4PT5A

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
molecule keywords Papain-like protease
total genus 82
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4pt5A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4pt5A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4pt5A03
4R3DA 4RNAA 4OW0A 3E9SA 4REZA 4WURA 3MP2A 4MM3B 3MJ5A 4RF1A 5KO3A 2FE8A 4OVZA 4RF0A 4PT5A 4P16A 4OVZB 4M0WA 5E6JA
chains in the Genus database with same CATH superfamily
2DWMA 3RNGC 3RMKC 1HTQA 5EE3A 1AU2A 3HIZA 1VEKA 3BBZA 1L2BA 3T38A 2D7GA 3NZSA 4HVBA 2VHSA 1W5TA 1JR3A 1XQQA 1JW9D 4HLEA 1V80A 4ZHPA 1HTOA 1AN8A 3QARA 5KPZA 1C78A 1GC6A 3FTCA 2O5RA 3ZGZA 2R9NA 2CKHB 1R4MI 3MP2A 1STEA 3K1JA 1R2YA 1MG4A 3SAVA 1WIAA 3N32A 1ATKA 2NQDB 4C80A 2FUG1 2LVAA 1CB5A 2N7DA 2M5ZA 1YSYA 3I01M 3GLGA 8CATA 1GUAB 3MHHA 3H9DA 2O25A 4WJNA 2L7HA 2ZNVB 3B21A 2EKKA 1IBLM 2PREA 3LXSA 2RDBC 4AOFA 1IFYA 4G11A 1N36M 4X66M 4S12A 2PMVA 3LYYA 1XXHB 3V6CB 2DCDA 4LF7M 4CDDB 1BXTA 3GCBA 2KRKA 1WGGA 2P86A 3V60A 3SYLA 4W9LA 5BPVA 2LVPC 3HRDD 4HRSA 3AN1A 3ZNZB 1VQ1A 3RFZB 2DZLA 4BS6A 4AG6A 1YQ3B 1F2CA 1FFUA 1TT5B 2E03A 4C00A 4FJVB 4DV7M 3DBRB 4RGTA 4DDGD 2HCBA 2NTSA 2KJ6A 2LXEA 1QDTA 1ZV1A 4GEWA 4OZCA 2JZ3B 2KDIA 4ARIA 3KOYE 3BB7A 2IBIB 4DXFA 1PM5A 3AE2B 1E9MA 3KFQA 1F2RI 2MJDA 2L76A 3OF8A 3KVWA 2R2OA 3AKZA 1OGWA 1SP4B 3DA1A 1QMYA 2M4NA 2H1RA 1M4VA 3KDSE 2APLA 1F1HA 3SHQA 4B0EA 2DAFA 3MC0B 1QILA 3R8FA 2AUXA 4NRVA 2N35A 2XFSA 1W5SA 4IM0A 1SXJD 1A5RA 3USVA 3NBXX 4P1CC 2E3TA 3UGBB 4KVGB 1ICFA 2G8JA 2G4DB 2GB1A 3QT4A 1DGBA 4II2B 1N5WA 2DZZA 3TEWA 4C4VA 3VH3B 3ZJUA 3ZDTA 3A4RA 2J5YA 2KW0A 3PVLA 3TBLD 1VZ7A 3DF0A 3MHZA 1WWTA 1N60A 4YWGG 1V6EA 3W30A 2HD5A 3R7QA 4PYUA 2KLGA 3RI7C 5ITQA 5KO3A 4D2KA 2BTEA 3VRAB 2MBHA 1NNUC 4P16A 2KT7A 4M0WA 2KO3A 4ASWC 1QUTA 4GHLA 2KHWB 3I57A 3BBAA 3TRKA 2WBFX 1WGYA 2NTTA 2PNSA 1F2BA 3JVZX 1TIFA 4AUQC 4IJFA 4IM3A 4KLBA 1N62A 4E3CA 1YT7A 2EKIA 1UH6A 4YYWA 2KMMA 3MC8A 5DNYA 4OW0A 3E9SA 2Y0TA 3ZC7B 4EZLA 1C9FA 4D8BA 4QRGA 4RKXA 4BOPA 2OHFA 4YTMB 3UK6A 5JI3E 4AJWA 1JMLA 3ZQJA 1QZEA 3KOXE 3ENEA 4K7UA 4FJYA 3HHMA 2JXTA 4WAFA 3DDCB 5EXSA 1YD8U 1V81A 1YX5B 3VVWB 3BPFA 4OVVA 1A5TA 2LBCA 4LFAM 2A4ZA 5IKCM 2B76B 3J7AS 1X37A 3PRMB 1OIZA 2KTRB 1PADA 2KVRA 2MA9B 4W9FA 4CZWA 2WP9B 4DR3M 5K16A 1YK7A 2CRUA 2QHOA 1ZAEA 2AEHA 1GPXA 3GP1A 5L8RF 3VLFB 4LLGM 4XR7A 4NAWA 3PRZA 3IEJA 4WJPA 3SD5A 1PIPA 2D3AA 4YSYB 2HE7A 4A90A 2WDTB 2BKFA 4KV2A 5G5GA 3DCGA 2H89B 3W0FA 1V34A 2V4IB 1K53A 2DI0A 1JWAD 1NBFC 3U2SC 3RNEC 4P6EA 4WWMA 2MCNB 3H6NA 2K6DB 4FJZA 1FH0A 1I35A 4OVUA 3NZ3A 1MX0A 1PPOA 2EELA 2LRUA 2BYTA 3IG3A 1D0MA 3AOEC 1EUVB 3PXGA 3VR9B 4CDFB 3CGWA 3W0LB 1V1PB 2M56B 2DJGB 1V1OA 3GLFE 1T43A 1JRPA 3A98B 3ZNHB 2V9HA 3OAWA 3B79A 4LNKA 1EIJA 1TGZB 5ITXE 3SHGB 4GB9A 1MHXA 4GMVA 4YTNB 2MGWA 4US9A 1XT9B 3APCA 4FXCA 3RNBC 1RYJA 2KD0A 3IUTA 4KLNA 1CV8A 1D5XC 4ZTBA 1QLBB 2KA6B 1TKGA 2O2VA 3H8BA 4DHZB 4DWFA 2UXBM 3UIOB 5F3WA 2PJHA 2HWJA 2XNAC 4BBAA 4LCDE 2JZ0A 1L0XB 2HKJA 4XE0A 1HUCB 3TEZA 4MZOA 4L6V6 1OKSA 3L17A 3LQRA 4GDLA 4OZAA 3KS8A 4IM2A 3GPPA 1TLOA 3FUUA 4BOSA 4IBKA 3WAOA 3B7ZA 2UZJA 5EP3A 3HK0A 1N6ZA 1TY0A 3W9CB 4G3OA 3VQIA 2MJ5B 1Z5AA 1V9JA 2MJEA 2FCQA 1SXJB 4PS3A 4HWIB 2FCSA 1ZIVA 4GKJM 1MHWA 2GBNA 5AUIA 4FCWA 1NQCA 2MBOA 3DBHI 3PTFC 3SEBA 2K6QA 2XBBC 2DCCA 2FOIC 2KTFA 4ZYSA 1KFXL 1YQBA 5C23A 1T0YA 4I6PA 1THEA 3J7BA 3IG5A 2MBQA 2R4JA 5AEKB 3GRUA 2VF7A 2K8BA 1N75A 5I4DA 4LJ7A 1KH0A 2BS4B 1RAXA 2YFQA 3FE3A 4FWHA 2WZJA 3OQCA 3QX1A 3BXWA 1EF5A 3N30A 2GI9A 1MVKA 3VDUA 1VJKA 5ITYA 5H92C 4WJOA 6PADA 3ZKJC 1PJJA 3AU5A 3L10B 1QDQA 3U6EA 1UZXB 1ZKHA 1CK1A 1HE8A 2EO2A 4XUIA 1VCBA 1TH2A 3KSJA 1Y4HA 3T9LA 2XF3A 1LGRA 3QCAA 2F5SA 1QT9A 3I5JC 4LF9M 2D3BA 2G45B 1YJ1A 2IJ0A 2C7HA 2K5PA 5J94A 4NQKE 4RGMA 5EXTA 2BYVE 2AQ1B 2PE9A 3U30A 1TH4A 2KTRA 3I4VA 2N9PC 1AW7A 2K8HA 1PXVA 3APDA 2XH9A 1Q5WB 3UI3A 3QQ8B 1DGHA 2WNMA 4NXNM 2G1EA 3AEDB 2DKLA 3PHXA 4OELA 2CJNA 4ANVA 1OIPA 1CZPA 3C0RA 2ZTCA 3EIHA 5IO9A 4W4UA 4NAWB 3UQAA 5E6NA 4CO7A 1EF1A 3B7QA 2UUCM 2I1KA 4AQ7A 2DVWB 4EZJA 1N32M 3PHUA 4JWSC 3VKGA 1X9YA 3BOSA 3F92A 4OVZA 1FRDA 2KOXA 3QIJA 1XMQM 1OQRA 3WXFA 4DMXA 2CWBA 4HJGE 4A8XC 1IY1A 4MGZE 1NNJA 2L0TA 4LF5M 2V1UA 2HDEA 3KVFB 4P6VF 5GXGB 3Q3NC 3BYTB 2FO5A 3Q8AA 3DHGC 4W5CA 4WURA 2BBCA 3KUCB 1JROA 5DCNA 3PZDA 1HQCA 2G3QB 4LDTB 1HEZE 4JI5M 1E8YA 4B7FA 3P4PB 4G0NB 4M02A 2D7HA 3QYEA 2FCMA 1E94E 1V8CA 1E5WA 2N9KA 2YEPB 2C5LC 2M1MA 5JH5C 3WXEA 4FJCA 1WZ0A 2Y3AA 5HKHA 4ITQA 5IZ7D 1WR6E 1YOVB 2BYEA 1XNQM 2RKOA 1XLOA 3QSDA 2VZKD 3U6OA 4ZYNA 4B7GA 3DBLI 1Y8RC 3KLSX 1N63A 1RFKA 1SE4A 2KC1A 2LWXA 2JRIB 2R9OA 1OQYA 4MB7A 4F2LA 1SXTA 1EWYC 1CS8A 3RYTA 2DZNB 2OO9A 2N7EA 4MGYE 2L83A 2WX0A 3QAQA 5FKAC 4HKQA 1SXJE 2C7MB 4YL8A 1K8RB 3AFHA 1ZOYB 2FIFA 2QENA 2HHHM 2CS4A 4CYEA 1ZP0B 1DO0A 1I4RA 4QOZC 1P7FA 3E4RA 3BK1A 1YNTE 3BVMA 1FRRA 4L2YA 2WXOA 3KXEC 2I38A 3VAWA 4ANUA 3TL5A 1TU6A 1Q10A 1MIRA 2WDRB 4DK5A 2RGHA 1TTEA 3X23A 2KKCA 3KWVA 2LD9A 4AS1A 2I2YA 3PW3A 4GDKA 2HWKA 2WDQB 3ERVA 5JHAA 2FQ9A 1SXJA 1D3ZA 1WY8A 2ZW0A 2E6XA 3ZCBB 2V3NA 4IUMA 2J7QC 1NHWC 1X1MA 1PBHA 1PGBA 3U5ZB 1TTNA 4X6HA 1VLBA 1G41A 2JQRB 3E56A 4B95A 1TR8A 3NY5A 5EE1A 2XZUA 2M0XA 4M8MA 3CBKA 3N9YC 3GRRA 2L00B 4UDUC 3Q6BA 4KDIC 1SE3A 2PTLA 3KSEA 5C1BA 1DEUA 4W9GA 4TKNA 4ICUA 2JUJA 2K8CA 1NV9A 2J0JA 1L7YA 2BPSA 4FIPA 1YIWA 3R2TA 1KOTA 3NVVA 1NO1A 2CFOA 4EFOA 2FS1A 3RZWC 5FK9C 3GPUA 3VFKA 1U5IA 1PYWD 4GITA 1VEJA 1SGHA 1C7YA 3WANA 4CDCB 5KHOA 3IT4B 2JNHA 2ZVOA 1AYUA 2AVWA 1DO2A 4Z6YA 3WCQA 4AXMA 1PPPA 1D0LA 5H37D 1I4PA 4I6NB 2C7NB 3NVZA 4II3B 4KIKB 3SFEB 2R18A 1BUIC 1NVID 2DAMA 2OJRA 3AE6B 3AE7B 3Q3MC 2OOBA 2HAKA 1UD7A 1FJGM 2TSSA 4JX1C 4LFBM 4Z8XA 1JB0F 4OVZB 1XLNA 2AYNA 2FFJA 3TMPB 3O1GA 3PSEA 2R45A 3PHWA 2D10A 4LY6A 2KDMA 1YZBA 4EE2A 3W67A 3QA8A 1OEYA 3SASA 3GS2A 4ZPXA 3KUZA 2C99A 2W82A 5EXXA 2DWLA 3DVNU 3AEAB 4BOQA 4IKGA 4E71A 1V1PA 1FXAA 1WSPA 5EP2A 1WYGA 4BBNC 2C9OA 2L1AA 1PJTA 1OTRB 1WXMA 4RNAA 1B1ZA 2REXA 2DZJA 1WMHA 5IP4D 4MH0E 3U60A 3HHZA 1LXDA 4NRWA 1JWMD 3RCZA 1FO4A 7PCKA 2MWSB 4IBGA 4XBOA 4RGNA 3MHSD 1V5OA 3CF0A 1TKEA 3O65A 2RDHA 1OEYJ 2K1FA 5IWAM 3S2AA 3PZ7A 2MP2A 4BOZB 3L4PA 4QRVA 5BMIA 4QBBA 3I51A 2CV0A 2QSDA 2V3PA 4WIPA 4IBCA 4MZSA 2BTWB 2LGIA 4LTUA 3ZO5B 2KWDA 2JRIA 5FTLA 2I1JA 4L23A 4WQOB 5C2TB 1E6EB 3ZVVA 1PE6A 3B1LX 5CHVA 3M95A 4GDLB 1JALA 3GLHA 4I8OA 1VDLA 1U9WA 3Q8EA 2L4FA 2KDLA 4W9DA 1C79A 1OAOC 3FC4A 2DC8A 1YN5A 3AEFB 2O01F 1BP4A 1ESFA 2LGSA 1MU5A 5CVMA 3C9EA 4EZKA 1UGJA 2X8AA 4I5SA 3N1ZC 1QANA 4LNOA 1UGMA 2WU2B 3EC8A 1KHQA 2XEPA 1NPZA 4PS7A 4FVMA 2LNHC 3DFZA 3JR5A 2IZVB 3NHEA 1GECE 3KYDD 2XN9C 4W9KA 2J53A 1IN7A 2Y5CA 1EWOA 1NHGC 4JPSA 3UQBA 3CSTA 2N9XA 3T6PA 2FNJB 4IBEA 3P4QB 5EJCA 1OQQA 3U61A 1GJZA 1XD3B 2VH1A 4IBDA 2VZKB 2BB5A 2JWSA 3I9V1 2Z3XA 4YY3M 4WP2A 2KHHA 4JYAM 2Y0QA 4IWQA 1WE7A 1ZDVA 4K1RB 1HJPA 5DPRA 4B3SM 2VIIA 4PADA 4QH6A 4I07A 2O6VB 5FTKA 1NSFA 3VUXA 2LTUA 3M63B 3U6PA 2O6XA 4NXMM 2DJFB 2Z59B 1GJTA 3H4JA 2ZAOA 4DR2M 4NL4H 2ZTDA 1Z59A 2FE8A 3N1YC 4XGAB 4I6LB 3RZFA 2NCNA 4TQ0A 3TEYA 1MDWA 1VD2A 4GC9A 5D3IB 2MBBB 4YVAA 3AE1B 1NY6A 1NB5A 4BQVA 4F7ZA 1EU3A 1JWBD 1T0QC 1F29A 4MDKE 1F0ZA 2UUAM 5D7GA 3IV2A 2R6FA 2LVOA 2D2QA 4M9XA 1K50A 3K9OB 2WSCF 3IFWB 2QPAA 1DGGA 3HHYA 3KFUG 4USAA 1F77A 3PVSA 2DOSA 2J52A 1WGHA 2INCC 2XZFA 2WXMA 4X6JA 1IN6A 1P3QU 2GBJA 4P1BC 1D5ZC 4LRSA 2AL3A 2E5LM 3PRPA 4WWOA 4M9ZA 5ITRA 1JQPA 2AGAA 3IAM1 1WXAA 1WE6A 2VRRB 4EEWA 2KEBA 1T3QA 4D80A 4DV3M 4I05A 5CHFA 2OOAA 1F2RC 4XYCA 2V0GA 3ZRCA 3PLUA 1HNZM 2WYQA 1TH3A 2DC6A 4IIWA 1JCKB 3L26A 4ACFA 3P42A 3ZNGC 1ET6A 4NAMA 3URYA 3Q3FA 3OVXA 3P2BA 4K7WA 4A3VB 3AECB 3P4SB 1QUSA 2FCNA 3I63C 2BB6A 2CHZA 3RN9C 2JX5A 4IBBA 1ZMVA 3HJSA 3MJ5A 3ZTDA 4EOYA 3N4CA 4HDQA 3FD9A 4A3PA 3GLFA 3RNFC 1NENB 3H1UA 2GNOA 4BOSC 1MJGM 2OP3A 1E8WA 5LMUM 1WYWB 3ZNID 1E9RA 2UWQA 2KNZA 4LJOB 7CATA 2BF8B 1TS4A 2K9XA 4PS8A 3AE9B 1WGNA 3GE8C 2KX0A 2DAGA 2NVUI 2Z4RA 3AE8B 2MLBA 5C3JB 1T5XD 1TS2A 2DHYA 2IY1B 4MELA 5DPWA 4DDID 1P3QQ 2D3GA 2E00A 4NZLB 4P17A 2WU5B 3DHIC 4KZ0A 3H6SA 2AIMA 2QSFX 3LVVA 4FCVA 4GMQA 1VRAB 2MH7A 2BVCA 5BO4B 2AU1A 1G8PA 1UELA 1KFVA 3H7PB 4A55A 2GLSA 3DPDA 1PUTA 3GQ4A 3U4EG 5J18A 2BQQA 2P7UA 2XK5B 2P5TA 1GO5A 2KDEB 2BJVA 1P9DU 4G6ZA 5H8YE 2NBVB 4H2AA 2JU6X 3GZNB 3ZUAA 1R6BX 2K0BX 3FKYA 1R4NB 3ECIA 3AJIB 2K39A 3C58A 4JI7M 2CEAA 2N4FA 4LRTA 5JHBA 5E6JA 1KLUD 2N0SB 5FR3A 1TYGB 4RKUF 5BMHA 3NJTA 4HXDB 2JPHA 3BINA 2Y6EA 3HM6X 2BDZA 4DR6M 1YJJA 3FUWA 2PE6B 2MH8A 3IOQA 2IO2B 3PPAA 2C60A 4X57B 4X6IA 2QZ4A 4PDIA 1FCLA 1ET9A 5J2RA 1QAOA 4BFRA 1IM2A 2KQ4X 2JXXA 3A9KA 3FILB 1KXRA 2DYOA 2ZPYA 3T1HM 4HDOA 1F9JA 2RGOA 4ZUXU 2XFTA 1QXPA 4B08A 4BVUC 2GBKA 1JRUA 4MSXA 1WJNA 4E74A 2M60A 2R46A 3E21A 5EQTA 4B9KA 3A1QA 3VTWA 3K8UA 2IYDB 2XU1A 3L27A 2C98A 3GLGE 1V5TA 4MJSB 3IHPA 3SHFA 4AQYM 2NBWB 3Q2AC 4AJYB 2DZKA 4RGOS 4YYUA 3K9OA 3Q3OC 2J42A 1N61A 3RNVA 4RY2A 3GQ3A 5CHTA 2FRAA 1WXQA 1KSFX 3TWKA 4ZDVA 3RT3B 2ARYA 3OJ4B 2FYEA 3HVDA 1T0SC 3PRPB 4D8IA 1XXHE 2JWZA 4P7IA 3RVXA 3HZJA 1ITOA 4AP4C 3B89A 3DVGY 2AUZA 4GUAA 4XZXA 3EFCA 1PFDA 3IFUA 1MEMA 2BT6A 2WSFF 3TPZA 1G59A 3HGIA 5IREB 2HTHA 3PZ8A 1A6RA 2YJCA 5CX3A 1IY0A 2MROB 2M0AA 2MEKA 4JI3M 3TJPA 3TEXA 2WXRA 1IYFA 4FN2A 4NJCA 4BLCA 3AOGA 3L29A 1I4GA 3GLIE 1V97A 3O65B 1TDZA 4IWPA 3DOAA 2L32A 3ML9A 2RD0A 4K3CA 5ITTA 3VH4B 4FBJB 3U6CA 4MM3B 3UIPB 3U52E 5LMNM 