4PSVA

Mycobacterium tuberculosis reca phosphate bound room temperature structure i-rt
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
311
Chain Sequence
PDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 311
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4psvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4psvA01
1KO7A 3IHWA 1KO5A 3T34A 1XMVA 2BIFA 5J4LA 1D2NA 4Q4LA 3R9WA 4M1WA 4Q19A 3TJZA 3SOPA 3T1QA 3AQ4A 4MYHA 4IOLA 3JVUA 4TLBA 2QPTA 4QBIA 3ZVRA 1KO1A 2OAP1 3UANA 3BH7A 3GLFB 5HCNA 3KB1A 4RD1A 1WBDA 4R2HA 1E3MA 3AVTA 3NG1A 2ZE5A 1MT0A 4XWOA 1OLOA 2GF9A 5EE0A 1NLFA 4Q4JB 2D2EA 2WPDD 1Q21A 4YLGA 3TSWA 2QNRA 3MMPA 2MSCB 3KL4A 1BMFD 2H1LA 1Z2AA 2DPXA 4DVGA 1LW7A 2ZI7A 3MJRA 3PENA 2WJIA 5EE5B 1XD2A 3I1FA 3W5IA 5IK2D 2ZRMA 2VTKA 1Z08A 3VHXA 3R8FA 1QHXA 1JALA 4DDVA 4HLDA 2ZRPA 3Q5DA 4M1MA 4XWAA 3KKQA 3WBKA 4BFYA 4EFNA 1DELA 2QZ4A 4QKQA 3V4FA 1ZU4A 2AXPA 4DUGD 1Q3TA 3KQHA 1W2GA 1OXXK 4LSGA 4DRZA 3AVQA 4ASUA 4ERNA 1RRCA 1D9XA 1P2VA 1QG2A 2VHQA 3GQBA 3KFVA 3EA0A 2PZFA 4IVRA 3RS7A 4FXPA 1YR6A 2JAQA 1Z0FA 3BBPA 3WY9A 3CPHA 5FBWB 1GIAA 1H8HA 1SXJD 1COWD 3UMRA 1NN1A 4HSEA 4EAQA 1G291 2R44A 3A58B 2I3BA 3FWYA 2BBSA 1N3BA 1R5BA 3KJIA 4L16A 3HP1A 1R8QA 1E1RA 5ELXA 3UWKA 3U7HB 5FPYA 5CB6A 3SHWA 2ZI3A 5AK0A 5KSYA 2IYUA 1ZIOA 4G5OA 2GXAA 4LUCA 1M74A 4CT4B 5F9HA 1E9BA 5FPHA 2NO7A 4JBYA 2R62A 3TE6A 3K0FB 4LDJA 2VH5R 1Q12A 1TEVA 4HDCA 3H86A 4Q1EA 1XD9A 3AGPA 1DVRA 1E2JA 4Q1FA 1QVAA 2Q3HA 1NSFA 4GMDA 3V00A 4E5UA 5HR5A 3U44B 4M2LA 4Q9LA 4B44A 1KMHB 1XB2A 4TMKA 4US0R 3U2QA 4Q4AA 2AD1A 1OXSC 3ZS8A 2GWHA 3GFTA 1P5ZB 4ZCMA 3T1VA 1HV8A 5H70A 1GUAA 3I61A 2IWHA 4Y0VA 1DG3A 4PC2A 1TPZA 2QE7D 3WRXC 1S9DA 1NSTA 3QPVA 1OH7A 2IXEA 2CNWD 1PV4A 5C2JB 3U7EB 4EKDA 4QNRA 4U7DA 3ZVNA 4YMVA 2VRWA 4WZAE 3THXB 1NVVR 2XB4A 4BEBA 3AVOA 1Q44A 2C9CA 3OHMA 3NHAA 1JXMA 4C0AC 1UFQA 1DBSA 1Z6TA 4AURA 2GF0A 4JLBA 1F2TA 1X8KA 2EYUA 4KHZA 4UJ5A 2F3RA 1NBME 1CJUC 2DY1A 2PEZA 1ANKA 1TEXA 3LRPA 3QXSA 3LD9A 3VX4A 2Z5FA 1S9HA 4W5WA 1ZC4A 1OFUX 3X1XA 1EXMA 1EWRA 4DBLC 1OH5A 1AS2A 2IYSA 2XB2A 5EUMA 5GJBA 2N46A 1GKIA 2ZVQX 4Q1BA 1KK3A 2YJTD 4XOIA 1QHIA 4FMDB 3TR5A 1CR2A 3U7GA 5H8WA 2JJ2D 3TUZC 3BGWA 4UXJA 1ZVQA 3C4JA 5FUXA 2EU8A 1DAFA 2WIBA 2ZRFA 3QOFA 4LJ9A 3MWJA 3ASYA 4BFVA 2ZR9A 1ZINA 2J7PA 1U2RA 3P20A 1GP2A 4NYIR 4RCYA 1KJZA 1T3SA 1XEXA 3W5JA 5L3VA 3ZGXA 4A0RA 3WXMA 5SZIA 2EWWA 1UBGA 2JDIA 2V1XA 1R0ZA 4RD6A 2G9NA 3ZLJA 1HE1C 1P4SA 2CE2X 4P3YA 2J0QA 4MA4A 3GJ3A 4D2IA 2O52A 3ETLA 4HAYA 5BW8A 2IW3A 5HE9A 2BVNA 3P1JA 2EYQA 1G4UR 1DTSA 1W46A 4RZ2A 4ZDJA 4YQFA 3FHTA 3R7WB 4LJ6A 1A82A 1W0JA 1Z3IX 3I8XA 1FP6A 2IHBA 1GNQA 3VX3A 3W8RA 2DWPA 221PA 1RPZA 3SNHA 5H68A 2GCOA 2VHJA 3AVWA 1EX6A 2XOKA 4QGFA 5KSZA 3SHFA 4CEIB 1OFHA 5C4MA 5KHOC 1J8MF 3AVUA 2JATA 1AGRA 4Q9HA 2WWIA 4FI3C 1KJWA 2C9YA 1R2QA 5G3ZA 4CIDA 1W1WA 4FMDF 1TQDA 2A9KA 2FPKA 4D25A 4KLZA 3WYAA 3SI7A 1QHYA 3QKSA 3CF0A 1DAKA 4KVGA 4LJAA 2ATXA 4QJ4A 2EFGA 4B76A 3J81k 3BB3A 1OH8A 2QRNA 3NEJA 1S8FA 5E7IA 1CLUA 4MYTA 2ZI5A 2IYYA 4RKFA 5FI0B 4RJLA 5D3QA 1XXHB 3QKRB 5IRCD 3UG7A 1US8B 3NTUA 5P21A 1G20E 2DFKB 2JCSA 2XZLA 2D4HA 3RAPR 1HT1E 1XDBA 3EXAA 2UVQA 4FIDA 3PXGA 1VHTA 2IF2A 1G8FA 2HF9A 1W4CA 3WNDA 1AJEA 4LHXA 2GBLC 1L7VC 1T5LA 2BJWA 3A1WA 2IBMA 4RFVA 4QG7A 1OB2A 3BC1A 2XZOA 5EZ6B 2RB4A 1KZGB 3RHFA 1DOAA 3NKVA 3PEWA 2QTHA 3RC8A 2XJ9A 4BECA 4A2WA 3IIKA 1VYVA 1G17A 4F7WA 1UM8A 1J70A 2ZUCA 4A8JA 1RC8A 2RGEA 2VL7A 1Z6YA 5B58C 1Z47A 1NBMD 3H2YA 2MSDB 3CZPA 1GRRA 1J2JA 4B35A 4MKFA 5CYPA 3I73A 3JZAA 2ODEA 3RWOA 2P6RA 3TVTA 2YKGA 2CL7X 1KI4A 1SKYB 3T06B 2AXNA 3SU8A 4PQYA 4YMUA 2HXSA 2NZ8A 4QJ3A 1E9FA 2CCGA 3THOA 4UNPA 2RAPA 4B47A 4WXRA 2WICA 1IHUA 1J7KA 1Y3AA 2VSXA 3AEZA 4AI6A 1E1QD 1BMFA 5AJZA 4L15A 4Q01A 1ELOA 3UPUA 4JT2A 3ND9A 2WSSD 5IK2A 1J8YF 1K5GA 5EP3A 4PC6A 1T3HA 4PSKA 1W5SA 1GRQA 4QOSA 2AKAB 3CX6A 5KYKA 2GJAA 2OV2A 5EE1A 5G41A 2FFQA 3IDQA 2GZHA 1E0SA 3GFPA 3SFVA 3P4YA 3VR2A 4DUGA 4BLSA 3K9LA 2CLCX 2WJJA 3S1AA 3CM0A 1TU3A 2WM9B 4JVSB 2REOA 2O8CA 3ADDA 3GLHA 4JLOA 1GWNA 4IHQA 1SXJA 3SZRA 1TL7C 1COWA 2ZJYA 2IYXA 5B64A 1L2TA 2ODBA 3EZ2A 3OE7D 3AB3A 3MCAA 1GNRA 2JJ1D 3ZDQA 3M1IA 4RFSA 1Q3HA 1EFRD 3FGNA 3SS8A 1SVLA 3U7FB 2OUKA 4JLJA 3WYGA 4NH0A 5DI9A 2GVZC 3DEFA 3LVRE 3KTAB 2XTNA 4DIEA 4EPRA 3ONWA 3UKDA 1NJFA 5IHPA 1AQUA 1SZPA 3VR5A 4ZDIA 1M7BA 1E0KA 2F1HA 1TNDA 3CRVA 1NN3A 2Z4RA 4A0FA 5HTKA 1M6NA 4EDHA 3GLFA 3B1YA 1EESA 3FMIA 3UIEA 3QBVA 2BDTA 2HCJB 4C0BA 1JJ7A 1M7HA 2JIZD 2IF0A 1LS1A 1NG9A 1A4RA 1OKKD 1LVGA 2FX3A 2GETA 3E2IA 3NEYA 3QXCA 1S3GA 2QE7A 5BYJA 1GRNA 1W2HA 2NOAA 3CBQA 3MUFA 4IDQA 4DSTA 2I1QA 4NCHA 4OHWA 4JVMA 4PSVA 2FSIA 1Z0IA 2H8KA 1KSHA 3DM5A 4PR0A 1KDRA 3B1VA 2QL6A 3B82A 3RRNA 1DAEA 2BKEA 1G7CA 2YC2C 2OAQ1 3L0OA 4ASUD 1P2SA 3CF6R 1NF3A 4LHZA 4HB2A 4MKGA 5FI1B 2W58A 2EFEB 2WJVA 2BKUA 3PEUA 2A30A 4Q02A 4CEHB 1LTQA 1NVVQ 1Z06A 5M04A 1JAHA 1E9SA 4LC0A 2R6CA 3OF5A 5BN4A 1MOZA 5L3SB 1N5IA 2D7DA 1XMJA 2LKDA 2ZJAA 1SULA 4LPKA 4LY6A 4OK6A 4FMCF 5G53C 4BRWA 5E3HA 2JJ2A 2ANCA 1P9RA 4A2PA 2BWJA 5FUWA 