQDB 2JJYA 4M0KA 1MJGM 5IARA 1V37A 5DXFA 4MAAA 3PEUA 1TJ5A 1ZK2A 4G5YA 4IEEA 3EC7A 1VP9A 3ZY3A 1SCBA 3AUUA 4M9QA 4RM2A 5JS6A 3OIWA 5B7QA 3ZNNA 1H2HA 1EWTA 2C97A 3GA5A 3RRXA 3ET4A 4BNXA 3QWHA 4DLRA 5KWJA 4HRYA 1XZAA 4RTKA 1QNFA 3FBWA 3QELB 3HK2A 1E1YA 2VJDA 2NUTB 1Z3IX 1YRHA 2Q3EA 4TL8A 4WI1A 5FOWA 2J6HA 1LPNA 2FSIA 4K3UA 3T3EA 1G7TA 4BVLA 2GARA 4BBZA 4MWCA 1ZP6A 3SBDA 3AVOA 3EAQA 2N9UA 2PSSA 9ABPA 1Y37A 3IJPA 3HL4A 4X97A 3IDAA 1X1SA 1ZM9A 1Z7GA 3O8RA 2GSWA 1E18A 3UWOA 3R0JA 2FWBA 1M5TA 1IG0A 3NHZA 4S1PA 4DMMA 4L0DA 2H2WA 4QD3A 5DTJA 1UMCB 1Y9EA 4KQ2A 2IS4A 1MENA 1PJZA 1M54A 2Y71A 1K4MA 4AJJA 3MOIA 2XNHA 4JKOA 3QE9Y 4KREA 2IZ0A 3BRQA 4ZI5A 3NOQA 1I24A 4TYPA 3LT4A 4AICA 4ZMRA 5E8JA 4HB3A 3LYHA 2XHZA 3QVGA 2GPWA 5ICSA 3FI0A 4EQ6A 4YRMA 3TOSA 1U1DA 3BBPA 5F1YA 2R8PA 2O4CA 2FOIA 1P7ZA 1ZESA 4JA2A 1MX5A 5T64A 1IBSA 4GX0A 1X3LA 3UH0A 4XD7D 4NU5A 3JQEA 4BFTA 1UJ2A 3VNBA 2B1JA 2QROA 4OYHA 4HYQA 4MICA 2VLBA 2FEXA 4B3IA 4RHXA 5BWNA 1RYZA 3V7UA 1IN7A 3HCCA 1UH5A 2EG5A 2PLRA 1W8DA 4P93A 4HRVA 3J81k 2NZJA 4M38A 1IEXA 4HAYA 5EJ9A 2IOYA 2Q5HA 4EMUA 4IICA 3D8TA 2EBHX 3BGWA 4K6OA 2DWQA 4A3SA 3GD7A 4CM4B 3WLFA 1SBCA 1Z5UA 4JI4B 1XV5A 3E8SA 2GUGA 3RI3A 2P5YA 3H5LA 5FDFA 4EHLA 5IF3A 5H68A 4GOOD 2PZKA 4UDYX 3RG8A 2AYXA 3DB2A 1I10A 2RHWA 3F98A 3M0EA 4PAMA 3WZ2A 2G67A 3MM4A 3KU1A 4HB2A 5JW6A 1JJAA 1U3FA 1CDDA 3FTNA 5B30A 1X3SA 5DGDA 1Z83A 2ETVA 5B5SA 1LVUA 1XVAA 3AEZA 3E3NA 4R2HA 4RLHA 2OC4A 1CZRA 1A5TA 2Q6VA 3UENA 4INZA 1NW5A 1XZLA 4ZKEA 3VKWA 1AMNA 2NZYA 1H3EA 2CJPA 5C4MA 4IG9A 5KDDA 2PV7A 2W37A 1UZNA 4E03A 4KYIB 4KNVA 2OLKA 5K5EA 1BMFA 1DAEA 3G2MA 2BY4A 1EUCB 2DPXA 4NCBA 2BSQA 4D5EA 2JHPA 4HAZA 1YV9A 1S2GA 4EJ2A 4NS4A 4XLTA 2GI4A 1UPFA 2WDZA 4ZAGA 4E13A 4JI2B 5CFRA 1G20A 1H0KA 3DNFA 1TRHA 2F43B 5IMSA 3OF2A 1JGTA 1DRVA 4FYKA 5EP3A 3VGPA 2PUEA 1H8HA 3VU8A 4H7JA 4DA0A 1GLNA 3GFTA 4D6XA 1UXJA 3NIWA 1YB2A 1F51E 2RGCA 2O8CA 1HFJA 4JJIA 1XA4A 1GG5A 2A5FA 2Z6VA 4V03A 2BRUC 4WZAE 5JD6A 2BKUA 3ZWYA 3SDBA 4KUEA 4ER5A 1EHYA 4H1UA 2PRZA 3LKVA 2H7YA 1I94B 4D41A 1PQYA 1COWD 2CMFA 1CYDA 