1WGKA 1IBXB 3MORA 4G4NA 1IQPA 1E8ZA 2R6NA 5FLXS 2DHZA 3RNCC 3T3NA 4HWYA 4AW4A 2KWVB 3ML8A 3PT2B 4KKIA 4RM9A 4K3BA 3W1SA 4IP3A 1SIJA 3IVFA 5DYGA 2DAEA 1BMLC 4JQWC 3U6SA 4F1SA 3E1ZB 1Q0WB 3SYKA 2JXNA 2KFKB 2Z4SA 2JSVX 2JYTA 3TL4X 3LFYA 2F5QA 1KLGD 4W5WA 2NBUA 3C0RB 3T8MA 3ZLZA 1WZ3A 2WHIA 3J9CA 3HHIA 4YYSA 1E0ZA 3RD2A 2JA2A 2KDBA 2ACTA 1IGCA 1NI3A 4BKSA 3Q8CA 1FM0D 2OULA 1T0RC 2LHDA 1L0YB 1GNUA 1C4AA 1IP9A 4CHKA 3OLMD 3IHPC 2G4SA 3JYUA 1SXJC 3J81S 1F2AA 2F7DA 3W68A 2ZJDA 4YTPB 3NHEB 4Q8HA 4C7ZA 1U4AA 2ONQA 2CV1A 3ZJVA 2JZZA 2AYOA 2CR5A 1GKIA 1DOYA 4HL4A 3LVWA 4DXGA 2UU9M 3WAPA 3ZRFA 2JTCA 4BKTA 2LUMA 3MTNA 4PCZA 1K3XA 4WA6A 3BK2A 3SAUA 2YJ8A 3RFWA 1A70A 4AKGA 1BQIA 4MI7A 4C56C 4C7YA 1OFHA 3HU3A 4US8A 4S0RA 2KXEA 2LVQA 1R4GA 2MR9A 1U9QX 5LLIA 3Q8FA 2IO1B 3ONSA 4PDGA 3B9JA 1AYFA 2QQ8A 5ITUA 1L1TA 3IAS1 5CVOB 1XLPA 1NVMA 4W9JA 4WWPA 3AE3B 3BIID 3SR6A 1ACCA 1J8CA 5AZHA 4D82A 2D7EA 2F5OA 4YYRA 1UWXA 4GN1A 4LK0M 1OFIA 3B74A 5D6JB 3DQVA 2KJRA 3VKHA 2HL7A 1U9VA 3CH3X 2ZM6M 4GOCA 2AWTA 1YMHE 1SF0A 1SBBB 2Y5PA 1IXSA 1ZDXA 2PADA 4N4ZA 3PS6A 1N78A 1G4AE 4W9EA 4BKGA 1MJDA 3I3TA 2CHXA 3NUHB 1GG3A 2D5GA 4XX5A 4YSXB 1HZ5A 1ZUD2 3EGRA 1ME4A 1I94M 3BWKA 2KNAA 2DENA 4DR5M 3QYBA 1WM3A 1KLVA 4GSWA 2NQAA 1MS6A 3KH0A 3WHKA 5G55A 2PKOA 3TWMA 1C1KA 2DYMA 5EE0A 1TZOA 1HQYE 2F4VM 1DV0A 2DX5B 2LJ5A 1WJ7A 3H4MA 2N7JA 5EDSA 3KP0E 4J6IA 4FA6A 2LGXA 5EZSA 2HD5B 2LJIA 2IGGA 3A45A 3VK7A 4TMAB 3GRYA 2KVZA 4L78A 4BOUA 5JA7A 1XWIA 2I7PA 1LTMA 3C9PA 1LV7A 1SNKA 3FTFA 2ZPNA 2Z7JA 2KMAA 1TL9A 1T6BX 3JW0X 1JR3E 3LB8C 3THGA 3Q8BA 1ROEA 1EWLA 1QOAA 1QAQA 2DZOB 3APFA 4W9HA 2N1WA 5CHVC 5HI1A 2MHJA 4G4QA 3GLFB 3P1MA 1CSBB 2DC9A 1NLJA 4EIWA 3FRIA 2FNAA 1D0KA 3I4YA 3NOBA 3F5VA 3ZH9B 1NDDA 2NPTB 2R44A 4DHJD 4DUZM 1DF0A 4LGYA 2BWFA 4FHJA 3PNYA 2QCUA 2XLJA 4JI8M 3MFGA 3RNAC 1AYWA 2KMCA 2B3TA 2BW2A 4GIVA 2VQEM 5EE9A 5BMGA 1R2ZA 3LXFA 1WF9A 3F75A 2J7OA 4JN6A 4JXJA 2BNKA 3PO0A 2G9HD 1SSNA 4WW0A 2LVQD 2J0KA 2ZAMA 4M01A 4B0MA 3AEGB 1Q6KA 3FRHA 2L6OA 4W9IA 3OF9A 1I7HA 3MMPA 4DV1M 3CBJA 1QOLA 4LNNA 4DXAB 3K9PB 2GOWA 4LJ6A 2XK5A 1CMXB 2W55A 1J7KA 1L6VA 3PSEB 2DZMA 4GC5A 2K3UA 3HHAA 1XXHA 5T8IA 3V6CA 1G71A 1Q3CA 2L05A 4QRXA 4LZZA 1RFAA 5EP4A 1Z5SB 1WX7A 2L7RA 2SAKA 1Y08A 1TDHA 2FT2A 2G6DA 4M0DA 5LXHA 3C8YA 3PNVA 4IJEA 3T1YM 5MPOA 2AYOB 4OU7A 4DV6M 3PGEA 2LI5A 4TSSA 3U6DA 1OJLA 1OTRA 3GO8A 4L4UA 1J7BA 4DV2M 3AMZA 4KKJA 1WMHB 4HXDA 4YHHM 3UGJA 2K22A 2LZ6A 4CHTB 2A5UA 3R3MA 1YVBA 1YJIA 2J0MA 1GMYA 4G3XB 3VXWA 4Q8GA 3CTWB 2GBRA 4PT5A 1WFYA 3H7SA 3ZNHA 5IAAC 4GIPA 2WXPA 4CISA 4QOSA 1KRHA 1TY2A 1QF6A 4JI2M 2BTWA 3D8BA 3DOWA 2C0YA 3S3QA 4NPNA 3FTEA 4NJ6A 2RR9A 2LGDA 2WLBA 2WXLA 3IG8A 4CQNA 2XSZD 4Q7JA 2RPQA 3TQSA 3B08A 4EKUA 4AWJA 1IXRC 1XHBA 2WXJA 1HNWM 2KAJA 3R9XB 1V92A 4UN2B 3K2LA 2KWUB 4HPMB 1WXVA 1D5MC 4C4VB 3Q8XA 3K8ZA 4DV4M 1VDVA 2KN4A 3I3TB 5IN7A 3N3GA 2Y20A 2LWPA 2LASA 4P6GA 1UWMA 3VK8A 1ENFA 1FNNA 1MG8A 1EF7A 2EMTA 1NL6A 5BYSA 4ICVA 1SB3C 3KW6A 4JI1M 3OJ3A 5IOIA 2FUHB 3DZDA 2JWUA 4JWUC 1R4MB 4M0WB 1EWPA 3GE3C 1RRBA 3J2PB 3GLIB 3WALA 1BVSA 1UBQA 1R4NI 2AX5A 2LVNC 4BSQA 3CWIA 1WR1B 1UF0A 3KWZA 2UYZB 2DBYA 3TE6A 1E8XA 4DQOC 3VDPA 3U61B 4XZ4A 3RVWA 3N20C 1ZQ9A 5D2MB 2LGYA 4J3OD 4GU2A 3UZUA 2FAZA 4WWNA 2LFIA 3UJNA 2BDLA 5F02A 1VDDA 4MGHA 1EO6A 2CHQA 1AU0A 3L25A 3GZNI 1U9XA 1FMAD 1GABA 3VFDA 2ZNVC 2XU5A 3C3EA 2DWQA 2OZ2A 4XK8F 3B0AA 5EXPA 1V86A 1WX8A 1XCQL 2GFOA 2LXCA 4CJ6A 3PNRA 3HU2A 4ARCA 2WWZA 3D32A 4LF8M 3PT2A 2WDVB 2EJSA 2KDFB 3Q69A 1QYRA 3PRMA 2F5PA 2DNAA 1UUPA 2LVOC 3V6EB 1IWDA 3TIXA 5FPWA 1MEGA 1Z5BA 5PADA 4FHKA 1ZPSA 3H7DA 1S4VA 4B7HA 1Q02A 4OX9M 2QHOB 1Z5CA 2ACZB 2UUBM 1BT0A 2H88B 2QIEB 1TKYA 3ZUNA 4BAXA 4EUTA 1E10A 1WHCA 3D8LA 3AV0A 3U6QA 1P7EA 2INNE 3QC8B 3ZXVA 4A3OA 3WXGA 2QJLA 2K25A 2DAKA 1XF5L 4L15A 3PHXB 1NYQA 4Q2JA 5DPTA 2PBHA 3TNXA 3FAHA 4N58A 3HY5A 1QOFA 3GQ5A 1XXGA 2LXAA 1YE9A 3ALBA 4TUWA 2MRPA 3VUYA 2AQ2B 2JY8A 2HHNA 3MJWA 2AL6A 1GB1A 4URKA 1TJEA 3I06A 2YEPF 5LXIB 3AU4A 3P5UA 2KZUA 1IY2A 1QKZA 1KYIA 3W31A 2FTDA 2LVPA 2DAIA 2KN5A 3KWLA 1N77A 1IBKM 4IWOA 3PBHA 1SJED 3AEEB 3BVGA 4LZJA 2FH0A 4LCBA 1PPDA 4R71A 3SC3A 1P1AA 1LFDA 4KDLB 1EFUB 4MSMB 1XLQA 4R3DA 2V1YA 4NSOB 2G3QA 1E32A 1WGDA 5CHWA 2JT4B 5CTRC 4BPVA 2J7QB 4DR7M 3WA0A 3BY4B 4GXBA 3L08A 2JRHA 1YUBA 3LJ3A 3U8ZA 2WXGA 1QZMA 4DR1M 5JZEA 3DHHC 1GL7A 1CVZA 2MJ3A 1C4CA 1R7SA 2PPHA 4HKZE 2YJBA 1STFE 1AYVA 2F1GA 2GRIA 2BKRB 1IXSB 5TR5A 2BWES 1K3WA 2JQGR 2L52A 4WAAA 4HCNB 4IBIA 3AE5B 1UNSA 2FRQA 2EA0A 3ZJTA 4LGMA 3B2FA 2NQGA 4XDDA 1GLOA 2QBYA 3HHXA 4DR4M 1FCCC 4KSLC 2M17A 2MX2A 2N9LA 4QNRA 2ZEQA 1MN3A 1CPJA 3W2DA 1E7PB 1MPEA 1XB2B 2OQ4A 4XDCA 1CQDA 4YSZB 3ILKA 1PGYA 1Z6TA 3V05A 4HROA 1DKIA 1K3BB 4GDKB 1IN8A 1LM8B 1XKGA 1WGLA 2KX3A 3GLIA 2GBMA 2R9MA 3BOWA 1WR1A 1R7RA 3W5UB 3U5ZA 9PAPA 1WM2A 3LQQA 2IGHA 1L4DB 3W1SC 2C9WB 2CU3A 4JGHB 4ZOHC 4LJ5A 4X65M 1XNRM 1UFZA 1NY5A 1H4RA 2RMMA 4ZRPA 3W5VB 4PP2E 4L1BA 4CGYB 3FYDA 2ERCA 3UMMA 3EA6A 2CJOA 3K92A 1GOZA 2C5RA 3JSVB 4JE3B 4CDEB 1KM7A 1PGXA 2CHGA 1V33A 5D94A 3IBEA 3TUOA 1QAMA 3MTVA 1Y8GA 2NQ8C 4N9F4 3A9KB 2LHGA 2M8SA 3FUVA 2C96A 1IN4A 1D2NA 3M62B 1GC7A 1NI2A 1K51A 4N79A 1J7CA 3KQ4A 3LW5F 4MH8A 3BZDB 1FNUA 4PK1A 1JQJC 2N9EB 3SFZA 1L6UA 3VHTC 3OG5A 4WH4A 1ZMUA 4WJQA 2YLMA 4I4LA 2RPVA 2UU7A 2BYFA 2O6VD 4N6EB 1SG9A 2AQ3B 1ME3A 1XEEA 2SEBD 2JY6B 4KT0F 4NQLB 3CH2X 5LNK1 2F5NA 1MFWA 5DPSA 1P0RA 2LHEA 1WH3A 2KNVA 3L0WB 2KC2A 2BS2B 3K9PA 3N1XC 4OEMA 1L2CA 1F52A 3DVGX 2Y5BB 4A6QA 1QVRA 3T3OA 1KFUL 2AS8A 2KLCA 4B3RM 2DZIA 4KIKA 2QCZA 3KOWE 4CIZA 4PYZA 2B1NA 5KPTA 5EZQA 3FKEA 3KW5B 2CV2A 1N5XA 2CHWA 2KWCA 1Q3BA 4KGRA 2MQJA 2Q2EB 2IPKD 3SMPA 4RH6A 4LF6M 3NBIA 1VSNA 4IBFA 4PI3A 3AOEA 4K7CA 2L7IA 1S1QB 1TS5A 3A9JA 3RE8A 3UINB 2J7NA 4NOOB 2EMSA 1Q39A 3QWLA 4HEA1 1PCIA 4ITKA 4XWWA 1YALA 4KHPM 3DBHB 1QDRA 4LJ8A 1J19A 2JZPA 2XEWA 1FFVA 1GB4A 5G5HA 2GHUA 1PDXA 2ZANA 3HWSA 4KGSA 1WXSA 2XU3A 2AHMA 3AV8A 1DOXA 1WX9A 3AH7A 1RWSA 4YV8A 2Z8YM 3O0UA 1YN3A 4BZAA 2KZRA 3A4SC 3BC3A 2WXFA 3QHTA 2L09A 3D6SA 4FULA 2INDC 2BWBA 2MP2B 2MW5A 4BOZA 2DWZB 2QP9X 5GKNA 2K6BA 3AULA 4L8RC 2GQFA 4PD2A 3V76A 3R7RA 1GJSA 2KFKA 3NS8A 2EKFA 1FD6A 1VG5A 1CQVA 1AUAA 3MHSA 1VR9A 2QNJA 1NEKB 3B7NA 3IECA 3DWMA 4D8EA 2A5YB 5IT9S 3N3KA 1F4IA 3R8BA 4AG5A 3GLHB 1IN5A 3H8HA 5AUKA 2I7NA 4HEOA 3A46A 3HD3A 1LO5D 3OTOM 3A33B 1L2DA 5J17A 2KFJA 3HKPA 4ANWA 2OEDA 1WJ4A 2RDGA 2Z0DB 3AXCA 4M8NA 1IGDA 1L0VB 3HUIA 3M7GA 2PLPA 1L4ZB 1E7UA 2WGSA 2KANA 4QHTA 4IUMB 4XC2A 2D07B 2NQIA 1TF0B 3SARA 3P5XA 2LMCA 5IA7A 2X4AA 1L5PA 3KOZE 2XGNA 2INPE 3V62A 3UF8A 4LJPB 3RVVA 2B3AA 3DBSA 2HH5A 1ZCMA 1D4BA 5BYQA 5EP1A 3CF6E 2L3ZA 4S17A 2LEKA 5JH3A 1HT2E 2CU1A 4IBJA 5EGWA 4KSKC 2R65A 5FTMA 3NVYA 2DCAA 2UXDM 3KX1A 3JSVA 2PVOD 2QMTA 1HR0M 4NJ7A 2JZ1A 2O6VA 4ZRJA 3ZIMA 2L2DA 2V3SA 3E46A 2DWNA 1NYRA 1I4HA 3L13A 1NB3A 4ZHOA 3FYCA 5GMVA 4MGKE 1SIFA 2BGFA 2KJHB 3FUXA 4OHJA 4XWTA 4G54A 1PVJA 1AWDA 2DHRA 1OFFA 4M9SA 2D3CA 4JV5M 2B1MA 3T15A 3M6AA 3DBLB 1PQSA 3VUWA 2NMQA 4X62M 4ZRKA 1CJLA 3DWGC 2QC8A 4I04A 3ZYYX 2IDYA 4YYQA 2QEJC 3SU8X 3KP1E 4FADA 4JL9A 3AI5A 1C77A 4BKSD 1NV8A 1QOBA 4AI6A 1YN4A 5L83A 2V6ZM 3MC9A 2Y5BA 4GLSC 4B3TM 4DV5M 4AXLA 1GAQB 2WXKA 1RLFA 3HJ8A 1ORYB 3PHWB 2Z0EB 1C76A 1T6OA 3JAMS 4W5BA 2X49A 1FPYA 4IG7B 2ZW1A 1JR3D 2LHCA 2WS3B 4TUUA 2K9DA 5EF4A 3S3RA 4X64M 2FBWB 2YJ9A 3KW9A 2CB5A 1DGJA 4K7SA 1KTKA 3HM3A 3L2AA 2G5GX 3VTVA 1N34M 3V3XA 3HVZA 1K52A 2JVCA 3GB1A 1JWUD 2BJWA 1QOGA 3B9PA 4GHAA 3BY4A 3V61A 4LFCM 1AECA 5JZEB 1AU4A 1PGAA 2KQ7A 3HX3A 1BGOA 5DFLA 4DHJB 2ICIA 1GVNA 2KACA 3RPFC 2NPTA 4K81A 2R2QA 3VR8B 5CVNB 4F1IA 4QNMA 2WXQA 3GRVA 2GMIC 3KWBX 5HG2A 2NS5A 1Z2MA 3CIRB 4LJ4A 4G4OA 1WJ6A 2JY7A 4GH9A 5BR8M 1TZ1A 2O2VB 4HK2A 5A24A 2IO0B 3ABVB 3GPXA 2JP7A 2WXIA 3EECA 1AIPC 1C4PA 1VZ6A 3CF2A 3GP7A 2KK8A 2G8LA 2XSZA 1VZ8A 3HWNA 4BS5A 3M0EA 1L8QA 1P98A 1S3SA 4GRIA 3U6MA 3N3KB 3OWEB 1UKFA 3Q8GA 2VHFA 1I4QA 3K24A 3ZQ4A 3K9MA 3DVNV 1C1YB 4RMAA 5BYRA 4RF0A 4KGTA 3H7PA 1UM8A 2R9FA 3NRZA 1AARA 3HHWA 3AL0C 2R62A 2K0PA 1FNVA 3P4RB 3X0WA 2IPPB 5FTNA 5FTJA 2PVGC 5HHDG 4QHSA 3ETRA 1M94A 1J7AA 2KYWA 1Q1OA 5KHQA 4YXDB 1DYQA 3TCAA 1M6DA 4AZFA 3U8EA 3AE4B 2CIOA 2JQFR 1FNWA 5E6PA 1CTEA 1WRDB 2YVCA 3DBRI 3H89A 4LF4M 4LNFA 1SJHD 1YLAA 3QAUA 2W9NA 1EWMA 1PPNA 3R66C 3ZW3A 1NJGA 4MT5A 1L2NA 2LH0A 4XGIA 5A2QS 2V4LA 4AKHA 1UBIA 1VEGA 2QDFA 2VDBB 1TBEA 1TS3A 1WJUA 2D11A 2MSED 5D3DA 4BBNF 2G7YA 3JR4A 2ZBKB 2IY0B 3BVZA 3L16A 2HXZA 4FWDA 1HNXM 3RGSA 3L28A 4M00A 2H7JA 2VH2A 5FSWA 3QWZB 2G8EA 1DGFA 4HCPB 2Z84A 2YNMD 2PIAA 3GOEA 3FILA 3H8CA 2WXHA 1I4WA 2W54A 2HJ1A 3Q14C 1GCBA 3J27B 2C9CA 2VQFM 1S3SG 2DNFA 4DUYM 2WQYB 4HPLB 1Y56A 1HXYD 2JY6A 1IPGA 2L8JA 3AEBB 4IDIA 3ZDMC 1T3TA 1E90A 2ATOA 2KZSA 5AZGA 4LNIA 4FD2A 4MSQB 1EM7A 3A1QB 3VDZA 4A5UA 4JIOU 2H5XA 2W3SA 1DGHB 1B9RA 2W3RA 4MJSA 3U7ZA 3A42A 1HZ6A 4R7GA 3GLHE 2EUCA 4RM8A 2R4EA 1ISNA 3IMAA 4IW0A 1E7VA 1SE9A 4KO8A 2JUOA 4JLCA 5TSSA 2J4XA 2P0RA 4DV0M 2MBEA 3NZUA 2WX1A 3BCNA 3R2IA 3GPYA 4QAYA 4NNJB 5AZFA 2E02A 3A9JB 2UXCM 3Q3JA 2X8XX 1XO3A 2NR2A 4KODA 2ZCCA 4ZRIA 4DBGB 4K0KM 2LRWA 3M99A 3AB5A 4A20A 1XC8A 4GKKM 1N33M 3FUTA 2YQZA 5FR6A 2EKEC 4ZRQA 1J09A 1J5EM 2R0IA 4NY0A 1EE8A 1AIMA 1K82A 8PCHA 3M3JA 4LDTD 1EWCA 2IO3B 4KZCA 2R61A 1ZW7A 2OJWA 2XU4A 2JY5A 2ZCBA 3SFDB 2KQSA 3KS4A 1KJTA 2DXIA 2OPFA 3U6LA 1PRBA 2RSUA 1V49A 2YR0A 4BB9A 1YK8A 1XMOM 1FIQA 2DAJA 2PW9A 