3L8ZA 4DLWA 1DAHA 2YV5A 2QP9X 3IIMA 2KBFA 2ZROA 2GXQA 4QFMA 4DJTA 5HKKA 1KY2A 4OI2A 1N25A 1R4AA 2XITA 2ZVPX 3LAWA 4UXIA 3R8CA 1E2EA 4DT1B 1YZKA 4I81A 5EXPA 2Q6TA 1T0JB 1SVMA 2DYKA 4EPWA 2H5EA 3QF4B 4Z54A 2F1RA 3KDSE 1CJTC 5L3QB 3FB4A 2CEAA 3K0FA 4MRVA 4L4UA 2A3RA 2YOFA 2D3WA 2XXAB 1G6HA 2ZYTX 1XEWY 3IILA 2CCJA 4DLUA 4C2TA 4NYJR 4MGZR 1QBKC 2E9SA 3BIFA 2OXRA 3QY0A 1KMHA 1Z22A 1RYFA 4UNSA 5F3WB 1NVUQ 3UK6A 3B5JA 3VNUA 3CR7A 1XTRA 2IK8A 1M2OB 1A2BA 1IJEA 4NE2A 4OHYA 2C03A 5JSZB 2NO1A 2ZPTX 4PQFA 1U98A 2V8OA 5AUNB 5FR1A 4BEJA 4CDGA 3THXA 1MRSA 4NYMR 4BGDA 1G8YA 1KK1A 3AVXA 1IXRC 2VP9A 4QNMA 4YMSA 1YRBA 4ZIRB 4AYWA 3QENA 1BO6A 1TX4B 2G6BA 4II7A 4JLKA 4DCNA 2QPOA 3HU3A 3T5DA 1YZQA 2HV8A 3D31A 2GK6A 3GJ5A 4KXFB 2CVHA 3BS4A 2ZREA 2P67A 2QROA 4XSGA 4P33A 1NKTA 3K0AB 2X19A 4V0LA 1ZC3A 3NBZC 3RS3A 1QHGA 1TF2A 2RHMA 1E99A 4QM7A 4DLSA 4P4SB 1LF0A 1SQ5A 1TF5A 4C4PA 4S35A 2FV8A 1DADA 3OIWA 1II9A 1ODFA 2J7PD 2IEZA 2AK2A 2QMHA 2QRZA 3FFAA 3GJ7A 2BEJA 1AQYA 2ZRJA 1JPJA 2CHGA 2PJRA 2QSYA 1O3YA 3Q7QA 5IF9A 1FW6A 2ZU6A 2JDID 2X8AA 3ZD6A 4BFTA 4DC9A 1L8QA 4BFUA 3DZ8A 1R7RA 3L0SA 4KLNA 2WMNB 2WKQA 4YXWA 4LGMA 2Q3MA 3LW8A 4H1UA 2AFIE 4JT4A 4GRAA 3K9HA 1GL9B 621PA 5JZVA 3DOFA 4QBHA 1FTNA 4EQ6B 4V03A 1BYIA 2ZE8A 3T15A 3NWJA 4TYPA 3EWSA 1KI6B 1NI3A 1OF1A 4A82A 3OIYA 4DLXA 2CMKA 5JHGB 3PJRA 4OQNA 1SXJE 2AKYA 2RGGA 1OFTA 2GRJA 3U61B 3R7WA 2V9PA 1G16A 4GP7A 1E2PA 2IYZA 4PHHA 1AN0A 3RANA 2BHRA 3THYB 4BWYA 4KFTA 2QG6A 1FMJA 3V9PA 3ZS9A 2JGNA 2XNSA 2KWIA 5J4VA 5JFGA 1KSJA 1FQKA 3K0CC 1HQCA 4DWJA 2C8VA 2ZSAA 3TGPA 4B2PA 1P61B 4LV6A 5K8TA 4Z1MA 1OXVA 4I1VA 3PEVA 1W4AA 2ZUDA 3L0IB 3GLFE 3OZXA 2VHTA 4XVQA 1FFHA 2NPIA 2VIIA 3SJBA 1NY6A 1ZM4A 1E1QA 3GJ0A 2QEQA 3C5CA 1G3MA 4EIWA 1GM5A 4TYYA 2WSSA 3RNLA 3LWNA 5C4GB 1I4TD 1GZSA 1EFCA 1QHSA 4TMVA 5KNDA 3LLUA 1WA5A 2FSGA 3QKRA 4OHXA 2REBA 1US8A 2C99A 4ZDWA 3AP1A 1Q1EA 5TXGA 3PR1A 3NHBA 2YWHA 3W8NA 5FFMA 3U6BA 4ZCLA 3PV0A 2VA8A 2GBLA 3IBYA 2AWOA 2N42A 2YC4C 3QQ5A 4KSCA 2FDCA 4RZXA 1OIVA 1YHNA 2A5GA 3IQXA 1T8UA 4Q4HB 5D3MB 2BBTA 3AF0A 1E32A 2OHFA 2OCYC 2X77A 3A1UA 3L43A 2Z0MA 1XJCA 5TDHA 5KUTA 4M1TA 3BFVA 5FBVB 3OE7A 2DFTA 4MKHA 4MRPA 1OE0A 3K0EA 4TMWA 1EFRA 3BFXA 2HJVA 3Q9LA 5BN3A 3A4LA 2G77B 2IEYA 4XVRA 4IEEA 2PBRA 3TSOA 2HYDA 1YU9A 3CIOA 1QHHB 2OEPA 4CGZA 1SGWA 4WIAA 2FOLA 4H9GA 1HE8B 4UJ3A 4KBGA 4TT3D 3V4RA 1OW3B 4HLCA 2WWYA 1EGAA 2OCAA 2YYZA 4Q7MB 4XTRA 4B74A 1AGPA 1NP6A 3SQWA 3GLGB 5EZ5A 1E79A 4B2IA 3VR3A 1T8TA 3B85A 4NONA 3SBEA 4R71A 4IFBA 1WE2A 4M8NE 3FTQA 4KAXA 4BLTA 2CDNA 3FKSD 1SHZA 4F38A 1XNJA 1NKSA 1N6RA 5LBIA 1XCPA 1DO0A 2JIZA 2GJ9A 1OV4A 5K8LA 1BKDR 2HT6A 1G7RA 3CUEF 1OKKA 1P60A 1TU4A 2ZS8A 5DO9A 1II8B 4JJZA 3WMFA 4NPHA 1R8SA 2D74A 1D5CA 4D81A 1KHTA 3AVPA 3LLMA 1N6KA 4ACAA 2CL0X 5UKDA 2GXSA 5AWFC 2YNMA 4GOJA 4PTLA 1A1VA 1CEEA 5JEDA 1GNPA 4IJMA 1E2NA 2EFDB 1X6VA 2SHKA 4YONB 1X86B 4DLZA 4RY2A 5KDLA 2Q9AA 4ZPXA 2ZSEA 4BQSA 5FTLA 3C8UA 3QKUA 4MRNA 4ABYA 2R6DA 2EVWX 3EZ9A 2BV3A 4OHVA 4ZKDA 2NPFA 4QC2A 2GJKA 1YZNA 2OCPA 4HI0E 4LJ8A 1UBEA 3AGQA 4DCUA 1SVIA 1G7TA 4V0MA 4BZXA 4URVR 1CR0A 3NC1C 4OQFA 1UPTA 2ZU0C 5A0FA 1XPOA 2FU5C 3BERA 1G7SA 3H0KA 4LRWA 5FTKA 5FBQB 2JLWA 5H1YA 2WKPA 5EXSA 2OM2A 4DZZA 2ZQ5A 4X8MA 3QI2A 4HLQB 5CB8A 2P5TB 3EWAA 3OIVA 1UAAA 3W6PA 2CK3D 4KFSA 2V7QD 3KTAA 2VHUA 3PFIA 5CJ2A 2LKCA 2ZSDA 2DFNA 3CRQA 3SYNA 4HZUB 2R6GA 1M1YE 2ZE7A 3QJYA 4XVUA 1UDWA 2RCNA 4EPVA 5E7JA 2FNAA 3THWB 5DI3B 1VYUA 1U94A 3I32A 2JEOA 5JS8A 2PMKA 1JXOA 1G1MA 4GZMA 3MGCA 5TY0A 2W2VA 4AC9A 1Q1ZA 1T0HB 4GNKA 5FPSA 4NCKA 5EJEA 2QN6A 2YOGA 1NLYA 5HE8A 1Z28A 2O5VA 1G6OA 5DE3A 3VQTA 3O8CA 4LBZA 3TNFA 1ZNZA 1W4BA 1E9DA 2AHOA 1N0VC 4XD7D 4NKRA 1EFUA 3N5CA 2DWOA 1ONBA 1DAGA 2H18A 3QXXA 3RABA 2BMJA 4PO9A 4BLPA 2FPMA 4WZBE 1DS6A 4V0OA 2ZRGA 1NJGA 2JLQA 3FPAA 1AM4D 2V6IA 5CM8B 4PAQA 2QSZA 1T9HA 4LPSA 4A4DA 2A2ZA 3R9IA 2X2EA 2E1RA 3WYFA 2O0HA 3KFXA 4OYHA 3PG5A 1VG1A 4JLDA 4YMTA 5KPDA 4D4KA 2IS2A 1GTVA 2C78A 2ZJBA 1N6HA 4A6PA 1N5JA 1X8JA 1W36B 1T91A 1W36C 1B23P 5ANRB 2UZIR 5JBQA 3CX8A 4M9XA 4MH0R 5AUOB 4CEHA 2BM0A 1WBBA 3LVQE 2WVJA 2P2LA 3KUDA 2QTFA 1VCIA 2XEXA 3A6PC 2RMKA 4EFLA 5L3SA 4G01B 5DHAA 2AWNA 5KSPA 5HKKD 3G0HA 1G21E 4F4CA 1G8PA 4M9SA 2ODWA 4QGHA 1OIWA 3GEIA 3LBNA 5DISB 3UWOA 1WQ1R 1Z0AA 1KIMA 1P6XA 1IXSB 1YKSA 2YWFA 2MMGA 2Z43A 5HZKA 5EUQB 2H16A 5KTYA 1G41A 2VPPA 1FPMA 1OFIA 2FN4A 2Z83A 4M9ZA 1E2GA 2OBNA 1F48A 1VMAA 1QVRA 2X1VA 4EPYA 2VP0A 1OPXA 2CHVA 3BH0A 3CNOA 4B43A 2H7VA 1H8EA 3K9GA 3NXSA 1XMIA 3QF4A 2OLKA 2Y8EA 4KBFA 2WWFA 4I1UA 2PJZA 1XPUA 1IN6A 5TV2A 1VECA 5L3QA 3QUSA 3EA5A 4FMBB 3EARA 2NIPA 3RWMB 3VKGA 1OSNA 2C2HA 3CWQA 3HPRA 1S1CA 4CF7A 4M4SA 3QIAA 2XXAA 4NCNA 1G5PA 1Y63A 4JL6A 3EPLA 1KDTA 1QZXA 3E70C 5AR1A 1SHKA 2QU8A 4Q1DA 2ZM5A 5GJWC 3SBDA 1XP8A 2QMOA 2W6ID 1V43A 5DNYB 2ANBA 2QPAA 1ZM9A 4XWKA 2VEDA 4DLTA 4MDEA 1MV5A 1P62B 2IS4A 4LJYA 2UKDA 3ASZA 3DVLA 4IVQA 1BIFA 3FVQA 4KSBA 4QHTA 5JSZA 4NL4H 1EFHA 5TB5A 3A37A 3GLIA 1JR3A 3CO5A 3LH5A 4WA7A 5EP1A 4F91B 4Q48A 3NBYC 4BFXA 2IYRA 1DG1G 5JWOA 2Q9CA 