4PT5A

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
molecule keywords Papain-like protease
total genus 82
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4pt5A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4pt5A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4pt5A03
4OVZB 3MP2A 3E9SA 3MJ5A 2FE8A 4M0WA 4OW0A 4R3DA 4RNAA 4RF0A 4WURA 5E6JA 5KO3A 4P16A 4PT5A 4OVZA 4MM3B 4RF1A 4REZA
chains in the Genus database with same CATH superfamily
4DMXA 3AEFB 3GLFE 3QAUA 1W5SA 3TWLA 2VF8A 1OKSA 2L4EA 4EKUA 1C78A 4GC5A 1IM2A 1PYWD 3L28A 3FTFA 1XHBA 4NQKE 1DO0A 2VHFA 4JWSC 1VSNA 3IECA 3QWZB 4LFBM 3ZKJC 3AE5B 4G50A 2UXDM 1AYVA 2QJLA 4WAFA 1YD8U 1WX8A 1C1YB 1V8CA 4BKSD 2KT7A 2L52A 4DDID 2J42A 3KSEA 2RSUA 3KW9A 3D6SA 2BYTA 1Z5SB 4XUIA 1XD3B 2WXRA 3H6NA 4WIPA 2HD5A 2D3GA 4YYRA 3VH3B 3H6SA 1F2RC 2BKRB 5AUKA 4FA6A 4NQLB 3NVZA 5C3JB 2DCBA 1OAOC 1H6UA 4FK5A 3I06A 5DPRA 4JI8M 2BT6A 4IWPA 2XBBC 4XBOA 3L08A 4RM8A 1V49A 1I35A 3HHZA 1FRDA 1VJKA 2BS2B 1PJTA 2HKJA 3DOAA 2J7NA 4A3VB 5F3WA 2KHWB 2FRQA 2DZIA 2KFKA 3MHSD 3N1XC 2ZAOA 2LASA 3UQAA 2BYFA 2KYWA 4TV3A 4JQWC 1N34M 2FUG1 3SFZA 4XWTA 2GQFA 1AYFA 1DGGA 1CSBB 2LVQA 1L1ZA 3M0EA 1U4AA 2O01F 3K1JA 4PYUA 3VRBB 4HVBA 4DV5M 3R8FA 4ZOHC 1WJNA 1KLVA 3I04M 2JP7A 4G54A 2GOWA 3LVVA 2KDMA 3RNEC 2KLCA 2BWES 2KHHA 3ZH9B 2K9XA 4MI7A 1NL6A 5D94A 2NQDB 3A45A 3L27A 3QJ3A 2EMTA 3V05A 3ZQ4A 1VZ8A 3IT6B 4HJGE 3EFCA 4A20A 2AVWA 3NRZA 4ANUA 1MG8A 4QHSA 4IP3A 2KDFB 2YR0A 5LXIB 1AU2A 3PRMA 2WU5B 2C7MB 2YLMA 1YK8A 4BSQA 1NJGA 1GPXA 3UGJA 4M01A 2CE7A 1QMYA 2AQ2B 1QZMA 4Z6YA 4B0EA 1M4VA 4F1IA 3GRRA 1E9RA 2DC8A 3NBIA 4HEA1 4W9IA 4XR7A 1YE9A 1C9FA 4N9F4 4XZ4A 4WWMA 3V3XA 2G6DA 4KDIC 1CJLA 1IGCA 3RNVA 1T0YA 4L16A 4AP4C 1G41A 2KRUA 2MJ3A 3IAS1 4MELA 1RRBA 3VK8A 1B1ZA 2AUZA 2IO0B 3JSVA 4YY3M 1GVNA 1V34A 1ISNA 1U5IA 3GCBA 1IPGA 2I2YA 3HWSA 4DV3M 1VRAB 2Y0QA 2L00B 4K0KM 4A8XC 3KOXE 3N20C 4WH4A 5BPVA 3KP1E 2PE6B 3A9JB 2YVCA 3Q8EA 2Z3XA 5EF4A 1HNZM 2D7GA 1FMAD 3P4RB 4OVUA 2Y21A 1VG5A 3GP1A 3B2GA 4M8MA 4AG5A 2CV1A 3GPYA 1P7EA 2RPQA 3ZUNA 4C4VA 1IGDA 4NJ6A 4XWWA 1V5OA 3NUHB 5D6JB 4BKTA 2VH1A 