1IXZA 1J0GA 4RCOA 1WGRA 5C18A 1MHHE 1GLNA 2N1VA 4MEMA 3V6EA 2FIDA 1IBXA 2BU3A 3NS1A 3LCVB 3KYCD 2JYEA 3EUB2 1CUKA 2KXJA 2X38A 4HPPA 3QK0A 2CE7A 1E9SA 4HLQA 3C19A 2JF5A 4YT0B 3HU1A 4IC7B 4REZA 5G2NA 1ZXHA 1TGUA 1R5LA 2CP8A 1PJIA 1KFYB 4RFBA 5KQ8A 1SEBD 1YX6B 3SBJA 3VTUA 1JWSD 3FTDA 3GLGB 4Y28F 3WIMA 1EU4A 1YQ4B 3IT6B 5E26A 2BS3B 4JI4M 5ITXA 4A9AA 3PV1A 3PFIA 2Z8LA 1HT1E 2L4EA 4MACA 2WXNA 3SATA 2Y21A 2ZZPB 1NJFA 1IUEA 3WAMA 4LJ9A 1SE2A 1G3IA 5KPRA 1AU3A 3BYYB 2DC7A 4YYVA 2E01A 3KKUA 2DCBA 3W1YA 4AKIA 1HQRD 4ANRA 2DLBA 3TWLA 5KQDA 3MTNB 3BWUD 3ZXRA 3PDFA 1L1ZA 5L95C 4F8CB 2J7QA 5JXVA 3QJ3A 4PP1A 3L54A 1FXIA 2IGDA 4DHZE 1KF6B 4II7A 2KNBA 4I81A 2IBIA 2KRUA 1CJEA 1PJQA 2PEAA 3PLVA 1WI0A 4N59A 4W9CA 3U7DA 5E6OA 3PREA 4B6WA 4LG2A 3J80S 4FW9A 5C1ZA 3P63A 5JI2E 1IBMM 3AM9A 3EFUA 3C3DA 4FCTA 1BY8A 3OVZA 1KHPA 2Q5WD 3B2GA 2K47A 1C3TA 4L16A 2WSEF 3AI8A 4KX6B 1G6JA 1ZXIA 1H6UA 1QQRA 1RM6C 3O13A 2QBYB 1D6EC 4OZBA 3NG0A 4NC6A 2M19A 4HJKA 3P5VA 4FK5A 2DYBA 4MGIE 3TSSA 3SMSA 4ANXA 3MP9A 3SAWA 3IXSA 4G4RA 3CMMB 2FUDA 4NSRA 4JI6M 4FWGA 3LCUA 2ON8A 2ASQA 1ZE3D 1FXTB 1I42A 1WRIA 2DENB 1ZMWA 3LMMA 1WIVA 4B3MM 5DYIA 2L0FA 3KSXA 3RGPA 4O1NA 2R9CA 4GGQA 2OOBB 4FLHA 3NWLA 1QQWA 4IOIE 4WQMA 3RUIB 2CUZA 2ZVNA 3HJQA 4TQ1A 3ZTCA 3TMPA 2YJ2A 2VF8A 5HFYA 2RGFA 3MK6A 2V1CA 4RF1A 3QJZA 2RRUA 1H8CA 4N8WA 1XCTL 3EHVA 1GL6A 3CSFA 2BWEA 1OAIA 1HA5A 1ZGUB 3LDZE 3SDLC 1POPA 2CHVA 1I4XA 2HTME 4G50A 3VRBB 3BPMA 4TV3A 4JI0M 4DBGA 1PJSA 4LJAA 4DMYA 3I04M 1MI0A 2QILA 1JQ4A 1FEHA 3NVWA 2HJ8A 2LUEA 2DZYA 4D81A 3RULA 3EIEA 3OISA 1VJVA 3WHLA 1DOIA 1V2YA 1LQBA 3MHVC 4MM3A 3U60B 1RU3A 3KUDB 1O0EA 3P5WA
chains in the Genus database with same CATH topology
2DWMA 5EE3A 1L2BA 3T38A 2D7GA 1W5TA 1JR3A 1JW9D 4ZHPA 1AN8A 5KPZA 1C78A 3ZGZA 3FTCA 2O5RA 3MP2A 1STEA 3K1JA 1R2YA 3SAVA 4C80A 2FUG1 2M5ZA 1YSYA 3GLGA 8CATA 3B21A 2L7HA 1IBLM 1N36M 4X66M 4S12A 2PMVA 3LYYA 1XXHB 4LF7M 1BXTA 2KRKA 3SYLA 5BPVA 3HRDD 4HRSA 3AN1A 3RFZB 4AG6A 1YQ3B 1FFUA 4DV7M 4RGTA 2HCBA 2NTSA 2LXEA 4OZCA 4ARIA 3KOYE 3BB7A 4DXFA 1PM5A 3AE2B 1E9MA 1F2RI 2MJDA 3KVWA 3AKZA 3DA1A 2H1RA 1M4VA 3KDSE 4B0EA 3MC0B 1QILA 3R8FA 4NRVA 2XFSA 1W5SA 1SXJD 2E3TA 2GB1A 1DGBA 1N5WA 3TEWA 3ZJUA 2KW0A 1VZ7A 3MHZA 1WWTA 1N60A 4YWGG 3W30A 5ITQA 5KO3A 4D2KA 2BTEA 3VRAB 1NNUC 4P16A 4M0WA 3BBAA 4GHLA 3I57A 3TRKA 2NTTA 4IJFA 1N62A 2EKIA 2KMMA 5DNYA 4OW0A 3E9SA 2Y0TA 3ZC7B 1C9FA 4D8BA 4RKXA 4BOPA 2OHFA 4YTMB 3UK6A 5JI3E 1JMLA 3KOXE 2JXTA 4WAFA 5EXSA 4LFAM 2B76B 3J7AS 1X37A 2WP9B 4DR3M 1ZAEA 1GPXA 3GP1A 3VLFB 4LLGM 4YSYB 4A90A 5G5GA 2H89B 3W0FA 2V4IB 1K53A 1JWAD 3U2SC 4WWMA 3NZ3A 1MX0A 2EELA 2BYTA 3AOEC 3PXGA 3VR9B 3W0LB 1V1PB 2M56B 1V1OA 1JRPA 3A98B 5ITXE 3SHGB 1MHXA 4YTNB 4US9A 4FXCA 1RYJA 4ZTBA 4KLNA 1D5XC 1QLBB 2KA6B 1TKGA 2UXBM 5F3WA 2XNAC 4BBAA 1L0XB 2HKJA 4XE0A 3TEZA 3LQRA 4OZAA 3KS8A 3GPPA 3FUUA 4BOSA 4IBKA 2UZJA 5EP3A 1TY0A 3W9CB 3VQIA 1Z5AA 2MJEA 1SXJB 4GKJM 5AUIA 4FCWA 3SEBA 2FOIC 4ZYSA 3J7BA 3IG5A 2R4JA 3GRUA 1N75A 5I4DA 4LJ7A 1KH0A 2BS4B 2YFQA 4FWHA 3OQCA 2GI9A 1MVKA 3VDUA 1VJKA 5ITYA 5H92C 1PJJA 3U6EA 1CK1A 2EO2A 1TH2A 3KSJA 2XF3A 2F5SA 1QT9A 4LF9M 2IJ0A 2K5PA 4RGMA 5EXTA 2AQ1B 1TH4A 3I4VA 1AW7A 2XH9A 3UI3A 3AEDB 1DGHA 4NXNM 2G1EA 2WNMA 3PHXA 2CJNA 1CZPA 3C0RA 3EIHA 4NAWB 2UUCM 4AQ7A 2DVWB 3PHUA 1N32M 4JWSC 3VKGA 3BOSA 4OVZA 1FRDA 1XMQM 1OQRA 4HJGE 4A8XC 1IY1A 4MGZE 1NNJA 4LF5M 2V1UA 2HDEA 4P6VF 5GXGB 3BYTB 3Q8AA 4WURA 2BBCA 1JROA 1HQCA 1HEZE 4JI5M 4B7FA 3P4PB 2D7HA 2N9KA 1E94E 1V8CA 2YEPB 2Y3AA 4ITQA 5IZ7D 1XNQM 2RKOA 1XLOA 2VZKD 3U6OA 4B7GA 3KLSX 1N63A 1RFKA 1SE4A 2LWXA 4MB7A 1SXTA 1EWYC 2DZNB 4MGYE 2L83A 5FKAC 4HKQA 1SXJE 3AFHA 1ZOYB 2QENA 2HHHM 1ZP0B 1DO0A 1I4RA 4QOZC 1P7FA 3E4RA 3BK1A 1YNTE 3BVMA 1FRRA 4L2YA 2WXOA 3KXEC 2I38A 1Q10A 2WDRB 2RGHA 3KWVA 4AS1A 2I2YA 2HWKA 2WDQB 1SXJA 2ZW0A 2E6XA 3ZCBB 2V3NA 4IUMA 2J7QC 1NHWC 1PGBA 3U5ZB 1VLBA 1G41A 2JQRB 3E56A 5EE1A 2XZUA 3N9YC 3GRRA 4UDUC 1SE3A 2PTLA 5C1BA 3R2TA 3NVVA 2CFOA 5FK9C 3GPUA 1PYWD 4GITA 3IT4B 1DO2A 4Z6YA 3WCQA 5H37D 1I4PA 3NVZA 3SFEB 2R18A 1BUIC 1NVID 3AE6B 3AE7B 1FJGM 2TSSA 4JX1C 4LFBM 4Z8XA 1XLNA 4OVZB 2FFJA 3PSEA 2R45A 3PHWA 4LY6A 2KDMA 1YZBA 4EE2A 3SASA 3GS2A 4ZPXA 2C99A 2W82A 5EXXA 2DWLA 4BOQA 3AEAB 4IKGA 1V1PA 1FXAA 1WSPA 5EP2A 1WYGA 2C9OA 2L1AA 4RNAA 1B1ZA 4MH0E 3U60A 3HHZA 4NRWA 1JWMD 1FO4A 4IBGA 4XBOA 4RGNA 3CF0A 1TKEA 3O65A 2RDHA 5IWAM 3PZ7A 3L4PA 5BMIA 3I51A 2CV0A 2QSDA 2V3PA 4WIPA 4IBCA 2BTWB 2LGIA 4LTUA 2KWDA 2JRIA 5FTLA 4L23A 5C2TB 1E6EB 4GDLB 1JALA 3GLHA 4I8OA 3Q8EA 1C79A 3FC4A 1YN5A 3AEFB 1ESFA 1MU5A 1UGJA 2X8AA 4I5SA 1QANA 2WU2B 2XEPA 4FVMA 2LNHC 3DFZA 3JR5A 2XN9C 2J53A 1IN7A 2Y5CA 1NHGC 4JPSA 3P4QB 4IBEA 5EJCA 1OQQA 3U61A 2VZKB 4IBDA 2BB5A 3I9V1 2Z3XA 4YY3M 4JYAM 2Y0QA 1ZDVA 4B3SM 2VIIA 5FTKA 1NSFA 3U6PA 4NXMM 2ZAOA 4DR2M 4NL4H 1Z59A 2FE8A 4TQ0A 3TEYA 4GC9A 5D3IB 3AE1B 1NY6A 1EU3A 1JWBD 1F0ZA 2UUAM 5D7GA 4M9XA 1K50A 2QPAA 1DGGA 3HHYA 3KFUG 4USAA 1F77A 3PVSA 2DOSA 2J52A 2XZFA 2WXMA 1IN6A 1D5ZC 4LRSA 2E5LM 3PRPA 4M9ZA 5ITRA 2AGAA 3IAM1 2KEBA 1T3QA 4D80A 4DV3M 1F2RC 2V0GA 1HNZM 1TH3A 4IIWA 1JCKB 3L26A 3P42A 1ET6A 4NAMA 3URYA 4A3VB 3AECB 3P4SB 2BB6A 2JX5A 4IBBA 3MJ5A 3HJSA 3FD9A 3GLFA 1NENB 5LMUM 1E9RA 7CATA 1TS4A 2K9XA 3AE9B 2Z4RA 3AE8B 5C3JB 1T5XD 1TS2A 4NZLB 2WU5B 4FCVA 3LVVA 4GMQA 1VRAB 2MH7A 1G8PA 1KFVA 4A55A 1PUTA 3GQ4A 3U4EG 2P5TA 2BJVA 4G6ZA 5H8YE 4H2AA 2JU6X 1R6BX 3AJIB 3C58A 4JI7M 2CEAA 4LRTA 5E6JA 1KLUD 2N0SB 5FR3A 1TYGB 4HXDB 5BMHA 4DR6M 1YJJA 3FUWA 2QZ4A 4PDIA 1FCLA 1ET9A 1QAOA 1IM2A 2KQ4X 3FILB 2DYOA 3T1HM 2RGOA 2XFTA 4B08A 2M60A 2R46A 5EQTA 3L27A 2C98A 3SHFA 4AQYM 4RGOS 2J42A 1N61A 3RNVA 3GQ3A 1WXQA 1KSFX 3TWKA 4D8IA 3HVDA 4GUAA 4XZXA 1PFDA 3IFUA 2BT6A 3TPZA 1G59A 3HGIA 5IREB 3PZ8A 1IY0A 2M0AA 2MEKA 4JI3M 3TEXA 2WXRA 4NJCA 4BLCA 3AOGA 3L29A 1I4GA 1V97A 1TDZA 3DOAA 2L32A 5ITTA 3U6CA 4MM3B 3U52E 5LMNM 1WGKA 1IBXB 4G4NA 1IQPA 5FLXS 3T3NA 4AW4A 4KKIA 3W1SA 4IP3A 1SIJA 5DYGA 1BMLC 3U6SA 3SYKA 2Z4SA 2JSVX 2JYTA 3TL4X 2F5QA 1KLGD 4W5WA 3J9CA 1E0ZA 2JA2A 1IGCA 1NI3A 3Q8CA 1FM0D 2LHDA 1L0YB 1C4AA 1SXJC 3J81S 4YTPB 4C7ZA 2ONQA 2CV1A 3ZJVA 1GKIA 1DOYA 4HL4A 3LVWA 4DXGA 2UU9M 2JTCA 2LUMA 4PCZA 1K3XA 3BK2A 3SAUA 3RFWA 1A70A 4AKGA 4MI7A 4C56C 4C7YA 1OFHA 3HU3A 4US8A 2KXEA 3Q8FA 4PDGA 3B9JA 1AYFA 5ITUA 1L1TA 3IAS1 1XLPA 1NVMA 3AE3B 3BIID 3SR6A 1ACCA 4D82A 2D7EA 2F5OA 1UWXA 4LK0M 1OFIA 3VKHA 2HL7A 2ZM6M 1YMHE 1SF0A 1SBBB 2Y5PA 1ZDXA 1N78A 1G4AE 3NUHB 2D5GA 4YSXB 1HZ5A 1ZUD2 3EGRA 1I94M 4DR5M 3WHKA 2PKOA 3TWMA 1C1KA 2DYMA 5EE0A 1TZOA 1HQYE 2F4VM 2N7JA 3H4MA 3KP0E 5EZSA 2LJIA 2IGGA 3A45A 3VK7A 4TMAB 3GRYA 4BOUA 4L78A 1XWIA 2I7PA 1LV7A 3FTFA 2Z7JA 1T6BX 3LB8C 3THGA 3Q8BA 1ROEA 1QOAA 1QAQA 2DZOB 5HI1A 4G4QA 3GLFB 3P1MA 4EIWA 2FNAA 3I4YA 3ZH9B 4DUZM 4LGYA 3PNYA 2QCUA 2XLJA 4JI8M 3MFGA 2BW2A 2VQEM 5EE9A 5BMGA 1R2ZA 3LXFA 2J7OA 4JN6A 4JXJA 2BNKA 3PO0A 2G9HD 1SSNA 4WW0A 2ZAMA 4B0MA 3AEGB 2L6OA 1I7HA 4DV1M 4LJ6A 2W55A 1J7KA 1L6VA 4GC5A 2K3UA 1XXHA 5T8IA 1Q3CA 4LZZA 5EP4A 2SAKA 1TDHA 4M0DA 5MPOA 3C8YA 3PNVA 4IJEA 3T1YM 4OU7A 4DV6M 4TSSA 3U6DA 1OJLA 3GO8A 4L4UA 1J7BA 4DV2M 3AMZA 4KKJA 4YHHM 3UGJA 2K22A 4CHTB 1YJIA 3CTWB 4PT5A 3ZNHA 4GIPA 2WXPA 4CISA 4QOSA 1KRHA 1TY2A 1QF6A 4JI2M 2BTWA 3D8BA 3FTEA 2WLBA 2WXLA 3IG8A 4CQNA 2XSZD 3TQSA 1IXRC 1XHBA 2WXJA 1HNWM 2KAJA 3R9XB 3K2LA 1D5MC 3Q8XA 3K8ZA 4DV4M 1VDVA 2KN4A 2Y20A 1UWMA 3VK8A 1ENFA 1FNNA 5BYSA 1SB3C 3KW6A 4JI1M 3DZDA 2JWUA 4JWUC 3J2PB 3GLIB 2AX5A 3CWIA 2DBYA 3TE6A 4DQOC 3VDPA 3U61B 1ZQ9A 4J3OD 3UZUA 2LFIA 3UJNA 1VDDA 4MGHA 2CHQA 3L25A 1FMAD 3VFDA 2DWQA 5EXPA 1XCQL 3HU2A 4ARCA 3PT2A 4LF8M 2WDVB 3Q69A 1QYRA 3PRMA 2F5PA 1UUPA 1Z5BA 1ZPSA 4B7HA 4OX9M 1Z5CA 2ACZB 2QIEB 2UUBM 2H88B 1TKYA 1E10A 1P7EA 3D8LA 3AV0A 3U6QA 2INNE 2QJLA 1XF5L 4L15A 1NYQA 4Q2JA 3FAHA 4N58A 1QOFA 3GQ5A 1XXGA 1YE9A 4TUWA 2AQ2B 1GB1A 1TJEA 2YEPF 2KZUA 1IY2A 1QKZA 1KYIA 3W31A 3KWLA 1N77A 1IBKM 1SJED 3AEEB 3BVGA 4LZJA 4LCBA 3SC3A 1XLQA 4R3DA 4NSOB 1E32A 4DR7M 1YUBA 2WXGA 1QZMA 4DR1M 5JZEA 1GL7A 2MJ3A 1C4CA 1R7SA 4HKZE 2GRIA 1IXSB 1K3WA 2L52A 4IBIA 3AE5B 1UNSA 2EA0A 3ZJTA 4LGMA 3B2FA 4XDDA 2QBYA 3HHXA 4DR4M 1FCCC 2N9LA 4QNRA 3W2DA 1E7PB 1MPEA 2OQ4A 4XDCA 4YSZB 3ILKA 1Z6TA 3V05A 4HROA 1DKIA 4GDKB 1IN8A 3GLIA 1R7RA 3W5UB 3U5ZA 3LQQA 2IGHA 1L4DB 2CU3A 4ZOHC 4LJ5A 4X65M 1XNRM 2RMMA 1NY5A 4ZRPA 3W5VB 4L1BA 4CGYB 3FYDA 2ERCA 3UMMA 3EA6A 2CJOA 3K92A 1GOZA 4JE3B 2C5RA 1PGXA 2CHGA 3TUOA 1QAMA 3MTVA 2NQ8C 3FUVA 2C96A 1IN4A 1D2NA 1K51A 1J7CA 3KQ4A 4MH8A 3BZDB 1FNUA 1JQJC 3SFZA 1L6UA 4WH4A 4I4LA 2RPVA 4N6EB 2AQ3B 1XEEA 2SEBD 5LNK1 2F5NA 2LHEA 2BS2B 1L2CA 4A6QA 1QVRA 3T3OA 4B3RM 3KOWE 5EZQA 5KPTA 3FKEA 2CV2A 1N5XA 1Q3BA 4KGRA 2Q2EB 2IPKD 3SMPA 4RH6A 4LF6M 3NBIA 4IBFA 3AOEA 2L7IA 1TS5A 3RE8A 2J7NA 4NOOB 1Q39A 3QWLA 4HEA1 4ITKA 4XWWA 4KHPM 4LJ8A 2JZPA 1FFVA 1GB4A 5G5HA 1PDXA 2ZANA 3HWSA 4KGSA 2AHMA 3AV8A 1DOXA 3AH7A 1RWSA 1YN3A 2WXFA 2L09A 4BOZA 2DWZB 2QP9X 5GKNA 4L8RC 4PD2A 1FD6A 1CQVA 1VR9A 1NEKB 3DWMA 4D8EA 2A5YB 5IT9S 3R8BA 4AG5A 3GLHB 1IN5A 3H8HA 5AUKA 2I7NA 3A46A 1LO5D 3OTOM 1L2DA 3HKPA 2OEDA 2RDGA 1IGDA 1L0VB 3HUIA 3M7GA 2PLPA 1L4ZB 4QHTA 3SARA 2LMCA 2X4AA 1L5PA 3KOZE 2XGNA 2INPE 1D4BA 5BYQA 5EP1A 3CF6E 2LEKA 1HT2E 4IBJA 2R65A 5FTMA 3NVYA 2UXDM 2PVOD 2QMTA 1HR0M 2DWNA 1NYRA 1I4HA 4ZHOA 3FYCA 4MGKE 3FUXA 4OHJA 4XWTA 1PVJA 1AWDA 2DHRA 1OFFA 4M9SA 4JV5M 3T15A 3M6AA 2NMQA 