4IDOA 5LB2A 3VAAA 4ZIRA 2HDNB 4HATA 1R5NA 4UNQA 2F43A 3MLEA 3SFZA 3K70B 2ERXA 2HT1A 2YZ2A 3K70C 1ZUIA 3Q3JB 5AJYA 4ILEA 5TMPA 1EX7A 1NMXA 2QT0A 1SKYE 4QGAA 1CF4A 3VKWA 1FOEB 4ZKEA 3TW4A 1XD8A 4GI7A 4IKEA 2GEDA 1GAJA 3K0AA 1QF9A 1DEKA 2D7CA 3MSXA 2QY9A 5CIQA 4P4SA 4OK3A 3IKJA 1KAGA 4A0HA 2ZRAA 3UMSA 1VIAA 4F4JA 3E1SA 2C9OA 2ZR0A 5EE9A 1U81A 521PA 2E87A 5KOYA 1YR8A 4C0KA 2IUUA 1KI1A 3VR6A 3FE2A 2D06A 2FSHA 3RSOA 4YXWD 2ZRHA 1BS1A 3FYHA 3U5ZB 4IXNA 3TAUA 5LPNA 3K8YA 4Z8YA 1MO4A 1IY2A 2PT7A 5CLQA 2AL7A 1D2MA 4GBMA 1JB1A 3IEVA 4RCZA 1RZ3A 1Z29A 3A4MA 3VHLB 1LFDB 4PPQA 2GAOA 1XRJA 2VQSA 1YZTA 4I1OA 4IXMA 1ZM2A 2B6HA 3SYKA 1AA9A 2GVDC 2NO9A 4NDZA 5FBRB 4EQ6A 2XTZA 2QM8A 4B3DA 5CYOA 4TL7A 1Z0KA 1KI6A 3BWDD 3MWKA 4LYHA 2D62A 4L5BA 5B57C 4V0ME 1HT2E 4F4IA 4PO8A 1J90A 1RRGA 1SVOA 4DEXA 1MABB 1XJQA 4G5QA 2ZR7A 1VCMA 1W44A 2QAGB 4DSOA 4ESHA 2QAGC 4JZKA 4PZYA 2EFCB 4C0LA 1U8YA 1C4OA 2ZTSA 3B7GA 5CIWA 4Q7KA 4HUTA 3THYA 4TT3A 1Q0UA 4E07A 4W9MC 1NRJB 2OESA 2O8FB 1OHHD 4BE7B 4Z1MD 4PC1A 3VKHA 3P32A 4ZI3A 1KDPA 4IVPA 2OFXA 3K0CA 3VR1A 3RS0A 4DSNA 4URXR 4TQUS 1E2DA 4QGGA 2GDJA 4KFUA 4LHYA 4GZLA 3H1TA 3QG5A 4A0GA 1T4GA 2FA9A 1R6BX 3FKSA 1JEDA 3AKEA 2OFOA 3HU2A 3X1YA 3ZIAA 3TKLA 3K70D 1KYIA 5DHFA 3MD0A 1D6JA 2ZI4A 4B6FA 2V6JA 4U00A 3AM1A 2RGNC 2AN9A 2XX3A 3WHKA 4DHEA 1BYUA 3CF2A 2FFAA 1XMSA 4QBFA 3TAHA 2ZRKA 4JYCA 1GITA 1CKEA 3IHLA 1ZD1A 1KMQA 1NVWQ 5J4YA 1NL3A 2ORVA 4TL6A 3SQXA 2J46A 2K5UA 2ZUBA 3BD9A 3KXLA 3PQCA 1ETUA 3P27A 4NTZA 3TVDA 4P0TA 1G5RA 1R0YA 4IDPA 4IFEA 5DYGA 5DH9A 4AKEA 1U9IC 1ZU5A 2RGDA 5D3MA 4Q4HA 2J9RA 1S4QA 1Z8FA 1M34E 3HJNA 4M1KA 2GCNA 5F9FA 2WJHA 4FMCB 1IY0A 4UKDA 1IONA 1FL9A 1RRFA 2DWQA 4HAWA 4P4UA 5JLJA 3QXJA 1ZD8A 2UZ3A 3ZZ0A 2XNDA 3FFBA 1N6NA 3AVYA 4P31A 3U3JA 5JWRA 2GEVA 4IRUB 4HLUC 3SEAA 1II0A 3GCGA 3N2EA 3T35A 1R0WA 3DMDA 4PPGA 2GK7A 3NDPA 1KI9A 3TQFA 1QHHA 2CK3A 4HAUA 2V7QA 3TBKA 3B13B 3LXRA 1E79D 2JJ8A 1FUUA 4UNNA 1U0JA 3U3KA 2PZEA 4HZIA 2FEOA 3KQUA 4G3XA 121PA 1AZTA 3CW2A 1S2MA 4PX9A 1KI2A 4TWZA 1ZUHA 2BMFA 5AJWA 4C3ZA 3GLGA 4C0HA 3C16C 2BBWA 1IN5A 2A78A 4LBYA 4Q4JA 2IYLD 4AKGA 4V0NA 2FZ4A 4CYMA 3DO6A 1I4LD 2ZRCA 3DKPA 4B3FX 5JMTA 2Q9BA 3EPKA 2C5LA 4URYR 3CB4A 1TQ2A 3RLFA 4Q9JA 2NG1A 4E09A 3MWYW 3W9YA 5JHHB 2NMVA 2OCBA 1E4VA 1II8A 4A6XA 4Q4AB 1E2FA 1XTJA 5FOXA 5GVRA 4LX0A 1AS0A 2DHRA 1XBTA 4IOMA 2CLSA 4XD7A 3U3MA 1AA3A 3KJGA 1L4UA 4B73A 1A2KC 2R9VA 4JLNA 4DCSA 2KI5A 4BFWA 1CRQA 2IYQA 4B71A 5JJKA 4K8OA 3MJHA 3WHLA 1E9CA 1HH4A 2FH5B 5LD2B 3GLIE 4LBWA 1JR3E 5LD2C 1ZM7A 3IUYA 1Q57A 1JPNA 2FWRA 2HJGA 2NO6A 4PHFA 3HU1A 1F2TB 1UKEA 2O8EB 4EUNA 1UEIA 2QI9C 2B21A 3VR4A 1E9EA 4TQAA 2D2FA 2J59A 2JASA 1LY1A 1XU4A 2F6RA 2AFHE 2ORWA 2IXFA 3B8HA 2RGAA 1Z5ZA 3B78A 1HUQA 1ZD9A 4FD2A 4D4LA 2ZJ2A 2F1JA 4BASA 3NH6A 2YVUA 4N0EA 2QT1A 4TLAA 2A7QA 1GKYA 3ZVLA 2R2AA 1KY3A 2AX4A 1LV7A 4M1YA 1T6NA 2BM1A 1IN8A 4KJZA 3PUXA 3L2OB 4DEYA 3K0SA 4M1SA 4FN5A 5JRJA 1JECA 2PT5A 1FUKA 1HA3A 5J5CA 3AKDA 4TTQA 1CS4C 4URWR 5SZJA 4NYIQ 4JL8A 1ZM3A 3KX2A 4HZUA 4CRWB 5J40A 1XEFA 4TZ6A 3LV8A 3U44A 3GJ4A 4JBXA 1ESMA 3A1VA 2OE2A 1XZPA 1VPLA 3I92A 5DI3A 5LB4A 4ZCIA 5KDDA 3ND8A 3GJ6A 2DR3A 3D3QA 5AUQA 1AKEA 3REGA 2PCLA 3HWSA 4HB0A 4D82A 2CHQA 2W6IA 4DLYA 2VYFA 3AKYA 5L3RA 1YQTA 2F1IA 2J0UB 3ZZUA 3QE0A 3ICQB 1GDDA 3F3YA 5EXXA 3IO5A 1NIJA 3I62A 3RYTC 2LWIA 3MAAC 1CP2A 2PX3A 4KVAA 1KGDA 5TVKA 4ARZB 3U3RA 4WZ6A 3T61A 2CXXA 4U02A 3ZVMA 2EWVA 2FE4A 1X1RA 3CPEA 3LFUA 4MITA 2O8BB 2FF7A 2HUPA 2QQ0A 3EZFA 1G9XA 1N0UA 1RJ9B 3EIHA 4AY2A 4ZI2A 3EW9A 3BE4A 4MRRA 1NMYA 1T5IA 2JLVA 4QXAA 3FDIA 2V1UA 4US1R 3JVVA 1S96A 3IGFA 1XWIA 3LY5A 3TR0A 4QHYA 5GJCA 1VTKA 4NMMA 3HPQA 1G64A 4OBEA 3W6NA 4W5JA 3BB1A 2QP4A 4LK2A 3T1TA 4TMXA 4K46A 3R20A 3QEOA 4JIMA 3DMNA 2R65A 2NGRA 4PHTA 5E95A 1YVDA 3QBTA 2IS1A 1H8ED 1OYYA 3AV0B 2WWHA 1DARA 3AKCA 4PXAA 4RVCA 1MO3A 5F2EA 3CR8A 2YHSA 1TAGA 1WMSA 5JJLA 1OXUA 3LA6A 3R9XA 1ZCBA 3GLHE 2PL3A 1VDZA 1WP9A 2WJYA 5EP2A 4LOAA 3N70A 1U0HC 3IEUA 3GP8A 4GT1A 1CXZA 1FX0B 3OFNA 2ZSBA 4B32A 3DZDA 4YDSA 4GFDA 4EJSB 4U5XA 2QGZA 4EJSC 1FTSA 4TL8A 3AF2A 2ECKA 3BXZA 3IIJA 4LYJA 1ZNXA 1G8GA 2FPLA 4RD3A 3AP2A 1C1YA 1JR3D 2WV9A 4CT5A 2CLDX 4D0NA 1KDOA 2HLDA 1XF9A 6Q21A 4KI0A 2ZJZA 2QP3A 1VCOA 3QPUA 4CEIA 4BLQA 4M0LA 1OHHA 1E96A 4H1VA 2KSQA 4LYFA 4TL9A 1Z63A 5JWHA 3LQQA 1R5OA 3CH5A 2PCJA 3BK7A 3BJIC 1IN4A 3AP3A 1K8RA 2H57A 3A8TA 1PUJA 2ATVA 2YWGA 4OQXA 3P4XA 3UG6A 2IUTA 3A36A 3GLGE 3PCRB 3X1WA 3ZQ6A 1G4AE 2P6UA 4NP6A 1OT3A 2FJUA 1A5TA 1D9ZA 1G3UA 2ZRLA 2KBEA 4NCIA 4DCVA 4OL0A 4A1FA 4ITRC 1Q1QA 1G18A 2B7CA 2F3TA 3FMFA 1P9NA 1R0XA 1XXHA 3RDPA 3UMFA 2VP6A 1CRPA 1XTIA 1RW4A 1M7GA 2EQBA 3KKMA 4TLCA 5FL7D 2QQEA 4O2RA 4D0GA 3LBHA 3LO5A 3GEHA 4XSHA 1RVDA 4ESVA 2IL1A 2VBCA 3ZQJA 3SDZA 4Q9KA 1IOZA 8OHMA 3REFA 3A1TA 1KTVA 5JCZA 5DN6A 5IT5A 2JLXA 4E03A 1X1SA 3QG1A 4I1SA 3KQKA 1FZQA 1KK2A 1P2UA 4D26A 2F9MA 2G0TA 3KUCA 5JRZA 2QGNA 5CLLA 4L8GA 1CTQA 3EG5A 1P7CA 4CEJB 2IT1A 2DCUA 5J4KA 4C0JA 4GOXA 4MYCA 1Q1BA 2GA8A 4O2LA 5B2ZA 3GJ8A 1E94E 4Q7LA 4W7SA 2WOOA 3QKTA 3C15C 