3EXG2 3TQSA 3BB4A 3KB1A 721PA 2ID7A 1KH1A 4LRUA 4L72A 4ZO7A 1K98A 3F3YA 1X14A 5ILQA 4BJ3A 2H9AA 5B2ZA 2E55A 2GZ1A 1JQKA 1BWSA 1X7XB 1U9IA 3M6XA 3NVMB 4K88A 4ZANA 4UHHA 3ZGVA 3W34A 2CDBA 5JOQA 2ILTA 3PIIA 4P3KA 5AIBA 1E4YA 2HBQA 1A0OA 1AKMA 4NNPA 4B82A 1IBKB 1M2VA 4JL8A 3KSUA 1E3QA 1JRLA 3GLGB 3F97A 4F4JA 1M9NA 3JTEA 2VJPA 3EMBA 2QE7D 3IEKA 4F2WA 1U7HA 4IVRA 4LRQA 3N59A 1ZOLA 2JFOA 3OP4A 2P0EA 2Y1DA 4MW2A 1CY8A 1WEHA 3S29A 1TVKA 3D5EA 3PC8C 4J6FA 1UXGA 1XTKA 2E49A 3DR3A 3P2IA 3MELA 3TLJA 2IJGX 2DBRA 3CUEF 2VK2A 2ZXFA 4X8OA 4F21A 1QONA 5FULA 1AKUA 3IVRA 3CRW1 3LQYA 4G09A 3VTAA 1VE7A 3R7AA 1XTBA 1RYHA 4J0FA 1LDEA 5E9WA 1XLVA 1SZPA 1NQXA 1N2OA 4UW9A 3TTTA 2Q29A 3MAJA 4LNUB 4IOLA 2FSSA 1ML3A 1LLCA 1WV0A 2Y1XA 4I3HA 2EZUA 4GP9A 5A9SB 4X65B 5D51S 4CT0A 2VA8A 2MCFA 1IRXA 2IU0A 1PJRA 5JC1A 4KEAA 3KPYA 2OQIA 4RJLA 4UBNA 3U0BA 3KQQA 2R00A 2EVWX 3LDHA 4DQXA 3LDAA 3W0LB 4QX6A 3DDUA 1M34E 4HZUA 4AVYA 1B4DA 3MPUA 5IC5A 4B7XA 3LX8A 3RREA 3FBGA 2ZRQA 1V8OA 3Q87B 1YAHA 1PK8A 1J2UA 1SG0A 2GK3A 2WT8A 3H8SA 3MHPA 4BV3A 2WU8A 3AESA 4OMDA 1E66A 3HLTA 3I9V1 5A0VA 4GE0A 1LRKA 3FNQA 3U3ZA 5I7OA 1YA8A 3S8EA 1E1LA 1XGKA 5IVDA 1EVJA 3O90A 3PNBA 4TKUB 4PVCA 4DWOA 3ZQKA 3R4VA 3HBFA 3C87A 3GARA 5TGZA 5DULA 1P4SA 4BAUA 3T1VA 1E8MA 4FS3A 4BMPB 1MB2A 1SMKA 3C39A 5IULC 3H0CA 4JITA 1U5AA 3SXUA 3FGPA 3RW9A 5JTUA 1FP4B 7ADHA 1L2TA 1D0IA 2SICE 5E2IA 2W8ZA 1M2FA 5CMLA 5FV7A 3CLKA 4IQ8A 4D6YA 1FLDA 3HYSA 5DU2A 3UWMA 5E7MA 3VC3A 1S9HA 4O33A 4OQQA 4FDMA 3KSMA 5BV2P 5IF9A 5KPJA 1XPUA 2B69A 4D56A 5LLSA 3BX1A 5AUQA 1DTEA 3HP7A 1UQRA 3L8ZA 4IV0A 4E32A 4LAFA 3ET5A 3ZIAD 1NQ5A 4MYHA 5AVKA 4B8WA 3ENNA 1N6OA 2Q1WA 2XD4A 3PFGA 4LRTB 4TL7A 5EXTA 1XWIA 1RWKA 3Q3EA 4DIBA 4AY6A 1EG7A 1JKXA 1NFQA 2ERCA 3CW9A 1XMJA 1W44A 4RFSB 3D3EA 3VNUA 1CRPA 1WQ4A 2P2GA 5CDFA 1ZJZA 2E5FA 3X43A 2WM9B 1O9HA 1PD0A 1CE8B 1MX9A 1OX5A 2H1SA 3A31A 3BWDD 4G4SO 5A5GA 4N40A 5L3QA 4DJTA 3HCDA 1TX4B 3KKNA 2DHRA 3CZAA 3IQEA 3PGKA 3QEKA 5DVZA 2OTCA 4KWHA 4HMOA 5HBGA 3ZDCA 3ZGZA 2EW8A 4IGFA 4EG3A 5TARA 4HTAA 3MQFA 2PUCA 4DG8A 2P8JA 2FVXA 