4X62M 3DWGC 3ZYYX 2IDYA 2QEJC 3KP1E 1C77A 1QOBA 4AI6A 1YN4A 2V6ZM 4GLSC 4B3TM 4DV5M 1GAQB 2WXKA 3HJ8A 1ORYB 1C76A 3JAMS 2X49A 2ZW1A 1JR3D 2WS3B 4X64M 2FBWB 1DGJA 1KTKA 3L2AA 2G5GX 1N34M 3V3XA 3HVZA 1K52A 3GB1A 1JWUD 2BJWA 1QOGA 3B9PA 4GHAA 3BY4A 4LFCM 1PGAA 2ICIA 1GVNA 2KACA 3RPFC 3VR8B 4QNMA 2WXQA 3GRVA 5HG2A 3CIRB 4LJ4A 4G4OA 4GH9A 5BR8M 3ABVB 3GPXA 2WXIA 1C4PA 1VZ6A 3CF2A 3GP7A 2G8LA 2XSZA 1VZ8A 3M0EA 1L8QA 1S3SA 4GRIA 3U6MA 3OWEB 1UKFA 1I4QA 3ZQ4A 5BYRA 4RF0A 4KGTA 1UM8A 3NRZA 3HHWA 3AL0C 2R62A 2K0PA 1FNVA 3P4RB 5FTNA 5FTJA 2PVGC 5HHDG 4QHSA 3ETRA 1J7AA 4YXDB 1DYQA 4AZFA 3AE4B 1FNWA 4LF4M 1SJHD 3QAUA 1NJGA 4MT5A 2LH0A 4XGIA 5A2QS 4AKHA 1TS3A 5D3DA 3JR4A 2ZBKB 3BVZA 4FWDA 1HNXM 3RGSA 3L28A 5FSWA 1DGFA 2Z84A 2YNMD 2PIAA 3FILA 2WXHA 1I4WA 2W54A 3J27B 2C9CA 2VQFM 4DUYM 2WQYB 1Y56A 4IDIA 1HXYD 3AEBB 1T3TA 2KZSA 4FD2A 1EM7A 4A5UA 2W3SA 1DGHB 1B9RA 2W3RA 3U7ZA 3A42A 1HZ6A 4R7GA 2EUCA 2R4EA 4KO8A 5TSSA 2J4XA 4DV0M 3R2IA 3GPYA 2UXCM 1XO3A 4KODA 4K0KM 3AB5A 1XC8A 4GKKM 1N33M 3FUTA 2YQZA 4ZRQA 1J09A 1J5EM 1EE8A 1K82A 1EWCA 2R61A 3SFDB 3KS4A 2DXIA 2OPFA 3U6LA 2YR0A 4BB9A 1XMOM 1FIQA 2PW9A 1IXZA 4RCOA 5C18A 1MHHE 1GLNA 1IBXA 2BU3A 3NS1A 2JYEA 3EUB2 2X38A 2CE7A 1E9SA 4HLQA 4YT0B 3HU1A 4REZA 1ZXHA 1TGUA 1PJIA 1KFYB 4RFBA 5KQ8A 1SEBD 3SBJA 1JWSD 3FTDA 3GLGB 1EU4A 1YQ4B 3IT6B 5E26A 2BS3B 4JI4M 5ITXA 4A9AA 3PFIA 2Z8LA 1HT1E 4MACA 2WXNA 3SATA 2Y21A 1NJFA 1IUEA 4LJ9A 1SE2A 1G3IA 5KPRA 3BYYB 4AKIA 1HQRD 2DLBA 3TWLA 5KQDA 3BWUD 1L1ZA 2J7QA 5JXVA 1FXIA 2IGDA 1KF6B 4II7A 4I81A 2KRUA 1CJEA 4N59A 4LG2A 3J80S 4FW9A 3P63A 5JI2E 1IBMM 3AM9A 4FCTA 2Q5WD 3B2GA 2K47A 4L16A 4KX6B 1ZXIA 1H6UA 1QQRA 1RM6C 3O13A 2QBYB 1D6EC 4OZBA 2M19A 4MGIE 3TSSA 3SMSA 3MP9A 3SAWA 3IXSA 4G4RA 4NSRA 4JI6M 4FWGA 2ON8A 1ZE3D 1WRIA 3LMMA 4B3MM 5DYIA 3KSXA 3RGPA 4O1NA 3NWLA 1QQWA 4IOIE 4WQMA 2CUZA 3HJQA 4TQ1A 3TMPA 5HFYA 3MK6A 2V1CA 4RF1A 1XCTL 1GL6A 1HA5A 2CHVA 1I4XA 2HTME 3VRBB 4JI0M 4LJAA 1MI0A 2QILA 1JQ4A 1FEHA 3NVWA 4D81A 3EIEA 3WHLA 1DOIA 3MHVC 3U60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3D A;  4RNA A;  4OW0 A;  3E9S A;  4REZ A;  4WUR A;  3MP2 A;  4MM3 B;  3MJ5 A;  4RF1 A;  5KO3 A;  2FE8 A;  4OVZ A;  4RF0 A;  4PT5 A;  4P16 A;  4OVZ B;  4M0W A;  5E6J A; 
#chains in the Genus database with same CATH topology
 2DWM A;  3RNG C;  3RMK C;  1HTQ A;  5EE3 A;  1AU2 A;  3HIZ A;  1VEK A;  3BBZ A;  1L2B A;  3T38 A;  2D7G A;  3NZS A;  4HVB A;  2VHS A;  1W5T A;  1JR3 A;  1XQQ A;  1JW9 D;  4HLE A;  1V80 A;  4ZHP A;  1HTO A;  1AN8 A;  3QAR A;  5KPZ A;  1C78 A;  1GC6 A;  3FTC A;  2O5R A;  3ZGZ A;  2R9N A;  2CKH B;  1R4M I;  3MP2 A;  1STE A;  3K1J A;  1R2Y A;  1MG4 A;  3SAV A;  1WIA A;  3N32 A;  1ATK A;  2NQD B;  4C80 A;  2FUG 1;  2LVA A;  1CB5 A;  2N7D A;  2M5Z A;  1YSY A;  3I01 M;  3GLG A;  8CAT A;  1GUA B;  3MHH A;  3H9D A;  2O25 A;  4WJN A;  2L7H A;  2ZNV B;  3B21 A;  2EKK A;  1IBL M;  2PRE A;  3LXS A;  2RDB C;  4AOF A;  1IFY A;  4G11 A;  1N36 M;  4X66 M;  4S12 A;  2PMV A;  3LYY A;  1XXH B;  3V6C B;  2DCD A;  4LF7 M;  4CDD B;  1BXT A;  3GCB A;  2KRK A;  1WGG A;  2P86 A;  3V60 A;  3SYL A;  4W9L A;  5BPV A;  2LVP C;  3HRD D;  4HRS A;  3AN1 A;  3ZNZ B;  1VQ1 A;  3RFZ B;  2DZL A;  4BS6 A;  4AG6 A;  1YQ3 B;  1F2C A;  1FFU A;  1TT5 B;  2E03 A;  4C00 A;  4FJV B;  4DV7 M;  3DBR B;  4RGT A;  4DDG D;  2HCB A;  2NTS A;  2KJ6 A;  2LXE A;  1QDT A;  1ZV1 A;  4GEW A;  4OZC A;  2JZ3 B;  2KDI A;  4ARI A;  3KOY E;  3BB7 A;  2IBI B;  4DXF A;  1PM5 A;  3AE2 B;  1E9M A;  3KFQ A;  1F2R I;  2MJD A;  2L76 A;  3OF8 A;  3KVW A;  2R2O A;  3AKZ A;  1OGW A;  1SP4 B;  3DA1 A;  1QMY A;  2M4N A;  2H1R A;  1M4V A;  3KDS E;  2APL A;  1F1H A;  3SHQ A;  4B0E A;  2DAF A;  3MC0 B;  1QIL A;  3R8F A;  2AUX A;  4NRV A;  2N35 A;  2XFS A;  1W5S A;  4IM0 A;  1SXJ D;  1A5R A;  3USV A;  3NBX X;  4P1C C;  2E3T A;  3UGB B;  4KVG B;  1ICF A;  2G8J A;  2G4D B;  2GB1 A;  3QT4 A;  1DGB A;  4II2 B;  1N5W A;  2DZZ A;  3TEW A;  4C4V A;  3VH3 B;  3ZJU A;  3ZDT A;  3A4R A;  2J5Y A;  2KW0 A;  3PVL A;  3TBL D;  1VZ7 A;  3DF0 A;  3MHZ A;  1WWT A;  1N60 A;  4YWG G;  1V6E A;  3W30 A;  2HD5 A;  3R7Q A;  4PYU A;  2KLG A;  3RI7 C;  5ITQ A;  5KO3 A;  4D2K A;  2BTE A;  3VRA B;  2MBH A;  1NNU C;  4P16 A;  2KT7 A;  4M0W A;  2KO3 A;  4ASW C;  1QUT A;  4GHL A;  2KHW B;  3I57 A;  3BBA A;  3TRK A;  2WBF X;  1WGY A;  2NTT A;  2PNS A;  1F2B A;  3JVZ X;  1TIF A;  4AUQ C;  4IJF A;  4IM3 A;  4KLB A;  1N62 A;  4E3C A;  1YT7 A;  2EKI A;  1UH6 A;  4YYW A;  2KMM A;  3MC8 A;  5DNY A;  4OW0 A;  3E9S A;  2Y0T A;  3ZC7 B;  4EZL A;  1C9F A;  4D8B A;  4QRG A;  4RKX A;  4BOP A;  2OHF A;  4YTM B;  3UK6 A;  5JI3 E;  4AJW A;  1JML A;  3ZQJ A;  1QZE A;  3KOX E;  3ENE A;  4K7U A;  4FJY A;  3HHM A;  2JXT A;  4WAF A;  3DDC B;  5EXS A;  1YD8 U;  1V81 A;  1YX5 B;  3VVW B;  3BPF A;  4OVV A;  1A5T A;  2LBC A;  4LFA M;  2A4Z A;  5IKC M;  2B76 B;  3J7A S;  1X37 A;  3PRM B;  1OIZ A;  2KTR B;  1PAD A;  2KVR A;  2MA9 B;  4W9F A;  4CZW A;  2WP9 B;  4DR3 M;  5K16 A;  1YK7 A;  2CRU A;  2QHO A;  1ZAE A;  2AEH A;  1GPX A;  3GP1 A;  5L8R F;  3VLF B;  4LLG M;  4XR7 A;  4NAW A;  3PRZ A;  3IEJ A;  4WJP A;  3SD5 A;  1PIP A;  2D3A A;  4YSY B;  2HE7 A;  4A90 A;  2WDT B;  2BKF A;  4KV2 A;  5G5G A;  3DCG A;  2H89 B;  3W0F A;  1V34 A;  2V4I B;  1K53 A;  2DI0 A;  1JWA D;  1NBF C;  3U2S C;  3RNE C;  4P6E A;  4WWM A;  2MCN B;  3H6N A;  2K6D B;  4FJZ A;  1FH0 A;  1I35 A;  4OVU A;  3NZ3 A;  1MX0 A;  1PPO A;  2EEL A;  2LRU A;  2BYT A;  3IG3 A;  1D0M A;  3AOE C;  1EUV B;  3PXG A;  3VR9 B;  4CDF B;  3CGW A;  3W0L B;  1V1P B;  2M56 B;  2DJG B;  1V1O A;  3GLF E;  1T43 A;  1JRP A;  3A98 B;  3ZNH B;  2V9H A;  3OAW A;  3B79 A;  4LNK A;  1EIJ A;  1TGZ B;  5ITX E;  3SHG B;  4GB9 A;  1MHX A;  4GMV A;  4YTN B;  2MGW A;  4US9 A;  1XT9 B;  3APC A;  4FXC A;  3RNB C;  1RYJ A;  2KD0 A;  3IUT A;  4KLN A;  1CV8 A;  1D5X C;  4ZTB A;  1QLB B;  2KA6 B;  1TKG A;  2O2V A;  3H8B A;  4DHZ B;  4DWF A;  2UXB M;  3UIO B;  5F3W A;  2PJH A;  2HWJ A;  2XNA C;  4BBA A;  4LCD E;  2JZ0 A;  1L0X B;  2HKJ A;  4XE0 A;  1HUC B;  3TEZ A;  4MZO A;  4L6V 6;  1OKS A;  3L17 A;  3LQR A;  4GDL A;  4OZA A;  3KS8 A;  4IM2 A;  3GPP A;  1TLO A;  3FUU A;  4BOS A;  4IBK A;  3WAO A;  3B7Z A;  2UZJ A;  5EP3 A;  3HK0 A;  1N6Z A;  1TY0 A;  3W9C B;  4G3O A;  3VQI A;  2MJ5 B;  1Z5A A;  1V9J A;  2MJE A;  2FCQ A;  1SXJ B;  4PS3 A;  4HWI B;  2FCS A;  1ZIV A;  4GKJ M;  1MHW A;  2GBN A;  5AUI A;  4FCW A;  1NQC A;  2MBO A;  3DBH I;  3PTF C;  3SEB A;  2K6Q A;  2XBB C;  2DCC A;  2FOI C;  2KTF A;  4ZYS A;  1KFX L;  1YQB A;  5C23 A;  1T0Y A;  4I6P A;  1THE A;  3J7B A;  3IG5 A;  2MBQ A;  2R4J A;  5AEK B;  3GRU A;  2VF7 A;  2K8B A;  1N75 A;  5I4D A;  4LJ7 A;  1KH0 A;  2BS4 B;  1RAX A;  2YFQ A;  3FE3 A;  4FWH A;  2WZJ A;  3OQC A;  3QX1 A;  3BXW A;  1EF5 A;  3N30 A;  2GI9 A;  1MVK A;  3VDU A;  1VJK A;  5ITY A;  5H92 C;  4WJO A;  6PAD A;  3ZKJ C;  1PJJ A;  3AU5 A;  3L10 B;  1QDQ A;  3U6E A;  1UZX B;  1ZKH A;  1CK1 A;  1HE8 A;  2EO2 A;  4XUI A;  1VCB A;  1TH2 A;  3KSJ A;  1Y4H A;  3T9L A;  2XF3 A;  1LGR A;  3QCA A;  2F5S A;  1QT9 A;  3I5J C;  4LF9 M;  2D3B A;  2G45 B;  1YJ1 A;  2IJ0 A;  2C7H A;  2K5P A;  5J94 A;  4NQK E;  4RGM A;  5EXT A;  2BYV E;  2AQ1 B;  2PE9 A;  3U30 A;  1TH4 A;  2KTR A;  3I4V A;  2N9P C;  1AW7 A;  2K8H A;  1PXV A;  3APD A;  2XH9 A;  1Q5W B;  3UI3 A;  3QQ8 B;  1DGH A;  2WNM A;  4NXN M;  2G1E A;  3AED B;  2DKL A;  3PHX A;  4OEL A;  2CJN A;  4ANV A;  1OIP A;  1CZP A;  3C0R A;  2ZTC A;  3EIH A;  5IO9 A;  4W4U A;  4NAW B;  3UQA A;  5E6N A;  4CO7 A;  1EF1 A;  3B7Q A;  2UUC M;  2I1K A;  4AQ7 A;  2DVW B;  4EZJ A;  1N32 M;  3PHU A;  4JWS C;  3VKG A;  1X9Y A;  3BOS A;  3F92 A;  4OVZ A;  1FRD A;  2KOX A;  3QIJ A;  1XMQ M;  1OQR A;  3WXF A;  4DMX A;  2CWB A;  4HJG E;  4A8X C;  1IY1 A;  4MGZ E;  1NNJ A;  2L0T A;  4LF5 M;  2V1U A;  2HDE A;  3KVF B;  4P6V F;  5GXG B;  3Q3N C;  3BYT B;  2FO5 A;  3Q8A A;  3DHG C;  4W5C A;  4WUR A;  2BBC A;  3KUC B;  1JRO A;  5DCN A;  3PZD A;  1HQC A;  2G3Q B;  4LDT B;  1HEZ E;  4JI5 M;  1E8Y A;  4B7F A;  3P4P B;  4G0N B;  4M02 A;  2D7H A;  3QYE A;  2FCM A;  1E94 E;  1V8C A;  1E5W A;  2N9K A;  2YEP B;  2C5L C;  2M1M A;  5JH5 C;  3WXE A;  4FJC A;  1WZ0 A;  2Y3A A;  5HKH A;  4ITQ A;  5IZ7 D;  1WR6 E;  1YOV B;  2BYE A;  1XNQ M;  2RKO A;  1XLO A;  3QSD A;  2VZK D;  3U6O A;  4ZYN A;  4B7G A;  3DBL I;  1Y8R C;  3KLS X;  1N63 A;  1RFK A;  1SE4 A;  2KC1 A;  2LWX A;  2JRI B;  2R9O A;  1OQY A;  4MB7 A;  4F2L A;  1SXT A;  1EWY C;  1CS8 A;  3RYT A;  2DZN B;  2OO9 A;  2N7E A;  4MGY E;  2L83 A;  2WX0 A;  3QAQ A;  5FKA C;  4HKQ A;  1SXJ E;  2C7M B;  4YL8 A;  1K8R B;  3AFH A;  1ZOY B;  2FIF A;  2QEN A;  2HHH M;  2CS4 A;  4CYE A;  1ZP0 B;  1DO0 A;  1I4R A;  4QOZ C;  1P7F A;  3E4R A;  3BK1 A;  1YNT E;  3BVM A;  1FRR A;  4L2Y A;  2WXO A;  3KXE C;  2I38 A;  3VAW A;  4ANU A;  3TL5 A;  1TU6 A;  1Q10 A;  1MIR A;  2WDR B;  4DK5 A;  2RGH A;  1TTE A;  3X23 A;  2KKC A;  3KWV A;  2LD9 A;  4AS1 A;  2I2Y A;  3PW3 A;  4GDK A;  2HWK A;  2WDQ B;  3ERV A;  5JHA A;  2FQ9 A;  1SXJ A;  1D3Z A;  1WY8 A;  2ZW0 A;  2E6X A;  3ZCB B;  2V3N A;  4IUM A;  2J7Q C;  1NHW C;  1X1M A;  1PBH A;  1PGB A;  3U5Z B;  1TTN A;  4X6H A;  1VLB A;  1G41 A;  2JQR B;  3E56 A;  4B95 A;  1TR8 A;  3NY5 