3PEYA 4HAZA 2QMEA 3OEHA 3A4NA 3MFYA 4O0MA 2FEMA 3TK1A 2XSZA 4DKXA 3W3AA 3D8BA 4RFSB 1I2MA 4TSFA 2WZQA 4RSGA 1MABA 4BUJA 5C18A 4D6PA 4XIGS 2J0SA 2QAGA 4C7OB 3IPYA 1F2UB 2O8DB 2GXUA 4GPTA 3K53A 4R2IA 2VP4A 2JLRA 1GOTA 2J3EA 1KSFX 1OXTA 1ZP6A 4AK9A 1W0KD 3ADKA 1ESNA 3BFKA 4HB3A 3RS5A 2O8FA 2WAYA 3K09C 3ZIAD 4DLRA 4EPXA 1IM2A 1GVNB 2CJWB 5CJPA 2W6JD 4AIIA 4J0QA 3L82B 3W34A 4LI0A 4EFMA 3T5GA 3UXMA 4WAUA 3VU9B 1PLJA 3IO3A 1O87A 3N2IA 1K5DA 2RGNA 3AH8A 5E7MA 5FPTA 1IBRA 4BFSA 3MWLA 2FGKA 3NBXX 2JLYA 4B33A 1IXZA 2J5XA 2GCPA 4CVNA 3Q72A 1NN5A 4PZLA 1D8TA 2G0NA 4D80A 5JECA 1E9AA 1TUIA 4NCJA 3D7MA 1S3SA 3AUYA 3LNCA 2X2FA 4TYNA 1P72A 2QBYB 1P3JA 1ZJ6A 4RZ3A 2EW1A 5BXQC 5CITA 2H17A 4FINA 4TMTA 2F55A 4B3BA 4BPBA 2VHCA 4JKIA 2OFWA 2WKRA 4XTCS 3T1OA 2ZJ5A 1U9IA 4IDNA 4R98A 3WNBA 2AD5A 4DLVA 1U99A 2XNDD 3O8RA 3F8TA 3CRRA 1IAQA 3JZMA 4YC7A 4US2R 2ZANA 3QVVA 4Q7JB 5FUVA 4RD4A 2NO0A 4TYQA 4HLUA 1UDXA 2BCGY 3KXIA 4MKIA 4OI1A 3KQLA 1DPFA 2IYVA 5CK4A 2R8RA 4HAVA 1Z6GA 1ZBDA 4JJKA 4LWZA 4XJXA 4LC1A 3NC0C 2CL6X 2YOHA 3QPWA 4GL2A 1D2EA 1TQ6A 3QXHA 1X8LA 3BAFA 4JKYA 2L0XA 3E5HA 4HUQB 3OEEA 4F92B 3F5FA 1EFTA 2IXGA 4PPNA 4AG5A 1TF7A 5FL3A 1GILA 1XEWX 4LHVA 1JBKA 2REXB 4PFSA 4Q00A 2A5JA 1F6BA 1NY5A 5DLQC 3MG9A 5A5GA 4KCGA 2VF8A 4PZZA 1XX6A 5AUPB 1DAIA 3ADBA 1KK0A 1SVKA 4M53A 1G19A 1DE0A 1KI3A 1G3QA 1Z83A 2W83A 4Y0AA 3U4QB 1NLZA 2ZIAA 4WW0A 4UNRA 4OHZA 3SJZA 4PPFA 2RH5A 4O25A 3THWA 2WWXA 4NYJQ 4A2QA 3DHWC 2GJSA 1YZUA 3NDBB 3QNUA 2ONKA 4HAXA 1JEEA 1Z0JA 3Q85A 1QG4A 3EIQA 1F5NA 4D4JA 2BEKA 1VG9B 3AVVA 3BH6A 3KZ1E 3NVAA 2GHIA 5C46F 1VYTA 4Q18A 3DM9B 1LNZA 1FNMA 3RS2A 1N5KA 3H84A 1B0UA 1WCV1 1G8HA 2VSOA 4Q9IA 1MKYA 4NYMQ 1SVWA 3RS4A 1OH6A 2O8EA 2ZI6A 2ZRBA 4FW9A 3I8SA 4R9UC 1NVXQ 2WAXA 4LBVA 3G82C 4CZ2A 5EP4A 1Z2CA 4S2EA 4C2UA 1DO2A 4A9AA 3VTKA 4P4TA 2C96A 2FGJA 4KYUA 4ZDKA 1YE8A 5CDFA 1W7AA 2G88A 1YR9A 4QRHA 4BRUA 3CX7A 5FOTA 1AZSC 1CU1A 1P2TA 2RHDA 3I72A 3L8YA 1XXHE 3FKQA 3TMKA 4JBWA 5SZKB 1R10A 3W3ZB 4DCTA 4A15A 4DT1A 4MGYR 2IX3A 4LZZA 4MQBA 5JCPA 2JLUA 3IQWA 4URUR 3B60A 4Q5IA 5C1BA 3EASA 4QM6A 4KYIB 2OBLA 3PUVA 1N6PA 3KQNA 1F3OA 1SVSA 5FOVA 1FP7A 4B3GA 2Q0HA 5FBLB 4DDUA 4TLDA 4PAOA 1E2MA 5HZHA 2G3YA 3NBFA 3TUIC 2A5YB 4MDFA 4TTRA 4C30A 1JI0A 721PA 5LDDC 3B1ZA 4B2LA 1XCGB 3CZQA 2I1VB 1OJLA 3B1WA 4Q1CA 5TARA 4YMWA 3HDTA 5K8UA 5FR2A 2G1KA 2WWWA 2B92A 3DDCA 3FOZA 4QHSA 3AUXA 4KV9A 3TW8B 3SE0A 3VFDA 1UBFA 1S1MA 2J0UA 4MRSA 4CW7A 1QDEA 4O3MA 4ARZA 2V3CC 1QRAA 1E4YA 4IDHA 4HB4A 4LV5B 3LXXA 5EXTA 2P6NA 3EC2A 5BN5A 1SKQA 4AYTA 3OESA 1HY3A 4DDWA 4JMPA 1BH2A 2VF7A 4OKSA 2O8BA 4W5HA 1W36D 1U0LA 2WBLC 5G40A 4ACBA 2HCBA 3I5XA 1RJ9A 1VG8A 2B8WA 2B8TA 1UKYA 1XFAA 2ZAMA 2OZEA 4Z8XA 3CNLA 4MYUA 1G3RA 1YZGA 4JS0A 1BOFA 3LX5A 1AKYA 2C98A 2GJ8A 1YJ5A 3K9NA 4NU0A 2A5DA 2P0EA 2GAAA 3AF1A 2WSMA 2Q3FA 3GFOA 2XGJA 4IOKA 4LJ7A 4OK5A 3TIFA 5FL7A 1IN7A 3O8BA 1P75A 3GMTA 2P5SA 3SC3A 4RZUA 4D4MA 3EZ7A 1UKVY 3HYTA 2ERYA 3W6OA 2W2TA 3G5UA 4OI0A 1S0UA 4MUAA 1LB1B 3PITA 4AD8A 4LJ5A 2HEIA 4HDOB 3L0PA 1LF5A 1W47A 2IUSA 3BB4A 3Q8XB 4IOJA 4G5GA 3KKNA 1XZQA 2XZPA 2BC9A 4AWXA 4EPTA 1ZRHA 4TYWA 4V02A 1ZW6A 4JL5A 3SJCA 1PZNA 1N6IA 2J45A 1E2QA 3OFND 4C0QC 4B6EA 3BORA 2VLIA 1LS6A 5AJVB 1XTKA 1WB9A 4DDTA 3AF4A 4MUBA 1F60A 4RD0A 3SYLA 1EWQA 1FX0A 2AR7A 5FPKA 4N1AA 3OAAA 3I5YA 5EQTA 2HLDD 2J7KA 2WHXA 1IY1A 1E2IA 2QTVB 4EJSA 3KKPA 5JI3E 2QORA 2Z4SA 3EZ6A 2ZSFA 3WP0A 4I4LA 4C9BA 2O0KA 4PO1A 3KJEA 3X1ZA 2VP5A 2HF8A 1W0KA 2W00A 3I4LA 5HCIA 2ZAOA 4PC3A 5B30A 4JSYA 4BFZA 1Q20A 2PMDA 3NH9A 4PANA 2W0MA 1NNEA 1CBUA 1WF3A 2YINC 4E22A 3DL0A 1FNNA 2B7BA 5CK5A 3AF3A 3ECCA 2F9LA 1IJFA 2W6JA 2ZYVX 4G5RA 3RVBA 1GKUB 5JS7A 3M6AA 1E2KA 3FHOA 1CR4A 1V5WA 4PC7A 4UXHA 3RC3A 5GADl 4DXAA 1Z0DA 3B1XA 3H4MA 1XJ0A 1PVOA 3EAQA 2GZDA 2V55B 2A5FA 5KU1A 4L9WA 4KITB 1RFLA 1FMLA 1N6OA 5DGXA 3A1SA 4B3XA 3B9QA 4UQOA 1YZLA 3T12A 1RRPA 2BOVA 1L4YA 1CIPA 1XD2B 3X1DA 1HTWA 2OSBA 2WPDA 3HYRA 1RYHA 2ZI9A 1UADA 4TTPA 3B9PA 3GPLA 1KNQA 5DN6D 5G3YA 2G83A 1GSIA 2KB0A 2F7SA 1ZMXA 2QA5A 4ZO4A 2Z6VA 4GSYA 2NZJA 4M22A 5JEEA 4NBSA 3VNVA 1CULC 2PEYA 2PX0A 1IQPA 3KKOA 2PLRA 3U3OA 3GEEA 821PA 1TUEA 3CONA 3LW7A 1QHNA 1G5TA 4CEJA 3UATA 2ZETA 3M4YA 5A4JA 4B34A 3OEHD 3U6KA 5FOUA 5J4HA 1VG0B 2XSZD 1E98A 3TQCA 3QEJA 4WBSA 2ODNA 1RIFA 2OBMA 3O8DA 4TSFD 2PH1A 2ORIA 4DSUA 3CPJB 3PUZA 5CDFE 1KZ7B 4FCTA 3LQRA 5DIFA 3WMGA 2GNOA 3LBIA 1N5LA 2Q21A 3CNNA 3SJAA 4Q03A 2RGCA 4C7OA 3PUWA 2O8DA 1MO5A 1CJMA 1F2UA 1GFIA 1JQJC 2BBOA 1G3IA 2KJQA 5GJVC 2C95A 1H65A 5IDVA 2DBYA 2YWEA 3O47A 1VHLA 4QL3A 2BCJQ 4PSAA 1Q22A 1NIPA 3K09A 4G0NA 4GP6A 3ZZTA 4TQ9A 3ZH9B 1FQJA 4BZPA 2R6FA 3HR8A 3I3SR 3TSZA 2CJWA 1KI7A 1XCMA 1HQYE 4JYBA 2QAJA 1YR7A 4LV8B 1HURA 1ZNYA 2TMKA 2DFLA 3Q5EA 2IWRA 5JI2E 2OO7A 1TTTA 1EG7A 1OIXA 1P73A 1I4DD 3VU9A 5KDOA 2ZITA 2GZAA 2IS6A 3IPXA 4POAA 1JQLB 1E2HA 2OILA 1U8AA 4R7ZA 1PLKA 4LCBA 1EK0A 4D0LB 1NG1A 4Z51A 1CJVC 2WIAA 1OB5A 2NTYC 5FOWA 2WWGA 4KFRA 2O0JA 2CNWA 4A36A 5FH9A 3DPUA 4IEIA 4Q1AA 3IBGA 1M8PA 1ZCAA 2J41A 2ZJOA 2MMCA 2CE7A 1ZYUA 2QBYA 