2WYOA 3T3IA 4DEXA 4S12A 1CUXA 4N7RA 3W5VA 4NEQA 2KBEA 3MLEA 4V1CI 2RC5A 1SHKA 3OEYA 4R2KA 2YVAA 1AHIA 5EE1A 3UXHA 1PJTA 2BFFA 1DSSG 4EKDA 4LYFA 3KFXA 5LQDA 3R0XA 4P81A 4CMHA 5JBNA 3GH1A 2O0MA 5EMMA 3ILYA 1ZG3A 3IUYA 1WW2A 5JSUA 3GLFE 4QQRA 3PFWO 4RKQA 4CQJA 1V8BA 1PWHA 2D1TA 4CTMA 5DYGA 3CGWA 3T35A 3WXBA 3WX0A 2V74B 5JH7A 2G6TA 1T0HB 2J0QA 4Y9UA 4I4TB 1J7KA 1E9EA 1RWQA 5AW5A 4P0QB 4P4GA 4TWJA 3N6VA 1E20A 4XQGA 4H6WA 1N3IA 1KI2A 3I01A 3DDCA 3IX7A 4E11A 1M7HA 4W5WA 3RQSA 4ZCRA 3I05A 2NX2A 3I12A 3FDJA 1L3CA 2W11A 1L5HB 1AGRA 1Y4ZA 3C6KA 3B1VA 2I62A 1G5QA 5CXUA 3OT1B 1FNBA 3PNLA 4N9QA 3VDQA 5MHTA 2GBLA 3LECA 4BWFB 1AKYA 4HGQA 5E9JA 3HO8A 4A0GA 2ZM5A 1JH9A 4NAHA 3U60B 1UK7A 4E0BA 4LHSA 3RIXA 3CSDA 5B7NA 3P5BA 1CDEA 3NKLA 3RS3A 2WINI 2ZG6A 5ECWA 2G1AA 3AIIA 3IPRA 3JQAA 4LX0A 4DMCA 5BMVF 3MRSA 4BVKA 3RH0A 3ZZ0A 1FP4A 4G1VA 4NENB 5EC8A 3Q9SA 1SKUA 1QV6A 2VK8A 2CJYA 1UWVA 1C5KA 1DJQA 4KXUA 4RD0A 4Y6RA 4AURA 3T1YB 2H7CA 3SVLA 3Q5GA 2V9PA 3QVGB 3LOPA 5CCDA 3FPLA 5DV9A 4WK2B 4CV1A 2XYRA 4KR2A 1Y6QA 2Q0QA 4A1OA 4L95C 1R37A 1XJ0A 1UJCA 2P9QA 3RBXA 1GPDG 3CT4A 5IRCD 3K1AA 2R1TA 3NO4A 4J2TA 4G8DA 2GFHA 2UXCB 5C8ZA 2DHDA 3A6FA 3DE1X 1XKLA 4U00A 1KEPA 3R8CA 4JKYA 1F2VA 3EVNA 4NCNA 2Z1DA 1UPAA 4N3NA 3SBXA 4F96A 3G17A 2QQGA 4J1SA 3WIUA 4HGOA 1VA4A 1E3DA 1IATA 4DMRA 4V0LA 3ANXA 4ZDIA 2VK4A 4QU0A 2WPDA 3OTQA 1LFAA 3PB3A 4FYYA 2WU4A 2P2CA 1VMDA 3IKJA 2DHEA 3TSCA 1JQ3A 1P6XA 1V2HE 1K5GA 3MJRA 4LDQA 3MPOA 2PO7A 4G0WA 1KQFA 1NHGA 3DV9A 4GX2A 5EP1A 1AQIA 4UOEA 1AGNA 2YX1A 2VCHA 3NV7A 4WKCA 4P9NA 1L5YA 1OXTA 2FJPA 2O5VA 2X1LA 2FZKA 3AIKA 3GXBA 2X15A 3H1GA 4L02A 1FPMA 2ZPUA 4TL6A 4WZAA 3GLIA 1W29A 2FY8A 1TKRA 1CIPA 1XCMA 3G1UA 2SKEA 1RVV1 2V5VA 2VEOA 5EL0A 5FWDA 5L4NA 4D3SA 2NADA 1U7ZA 3MWKA 2GMWA 5LBTA 2H4FA 4OSEA 2H18A 2ZIGA 3VOSA 2OMEA 4R9UC 3SI7A 2QBYA 5HKKA 5CVJA 1G8HA 2ZCUA 1GADO 4JN6B 3TUIC 3EDQA 2V3VA 4RQUA 1VCMA 3PHIA 4GC5A 3TTUA 1U2GC 2CUZA 3ZGLA 2PIAA 1ECFA 3RK0A 2W2XA 2VHUA 4BO8A 1DQPA 1IDN1 3H17A 2Y1FA 3CEJA 3D3JA 2G40A 2IE0A 5JNTA 1IM5A 4M54A 4RUKA 4W8OA 1M2NA 5FUWA 1N2