A;  5EE1 A;  2XZU A;  2M0X A;  4M8M A;  3CBK A;  3N9Y C;  3GRR A;  2L00 B;  4UDU C;  3Q6B A;  4KDI C;  1SE3 A;  2PTL A;  3KSE A;  5C1B A;  1DEU A;  4W9G A;  4TKN A;  4ICU A;  2JUJ A;  2K8C A;  1NV9 A;  2J0J A;  1L7Y A;  2BPS A;  4FIP A;  1YIW A;  3R2T A;  1KOT A;  3NVV A;  1NO1 A;  2CFO A;  4EFO A;  2FS1 A;  3RZW C;  5FK9 C;  3GPU A;  3VFK A;  1U5I A;  1PYW D;  4GIT A;  1VEJ A;  1SGH A;  1C7Y A;  3WAN A;  4CDC B;  5KHO A;  3IT4 B;  2JNH A;  2ZVO A;  1AYU A;  2AVW A;  1DO2 A;  4Z6Y A;  3WCQ A;  4AXM A;  1PPP A;  1D0L A;  5H37 D;  1I4P A;  4I6N B;  2C7N B;  3NVZ A;  4II3 B;  4KIK B;  3SFE B;  2R18 A;  1BUI C;  1NVI D;  2DAM A;  2OJR A;  3AE6 B;  3AE7 B;  3Q3M C;  2OOB A;  2HAK A;  1UD7 A;  1FJG M;  2TSS A;  4JX1 C;  4LFB M;  4Z8X A;  1JB0 F;  4OVZ B;  1XLN A;  2AYN A;  2FFJ A;  3TMP B;  3O1G A;  3PSE A;  2R45 A;  3PHW A;  2D10 A;  4LY6 A;  2KDM A;  1YZB A;  4EE2 A;  3W67 A;  3QA8 A;  1OEY A;  3SAS A;  3GS2 A;  4ZPX A;  3KUZ A;  2C99 A;  2W82 A;  5EXX A;  2DWL A;  3DVN U;  3AEA B;  4BOQ A;  4IKG A;  4E71 A;  1V1P A;  1FXA A;  1WSP A;  5EP2 A;  1WYG A;  4BBN C;  2C9O A;  2L1A A;  1PJT A;  1OTR B;  1WXM A;  4RNA A;  1B1Z A;  2REX A;  2DZJ A;  1WMH A;  5IP4 D;  4MH0 E;  3U60 A;  3HHZ A;  1LXD A;  4NRW A;  1JWM D;  3RCZ A;  1FO4 A;  7PCK A;  2MWS B;  4IBG A;  4XBO A;  4RGN A;  3MHS D;  1V5O A;  3CF0 A;  1TKE A;  3O65 A;  2RDH A;  1OEY J;  2K1F A;  5IWA M;  3S2A A;  3PZ7 A;  2MP2 A;  4BOZ B;  3L4P A;  4QRV A;  5BMI A;  4QBB A;  3I51 A;  2CV0 A;  2QSD A;  2V3P A;  4WIP A;  4IBC A;  4MZS A;  2BTW B;  2LGI A;  4LTU A;  3ZO5 B;  2KWD A;  2JRI A;  5FTL A;  2I1J A;  4L23 A;  4WQO B;  5C2T B;  1E6E B;  3ZVV A;  1PE6 A;  3B1L X;  5CHV A;  3M95 A;  4GDL B;  1JAL A;  3GLH A;  4I8O A;  1VDL A;  1U9W A;  3Q8E A;  2L4F A;  2KDL A;  4W9D A;  1C79 A;  1OAO C;  3FC4 A;  2DC8 A;  1YN5 A;  3AEF B;  2O01 F;  1BP4 A;  1ESF A;  2LGS A;  1MU5 A;  5CVM A;  3C9E A;  4EZK A;  1UGJ A;  2X8A A;  4I5S A;  3N1Z C;  1QAN A;  4LNO A;  1UGM A;  2WU2 B;  3EC8 A;  1KHQ A;  2XEP A;  1NPZ A;  4PS7 A;  4FVM A;  2LNH C;  3DFZ A;  3JR5 A;  2IZV B;  3NHE A;  1GEC E;  3KYD D;  2XN9 C;  4W9K A;  2J53 A;  1IN7 A;  2Y5C A;  1EWO A;  1NHG C;  4JPS A;  3UQB A;  3CST A;  2N9X A;  3T6P A;  2FNJ B;  4IBE A;  3P4Q B;  5EJC A;  1OQQ A;  3U61 A;  1GJZ A;  1XD3 B;  2VH1 A;  4IBD A;  2VZK B;  2BB5 A;  2JWS A;  3I9V 1;  2Z3X A;  4YY3 M;  4WP2 A;  2KHH A;  4JYA M;  2Y0Q A;  4IWQ A;  1WE7 A;  1ZDV A;  4K1R B;  1HJP A;  5DPR A;  4B3S M;  2VII A;  4PAD A;  4QH6 A;  4I07 A;  2O6V B;  5FTK A;  1NSF A;  3VUX A;  2LTU A;  3M63 B;  3U6P A;  2O6X A;  4NXM M;  2DJF B;  2Z59 B;  1GJT A;  3H4J A;  2ZAO A;  4DR2 M;  4NL4 H;  2ZTD A;  1Z59 A;  2FE8 A;  3N1Y C;  4XGA B;  4I6L B;  3RZF A;  2NCN A;  4TQ0 A;  3TEY A;  1MDW A;  1VD2 A;  4GC9 A;  5D3I B;  2MBB B;  4YVA A;  3AE1 B;  1NY6 A;  1NB5 A;  4BQV A;  4F7Z A;  1EU3 A;  1JWB D;  1T0Q C;  1F29 A;  4MDK E;  1F0Z A;  2UUA M;  5D7G A;  3IV2 A;  2R6F A;  2LVO A;  2D2Q A;  4M9X A;  1K50 A;  3K9O B;  2WSC F;  3IFW B;  2QPA A;  1DGG A;  3HHY A;  3KFU G;  4USA A;  1F77 A;  3PVS A;  2DOS A;  2J52 A;  1WGH A;  2INC C;  2XZF A;  2WXM A;  4X6J A;  1IN6 A;  1P3Q U;  2GBJ A;  4P1B C;  1D5Z C;  4LRS A;  2AL3 A;  2E5L M;  3PRP A;  4WWO A;  4M9Z A;  5ITR A;  1JQP A;  2AGA A;  3IAM 1;  1WXA A;  1WE6 A;  2VRR B;  4EEW A;  2KEB A;  1T3Q A;  4D80 A;  4DV3 M;  4I05 A;  5CHF A;  2OOA A;  1F2R C;  4XYC A;  2V0G A;  3ZRC A;  3PLU A;  1HNZ M;  2WYQ A;  1TH3 A;  2DC6 A;  4IIW A;  1JCK B;  3L26 A;  4ACF A;  3P42 A;  3ZNG C;  1ET6 A;  4NAM A;  3URY A;  3Q3F A;  3OVX A;  3P2B A;  4K7W A;  4A3V B;  3AEC B;  3P4S B;  1QUS A;  2FCN A;  3I63 C;  2BB6 A;  2CHZ A;  3RN9 C;  2JX5 A;  4IBB A;  1ZMV A;  3HJS A;  3MJ5 A;  3ZTD A;  4EOY A;  3N4C A;  4HDQ A;  3FD9 A;  4A3P A;  3GLF A;  3RNF C;  1NEN B;  3H1U A;  2GNO A;  4BOS C;  1MJG M;  2OP3 A;  1E8W A;  5LMU M;  1WYW B;  3ZNI D;  1E9R A;  2UWQ A;  2KNZ A;  4LJO B;  7CAT A;  2BF8 B;  1TS4 A;  2K9X A;  4PS8 A;  3AE9 B;  1WGN A;  3GE8 C;  2KX0 A;  2DAG A;  2NVU I;  2Z4R A;  3AE8 B;  2MLB A;  5C3J B;  1T5X D;  1TS2 A;  2DHY A;  2IY1 B;  4MEL A;  5DPW A;  4DDI D;  1P3Q Q;  2D3G A;  2E00 A;  4NZL B;  4P17 A;  2WU5 B;  3DHI C;  4KZ0 A;  3H6S A;  2AIM A;  2QSF X;  3LVV A;  4FCV A;  4GMQ A;  1VRA B;  2MH7 A;  2BVC A;  5BO4 B;  2AU1 A;  1G8P A;  1UEL A;  1KFV A;  3H7P B;  4A55 A;  2GLS A;  3DPD A;  1PUT A;  3GQ4 A;  3U4E G;  5J18 A;  2BQQ A;  2P7U A;  2XK5 B;  2P5T A;  1GO5 A;  2KDE B;  2BJV A;  1P9D U;  4G6Z A;  5H8Y E;  2NBV B;  4H2A A;  2JU6 X;  3GZN B;  3ZUA A;  1R6B X;  2K0B X;  3FKY A;  1R4N B;  3ECI A;  3AJI B;  2K39 A;  3C58 A;  4JI7 M;  2CEA A;  2N4F A;  4LRT A;  5JHB A;  5E6J A;  1KLU D;  2N0S B;  5FR3 A;  1TYG B;  4RKU F;  5BMH A;  3NJT A;  4HXD B;  2JPH A;  3BIN A;  2Y6E A;  3HM6 X;  2BDZ A;  4DR6 M;  1YJJ A;  3FUW A;  2PE6 B;  2MH8 A;  3IOQ A;  2IO2 B;  3PPA A;  2C60 A;  4X57 B;  4X6I A;  2QZ4 A;  4PDI A;  1FCL A;  1ET9 A;  5J2R A;  1QAO A;  4BFR A;  1IM2 A;  2KQ4 X;  2JXX A;  3A9K A;  3FIL B;  1KXR A;  2DYO A;  2ZPY A;  3T1H M;  4HDO A;  1F9J A;  2RGO A;  4ZUX U;  2XFT A;  1QXP A;  4B08 A;  4BVU C;  2GBK A;  1JRU A;  4MSX A;  1WJN A;  4E74 A;  2M60 A;  2R46 A;  3E21 A;  5EQT A;  4B9K A;  3A1Q A;  3VTW A;  3K8U A;  2IYD B;  2XU1 A;  3L27 A;  2C98 A;  3GLG E;  1V5T A;  4MJS B;  3IHP A;  3SHF A;  4AQY M;  2NBW B;  3Q2A C;  4AJY B;  2DZK A;  4RGO S;  4YYU A;  3K9O A;  3Q3O C;  2J42 A;  1N61 A;  3RNV A;  4RY2 A;  3GQ3 A;  5CHT A;  2FRA A;  1WXQ A;  1KSF X;  3TWK A;  4ZDV A;  3RT3 B;  2ARY A;  3OJ4 B;  2FYE A;  3HVD A;  1T0S C;  3PRP B;  4D8I A;  1XXH E;  2JWZ A;  4P7I A;  3RVX A;  3HZJ A;  1ITO A;  4AP4 C;  3B89 A;  3DVG Y;  2AUZ A;  4GUA A;  4XZX A;  3EFC A;  1PFD A;  3IFU A;  1MEM A;  2BT6 A;  2WSF F;  3TPZ A;  1G59 A;  3HGI A;  5IRE B;  2HTH A;  3PZ8 A;  1A6R A;  2YJC A;  5CX3 A;  1IY0 A;  2MRO B;  2M0A A;  2MEK A;  4JI3 M;  3TJP A;  3TEX A;  2WXR A;  1IYF A;  4FN2 A;  4NJC A;  4BLC A;  3AOG A;  3L29 A;  1I4G A;  3GLI E;  1V97 A;  3O65 B;  1TDZ A;  4IWP A;  3DOA A;  2L32 A;  3ML9 A;  2RD0 A;  4K3C A;  5ITT A;  3VH4 B;  4FBJ B;  3U6C A;  4MM3 B;  3UIP B;  3U52 E;  5LMN M;  1WGK A;  1IBX B;  3MOR A;  4G4N A;  1IQP A;  1E8Z A;  2R6N A;  5FLX S;  2DHZ A;  3RNC C;  3T3N A;  4HWY A;  4AW4 A;  2KWV B;  3ML8 A;  3PT2 B;  4KKI A;  4RM9 A;  4K3B A;  3W1S A;  4IP3 A;  1SIJ A;  3IVF A;  5DYG A;  2DAE A;  1BML C;  4JQW C;  3U6S A;  4F1S A;  3E1Z B;  1Q0W B;  3SYK A;  2JXN A;  2KFK B;  2Z4S A;  2JSV X;  2JYT A;  3TL4 X;  3LFY A;  2F5Q A;  1KLG D;  4W5W A;  2NBU A;  3C0R B;  3T8M A;  3ZLZ A;  1WZ3 A;  2WHI A;  3J9C A;  3HHI A;  4YYS A;  1E0Z A;  3RD2 A;  2JA2 A;  2KDB A;  2ACT A;  1IGC A;  1NI3 A;  4BKS A;  3Q8C A;  1FM0 D;  2OUL A;  1T0R C;  2LHD A;  1L0Y B;  1GNU A;  1C4A A;  1IP9 A;  4CHK A;  3OLM D;  3IHP C;  2G4S A;  3JYU A;  1SXJ C;  3J81 S;  1F2A A;  2F7D A;  3W68 A;  2ZJD A;  4YTP B;  3NHE B;  4Q8H A;  4C7Z A;  1U4A A;  2ONQ A;  2CV1 A;  3ZJV A;  2JZZ A;  2AYO A;  2CR5 A;  1GKI A;  1DOY A;  4HL4 A;  3LVW A;  4DXG A;  2UU9 M;  3WAP A;  3ZRF A;  2JTC A;  4BKT A;  2LUM A;  3MTN A;  4PCZ A;  1K3X A;  4WA6 A;  3BK2 A;  3SAU A;  2YJ8 A;  3RFW A;  1A70 A;  4AKG A;  1BQI A;  4MI7 A;  4C56 C;  4C7Y A;  1OFH A;  3HU3 A;  4US8 A;  4S0R A;  2KXE A;  2LVQ A;  1R4G A;  2MR9 A;  1U9Q X;  5LLI A;  3Q8F A;  2IO1 B;  3ONS A;  4PDG A;  3B9J A;  1AYF A;  2QQ8 A;  5ITU A;  1L1T A;  3IAS 1;  5CVO B;  1XLP A;  1NVM A;  4W9J A;  4WWP A;  3AE3 B;  3BII D;  3SR6 A;  1ACC A;  1J8C A;  5AZH A;  4D82 A;  2D7E A;  2F5O A;  4YYR A;  1UWX A;  4GN1 A;  4LK0 M;  1OFI A;  3B74 A;  5D6J B;  3DQV A;  2KJR A;  3VKH A;  2HL7 A;  1U9V A;  3CH3 X;  2ZM6 M;  4GOC A;  2AWT A;  1YMH E;  1SF0 A;  1SBB B;  2Y5P A;  1IXS A;  1ZDX A;  2PAD A;  4N4Z A;  3PS6 A;  1N78 A;  1G4A E;  4W9E A;  4BKG A;  1MJD A;  3I3T A;  2CHX A;  3NUH B;  1GG3 A;  2D5G A;  4XX5 A;  4YSX B;  1HZ5 A;  1ZUD 2;  3EGR A;  1ME4 A;  1I94 M;  3BWK A;  2KNA A;  2DEN A;  4DR5 M;  3QYB A;  1WM3 A;  1KLV A;  4GSW A;  2NQA A;  1MS6 A;  3KH0 A;  3WHK A;  5G55 A;  2PKO A;  3TWM A;  1C1K A;  2DYM A;  5EE0 A;  1TZO A;  1HQY E;  2F4V M;  1DV0 A;  2DX5 B;  2LJ5 A;  1WJ7 A;  3H4M A;  2N7J A;  5EDS A;  3KP0 E;  4J6I A;  4FA6 A;  2LGX A;  5EZS A;  2HD5 B;  2LJI A;  2IGG A;  3A45 A;  3VK7 A;  4TMA B;  3GRY A;  2KVZ A;  4L78 A;  4BOU A;  5JA7 A;  1XWI A;  2I7P A;  1LTM A;  3C9P A;  1LV7 A;  1SNK A;  3FTF A;  2ZPN A;  2Z7J A;  2KMA A;  1TL9 A;  1T6B X;  3JW0 X;  1JR3 E;  3LB8 C;  3THG A;  3Q8B A;  1ROE A;  1EWL A;  1QOA A;  1QAQ A;  2DZO B;  3APF A;  4W9H A;  2N1W A;  5CHV C;  5HI1 A;  2MHJ A;  4G4Q A;  3GLF B;  3P1M A;  1CSB B;  2DC9 A;  1NLJ A;  4EIW A;  3FRI A;  2FNA A;  1D0K A;  3I4Y A;  3NOB A;  3F5V A;  3ZH9 B;  1NDD A;  2NPT B;  2R44 A;  4DHJ D;  4DUZ M;  1DF0 A;  4LGY A;  2BWF A;  4FHJ A;  3PNY A;  2QCU A;  2XLJ A;  4JI8 M;  3MFG A;  3RNA C;  1AYW A;  2KMC A;  2B3T A;  2BW2 A;  4GIV A;  2VQE M;  5EE9 A;  5BMG A;  1R2Z A;  3LXF A;  1WF9 A;  3F75 A;  2J7O A;  4JN6 A;  4JXJ A;  2BNK A;  3PO0 A;  2G9H D;  1SSN A;  4WW0 A;  2LVQ D;  2J0K A;  2ZAM A;  4M01 A;  4B0M A;  3AEG B;  1Q6K A;  3FRH A;  2L6O A;  4W9I A;  3OF9 A;  1I7H A;  3MMP A;  4DV1 M;  