4PQRA 4JVLA 1CR1A 2VP2A 1JJVA 4QBGB 1AK2A 2J0VA 4JLVA 3DKVA 5BYKA 4LJ4A 3ADCA 3WMEA 2CCKA 3CRMA 1H8HD 4TLEA 3VMFA 4L9SA 5GVSA 3FMPB 5J47A 3U60B 1HYQA 2AK3A 4GDFA 3C7KA 4AG6A 2LCFA 4PAMA 4WOPA 1VKJA 2CBZA 2HXYA 1E1RD 1ZAKA 4XH9B 3TRFA 1UKZA 4ON9A 3FMOB 1W49A 1XEXB 3OEED 2KE5A 2WOJA 1CJKC 3QVUA 1N0WA 2ZRNA 1UEJA 1E2LA 5JJIA 3WBJA 1AS3A 2JLSA 4YDHB 4HUQA 2DB3A 2OXCA 1KSGA 1E0JA 1MH1A 4JSTA 5AJXA 1DAMA 4G5SA 1Z07A 4OQMA 4BZQA 4M1OA 4LYAA 1TQ4A 5BQ5A 1W5TA 1E9RA 3PIRA 1N2CE 4Q21A 1E0AA 4X8HA 2GILA 3LX8A 3PVSA 1K6MA 2QM7A 4KU4A 5KPJA 3WNCA 3U4QA 1VIYA 1ZUNB 2C77A 4JLMA 1MO6A 4WXPA 1E6CA 4RD2A 3TH5A 1UJ2A 2P3SA 2GCOB 2BMDA 3LDAA 5FUYA 2FZLA 4B75A 4N0DA 4MGKR 3CRW1 1KKLA 3ZJYA 4HYYA 4AYXA 5KSOA 4QJ5A 3Q7PA 3GLIB 4OJKA 3PUYA 3WRYC 1J99A 1OYWA 4M21A 3EPHA 1UBCA 4TN1A 4URZR 4B48A 3EX7C 3NIBA 2C04A 4I99A 3GD7A 4OQLA 4FWTA 1P9WA 2F43B 3QSYA 1KNXA 4N3NA 3RSLA 3QKSB 4K81B 1HEIA 3KXKA 3P26A 2JA1A 2FFHA 1W48A 2QENA 5BWMA 4DIDA 2GEUA 1N6LA 5E4FA 4TZ0A 2ZRDA 2ZJ8A 2ZS7A 1GL6A 3F0TA 421PA 1WXQA 2GTPA 2V54A 2EFHB 3SN6A 2RKOA 5DYIA 4DB4A 5FTJA 4DB2A 3FHCB 1XTQA 3CLVA 1MR3F 4WVFA 4BLOA 2ZRIA 2IYWA 3BOSA 5SZHB 4V0KA 2IC5A 1A7JA 3EC1A 4OJQA 2J87A 2RGXA 1MRNA 2VO1A 2G1JA 3K1JA 1RE0A 2FSFA 2H92A 2WMOB 2GKSA 5DSZA 3KB2A 2IYTA 1KO8A 2WJGA 1RKBA 3EPJA 3RRYA 2ZE6A 2ZYWX 4JLPA 1KAOA 5CM9C 3M0EA 1TADA 2JLZA 2ASEA 2VSFA 4GOKA 2PLFA 1W0JD 4A8JB 5HPYB 3W90A 3RRZA 1TMKA 3C41J 4A8JC 1JR6A 4RKEA 5K8IA 1X3SA 4C0SA 3GJXC 4FCVA 3X2SA 3OIUA 5KNBA 4HDQB 1C9KA 2BJVA 4OI4A 4AKHA 3DOEA 2ZXUA 1NN0A 1VCNA 1WDTA 1GG2A 1NBMA 2OT3B 2XOKD 4KO8A 3KJHA 2XTMA 3EIEA 1PUIA 1U8ZA 5KNCA 3D6TB 3B6EA 2XJ4A 1Z6XA 1PJRA 2XAUA 5FOSA 2CVFA 3BRWD 4Q66C 4HEJA 2IA5A 2ZEJA 4P32A 1UF9A 2J1LA 2HYIC 4PHGA 4Q47A 2QUZA 5KO2A 4BLRA 2W2XA 4G1UC 3ICEA 5FTMA 2FG5A 1JNYA 2BMEA 3QF7A 4TMZA 3TLXA 1JAIA 4IW3B 4ZV4A 3WP1B 1ZNWA 4FCWA 4F93B 1AIPA 1T3LA 1ZIPA 2ZS9A 4JVNA 3ZYCA 4B3CA 3C14C 1PLLA 3RRMA 1W4RA 4AKIA 2ONJA 3ZD7A 1XPRA 2FMXA 4FWIB 3MRSA 3HR7A 1KKMA 1Z6AA 4KODA 3TUJC 2P65A 2QMUA 4GMXA 4JLAA 3CWZA 1E69A 1KI8A 2GESA 3C5HA 3S1AB 1GL7A 2NQ2C 4X8LA 3B2EA 4LHWA 1WRBA 5FTNA 2O8CB 1I2DA 2W0SA 3GLHB 3CKLA 4MGIR 1U90A 5F98A 5EE3A 2N1BA 1SXJB 2I4IA 4X8OA 1SXJC 1KO4A 5L8VA 4A92A 1NMZA 2OLJA 3OAAD 2OG2A 4NZYA 2FFBA 2RGBA 2WTUA 1XTSA 2R6AA 3CH4B 4NHOA 2PZGA 2ZYUX 2MSEB 2V4ZA 1KOFA 1KJYA 1YRAA 3SR0A 2IHYA 2JJ1A 4M9QA
chains in the Genus database with same CATH superfamily
4NNJA 1JQ3A 3EULA 4OQZA 4K6MA 4YI3A 5IC6A 5J4LA 2PIDA 4Q4LA 3R9WA 3TJZA 1NF9A 4DA8A 1N36B 3SOPA 3T1QA 2GN6A 3AQ4A 4QOFA 3BQNB 3OP1A 2D8AA 4IOLA 3AHCA 2OXEA 5JXJA 1DLJA 1ZXLA 5T8KA 1QK5A 4ZAZA 4QBIA 2FSVC 1BMTA 3B20A 3WGYA 3ZV5A 4DARA 2P91A 2PUCA 1DRVA 1H6DA 3SOZA 3HJFA 4GPZA 3MTQA 4RBNA 5EQDA 4Y7DA 1O95C 1TPYA 4BBJA 2QZSA 4DYHA 2FY8A 2HMWA 3R44A 1EH5A 2HA7A 4H3HB 4BIMA 5EE0A 4EA6A 2NM0A 4IGIA 4Q4JB 4AJPA 2WPDD 1Q21A 4H15A 4YLGA 2QNRA 2R751 4RXMA 3RARA 3ZE7A 5HUHA 3K71B 2O20A 3DUWA 2ZI7A 3TOVA 3PENA 3JSAA 3LF1A 5BSRA 4H17A 1O0CA 4IMRA 4NMWA 1XD2A 4PXYA 4LI3X 3W5IA 1RM3A 4QOJA 1T9GR 5IAOA 2VTKA 5IK2D 5JVDA 3AU8A 2NVUB 3KLNA 2NYVA 3JRNA 3U4IA 1NVFA 1BH6A 2ZRPA 2IKQA 2RAVA 3PYXA 4HLDA 4M1MA 4BFYA 5AVWA 4GMHA 3DTVB 1N9GB 3EPRA 4Q3CA 5BPFA 4LXQA 2R8XA 2XGGA 4C0WA 4KVZA 3DNPA 1TCUA 2Q5CA 2VJBA 5EFZA 1I6LA 2YIVX 3RC1A 4HNQA 3KOXA 1ZU4A 1O96A 1RWQA 2H7YA 1XRNA 5SY9A 1Q3TA 1BFUA 2DHEA 4O4HF 4LSGA 4RA6B 4C7MA 4NFYA 3J81A 1MUUA 1JKXA 1FDRA 1OWMA 3AVQA 2ZBPA 3JASB 3MT0A 4HWOA 5HRUA 1QG2A 3KFVA 4MHSA 4YRJA 1SB8A 5BN4B 3ZK8A 3VO2A 2JAQA 2Q4DA 1Q7TA 3BBPA 4OUKX 4K3UA 3REQA 5EOVA 1CRWG 3UMRA 2F3UA 5K0NA 1RMYA 3A6EA 4PLYA 5CLIA 1I13A 1KVQA 3EXIB 3TLJA 4EA7A 3A58B 3B3FA 5FYDA 1U5BB 4YMIA 4YHBA 5FNVF 3GA7A 4F2DA 3SM9A 2VDPB 2G09A 4DIOA 1E1RA 1P6QA 5HYVA 3SHWA 1RMTA 3KQMA 3CIFA 3NI2A 1EWTA 3ABSB 2C2WA 2F17A 3EXG1 2JGJA 1ZIOA 4KRXA 2V6BA 3D6FA 2GXAA 1AKRA 3G7NA 1UXHA 3GWGA 1ECGA 3NOQA 5ESWA 4CT4B 1E9BA 1SKUA 1T1GA 2YV4A 1QHEA 3DE6X 2R62A 3K0FB 1QH8B 1Z4OA 4NCAA 3OX1A 1ULAA 4EI8A 4QEKA 2PXCA 3OQBA 1WPRA 2QLTA 3SOOA 1E2JA 3NB0A 3QFSA 1NQAO 2OPBA 5LVAA 4Q9LA 4B44A 2OQIA 4DR2B 1DXHA 1XB2A 4BMVA 4X6LA 3U2QA 1I7QB 1EJ0A 2Z6QA 4K86A 1MAWA 4AJKA 1JFLA 3I1IA 1HLGA 2GWHA 2DY0A 2IYFA 3S8YA 1P5ZB 1HV8A 1TT7A 3R24A 1CNFA 1F0NA 3JD1A 4OJMX 2JBHA 4BO8A 1EUDB 2C0CA 3WRXC 4YWJA 1S9DA 2FR0A 4YMLA 4HYTA 1Y4DE 2CNWD 1G5HA 2Q2VA 3CGWA 2EKQA 4IG9A 1AY0A 3AETA 4NPAA 3SR4A 3W2HA 1NATA 4MVJA 2VRWA 3FM9A 4YMVA 5K09A 4U7DA 3DW1X 1Q44A 2C9CA 1J5XA 2ZVJA 3OHMA 3PI7A 3H2IA 4YRQA 4C0AC 1UFQA 1S2LA 5CT5A 2B5WA 5CT6A 4P8RA 1U3GA 3WL5A 1OU4A 4Y0NA 3BICA 4AURA 2GF0A 1F2TA 1K3FA 1X8KA 2PO5A 3PQ3A 2F3RA 4I0WB 2EJVA 3LRPA 3OFJA 4G89A 3LD9A 5G1OA 2AHRA 2ZJ4A 4EKEA 4M89A 3E22A 1EWRA 3FYDA 3WLFA 4QGSA 3BWCA 1ADGA 3MWFA 5CPBA 2PQ2A 2H4XA 2DJ5A 1AS2A 8GPBA 2O5RA 1HNZB 3PD7A 5DJ5A 4GPEA 4RM2A 2N46A 3LG2A 4G6ZA 5IWCA 4RTNA 3RCBA 1GFWA 2ZVQX 4EY4A 1KC1A 2YJTD 4U0KA 3KVRA 5K20A 2NU9B 2O7SA 3FCEA 3J80A 3PWZA 1RAEA 3TR5A 5HR5A 4KWIA 1ZJYA 3GLKA 4KXXA 4LVCA 1J0BA 1ZMTA 1CS0B 1B8VA 2FRXA 3QWHA 