3CBJ A;  1QOL A;  4LNN A;  4DXA B;  3K9P B;  2GOW A;  4LJ6 A;  2XK5 A;  1CMX B;  2W55 A;  1J7K A;  1L6V A;  3PSE B;  2DZM A;  4GC5 A;  2K3U A;  3HHA A;  1XXH A;  5T8I A;  3V6C A;  1G71 A;  1Q3C A;  2L05 A;  4QRX A;  4LZZ A;  1RFA A;  5EP4 A;  1Z5S B;  1WX7 A;  2L7R A;  2SAK A;  1Y08 A;  1TDH A;  2FT2 A;  2G6D A;  4M0D A;  5LXH A;  3C8Y A;  3PNV A;  4IJE A;  3T1Y M;  5MPO A;  2AYO B;  4OU7 A;  4DV6 M;  3PGE A;  2LI5 A;  4TSS A;  3U6D A;  1OJL A;  1OTR A;  3GO8 A;  4L4U A;  1J7B A;  4DV2 M;  3AMZ A;  4KKJ A;  1WMH B;  4HXD A;  4YHH M;  3UGJ A;  2K22 A;  2LZ6 A;  4CHT B;  2A5U A;  3R3M A;  1YVB A;  1YJI A;  2J0M A;  1GMY A;  4G3X B;  3VXW A;  4Q8G A;  3CTW B;  2GBR A;  4PT5 A;  1WFY A;  3H7S A;  3ZNH A;  5IAA C;  4GIP A;  2WXP A;  4CIS A;  4QOS A;  1KRH A;  1TY2 A;  1QF6 A;  4JI2 M;  2BTW A;  3D8B A;  3DOW A;  2C0Y A;  3S3Q A;  4NPN A;  3FTE A;  4NJ6 A;  2RR9 A;  2LGD A;  2WLB A;  2WXL A;  3IG8 A;  4CQN A;  2XSZ D;  4Q7J A;  2RPQ A;  3TQS A;  3B08 A;  4EKU A;  4AWJ A;  1IXR C;  1XHB A;  2WXJ A;  1HNW M;  2KAJ A;  3R9X B;  1V92 A;  4UN2 B;  3K2L A;  2KWU B;  4HPM B;  1WXV A;  1D5M C;  4C4V B;  3Q8X A;  3K8Z A;  4DV4 M;  1VDV A;  2KN4 A;  3I3T B;  5IN7 A;  3N3G A;  2Y20 A;  2LWP A;  2LAS A;  4P6G A;  1UWM A;  3VK8 A;  1ENF A;  1FNN A;  1MG8 A;  1EF7 A;  2EMT A;  1NL6 A;  5BYS A;  4ICV A;  1SB3 C;  3KW6 A;  4JI1 M;  3OJ3 A;  5IOI A;  2FUH B;  3DZD A;  2JWU A;  4JWU C;  1R4M B;  4M0W B;  1EWP A;  3GE3 C;  1RRB A;  3J2P B;  3GLI B;  3WAL A;  1BVS A;  1UBQ A;  1R4N I;  2AX5 A;  2LVN C;  4BSQ A;  3CWI A;  1WR1 B;  1UF0 A;  3KWZ A;  2UYZ B;  2DBY A;  3TE6 A;  1E8X A;  4DQO C;  3VDP A;  3U61 B;  4XZ4 A;  3RVW A;  3N20 C;  1ZQ9 A;  5D2M B;  2LGY A;  4J3O D;  4GU2 A;  3UZU A;  2FAZ A;  4WWN A;  2LFI A;  3UJN A;  2BDL A;  5F02 A;  1VDD A;  4MGH A;  1EO6 A;  2CHQ A;  1AU0 A;  3L25 A;  3GZN I;  1U9X A;  1FMA D;  1GAB A;  3VFD A;  2ZNV C;  2XU5 A;  3C3E A;  2DWQ A;  2OZ2 A;  4XK8 F;  3B0A A;  5EXP A;  1V86 A;  1WX8 A;  1XCQ L;  2GFO A;  2LXC A;  4CJ6 A;  3PNR A;  3HU2 A;  4ARC A;  2WWZ A;  3D32 A;  4LF8 M;  3PT2 A;  2WDV B;  2EJS A;  2KDF B;  3Q69 A;  1QYR A;  3PRM A;  2F5P A;  2DNA A;  1UUP A;  2LVO C;  3V6E B;  1IWD A;  3TIX A;  5FPW A;  1MEG A;  1Z5B A;  5PAD A;  4FHK A;  1ZPS A;  3H7D A;  1S4V A;  4B7H A;  1Q02 A;  4OX9 M;  2QHO B;  1Z5C A;  2ACZ B;  2UUB M;  1BT0 A;  2H88 B;  2QIE B;  1TKY A;  3ZUN A;  4BAX A;  4EUT A;  1E10 A;  1WHC A;  3D8L A;  3AV0 A;  3U6Q A;  1P7E A;  2INN E;  3QC8 B;  3ZXV A;  4A3O A;  3WXG A;  2QJL A;  2K25 A;  2DAK A;  1XF5 L;  4L15 A;  3PHX B;  1NYQ A;  4Q2J A;  5DPT A;  2PBH A;  3TNX A;  3FAH A;  4N58 A;  3HY5 A;  1QOF A;  3GQ5 A;  1XXG A;  2LXA A;  1YE9 A;  3ALB A;  4TUW A;  2MRP A;  3VUY A;  2AQ2 B;  2JY8 A;  2HHN A;  3MJW A;  2AL6 A;  1GB1 A;  4URK A;  1TJE A;  3I06 A;  2YEP F;  5LXI B;  3AU4 A;  3P5U A;  2KZU A;  1IY2 A;  1QKZ A;  1KYI A;  3W31 A;  2FTD A;  2LVP A;  2DAI A;  2KN5 A;  3KWL A;  1N77 A;  1IBK M;  4IWO A;  3PBH A;  1SJE D;  3AEE B;  3BVG A;  4LZJ A;  2FH0 A;  4LCB A;  1PPD A;  4R71 A;  3SC3 A;  1P1A A;  1LFD A;  4KDL B;  1EFU B;  4MSM B;  1XLQ A;  4R3D A;  2V1Y A;  4NSO B;  2G3Q A;  1E32 A;  1WGD A;  5CHW A;  2JT4 B;  5CTR C;  4BPV A;  2J7Q B;  4DR7 M;  3WA0 A;  3BY4 B;  4GXB A;  3L08 A;  2JRH A;  1YUB A;  3LJ3 A;  3U8Z A;  2WXG A;  1QZM A;  4DR1 M;  5JZE A;  3DHH C;  1GL7 A;  1CVZ A;  2MJ3 A;  1C4C A;  1R7S A;  2PPH A;  4HKZ E;  2YJB A;  1STF E;  1AYV A;  2F1G A;  2GRI A;  2BKR B;  1IXS B;  5TR5 A;  2BWE S;  1K3W A;  2JQG R;  2L52 A;  4WAA A;  4HCN B;  4IBI A;  3AE5 B;  1UNS A;  2FRQ A;  2EA0 A;  3ZJT A;  4LGM A;  3B2F A;  2NQG A;  4XDD A;  1GLO A;  2QBY A;  3HHX A;  4DR4 M;  1FCC C;  4KSL C;  2M17 A;  2MX2 A;  2N9L A;  4QNR A;  2ZEQ A;  1MN3 A;  1CPJ A;  3W2D A;  1E7P B;  1MPE A;  1XB2 B;  2OQ4 A;  4XDC A;  1CQD A;  4YSZ B;  3ILK A;  1PGY A;  1Z6T A;  3V05 A;  4HRO A;  1DKI A;  1K3B B;  4GDK B;  1IN8 A;  1LM8 B;  1XKG A;  1WGL A;  2KX3 A;  3GLI A;  2GBM A;  2R9M A;  3BOW A;  1WR1 A;  1R7R A;  3W5U B;  3U5Z A;  9PAP A;  1WM2 A;  3LQQ A;  2IGH A;  1L4D B;  3W1S C;  2C9W B;  2CU3 A;  4JGH B;  4ZOH C;  4LJ5 A;  4X65 M;  1XNR M;  1UFZ A;  1NY5 A;  1H4R A;  2RMM A;  4ZRP A;  3W5V B;  4PP2 E;  4L1B A;  4CGY B;  3FYD A;  2ERC A;  3UMM A;  3EA6 A;  2CJO A;  3K92 A;  1GOZ A;  2C5R A;  3JSV B;  4JE3 B;  4CDE B;  1KM7 A;  1PGX A;  2CHG A;  1V33 A;  5D94 A;  3IBE A;  3TUO A;  1QAM A;  3MTV A;  1Y8G A;  2NQ8 C;  4N9F 4;  3A9K B;  2LHG A;  2M8S A;  3FUV A;  2C96 A;  1IN4 A;  1D2N A;  3M62 B;  1GC7 A;  1NI2 A;  1K51 A;  4N79 A;  1J7C A;  3KQ4 A;  3LW5 F;  4MH8 A;  3BZD B;  1FNU A;  4PK1 A;  1JQJ C;  2N9E B;  3SFZ A;  1L6U A;  3VHT C;  3OG5 A;  4WH4 A;  1ZMU A;  4WJQ A;  2YLM A;  4I4L A;  2RPV A;  2UU7 A;  2BYF A;  2O6V D;  4N6E B;  1SG9 A;  2AQ3 B;  1ME3 A;  1XEE A;  2SEB D;  2JY6 B;  4KT0 F;  4NQL B;  3CH2 X;  5LNK 1;  2F5N A;  1MFW A;  5DPS A;  1P0R A;  2LHE A;  1WH3 A;  2KNV A;  3L0W B;  2KC2 A;  2BS2 B;  3K9P A;  3N1X C;  4OEM A;  1L2C A;  1F52 A;  3DVG X;  2Y5B B;  4A6Q A;  1QVR A;  3T3O A;  1KFU L;  2AS8 A;  2KLC A;  4B3R M;  2DZI A;  4KIK A;  2QCZ A;  3KOW E;  4CIZ A;  4PYZ A;  2B1N A;  5KPT A;  5EZQ A;  3FKE A;  3KW5 B;  2CV2 A;  1N5X A;  2CHW A;  2KWC A;  1Q3B A;  4KGR A;  2MQJ A;  2Q2E B;  2IPK D;  3SMP A;  4RH6 A;  4LF6 M;  3NBI A;  1VSN A;  4IBF A;  4PI3 A;  3AOE A;  4K7C A;  2L7I A;  1S1Q B;  1TS5 A;  3A9J A;  3RE8 A;  3UIN B;  2J7N A;  4NOO B;  2EMS A;  1Q39 A;  3QWL A;  4HEA 1;  1PCI A;  4ITK A;  4XWW A;  1YAL A;  4KHP M;  3DBH B;  1QDR A;  4LJ8 A;  1J19 A;  2JZP A;  2XEW A;  1FFV A;  1GB4 A;  5G5H A;  2GHU A;  1PDX A;  2ZAN A;  3HWS A;  4KGS A;  1WXS A;  2XU3 A;  2AHM A;  3AV8 A;  1DOX A;  1WX9 A;  3AH7 A;  1RWS A;  4YV8 A;  2Z8Y M;  3O0U A;  1YN3 A;  4BZA A;  2KZR A;  3A4S C;  3BC3 A;  2WXF A;  3QHT A;  2L09 A;  3D6S A;  4FUL A;  2IND C;  2BWB A;  2MP2 B;  2MW5 A;  4BOZ A;  2DWZ B;  2QP9 X;  5GKN A;  2K6B A;  3AUL A;  4L8R C;  2GQF A;  4PD2 A;  3V76 A;  3R7R A;  1GJS A;  2KFK A;  3NS8 A;  2EKF A;  1FD6 A;  1VG5 A;  1CQV A;  1AUA A;  3MHS A;  1VR9 A;  2QNJ A;  1NEK B;  3B7N A;  3IEC A;  3DWM A;  4D8E A;  2A5Y B;  5IT9 S;  3N3K A;  1F4I A;  3R8B A;  4AG5 A;  3GLH B;  1IN5 A;  3H8H A;  5AUK A;  2I7N A;  4HEO A;  3A46 A;  3HD3 A;  1LO5 D;  3OTO M;  3A33 B;  1L2D A;  5J17 A;  2KFJ A;  3HKP A;  4ANW A;  2OED A;  1WJ4 A;  2RDG A;  2Z0D B;  3AXC A;  4M8N A;  1IGD A;  1L0V B;  3HUI A;  3M7G A;  2PLP A;  1L4Z B;  1E7U A;  2WGS A;  2KAN A;  4QHT A;  4IUM B;  4XC2 A;  2D07 B;  2NQI A;  1TF0 B;  3SAR A;  3P5X A;  2LMC A;  5IA7 A;  2X4A A;  1L5P A;  3KOZ E;  2XGN A;  2INP E;  3V62 A;  3UF8 A;  4LJP B;  3RVV A;  2B3A A;  3DBS A;  2HH5 A;  1ZCM A;  1D4B A;  5BYQ A;  5EP1 A;  3CF6 E;  2L3Z A;  4S17 A;  2LEK A;  5JH3 A;  1HT2 E;  2CU1 A;  4IBJ A;  5EGW A;  4KSK C;  2R65 A;  5FTM A;  3NVY A;  2DCA A;  2UXD M;  3KX1 A;  3JSV A;  2PVO D;  2QMT A;  1HR0 M;  4NJ7 A;  2JZ1 A;  2O6V A;  4ZRJ A;  3ZIM A;  2L2D A;  2V3S A;  3E46 A;  2DWN A;  1NYR A;  1I4H A;  3L13 A;  1NB3 A;  4ZHO A;  3FYC A;  5GMV A;  4MGK E;  1SIF A;  2BGF A;  2KJH B;  3FUX A;  4OHJ A;  4XWT A;  4G54 A;  1PVJ A;  1AWD A;  2DHR A;  1OFF A;  4M9S A;  2D3C A;  4JV5 M;  2B1M A;  3T15 A;  3M6A A;  3DBL B;  1PQS A;  3VUW A;  2NMQ A;  4X62 M;  4ZRK A;  1CJL A;  3DWG C;  2QC8 A;  4I04 A;  3ZYY X;  2IDY A;  4YYQ A;  2QEJ C;  3SU8 X;  3KP1 E;  4FAD A;  4JL9 A;  3AI5 A;  1C77 A;  4BKS D;  1NV8 A;  1QOB A;  4AI6 A;  1YN4 A;  5L83 A;  2V6Z M;  3MC9 A;  2Y5B A;  4GLS C;  4B3T M;  4DV5 M;  4AXL A;  1GAQ B;  2WXK A;  1RLF A;  3HJ8 A;  1ORY B;  3PHW B;  2Z0E B;  1C76 A;  1T6O A;  3JAM S;  4W5B A;  2X49 A;  1FPY A;  4IG7 B;  2ZW1 A;  1JR3 D;  2LHC A;  2WS3 B;  4TUU A;  2K9D A;  5EF4 A;  3S3R A;  4X64 M;  2FBW B;  2YJ9 A;  3KW9 A;  2CB5 A;  1DGJ A;  4K7S A;  1KTK A;  3HM3 A;  3L2A A;  2G5G X;  3VTV A;  1N34 M;  3V3X A;  3HVZ A;  1K52 A;  2JVC A;  3GB1 A;  1JWU D;  2BJW A;  1QOG A;  3B9P A;  4GHA A;  3BY4 A;  3V61 A;  4LFC M;  1AEC A;  5JZE B;  1AU4 A;  1PGA A;  2KQ7 A;  3HX3 A;  1BGO A;  5DFL A;  4DHJ B;  2ICI A;  1GVN A;  2KAC A;  3RPF C;  2NPT A;  4K81 A;  2R2Q A;  3VR8 B;  5CVN B;  4F1I A;  4QNM A;  2WXQ A;  3GRV A;  2GMI C;  3KWB X;  5HG2 A;  2NS5 A;  1Z2M A;  3CIR B;  4LJ4 A;  4G4O A;  1WJ6 A;  2JY7 A;  4GH9 A;  5BR8 M;  1TZ1 A;  2O2V B;  4HK2 A;  5A24 A;  2IO0 B;  3ABV B;  3GPX A;  2JP7 A;  2WXI A;  3EEC A;  1AIP C;  1C4P A;  1VZ6 A;  3CF2 A;  3GP7 A;  2KK8 A;  2G8L A;  2XSZ A;  1VZ8 A;  3HWN A;  4BS5 A;  3M0E A;  1L8Q A;  1P98 A;  1S3S A;  4GRI A;  3U6M A;  3N3K B;  3OWE B;  1UKF A;  3Q8G A;  2VHF A;  1I4Q A;  3K24 A;  3ZQ4 A;  3K9M A;  3DVN V;  1C1Y B;  4RMA A;  5BYR A;  4RF0 A;  4KGT A;  3H7P A;  1UM8 A;  2R9F A;  3NRZ A;  1AAR A;  3HHW A;  3AL0 C;  2R62 A;  2K0P A;  1FNV A;  3P4R B;  3X0W A;  2IPP B;  5FTN A;  5FTJ A;  2PVG C;  5HHD G;  4QHS A;  3ETR A;  1M94 A;  1J7A A;  2KYW A;  1Q1O A;  5KHQ A;  4YXD B;  1DYQ A;  3TCA A;  1M6D A;  4AZF A;  3U8E A;  3AE4 B;  2CIO A;  2JQF R;  1FNW A;  5E6P A;  1CTE A;  1WRD B;  2YVC A;  3DBR I;  3H89 A;  4LF4 M;  4LNF A;  1SJH D;  1YLA A;  3QAU A;  2W9N A;  1EWM A;  1PPN A;  3R66 C;  3ZW3 A;  1NJG A;  4MT5 A;  1L2N A;  2LH0 A;  4XGI