5FUXA 1Z73A 4LJ9A 3QOFA 5H7XA 3MWJA 3QE4A 3ASYA 4TVKA 3RADC 5DF1A 4OL9A 4CDRA 1T4MA 1YBHA 4ROSA 1ZINA 3QNMA 5HIIA 4AZ3B 1GP2A 1M1YB 3C3BA 2NUAB 3OBBA 3PR2B 4D8YA 1KJZA 1RRVA 1VIDA 4Y2JA 4ZJPA 2N1MA 3SXUB 4L8LA 4RZHA 3MINB 4YJFB 4A0RA 1NULA 1ZA1A 5GGXA 2AE2A 3WXMA 4D74A 4DV0B 3ZJTA 2JDIA 2V1XA 1R0ZA 3UICA 4CU2A 2O52A 3RNOA 2HPHA 2I55A 4DMLA 4RHYA 5BW8A 4H16A 5HE9A 2QX6A 3AFHA 4FFMA 4LNHA 5T4HA 4GKKB 3CLSC 3HLTA 1SCDA 1KP3A 4DANA 1W46A 5HQ3B 5DGTA 4EL0A 3QY9A 1IY8A 1ENYA 1JQ5A 2C7QA 2ZWAA 1JFSA 1W0JA 3PC8A 4KLCA 4WLNA 3VU1A 1Z3IX 1D2RA 2BRUA 1KGSA 5AI8A 2HRDA 5BRAA 5ECDA 2BUBA 2D0OB 1ZUNA 1YS4A 2IHBA 3TCNA 4DE5A 1H9BA 4TWBA 2FMIA 4KFCA 1BTOA 3ECSA 3ILHA 4WWHA 1RPZA 3SNHA 2GCOA 2VHJA 2JGEA 2XOKA 2GN4A 1SOMA 1A9QA 1TA0A 1VJ5A 1USWA 5KSZA 2PZ8A 3HTXA 1FPQA 2LIVA 3T4PA 3VUEA 4YXFA 3R3SA 1ENPA 4UPEA 3QKIA 5CFNA 3A9TA 1KDYA 3LUGA 3AVUA 1NX9A 3OQNA 3G0HA 3AIMA 1AH2A 3TCKA 3SLRA 2WWIA 1M2HA 2RI1A 4FI3C 4QDZA 4QRDA 5BR4A 2QM0A 3IP1A 1QZ3A 2J32A 3DO8A 3Q2OA 2ZZNA 1ZMBA 5HFJA 1W1WA 1CY7A 4DSZA 5BSEA 5T7BA 1FFWA 2A9KA 2PY6A 5CXSA 1U7ZA 2ATXA 1TKBA 5DTEA 3W5AA 3Q1KA 3T3PB 4B76A 3BB3A 4KWTA 2QRNA 3NEJA 4D9IA 2C2OA 3NR2A 3DBHA 2I4NA 4HH1A 1H5QA 5E7IA 4M55A 4JT9A 1V6SA 3DAYA 3WLRA 4RJLA 1XXHB 4RTOA 2HJ9A 3IL2A 2DZDA 2DTEA 3IAFA 4DCMA 1US8B 3NTUA 1W85B 2CVZA 4DRXA 2ZB8A 2DFKB 2B7LA 5DW3A 2XQFA 3A1DA 5AI4A 2HZ7A 3JWEA 3B1FA 4C78A 2JGFA 3CE9A 4FIDA 1NW8A 4PQEA 2IF2A 1DRUA 3FTDA 2BM9A 3FTNA 4PZCA 4YJ3A 1RZUA 1VA4A 2GBLC 2ZRQA 4LHXA 3A9VA 4S1WA 3TYXA 3WS7A 3A28A 1HSZA 1L7VC 5CA0B 4IHKA 4D1YA 2BJWA 4EBBA 1YDFA 1JHRA 4FUTA 2XLCA 2WWRA 4LVUA 3OICA 3TG8A 3U17A 3EOBI 1QXSA 4BNMA 1KZGB 1V5FA 3RHFA 4I4IA 4DLKA 1EFLA 3NKVA 5F5XA 3TX2A 2QTHA 2HA2A 3KPWA 3GCDA 4ZYUA 2XJ9A 4YV2A 3SM3A 1C7ZA 1TZJA 4A2WA 3IIKA 5DHQA 1C81A 5DHTA 4FSXA 3GRZA 5BN3B 1Y4AE 2C0QA 1ZOIA 3NCTA 4ODIA 1GZUA 3SSAA 2H8GA 1FP4B 2RGEA 3IH5A 3SJUA 5HXAA 1Z6YA 4KREA 1C8LA 4S1OA 3WK9A 5HCUA 1Z2DA 2JIMA 1PR1A 4Q6BA 1ADBA 1L6IA 2IY8A 4YACA 4C05A 5BOSA 3CZPA 3NTVA 4K7JA 3EMVA 4MKFA 2Z6UA 2RDMA 3I64A 2WZDA 3USCS 2YY5A 4OF4A 4FM9A 4OGKA 2YKGA 2WILA 1KI4A 2NU7A 4WXEA 3UUEA 1M33A 2C4MA 4RL4A 4XXHA 4PQYA 5I8WA 2HXSA 4H6VA 3AFMA 5JZSA 1T36B 4UBLA 1NUSA 3RFFA 4M83A 1CD5A 1NVTA 4B47A 4P3PA 3GYBA 4PTZA 3W77A 4D25A 2B1QA 3K5WA 1O7JA 4M88A 2OA0A 4QICA 4EYOA 2PGNA 2IKSA 4AI6A 1MAUA 1BMFA 4YDQA 1DEHA 3FCOA 4A2CA 4EZIA 4PS1A 3UC9A 2E4ZA 4Q01A 4BVJA 2H3EA 1GZVA 2YNMC 1UINA 4JI2B 4YRBA 4PZAA 1WIWA 4J75A 3ZI0A 5GWXA 3K9BA 2I3ZA 3U39A 2JLCA 1J8YF 1R4MB 2Z58A 4CKCB 2NVBA 4EO9A 1YBAA 3TE7A 2PXAA 1NURA 1A9YA 3CX6A 1WXDA 1YIAA 4GOMD 4PAWA 5CA0F 4N47A 3CURA 3LXUX 5IDYA 2OPHA 3V8QA 4HDMA 3TZCA 1SU4A 1Q0SA 2GZHA 3FBGA 4HDAA 4XPIA 1L5NA 3P4YA 5JAPA 2R00C 5KVAA 2UUCB 4DUGA 3JQQA 1UCFA 1YC5A 2CLCX 3I0MA 4O4JF 3CM0A 3ZWCA 2NZXA 3UUGA 1WCWA 1CUUA 4HQNA 3DNFA 3GLHA 4H7DA 2X0KA 3N8DA 3R0JA 2A1UB 2ALJA 3PNOA 4ZMSA 1IBMB 4KK4A 4B0OA 1S89A 2R5WA 1SXJA 4KIGA 3HO6A 3SZRA 1JV2B 2PGDA 3R5JA 5B64A 2IYXA 5LNK6 1L2TA 2WYVA 2AYXA 3HCDA 3T9CA 3MCAA 1TVCA 5BVHA 4EHJA 5AM3A 3ZDQA 3ADOA 1GXSA 3IAS6 1FYVA 2WYIA 4JOQA 3WYGA 4OSPA 2ZYIA 4UTZA 1ZGHA 2EIHA 1PE0A 2AXQA 2IQIA 3H9QA 3LVRE 4OSEA 5FWYB 3LS2A 4DIEA 3OZDA 5C0OE 3UKDA 2Z04A 3O2SB 1TTPB 2DUMA 2EEZA 3CGGA 3H4VA 2COUA 5IHPA 1YR2A 3H6GA 4ZDIA 4JT8A 1M7BA 1A8UA 2HK8A 1P44A 2IHNA 2QD4A 3W2TA 1NN3A 1K3UB 2C2ZA 4NMLA 1ODSA 2QV7A 1NVDA 1YKGA 3KAPA 4JXXA 2HBZA 3GR6A 4ZJYA 3B1YA 2XRMA 1FFXA 3I9OA 3BJZA 2VJQA 3ZCPA 2FR8C 4X24A 4ZCTA 3IKTA 3QBVA 3G2LA 1IPEA 2UU9B 2W22A 2C2XA 1JJ7A 4NARA 5KYXB 4KMRA 1PFYA 1V41E 2OV4A 4JC4A 2MCFA 1A4RA 1OKKD 5F9MA 1R6DA 4ECAA 2QLNA 1B1CA 2G28A 4G5HA 4W8OA 1SRRA 1RT9A 2OKGA 5BYJA 2C88A 3A6JA 4LF4B 1GRNA 1RJGA 2B4KA 1Q0ZA 3GG9A 4LZAA 2NOAA 4IDQA 4H3KB 1K7XB 2YNMD 4IIJB 2K87A 3FGPA 2C4HA 2NO5A 4JVMA 4D8UA 4Q39A 1Z0IA 2H8KA 3R9KA 2QRJA 5C5CA 5J2TB 2NVUA 2QL6A 3L05A 3KOZA 4GX2A 1H3NA 5AW0A 4RV9A 1D0VA 3RGWS 1LA2A 3DTVA 4M8LA 4F45A 3CF6R 2OCDA 3SKVA 3HBAA 4LHZA 4HB2A 2JZCA 4F46A 3Q0TA 4YAFA 5L7WA 4MKGA 4K9QA 1Y3IA 2VRNA 3GJYA 3HGMA 4PLHA 3L7AA 2G36A 2BKUA 3PEUA 1Z7EA 3PRHA 4RA6A 5ALSA 2V0NA 2YCBA 3JASA 3O9MA 4CQLB 1E0DA 1P1KA 2FPGB 3OF5A 5BN1A 2YKPA 5BN4A 4ONEA 1GZ4A 1MOZA 2ES4A 1GUYA 3GBSA 3RKSA 2YMPA 3E9RA 1DJMA 3KSZO 1BVYF 2LKDA 2ZJAA 3NOXA 4LY6A 4BRWA 3D5TA 2YL2A 5E3HA 2JJ2A 1Y3FE 2IUFA 2JRCA 2ANCA 3FCSB 4GIBA 3GBVA 3K4PA 4NSNA 1YB7A 4UC0A 3L8ZA 5EQFA 5LA6B 4DLWA 3RAFC 3EXIA 2P9HA 1DAHA 1ONSA 4FFBB 1MJHA 2EJBA 4TSRA 3QWAA 3VDRA 5LZ9A 5J3JA 1U5BA 2BZ1A 4QFMA 4N40A 2CVQA 5A03A 4OI2A 5LB4A 3RTCA 1RU3A 2JFHA 2XMQA 4RIIA 3UNXA 1SU8A 2ZVPX 5DXFA 3SPXA 2WYOA 3HCAA 3L8CA 3D5QA 2XMDA 1J2UA 2ZG6A 1T0JB 4QNNA 1D1SA 2W6MA 4RVSA 3FVRA 3WNQA 1K88A 1UBJS 1Z18A 2H5EA 4JNKA 1LDYA 5CW2A 3KDSE 1DB3A 1CB7A 3FB4A 3K0FA 1QH8A 5LIPA 4YCDA 4L4UA 2YOFA 3VC1A 4F0JA 2D3WA 3DFMA 4XGKA 1BDJA 4P4LA 3VH2A 1RSZA 1ZWLA 4EHDA 1UJCA 4KUEA 1M2EA 4J29A 3WLKX 5IKPA 1AF7A 4NYJR 1NXWA 4MGZR 4KJXA 4XQGA 2E9SA 4UE2A 2J9XB 2OXRA 3C2QA 3ZW8A 1H1LB 1BAPA 1ADJA 1D2HA 1RYFA 3AOEA 2W2LA 3RTDA 5F3WB 