A;  5A2Q S;  2V4L A;  4AKH A;  1UBI A;  1VEG A;  2QDF A;  2VDB B;  1TBE A;  1TS3 A;  1WJU A;  2D11 A;  2MSE D;  5D3D A;  4BBN F;  2G7Y A;  3JR4 A;  2ZBK B;  2IY0 B;  3BVZ A;  3L16 A;  2HXZ A;  4FWD A;  1HNX M;  3RGS A;  3L28 A;  4M00 A;  2H7J A;  2VH2 A;  5FSW A;  3QWZ B;  2G8E A;  1DGF A;  4HCP B;  2Z84 A;  2YNM D;  2PIA A;  3GOE A;  3FIL A;  3H8C A;  2WXH A;  1I4W A;  2W54 A;  2HJ1 A;  3Q14 C;  1GCB A;  3J27 B;  2C9C A;  2VQF M;  1S3S G;  2DNF A;  4DUY M;  2WQY B;  4HPL B;  1Y56 A;  1HXY D;  2JY6 A;  1IPG A;  2L8J A;  3AEB B;  4IDI A;  3ZDM C;  1T3T A;  1E90 A;  2ATO A;  2KZS A;  5AZG A;  4LNI A;  4FD2 A;  4MSQ B;  1EM7 A;  3A1Q B;  3VDZ A;  4A5U A;  4JIO U;  2H5X A;  2W3S A;  1DGH B;  1B9R A;  2W3R A;  4MJS A;  3U7Z A;  3A42 A;  1HZ6 A;  4R7G A;  3GLH E;  2EUC A;  4RM8 A;  2R4E A;  1ISN A;  3IMA A;  4IW0 A;  1E7V A;  1SE9 A;  4KO8 A;  2JUO A;  4JLC A;  5TSS A;  2J4X A;  2P0R A;  4DV0 M;  2MBE A;  3NZU A;  2WX1 A;  3BCN A;  3R2I A;  3GPY A;  4QAY A;  4NNJ B;  5AZF A;  2E02 A;  3A9J B;  2UXC M;  3Q3J A;  2X8X X;  1XO3 A;  2NR2 A;  4KOD A;  2ZCC A;  4ZRI A;  4DBG B;  4K0K M;  2LRW A;  3M99 A;  3AB5 A;  4A20 A;  1XC8 A;  4GKK M;  1N33 M;  3FUT A;  2YQZ A;  5FR6 A;  2EKE C;  4ZRQ A;  1J09 A;  1J5E M;  2R0I A;  4NY0 A;  1EE8 A;  1AIM A;  1K82 A;  8PCH A;  3M3J A;  4LDT D;  1EWC A;  2IO3 B;  4KZC A;  2R61 A;  1ZW7 A;  2OJW A;  2XU4 A;  2JY5 A;  2ZCB A;  3SFD B;  2KQS A;  3KS4 A;  1KJT A;  2DXI A;  2OPF A;  3U6L A;  1PRB A;  2RSU A;  1V49 A;  2YR0 A;  4BB9 A;  1YK8 A;  1XMO M;  1FIQ A;  2DAJ A;  2PW9 A;  1IXZ A;  1J0G A;  4RCO A;  1WGR A;  5C18 A;  1MHH E;  1GLN A;  2N1V A;  4MEM A;  3V6E A;  2FID A;  1IBX A;  2BU3 A;  3NS1 A;  3LCV B;  3KYC D;  2JYE A;  3EUB 2;  1CUK A;  2KXJ A;  2X38 A;  4HPP A;  3QK0 A;  2CE7 A;  1E9S A;  4HLQ A;  3C19 A;  2JF5 A;  4YT0 B;  3HU1 A;  4IC7 B;  4REZ A;  5G2N A;  1ZXH A;  1TGU A;  1R5L A;  2CP8 A;  1PJI A;  1KFY B;  4RFB A;  5KQ8 A;  1SEB D;  1YX6 B;  3SBJ A;  3VTU A;  1JWS D;  3FTD A;  3GLG B;  4Y28 F;  3WIM A;  1EU4 A;  1YQ4 B;  3IT6 B;  5E26 A;  2BS3 B;  4JI4 M;  5ITX A;  4A9A A;  3PV1 A;  3PFI A;  2Z8L A;  1HT1 E;  2L4E A;  4MAC A;  2WXN A;  3SAT A;  2Y21 A;  2ZZP B;  1NJF A;  1IUE A;  3WAM A;  4LJ9 A;  1SE2 A;  1G3I A;  5KPR A;  1AU3 A;  3BYY B;  2DC7 A;  4YYV A;  2E01 A;  3KKU A;  2DCB A;  3W1Y A;  4AKI A;  1HQR D;  4ANR A;  2DLB A;  3TWL A;  5KQD A;  3MTN B;  3BWU D;  3ZXR A;  3PDF A;  1L1Z A;  5L95 C;  4F8C B;  2J7Q A;  5JXV A;  3QJ3 A;  4PP1 A;  3L54 A;  1FXI A;  2IGD A;  4DHZ E;  1KF6 B;  4II7 A;  2KNB A;  4I81 A;  2IBI A;  2KRU A;  1CJE A;  1PJQ A;  2PEA A;  3PLV A;  1WI0 A;  4N59 A;  4W9C A;  3U7D A;  5E6O A;  3PRE A;  4B6W A;  4LG2 A;  3J80 S;  4FW9 A;  5C1Z A;  3P63 A;  5JI2 E;  1IBM M;  3AM9 A;  3EFU A;  3C3D A;  4FCT A;  1BY8 A;  3OVZ A;  1KHP A;  2Q5W D;  3B2G A;  2K47 A;  1C3T A;  4L16 A;  2WSE F;  3AI8 A;  4KX6 B;  1G6J A;  1ZXI A;  1H6U A;  1QQR A;  1RM6 C;  3O13 A;  2QBY B;  1D6E C;  4OZB A;  3NG0 A;  4NC6 A;  2M19 A;  4HJK A;  3P5V A;  4FK5 A;  2DYB A;  4MGI E;  3TSS A;  3SMS A;  4ANX A;  3MP9 A;  3SAW A;  3IXS A;  4G4R A;  3CMM B;  2FUD A;  4NSR A;  4JI6 M;  4FWG A;  3LCU A;  2ON8 A;  2ASQ A;  1ZE3 D;  1FXT B;  1I42 A;  1WRI A;  2DEN B;  1ZMW A;  3LMM A;  1WIV A;  4B3M M;  5DYI A;  2L0F A;  3KSX A;  3RGP A;  4O1N A;  2R9C A;  4GGQ A;  2OOB B;  4FLH A;  3NWL A;  1QQW A;  4IOI E;  4WQM A;  3RUI B;  2CUZ A;  2ZVN A;  3HJQ A;  4TQ1 A;  3ZTC A;  3TMP A;  2YJ2 A;  2VF8 A;  5HFY A;  2RGF A;  3MK6 A;  2V1C A;  4RF1 A;  3QJZ A;  2RRU A;  1H8C A;  4N8W A;  1XCT L;  3EHV A;  1GL6 A;  3CSF A;  2BWE A;  1OAI A;  1HA5 A;  1ZGU B;  3LDZ E;  3SDL C;  1POP A;  2CHV A;  1I4X A;  2HTM E;  4G50 A;  3VRB B;  3BPM A;  4TV3 A;  4JI0 M;  4DBG A;  1PJS A;  4LJA A;  4DMY A;  3I04 M;  1MI0 A;  2QIL A;  1JQ4 A;  1FEH A;  3NVW A;  2HJ8 A;  2LUE A;  2DZY A;  4D81 A;  3RUL A;  3EIE A;  3OIS A;  1VJV A;  3WHL A;  1DOI A;  1V2Y A;  1LQB A;  3MHV C;  4MM3 A;  3U60 B;  1RU3 A;  3KUD B;  1O0E A;  3P5W A; 
#chains in the Genus database with same CATH homology
 2DWM A;  5EE3 A;  1L2B A;  3T38 A;  2D7G A;  1W5T A;  1JR3 A;  1JW9 D;  4ZHP A;  1AN8 A;  5KPZ A;  1C78 A;  3ZGZ A;  3FTC A;  2O5R A;  3MP2 A;  1STE A;  3K1J A;  1R2Y A;  3SAV A;  4C80 A;  2FUG 1;  2M5Z A;  1YSY A;  3GLG A;  8CAT A;  3B21 A;  2L7H A;  1IBL M;  1N36 M;  4X66 M;  4S12 A;  2PMV A;  3LYY A;  1XXH B;  4LF7 M;  1BXT A;  2KRK A;  3SYL A;  5BPV A;  3HRD D;  4HRS A;  3AN1 A;  3RFZ B;  4AG6 A;  1YQ3 B;  1FFU A;  4DV7 M;  4RGT A;  2HCB A;  2NTS A;  2LXE A;  4OZC A;  4ARI A;  3KOY E;  3BB7 A;  4DXF A;  1PM5 A;  3AE2 B;  1E9M A;  1F2R I;  2MJD A;  3KVW A;  3AKZ A;  3DA1 A;  2H1R A;  1M4V A;  3KDS E;  4B0E A;  3MC0 B;  1QIL A;  3R8F A;  4NRV A;  2XFS A;  1W5S A;  1SXJ D;  2E3T A;  2GB1 A;  1DGB A;  1N5W A;  3TEW A;  3ZJU A;  2KW0 A;  1VZ7 A;  3MHZ A;  1WWT A;  1N60 A;  4YWG G;  3W30 A;  5ITQ A;  5KO3 A;  4D2K A;  2BTE A;  3VRA B;  1NNU C;  4P16 A;  4M0W A;  3BBA A;  4GHL A;  3I57 A;  3TRK A;  2NTT A;  4IJF A;  1N62 A;  2EKI A;  2KMM A;  5DNY A;  4OW0 A;  3E9S A;  2Y0T A;  3ZC7 B;  1C9F A;  4D8B A;  4RKX A;  4BOP A;  2OHF A;  4YTM B;  3UK6 A;  5JI3 E;  1JML A;  3KOX E;  2JXT A;  4WAF A;  5EXS A;  4LFA M;  2B76 B;  3J7A S;  1X37 A;  2WP9 B;  4DR3 M;  1ZAE A;  1GPX A;  3GP1 A;  3VLF B;  4LLG M;  4YSY B;  4A90 A;  5G5G A;  2H89 B;  3W0F A;  2V4I B;  1K53 A;  1JWA D;  3U2S C;  4WWM A;  3NZ3 A;  1MX0 A;  2EEL A;  2BYT A;  3AOE C;  3PXG A;  3VR9 B;  3W0L B;  1V1P B;  2M56 B;  1V1O A;  1JRP A;  3A98 B;  5ITX E;  3SHG B;  1MHX A;  4YTN B;  4US9 A;  4FXC A;  1RYJ A;  4ZTB A;  4KLN A;  1D5X C;  1QLB B;  2KA6 B;  1TKG A;  2UXB M;  5F3W A;  2XNA C;  4BBA A;  1L0X B;  2HKJ A;  4XE0 A;  3TEZ A;  3LQR A;  4OZA A;  3KS8 A;  3GPP A;  3FUU A;  4BOS A;  4IBK A;  2UZJ A;  5EP3 A;  1TY0 A;  3W9C B;  3VQI A;  1Z5A A;  2MJE A;  1SXJ B;  4GKJ M;  5AUI A;  4FCW A;  3SEB A;  2FOI C;  4ZYS A;  3J7B A;  3IG5 A;  2R4J A;  3GRU A;  1N75 A;  5I4D A;  4LJ7 A;  1KH0 A;  2BS4 B;  2YFQ A;  4FWH A;  3OQC A;  2GI9 A;  1MVK A;  3VDU A;  1VJK A;  5ITY A;  5H92 C;  1PJJ A;  3U6E A;  1CK1 A;  2EO2 A;  1TH2 A;  3KSJ A;  2XF3 A;  2F5S A;  1QT9 A;  4LF9 M;  2IJ0 A;  2K5P A;  4RGM A;  5EXT A;  2AQ1 B;  1TH4 A;  3I4V A;  1AW7 A;  2XH9 A;  3UI3 A;  3AED B;  1DGH A;  4NXN M;  2G1E A;  2WNM A;  3PHX A;  2CJN A;  1CZP A;  3C0R A;  3EIH A;  4NAW B;  2UUC M;  4AQ7 A;  2DVW B;  3PHU A;  1N32 M;  4JWS C;  3VKG A;  3BOS A;  4OVZ A;  1FRD A;  1XMQ M;  1OQR A;  4HJG E;  4A8X C;  1IY1 A;  4MGZ E;  1NNJ A;  4LF5 M;  2V1U A;  2HDE A;  4P6V F;  5GXG B;  3BYT B;  3Q8A A;  4WUR A;  2BBC A;  1JRO A;  1HQC A;  1HEZ E;  4JI5 M;  4B7F A;  3P4P B;  2D7H A;  2N9K A;  1E94 E;  1V8C A;  2YEP B;  2Y3A A;  4ITQ A;  5IZ7 D;  1XNQ M;  2RKO A;  1XLO A;  2VZK D;  3U6O A;  4B7G A;  3KLS X;  1N63 A;  1RFK A;  1SE4 A;  2LWX A;  4MB7 A;  1SXT A;  1EWY C;  2DZN B;  4MGY E;  2L83 A;  5FKA C;  4HKQ A;  1SXJ E;  3AFH A;  1ZOY B;  2QEN A;  2HHH M;  1ZP0 B;  1DO0 A;  1I4R A;  4QOZ C;  1P7F A;  3E4R A;  3BK1 A;  1YNT E;  3BVM A;  1FRR A;  4L2Y A;  2WXO A;  3KXE C;  2I38 A;  1Q10 A;  2WDR B;  2RGH A;  3KWV A;  4AS1 A;  2I2Y A;  2HWK A;  2WDQ B;  1SXJ A;  2ZW0 A;  2E6X A;  3ZCB B;  2V3N A;  4IUM A;  2J7Q C;  1NHW C;  1PGB A;  3U5Z B;  1VLB A;  1G41 A;  2JQR B;  3E56 A;  5EE1 A;  2XZU A;  3N9Y C;  3GRR A;  4UDU C;  1SE3 A;  2PTL A;  5C1B A;  3R2T A;  3NVV A;  2CFO A;  5FK9 C;  3GPU A;  1PYW D;  4GIT A;  3IT4 B;  1DO2 A;  4Z6Y A;  3WCQ A;  5H37 D;  1I4P A;  3NVZ A;  3SFE B;  2R18 A;  1BUI C;  1NVI D;  3AE6 B;  3AE7 B;  1FJG M;  2TSS A;  4JX1 C;  4LFB M;  4Z8X A;  1XLN A;  4OVZ B;  2FFJ A;  3PSE A;  2R45 A;  3PHW A;  4LY6 A;  2KDM A;  1YZB A;  4EE2 A;  3SAS A;  3GS2 A;  4ZPX A;  2C99 A;  2W82 A;  5EXX A;  2DWL A;  4BOQ A;  3AEA B;  4IKG A;  1V1P A;  1FXA A;  1WSP A;  5EP2 A;  1WYG A;  2C9O A;  2L1A A;  4RNA A;  1B1Z A;  4MH0 E;  3U60 A;  3HHZ A;  4NRW A;  1JWM D;  1FO4 A;  4IBG A;  4XBO A;  4RGN A;  3CF0 A;  1TKE A;  3O65 A;  2RDH A;  5IWA M;  3PZ7 A;  3L4P A;  5BMI A;  3I51 A;  2CV0 A;  2QSD A;  2V3P A;  4WIP A;  4IBC A;  2BTW B;  2LGI A;  4LTU A;  2KWD A;  2JRI A;  5FTL A;  4L23 A;  5C2T B;  1E6E B;  4GDL B;  1JAL A;  3GLH A;  4I8O A;  3Q8E A;  1C79 A;  3FC4 A;  1YN5 A;  3AEF B;  1ESF A;  1MU5 A;  1UGJ A;  2X8A A;  4I5S A;  1QAN A;  2WU2 B;  2XEP A;  4FVM A;  2LNH C;  3DFZ A;  3JR5 A;  2XN9 C;  2J53 A;  1IN7 A;  2Y5C A;  1NHG C;  4JPS A;  3P4Q B;  4IBE A;  5EJC A;  1OQQ A;  3U61 A;  2VZK B;  4IBD A;  2BB5 A;  3I9V 1;  2Z3X A;  4YY3 M;  4JYA M;  2Y0Q A;  1ZDV A;  4B3S M;  2VII A;  5FTK A;  1NSF A;  3U6P A;  4NXM M;  2ZAO A;  4DR2 M;  4NL4 H;  1Z59 A;  2FE8 A;  4TQ0 A;  3TEY A;  4GC9 A;  5D3I B;  3AE1 B;  1NY6 A;  1EU3 A;  1JWB D;  1F0Z A;  2UUA M;  5D7G A;  4M9X A;  1K50 A;  2QPA A;  1DGG A;  3HHY A;  3KFU G;  4USA A;  1F77 A;  3PVS A;  2DOS A;  2J52 A;  2XZF A;  2WXM A;  1IN6 A;  1D5Z C;  4LRS A;  2E5L M;  3PRP A;  4M9Z A;  5ITR A;  2AGA A;  3IAM 1;  2KEB A;  1T3Q A;  4D80 A;  4DV3 M;  1F2R C;  2V0G A;  1HNZ M;  1TH3 A;  4IIW A;  1JCK B;  3L26 A;  3P42 A;  1ET6 A;  4NAM A;  3URY A;  4A3V B;  3AEC B;  3P4S B;  2BB6 A;  2JX5 A;  4IBB A;  3MJ5 A;  3HJS A;  