5TRTA 3RODA 3UK6A 2QRKA 4AG3A 1P39A 1ZDMA 5CDHA 3NHKA 1NLMA 3Q12A 5E9AA 4YIKA 1IJEA 3LPMA 1EG2A 1EUDA 3Q3GE 2PJUA 4NE2A 4EGAA 2C03A 4OXIA 1O2DA 1OXBB 2NO1A 4I5EA 4PQFA 2VYVA 1UOOA 3KZVA 4BMOB 2H1IA 1F8GA 2V8OA 5FR1A 1TZMA 4BEJA 1RHQA 3OIDA 4CDGA 4Z1OA 4ZJUA 4QOEA 1XK6A 1KK1A 4REOA 3LPCA 1IQRA 4YMSA 1K2WA 4V2IA 1U0GA 1RQPA 1SC6A 1Z38A 1PEDA 2WF5A 3I3OA 1U2PA 3KJZA 3HU3A 4JLKA 3OZ7A 5K2MA 3WIBA 3QWFA 4DMMA 2AFHB 3IERA 5LLTA 4B3IA 1YL5A 1F06A 3KQSA 4LXYA 3ZWBA 2CZCA 4R3NA 1DDOA 2L2QA 3EWIA 2JIQA 1Z26A 3EVGA 2ACWA 4J0EA 1FU8A 5IC5A 4AUKA 5JNLA 4D8XA 4OIFA 5KAMA 4NH4A 1QHGA 3DONA 4QM7A 4Y9DA 3QEMB 3RUPA 1FNDA 1RI4A 3M49A 5LQSA 3ZI4A 4D3SA 1IATA 1YRQA 1Z6QA 4FKBA 4HNAB 5BY2A 3OIWA 4LF7B 4D56A 1H94A 1T4BA 1SIUA 1PJSA 5ALEA 1GQQA 2QMHA 1CS0A 1TCCA 3LK6A 1BFDA 4MUYA 3AM5A 1J07A 1VPVA 1WOMA 4C2BA 5B7GA 1J0AA 2CHGA 2HMUA 1Y3BE 2NTJA 3ZY3A 4COOA 5HRAA 1O3YA 4MV5A 5K0BA 5IF9A 4AZ3A 4IX1A 2QYTA 1KXJA 1M1YA 2Y1EA 2NUAA 2XRYA 1WKBA 1L4NA 4NG4A 3KZKA 3JQFA 4FDLA 3E7FA 3SXUA 5LN1A 3D7RA 3BRSA 1I32A 2Y1DA 3MINA 3DZ8A 4S3MA 4YJFA 1R7RA 5DHRA 3KUUA 1P4JA 2KLBA 4FS8A 1HDOA 3H1PA 3NGMA 3C3PA 4ZC8A 1QC5B 4C14A 1LQUA 3DOUA 3OJCA 4PG8A 5BO5A 3LW8A 2HHJA 3P52A 4GRAA 4X0EA 1CYDA 3W04A 1FTNA 4EQ6B 1FS4A 3ISVA 2VNSA 3KG2A 3MJVA 3RJTA 4AZ0B 1SUEA 3EWSA 1DOZA 1OF1A 4DLXA 2CMKA 1J56A 4A6EA 3KE9A 4U1RA 2BP7B 3RRFA 2P2SA 4OQNA 1J8DA 4Q15A 5C3UA 5HQ3A 3IX7A 2DR2A 1RAIA 3U61B 5AK5A 1WW2A 4U9IS 4J7UA 3VZRA 4GP7A 3DT6A 2BZGA 2XVZA 5AM2A 2C54A 2BHRA 3THYB 5G0WA 1SC1A 2NLOA 2Z09A 3FYUB 2FDXA 4IIUA 4BWYA 2P3QA 3GT3A 2R11A 3RT1A 1NI4B 2VK4A 1UBHS 3QE9Y 2O0MA 4C43A 1FDVA 2OCKA 2HSEA 1HQCA 5LLDA 2C8VA 2ZSAA 5EUBA 3TGPA 5ALQA 3HA2A 4EGFA 5K8TA 4LMPA 4Z1MA 5DM1A 1OXVA 5EEGA 4CLHA 2GSWA 3R1IA 2V3WA 3OZXA 3BHMA 3D02A 4N3AA 1PGJA 3WI7A 1NM5A 4YCBA 4AS2A 3GLVA 1LTKA 3GJ0A 5K3FB 4RMNA 2QEQA 3EDOA 3WLHA 1WW8A 2Q62A 4PX5A 4MIOA 2QIPA 5G0UA 1G3MA 1NQVA 2JEZA 3GELA 3FX2A 3QNWA 4TYMA 5E3JA 1ESZA 3OJWA 2AQHA 3LWNA 4FOOA 1GZSA 2Y67A 1X70A 2A0UA 5T3UA 5KNDA 4W5QA 4REMA 2CLHB 3UHFA 1JGTA 1U7UA 3EJ6A 2REBA 1US8A 1W85A 2C99A 4RPLA 4ZDWA 3S40A 2I65A 3TLGB 3ZOZA 3LDFA 4LF9B 5EQJB 1Q6ZA 3PR1A 3QWIA 1DBRA 2OD9A 4U9UA 3WB0A 1GG9A 3U6BA 3OG9A 3B6IA 2VA8A 3OOYA 3PXEA 2PUGA 3L7LA 2A0WA 3OBIA 2YC4C 3I34X 4KSCA 5EJIA 4EF4A 4IQFA 4Q4HB 1T8UA 3E48A 3AF0A 1E32A 1UOEA 2OCYC 2OHFA 3A1UA 3LECA 3ZWAA 1K8XB 4KXYA 3OEWA 4Y2QA 2Z0MA 1DGQA 2PKYX 2RH4A 2YZ7A 1C3VA 2HWKA 1XDSA 2XTJA 4RWZA 4M1TA 3GWZA 2UUPA 2RI6A 3MJ4A 3VZSA 5FUMA 1X7HA 1WP4A 3CG4A 3QU2A 1BVRA 1VB5A 4G5XA 3K0EA 2HPVA 1P7WA 3D0KA 3OQ6A 3BFXA 1MN6A 2QWXA 2Y2VA 2WD8A 2X3FA 2IEYA 3A4LA 1YE5A 3K35A 5HQJA 3VO8A 3WGHA 4LC9A 4IEEA 4BHTA 1LLDA 1TTHA 2PBRA 1P91A 1I6WA 2HYDA 2POQX 3HUEA 4DGSA 1FP4A 5L40A 4FNGA 4CGZA 5ER6A 3TLCA 1IVYA 4KACA 4OHKA 4WIAA 4YAJA 1A1SA 5A0VA 2PMBA 4A27A 2XUPA 4FX2A 5CX1B 4HLCA 3HWWA 2WWYA 1LRJA 2HA5A 5EZYB 4Q7MB 4O0LA 2BFOA 4L50A 4XTRA 5U4QA 5BV0A 1NP6A 4D3DA 3HVUA 2QUJA 5EZ5A 4RYLA 3S1SA 2F9FA 4MVYA 4NONA 4R71A 4L3WA 1KAHA 3CNQS 4IFBA 5I7SA 1Z12A 5LKAA 3A27A 3S4YA 5JR3A 2WIFA 5T3YA 3PL5A 5LZ8A 4F38A 1XNJA 3JQCA 1N6RA 5SV2A 1RVV1 1BHJA 1N2OA 1NNI1 1OC2A 1T36A 2FEAA 2JIZA 4KQWA 4O1IA 1G7RA 3KJFA 3F78A 4ZTZB 1ODJA 4II2A 3WMFA 5I6DA 3ZZ1A 2H52A 5MFPA 3AVPA 3LLMA 5BPHA 3ZDAA 3N86A 1Y48E 2YDYA 4D96A 2J8ZA 2HMSA 4G24A 1UMDB 4FC6A 2FUKA 2R87A 3CEHA 3OPXA 3R3XA 4CKCA 1R4MA 1LPNA 2QQFA 2VK1A 2VUTA 5FAXA 2XUHA 3VR2D 4QUAA 4YONB 4CI9A 3KCQA 4OEHA 4ZANA 4DLZA 4RY2A 3LUBA 2ZSEA 5HOEA 1CQXA 3MERA 4G9GA 4C3UA 2R6DA 5HG0A 2B3DA 4K1XA 4MI3A 1R0SA 1B42A 4AM8A 3TO5A 4G1BA 5EHNA 4E7PA 2Z6AA 1PDVA 1OBFO 1QZUA 4FZRA 2ENUA 2JJMA 2OCPA 3FSRA 4R0MA 1NLUA 3NTLA 2I66A 4QFCA 4BRSA 5DB4A 5ICMA 3DS8A 4IDBA 2A1UA 3GP3A 5F12A 1G7TA 4DBLE 4URVR 1SU6A 3GFSA 3NC1C 5EPOA 1DHRA 2QTRA 2ZU0C 3AYZB 1XPOA 2B94A 3BERA 3M3PA 4LRWA 1A8IA 3H2JA 4RGBA 3FFTA 5FBQB 3WGLA 2JLWA 3VAZA 1TZ2A 3EH1A 4BRZA 5KYYB 3IS3A 2ZQ5A 1QAMA 2IY9A 3DT8A 3ZCTA 3BWMA 3DR5A 2C5EA 3OIVA 2XA1A 1SUPA 3W6PA 4HXYA 4KPFC 3LXMA 5FWYA 2IE8A 4YRDA 2LKCA 4LSMA 3CRQA 5C5DA 1WPXA 2ZTMA 2R6GA 3M6XA 3D3WB 4ZQGA 3GRAA 3QJYA 4K9LA 4MQ6A 4ND5A 1U3UA 5FUBA 5IBPA 2X0EA 5E7JA 1E77A 3C3KA 4YP9A 4LFCB 1VYUA 4KWEA 4NPCA 4MS4B 3OJEA 5CDYA 2VZ8A 3D8RA 1L5KA 3WMXA 4R83A 1G1MA 2HSGA 1ZWKA 1WU7A 3MGCA 5CT4A 2W2VA 5EIFA 3LZCA 1FXSA 2W8BB 4GNKA 3SF0A 2X15A 3DOHA 2YOGA 5KYXA 2XWQA 3M6FA 1E7MA 1Z5WA 5HE8A 4BQOA 4Z7JA 4JQSA 5BOVA 1MH9A 5DE3A 4XIYA 4TSKA 5BW5A 1ZNZA 3URKA 4EHHA 2C3UA 4DV2B 2L69A 1TEHA 3B38A 4UTOA 2P3LA 4NKRA 4YGXB 3FOFC 1S8NA 3PQ6A 1NBHA 2BFWA 3AK4A 4NU5A 4CLDA 4IIJA 5HIJA 3RKRA 1FNBA 3PGJA 4EJ0A 2XOXA 2IUYA 2QMZA 1AM4D 2DWCA 2V6IA 3PGLA 5J2TA 2QSZA 4IWYA 1ECCA 4PNHA 2A2ZA 1HNXB 3R9IA 3BCUA 1XDUA 3UWPA 1MC4A 3UJ8A 5JMOA 3KFXA 1GFZA 3ABIA 5KPDA 4D4KA 2ZJBA 1UZAA 4KQ6A 1Q74A 3GDWA 4RJIA 4ZOLB 4MQ5A 2UZIR 5JBQA 1JFFB 1OCEA 2V6GA 4MH0R 3PCTA 3IAAA 1WBBA 3OPNA 3K70C 2C4VA 4CQLA 1GZ7A 1JU4A 3SMQA 2FPGA 4CJXA 1W52X 5D85A 4DMRA 2H59A 2P7IA 2O2IA 2IDMA 1C9MA 2P4EA 2AWNA 2QJWA 3DEZA 4IIEA 5KSPA 4C2AA 4R5HA 5TIIA 3CLRD 3A26A 1DXYA 4WACA 4EEZA 4V1CB 1OIWA 5LA6A 1KH2A 4XDYA 3SBXA 3GEIA 1NUAA 1VJRA 3LBNA 4FFBA 3UWOA 1KBZA 2OR3A 2XCTB 2HHHB 1KIMA 1P6XA 1KYYA 2JFUA 4C87A 3U7QB 4BY9E 2Z43A 3IPAA 3M1AA 4JAVC 2OWDA 2H16A 2VPYA 3T7IA 1G41A 9LDBA 5KTYA 2BGGA 1SQ6A 5IHXA 2OBXA 3ZE6A 4B3HA 4YMGA 3OY7A 2FN4A 2PKQP 1J2RA 2CFOA 1QYWA 4BV9A 4QARA 2D1SA 4BZZA 5JCOC 1QVRA 2A92A 2HEGA 1K3TA 3CNOA 3KJQA 3NXSA 2PH3A 1XCBA 2A84A 2IPAB 3Q4GA 5GONF 1KP2A 1PT6A 4J4TA 4K0RA 2OL4A 3EIXA 3EA5A 3HSKA 2XDWA 4IF4A 3RWMB 1ISMA 2C2HA 1S1CA 4BO4A 5E8JA 2IVZA 5EMJA 5HFNA 1V26A 1O89A 1E3WB 2VWQA 4R1MA 3PQ4A 5K45A 1QB7A 4UMEA 1A9XB 1QRSA 3I2HA 4G0OA 5JMWA 1SH7A 3H9JA 1SHJA 1Z88A 1YUMA 2II6A 1KFBB 1MV5A 1P62B 2VEDA 3GFBA 1E4OA 3LDUA 4LJYA 1NRWA 3DVLA 1A9TA 4IVQA 2OCLA 1LNQA 3DC7A 5JH7A 1SPBS 1FYXA 5JSYA 3WIUA 3CO5A 4F91B 3PLAE 1UMKA 4MKXA 3PSHA 3ZV4A 5CCXA 1J0EA 3C8DA 4GZ5A 2QRPA 3W2FA 5IZ4A 4RH3A 1W4ZA 5EWMB 1GUDA 5FP0A 1R5NA 4C03A 2PG3A 4UNQA 3ZJ4A 3K70B 1O0SA 4R1PA 1R5JA 2AFHA 1FYWA 3GMSA 3PFWO 4FYHA 3Q8MA 3O90A 4IHJF 2GH1A 3KFLA 1EX7A 2HIGA 1NMXA 1X77A 4TKUB 4M9CA 3ITDA 1LBIA 1X7ZA 3NHJA 4Z4FA 5B36A 4YH1A 3MGKA 1ZN9A 1M0SA 1JTEA 1RHUA 2D7CA 4K03A 4ZODA 2G71A 3BHJA 2A0YA 4NQZA 5CIQA 2CZGA 3QEMA 3WKAA 5GGYA 3SE7A 3VRHA 1KAGA 2VNKA 3CLUC 5E2AA 4HNAA 2ZRAA 1AQ6A 1VIAA 3VC2A 3UAYA 3GMIA 4A0HA 1U81A 1PZHA 2H0QA 4C0KA 2AOXA 4LXGA 4YT5A 4MA5A 2FW7A 5K4GA 3V97A 3VR6A 4JX9A 1HSOA 4NBVA 2X42A 3SMVA 4YUYA 1DWPA 2D06A 4ZU3A 3DZJA 1DWOA 3Q9UA 4YXWD 2QR2A 3IV9A 1BS1A 4FJ0A 1DIGA 3FYHA 2HNAA 2PM8A 3OKAA 3PHBE 4GE0A 4O5AA 3AR4A 3TAUA 3UWSA 4Z8YA 4BU0A 1OFGA 3HFRA 5JG7A 5A4IS 4Z4QA 1NRXA 3V34A 5B1SA 1C29B 3HY3A 5CLQA 5H4GA 1D2MA 2PNJA 2R66A 1RZ3A 1QC5A 1W1IA 1YSCA 2GAOA 2C42A 4PN3A 2VQSA 5IKXA 3ERCA 4YBZA 4NEQA 4IXMA 2B6HA 3VYRB 1VGQA 1AA9A 3SYKA 4CMBA 2OSVA 2V59A 4MWCA 5ALDA 3SX2A 1GAXA 1YWGO 4EQ6A 2WW8A 3IHKA 1N3IA 4TL7A 4AZ0A 5E9QA 2O3TA 1XJ5A 4LYHA 2RHRA 3DZIA 3IA2A 4JQOA 2BP7A 2FUNB 4AMVA 3ZWNA 4ZYWA 3C4VA 2EKDA 3CKYA 3EE6A 3TMYA 3WHIA 4DEXA 4XYLA 1XJQA 1MC8A 2QAGB 4ESHA 4HNVA 4EHBA 1E66A 2EFCB 1ZHHA 1U8YA 4AWAA 2MOKA 4X6YA 3FMVA 5CIWA 2XCIA 3HJRA 3THYA 1I8TA 2DGDA 1SJ9A 3EFBA 3FYUA 2QQGA 1J1IA 2OESA 4CIBA 1NI4A 1QOPB 3AHEA 4G9BA 2X5JO 1SCUB 3AMVA 4IJKA 3GGDA 5IMSA 3NTRA 2RBEA 3RS0A 4DSNA 3DGFC 1IWOA 4TQUS 4ZOEA 3Q6MA 4JJGA 2ZTHA 3AERA 4BCBA 4EDFA 2E4VA 4KFUA 1XZHA 5AI0A 3H1TA 4HN4B 3K73O 1T4GA 3UK2A 3ZU5A 4D5GA 5L9AA 5BUQA 2OFOA 2LZ0A 1YACA 2GN8A 2QD1A 4NLLA 1KYIA 1E4EB 4TWIA 3HNRA 2X7JA 4GVPA 5CDSA 3TI7A 1F38A 1LDNA 1MXHA 3R4CA 4U00A 4BLWA 2XX3A 1NF2A 3LPNA 4RMGA 5K3FA 1M2JA 4EVIA 2IPNA 4ENRA 4HNUA 2BI8A 3OT5A 2FFAA 4KAAA 4QBFA 2XNKA 3G49A 4N65A 4NENB 4MV1A 1VE5A 3CLUD 1MJNA 1CKEA 3EOZA 2BELA 3IHLA 2V5AA 1O1YA 1E7YA 1T5HX 4D8TA 1PKXA 3DAPA 3IT3A 5J4YA 1P74A 2WSIA 3LHIA 1AD2A 1IEWA 3QLEA 1GA6A 2J46A 3F96A 2ZUBA 3BD9A 1V8PA 4UU1A 2AVDA 4OKIA 4UHJA 4Y2TA 2P8JA 3SXJA 3JYOA 3T38A 1E5XA 3TVDA 5I4CA 5ENDA 4AW9A 1G5RA 3RUAA 3LBYA 4IDPA 1B8PA 1UDCA 3HH8A 4IFEA 1LX7A 4AKEA 1U9IC 2O2GA 4Q4HA 3BN3A 5CVTA 5TQ2B 3LL7A 4JZYA 1S4QA 1QGAA 5TT1A 4UD2A 5JISA 1RWXA 4KK3A 2ZXFA 3OHPA 4X90A 2UXBB 3RUHA 4WL0A 3A3KA 4I4TB 4M1KA 2WJHA 4UKDA 1IONA 1W4LA 4JXZA 3M89A 3PFBA 1QGYA 3QXJA 4TTTS 3FCCA 4KO1S 1N6NA 4F5WA 4P31A 3U3JA 5JWRA 1QP7A 4OD0A 5KWEA 4NXMB 1Y6QA 4BNZA 3UMVA 4HLUC 3GCGA 5JNWA 4RABA 1NZFA 3T35A 3EGDB 1EDDA 2Q2OA 3GCXA 3SQNA 2B78A 2GZ3A 2HA6A 3GD5A 3TQFA 3NHZA 2CK3A 1NJ5A 3UHJA 3GCWA 3B13B 4F3KA 4LA4A 1GCOA 2MSWA 4JP3A 4JUDX 3AJ9A 5J58A 5CX1A 2FEOA 3KQUA 3MWDA 1VSQA 2Q0QA 3HA7A 1MAAA 3ICVA 5EZYA 3TWOA 1S2MA 1TK2A 4L22A 4ME6A 4AF6A 3ZEAA 1T3ZA 3QX8A 2H5LA 1DAOA 2A78A 2FK7A 2HV9A 1JS1X 3OJLA 5HMLA 3WADA 3ZCXA 2FZ4A 4AKGA 1Q7CA 3HCCA 3DKPA 4UEKA 4G9EA 2ZZKA 4KN9S 4BP8A 3EPKA 3WGNA 4URYR 3VR4H 3ZK9A 3N1UA 3RLFA 2NG1A 2R79A 3CY6A 3W9YA 2EC5A 2XHEA 2NMVA 2OCBA 1E4VA 1HFJA 3TTSA 2D13A 2ZBGA 4Q4AB 4ZEXA 1E2FA 3DBOB 3F71A 4A6XA 2HIHA 3FUWA 1P19A 1IVNA 5CP8A 1EUYA 3UT6A 2UUAB 4R1LA 2XUZA 4B73A 3GT4A 3DZHA 3WK8A 1SC9A 2R8PA 2R9VA 1IAVA 1JB9A 1UMDA 2J4CA 3A9SA 1CRQA 4B71A 3HN6A 2JFFA 2X0RA 3WHLA 2HLHA 3CKMA 1RI3A 2X22A 3DMGA 4MLCA 4Z7OB 4MR7B 3GLIE 1RBMA 1JR3E 2ZYGA 5TF4A 3MXTA 1JPNA 2DP4E 2O8EB 3L4SO 1SG0A 1UXKA 5G0VA 1FXUA 1YU6A 5AQEA 1UEIA 5E4JA 3H2SA 3L77A 3N0WA 1E9EA 3S29A 4ABTA 2VPIA 5IYZB 4MMYB 2J59A 3PNPA 1LY1A 3TOCA 3IAEA 4BWFB 4OOFA 2F6RA 4NZ9A 4O1MA 4Q9NA 5GZ3A 3TQRA 1JLRA 1QFXA 1Z5ZA 9LDTA 3I2JA 3FR8A 4JA2A 4W82A 3T1NA 1ZD9A 2ZJ2A 1RQLA 2H4WA 2XUOA 4PRLA 1Y8QB 4BASA 4N0EA 2QT1A 4TLAA 2SKEA 1XTVA 2GZRA 1PL6A 1IY9A 4F96A 1EPUA 4I9HA 3VHRA 5AW8A 4JIGA 2R2AA 2AX4A 1JAXA 5B53A 1T6NA 3DPSA 1A88A 1T6XA 2QLLA 5DRTA 1IN8A 3RIXA 3W5SA 4E15A 1BDHA 3PUXA 1ZI6A 1Y7IA 3W2IA 3L4EA 3FUCA 3CQ9A 1QIHA 1UBOS 3O2JA 1ZM3A 4J16A 4P7BA 5J40A 3X1KA 3WRWA 3D3WA 4EG3A 1KVRA 1THZA 4CCAA 1ESMA 4FGKA 4HFNA 1XZPA 4BKMA 2VPQA 3SICE 1AQJA 1C3OB 1IDOA 3ZV3A 4MS4A 1ZZEA 2LR0A 1FK8A 4MYDA 1EVEA 4OHMA 4WEOA 3C97A 3SEFA 5FOQA 1JH8A 3KWLA 3N8NA 1KFJB 1QKKA 1QTRA 1XKXA 2GK4A 4CG3A 5JJBA 1DWUA 4LNUB</