3FD9 A;  3GLF A;  1NEN B;  5LMU M;  1E9R A;  7CAT A;  1TS4 A;  2K9X A;  3AE9 B;  2Z4R A;  3AE8 B;  5C3J B;  1T5X D;  1TS2 A;  4NZL B;  2WU5 B;  4FCV A;  3LVV A;  4GMQ A;  1VRA B;  2MH7 A;  1G8P A;  1KFV A;  4A55 A;  1PUT A;  3GQ4 A;  3U4E G;  2P5T A;  2BJV A;  4G6Z A;  5H8Y E;  4H2A A;  2JU6 X;  1R6B X;  3AJI B;  3C58 A;  4JI7 M;  2CEA A;  4LRT A;  5E6J A;  1KLU D;  2N0S B;  5FR3 A;  1TYG B;  4HXD B;  5BMH A;  4DR6 M;  1YJJ A;  3FUW A;  2QZ4 A;  4PDI A;  1FCL A;  1ET9 A;  1QAO A;  1IM2 A;  2KQ4 X;  3FIL B;  2DYO A;  3T1H M;  2RGO A;  2XFT A;  4B08 A;  2M60 A;  2R46 A;  5EQT A;  3L27 A;  2C98 A;  3SHF A;  4AQY M;  4RGO S;  2J42 A;  1N61 A;  3RNV A;  3GQ3 A;  1WXQ A;  1KSF X;  3TWK A;  4D8I A;  3HVD A;  4GUA A;  4XZX A;  1PFD A;  3IFU A;  2BT6 A;  3TPZ A;  1G59 A;  3HGI A;  5IRE B;  3PZ8 A;  1IY0 A;  2M0A A;  2MEK A;  4JI3 M;  3TEX A;  2WXR A;  4NJC A;  4BLC A;  3AOG A;  3L29 A;  1I4G A;  1V97 A;  1TDZ A;  3DOA A;  2L32 A;  5ITT A;  3U6C A;  4MM3 B;  3U52 E;  5LMN M;  1WGK A;  1IBX B;  4G4N A;  1IQP A;  5FLX S;  3T3N A;  4AW4 A;  4KKI A;  3W1S A;  4IP3 A;  1SIJ A;  5DYG A;  1BML C;  3U6S A;  3SYK A;  2Z4S A;  2JSV X;  2JYT A;  3TL4 X;  2F5Q A;  1KLG D;  4W5W A;  3J9C A;  1E0Z A;  2JA2 A;  1IGC A;  1NI3 A;  3Q8C A;  1FM0 D;  2LHD A;  1L0Y B;  1C4A A;  1SXJ C;  3J81 S;  4YTP B;  4C7Z A;  2ONQ A;  2CV1 A;  3ZJV A;  1GKI A;  1DOY A;  4HL4 A;  3LVW A;  4DXG A;  2UU9 M;  2JTC A;  2LUM A;  4PCZ A;  1K3X A;  3BK2 A;  3SAU A;  3RFW A;  1A70 A;  4AKG A;  4MI7 A;  4C56 C;  4C7Y A;  1OFH A;  3HU3 A;  4US8 A;  2KXE A;  3Q8F A;  4PDG A;  3B9J A;  1AYF A;  5ITU A;  1L1T A;  3IAS 1;  1XLP A;  1NVM A;  3AE3 B;  3BII D;  3SR6 A;  1ACC A;  4D82 A;  2D7E A;  2F5O A;  1UWX A;  4LK0 M;  1OFI A;  3VKH A;  2HL7 A;  2ZM6 M;  1YMH E;  1SF0 A;  1SBB B;  2Y5P A;  1ZDX A;  1N78 A;  1G4A E;  3NUH B;  2D5G A;  4YSX B;  1HZ5 A;  1ZUD 2;  3EGR A;  1I94 M;  4DR5 M;  3WHK A;  2PKO A;  3TWM A;  1C1K A;  2DYM A;  5EE0 A;  1TZO A;  1HQY E;  2F4V M;  2N7J A;  3H4M A;  3KP0 E;  5EZS A;  2LJI A;  2IGG A;  3A45 A;  3VK7 A;  4TMA B;  3GRY A;  4BOU A;  4L78 A;  1XWI A;  2I7P A;  1LV7 A;  3FTF A;  2Z7J A;  1T6B X;  3LB8 C;  3THG A;  3Q8B A;  1ROE A;  1QOA A;  1QAQ A;  2DZO B;  5HI1 A;  4G4Q A;  3GLF B;  3P1M A;  4EIW A;  2FNA A;  3I4Y A;  3ZH9 B;  4DUZ M;  4LGY A;  3PNY A;  2QCU A;  2XLJ A;  4JI8 M;  3MFG A;  2BW2 A;  2VQE M;  5EE9 A;  5BMG A;  1R2Z A;  3LXF A;  2J7O A;  4JN6 A;  4JXJ A;  2BNK A;  3PO0 A;  2G9H D;  1SSN A;  4WW0 A;  2ZAM A;  4B0M A;  3AEG B;  2L6O A;  1I7H A;  4DV1 M;  4LJ6 A;  2W55 A;  1J7K A;  1L6V A;  4GC5 A;  2K3U A;  1XXH A;  5T8I A;  1Q3C A;  4LZZ A;  5EP4 A;  2SAK A;  1TDH A;  4M0D A;  5MPO A;  3C8Y A;  3PNV A;  4IJE A;  3T1Y M;  4OU7 A;  4DV6 M;  4TSS A;  3U6D A;  1OJL A;  3GO8 A;  4L4U A;  1J7B A;  4DV2 M;  3AMZ A;  4KKJ A;  4YHH M;  3UGJ A;  2K22 A;  4CHT B;  1YJI A;  3CTW B;  4PT5 A;  3ZNH A;  4GIP A;  2WXP A;  4CIS A;  4QOS A;  1KRH A;  1TY2 A;  1QF6 A;  4JI2 M;  2BTW A;  3D8B A;  3FTE A;  2WLB A;  2WXL A;  3IG8 A;  4CQN A;  2XSZ D;  3TQS A;  1IXR C;  1XHB A;  2WXJ A;  1HNW M;  2KAJ A;  3R9X B;  3K2L A;  1D5M C;  3Q8X A;  3K8Z A;  4DV4 M;  1VDV A;  2KN4 A;  2Y20 A;  1UWM A;  3VK8 A;  1ENF A;  1FNN A;  5BYS A;  1SB3 C;  3KW6 A;  4JI1 M;  3DZD A;  2JWU A;  4JWU C;  3J2P B;  3GLI B;  2AX5 A;  3CWI A;  2DBY A;  3TE6 A;  4DQO C;  3VDP A;  3U61 B;  1ZQ9 A;  4J3O D;  3UZU A;  2LFI A;  3UJN A;  1VDD A;  4MGH A;  2CHQ A;  3L25 A;  1FMA D;  3VFD A;  2DWQ A;  5EXP A;  1XCQ L;  3HU2 A;  4ARC A;  3PT2 A;  4LF8 M;  2WDV B;  3Q69 A;  1QYR A;  3PRM A;  2F5P A;  1UUP A;  1Z5B A;  1ZPS A;  4B7H A;  4OX9 M;  1Z5C A;  2ACZ B;  2QIE B;  2UUB M;  2H88 B;  1TKY A;  1E10 A;  1P7E A;  3D8L A;  3AV0 A;  3U6Q A;  2INN E;  2QJL A;  1XF5 L;  4L15 A;  1NYQ A;  4Q2J A;  3FAH A;  4N58 A;  1QOF A;  3GQ5 A;  1XXG A;  1YE9 A;  4TUW A;  2AQ2 B;  1GB1 A;  1TJE A;  2YEP F;  2KZU A;  1IY2 A;  1QKZ A;  1KYI A;  3W31 A;  3KWL A;  1N77 A;  1IBK M;  1SJE D;  3AEE B;  3BVG A;  4LZJ A;  4LCB A;  3SC3 A;  1XLQ A;  4R3D A;  4NSO B;  1E32 A;  4DR7 M;  1YUB A;  2WXG A;  1QZM A;  4DR1 M;  5JZE A;  1GL7 A;  2MJ3 A;  1C4C A;  1R7S A;  4HKZ E;  2GRI A;  1IXS B;  1K3W A;  2L52 A;  4IBI A;  3AE5 B;  1UNS A;  2EA0 A;  3ZJT A;  4LGM A;  3B2F A;  4XDD A;  2QBY A;  3HHX A;  4DR4 M;  1FCC C;  2N9L A;  4QNR A;  3W2D A;  1E7P B;  1MPE A;  2OQ4 A;  4XDC A;  4YSZ B;  3ILK A;  1Z6T A;  3V05 A;  4HRO A;  1DKI A;  4GDK B;  1IN8 A;  3GLI A;  1R7R A;  3W5U B;  3U5Z A;  3LQQ A;  2IGH A;  1L4D B;  2CU3 A;  4ZOH C;  4LJ5 A;  4X65 M;  1XNR M;  2RMM A;  1NY5 A;  4ZRP A;  3W5V B;  4L1B A;  4CGY B;  3FYD A;  2ERC A;  3UMM A;  3EA6 A;  2CJO A;  3K92 A;  1GOZ A;  4JE3 B;  2C5R A;  1PGX A;  2CHG A;  3TUO A;  1QAM A;  3MTV A;  2NQ8 C;  3FUV A;  2C96 A;  1IN4 A;  1D2N A;  1K51 A;  1J7C A;  3KQ4 A;  4MH8 A;  3BZD B;  1FNU A;  1JQJ C;  3SFZ A;  1L6U A;  4WH4 A;  4I4L A;  2RPV A;  4N6E B;  2AQ3 B;  1XEE A;  2SEB D;  5LNK 1;  2F5N A;  2LHE A;  2BS2 B;  1L2C A;  4A6Q A;  1QVR A;  3T3O A;  4B3R M;  3KOW E;  5EZQ A;  5KPT A;  3FKE A;  2CV2 A;  1N5X A;  1Q3B A;  4KGR A;  2Q2E B;  2IPK D;  3SMP A;  4RH6 A;  4LF6 M;  3NBI A;  4IBF A;  3AOE A;  2L7I A;  1TS5 A;  3RE8 A;  2J7N A;  4NOO B;  1Q39 A;  3QWL A;  4HEA 1;  4ITK A;  4XWW A;  4KHP M;  4LJ8 A;  2JZP A;  1FFV A;  1GB4 A;  5G5H A;  1PDX A;  2ZAN A;  3HWS A;  4KGS A;  2AHM A;  3AV8 A;  1DOX A;  3AH7 A;  1RWS A;  1YN3 A;  2WXF A;  2L09 A;  4BOZ A;  2DWZ B;  2QP9 X;  5GKN A;  4L8R C;  4PD2 A;  1FD6 A;  1CQV A;  1VR9 A;  1NEK B;  3DWM A;  4D8E A;  2A5Y B;  5IT9 S;  3R8B A;  4AG5 A;  3GLH B;  1IN5 A;  3H8H A;  5AUK A;  2I7N A;  3A46 A;  1LO5 D;  3OTO M;  1L2D A;  3HKP A;  2OED A;  2RDG A;  1IGD A;  1L0V B;  3HUI A;  3M7G A;  2PLP A;  1L4Z B;  4QHT A;  3SAR A;  2LMC A;  2X4A A;  1L5P A;  3KOZ E;  2XGN A;  2INP E;  1D4B A;  5BYQ A;  5EP1 A;  3CF6 E;  2LEK A;  1HT2 E;  4IBJ A;  2R65 A;  5FTM A;  3NVY A;  2UXD M;  2PVO D;  2QMT A;  1HR0 M;  2DWN A;  1NYR A;  1I4H A;  4ZHO A;  3FYC A;  4MGK E;  3FUX A;  4OHJ A;  4XWT A;  1PVJ A;  1AWD A;  2DHR A;  1OFF A;  4M9S A;  4JV5 M;  3T15 A;  3M6A A;  2NMQ A;  4X62 M;  3DWG C;  3ZYY X;  2IDY A;  2QEJ C;  3KP1 E;  1C77 A;  1QOB A;  4AI6 A;  1YN4 A;  2V6Z M;  4GLS C;  4B3T M;  4DV5 M;  1GAQ B;  2WXK A;  3HJ8 A;  1ORY B;  1C76 A;  3JAM S;  2X49 A;  2ZW1 A;  1JR3 D;  2WS3 B;  4X64 M;  2FBW B;  1DGJ A;  1KTK A;  3L2A A;  2G5G X;  1N34 M;  3V3X A;  3HVZ A;  1K52 A;  3GB1 A;  1JWU D;  2BJW A;  1QOG A;  3B9P A;  4GHA A;  3BY4 A;  4LFC M;  1PGA A;  2ICI A;  1GVN A;  2KAC A;  3RPF C;  3VR8 B;  4QNM A;  2WXQ A;  3GRV A;  5HG2 A;  3CIR B;  4LJ4 A;  4G4O A;  4GH9 A;  5BR8 M;  3ABV B;  3GPX A;  2WXI A;  1C4P A;  1VZ6 A;  3CF2 A;  3GP7 A;  2G8L A;  2XSZ A;  1VZ8 A;  3M0E A;  1L8Q A;  1S3S A;  4GRI A;  3U6M A;  3OWE B;  1UKF A;  1I4Q A;  3ZQ4 A;  5BYR A;  4RF0 A;  4KGT A;  1UM8 A;  3NRZ A;  3HHW A;  3AL0 C;  2R62 A;  2K0P A;  1FNV A;  3P4R B;  5FTN A;  5FTJ A;  2PVG C;  5HHD G;  4QHS A;  3ETR A;  1J7A A;  4YXD B;  1DYQ A;  4AZF A;  3AE4 B;  1FNW A;  4LF4 M;  1SJH D;  3QAU A;  1NJG A;  4MT5 A;  2LH0 A;  4XGI A;  5A2Q S;  4AKH A;  1TS3 A;  5D3D A;  3JR4 A;  2ZBK B;  3BVZ A;  4FWD A;  1HNX M;  3RGS A;  3L28 A;  5FSW A;  1DGF A;  2Z84 A;  2YNM D;  2PIA A;  3FIL A;  2WXH A;  1I4W A;  2W54 A;  3J27 B;  2C9C A;  2VQF M;  4DUY M;  2WQY B;  1Y56 A;  4IDI A;  1HXY D;  3AEB B;  1T3T A;  2KZS A;  4FD2 A;  1EM7 A;  4A5U A;  2W3S A;  1DGH B;  1B9R A;  2W3R A;  3U7Z A;  3A42 A;  1HZ6 A;  4R7G A;  2EUC A;  2R4E A;  4KO8 A;  5TSS A;  2J4X A;  4DV0 M;  3R2I A;  3GPY A;  2UXC M;  1XO3 A;  4KOD A;  4K0K M;  3AB5 A;  1XC8 A;  4GKK M;  1N33 M;  3FUT A;  2YQZ A;  4ZRQ A;  1J09 A;  1J5E M;  1EE8 A;  1K82 A;  1EWC A;  2R61 A;  3SFD B;  3KS4 A;  2DXI A;  2OPF A;  3U6L A;  2YR0 A;  4BB9 A;  1XMO M;  1FIQ A;  2PW9 A;  1IXZ A;  4RCO A;  5C18 A;  1MHH E;  1GLN A;  1IBX A;  2BU3 A;  3NS1 A;  2JYE A;  3EUB 2;  2X38 A;  2CE7 A;  1E9S A;  4HLQ A;  4YT0 B;  3HU1 A;  4REZ A;  1ZXH A;  1TGU A;  1PJI A;  1KFY B;  4RFB A;  5KQ8 A;  1SEB D;  3SBJ A;  1JWS D;  3FTD A;  3GLG B;  1EU4 A;  1YQ4 B;  3IT6 B;  5E26 A;  2BS3 B;  4JI4 M;  5ITX A;  4A9A A;  3PFI A;  2Z8L A;  1HT1 E;  4MAC A;  2WXN A;  3SAT A;  2Y21 A;  1NJF A;  1IUE A;  4LJ9 A;  1SE2 A;  1G3I A;  5KPR A;  3BYY B;  4AKI A;  1HQR D;  2DLB A;  3TWL A;  5KQD A;  3BWU D;  1L1Z A;  2J7Q A;  5JXV A;  1FXI A;  2IGD A;  1KF6 B;  4II7 A;  4I81 A;  2KRU A;  1CJE A;  4N59 A;  4LG2 A;  3J80 S;  4FW9 A;  3P63 A;  5JI2 E;  1IBM M;  3AM9 A;  4FCT A;  2Q5W D;  3B2G A;  2K47 A;  4L16 A;  4KX6 B;  1ZXI A;  1H6U A;  1QQR A;  1RM6 C;  3O13 A;  2QBY B;  1D6E C;  4OZB A;  2M19 A;  4MGI E;  3TSS A;  3SMS A;  3MP9 A;  3SAW A;  3IXS A;  4G4R A;  4NSR A;  4JI6 M;  4FWG A;  2ON8 A;  1ZE3 D;  1WRI A;  3LMM A;  4B3M M;  5DYI A;  3KSX A;  3RGP A;  4O1N A;  3NWL A;  1QQW A;  4IOI E;  4WQM A;  2CUZ A;  3HJQ A;  4TQ1 A;  3TMP A;  5HFY A;  3MK6 A;  2V1C A;  4RF1 A;  1XCT L;  1GL6 A;  1HA5 A;  2CHV A;  1I4X A;  2HTM E;  3VRB B;  4JI0 M;  4LJA A;  1MI0 A;  2QIL A;  1JQ4 A;  1FEH A;  3NVW A;  4D81 A;  3EIE A;  3WHL A;  1DOI A;  3MHV C;  3U60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...