1A70A 2C60A 3KH0A 5DYIA 1MHXA 4ZTBA 2K9DA 3AMZA 4BZAA 3LQQA 3L25A 3APFA 3PHWB 1G71A 1XT9B 1HZ6A 1AU3A 1XXHB 3JYUA 1XMOM 2AX5A 4XK8F 3THGA 2DVWB 4GRIA 3UJNA 3O1GA 3R2TA 3RT3B 3LJ3A 2LUMA 4YYUA 2CFOA 1FO4A 3HD3A 1L0VB 4LGYA 3KOYE 1JW9D 2QBYB 1RFKA 4GMQA 1L4ZB 4JI1M 3EIEA 2IPKD 4X64M 1WJ4A 3ZIMA 3MC8A 4BOSC 4IDIA 3D8LA 5DNYA 2XU1A 3MTNA 4W9CA 4RFBA 2LXEA 2CJOA 2MJ5B 3T9LA 1PRBA 4MGIE 1N60A 1QT9A 3KLSX 3BOWA 3NHEA 2KDEB 2L09A 4JIOU 4OVVA 5C23A 1JR3D 3VDUA 1ZUD2 2BWBA 4NPNA 4MJSA 4GIVA 1BQIA 3NBXX 1L0YB 1AARA 1Y4HA 4A55A 2V4LA 1WYWB 1ET9A 4I04A 3F92A 4X65M 2W3RA 4YTNB 4W9KA 3X0WA 2LJIA 4XDCA 3UIOB 2A5UA 1D0MA 3CF0A 5CHTA 1PGBA 1JQJC 4M9SA 3VDPA 4KKIA 2DWZB 2AL6A 3I5JC 5LNK1 2KZSA 1LFDA 2WXFA 4B95A 2LRUA 3MP2A 3SD5A 1XKGA 2WZJA 1GL6A 1VEGA 4NY0A 2IBIA 4BOSA 5IT9S 2CRUA 3HHMA 3GZNB 2REXA 4DHJD 3AE3B 1U9WA 4ZUXU 2DWLA 3HU3A 2JWSA 1MIRA 2DX5B 4P6GA 1OJLA 4IBJA 3TEXA 3PHXA 2HXZA 2KANA 4NXMM 1ZXIA 5AZHA 4EUTA 2KRKA 1V1PB 1JWUD 2AEHA 3B1LX 3IG5A 3C9EA 2C98A 4AZFA 4N6EB 1DEUA 3OVXA 1JRPA 1IN4A 3W2DA 1D5XC 1FFUA 2YFQA 3HHIA 1EWLA 2KLGA 2KZRA 1DOYA 3O65A 2L0FA 1AU0A 4NNJB 1PPDA 3SAWA 4AJWA 2Z4RA 4B7GA 1QDQA 4C7YA 4EIWA 3BPMA 5EP3A 2PLPA 3PT2B 2WXGA 3R2IA 1YT7A 1OAIA 3GB1A 8PCHA 2WHIA 4QHTA 4I6PA 1XXHA 1V5TA 3RGPA 4XX5A 2G3QA 3VR8B 1TTNA 3KX1A 2Z8YM 4PP2E 4X6JA 3Q3JA 1RYJA 4FJVB 3LXFA 1NEKB 3ZVVA 1GABA 1F4IA 4C4VB 3BVGA 2R62A 3BXWA 2RR9A 3R66C 1L7YA 2R44A 3H7PB 4JXJA 3IG3A 1JWMD 3U60A 3MTNB 1HTOA 1UD7A 1WGRA 2N7EA 3KVWA 2FCNA 4IKGA 4KV2A 2XZUA 1IY2A 3EA6A 3KKUA 4PI3A 4O1NA 2IO1B 3H9DA 2FT2A 2F4VM 3A46A 3B89A 1NQCA 3Q3OC 2R9FA 4LCDE 1N61A 1SE3A 3SDLC 3JSVB 1IBMM 2R4JA 4IIWA 3RVVA 1PIPA 4B3SM 2AGAA 2EKKA 2W9NA 4MGZE 2DZMA 4GGQA 4ANWA 2LMCA 1NBFC 2OP3A 3AEDB 3RZFA 2MBBB 3IVFA 1AYUA 3HWNA 3EFUA 1WGHA 1I4QA 2VRRB 4NSRA 1EM7A 3A42A 5EXSA 4YTPB 2HH5A 1SSNA 4IM0A 3SEBA 3GPPA 2GHUA 1SB3C 2WS3B 5J94A 2KA6B 2E3TA 2I1KA 6PADA 1DGHB 2Z0DB 3PZDA 3H8CA 1A5TA 4QRXA 4HL4A 1K51A 5HHDG 2YQZA 4C00A 5DPSA 1ZV1A 3E1ZB 4KHPM 3TRKA 1XLQA 5DCNA 3ZNHA 2KNBA 1BMLC 2FOIC 3FUUA 4DR5M 1KF6B 1QDTA 3HVDA 3AU5A 4PCZA 4X62M 2B3TA 4I6NB 3H8BA 3AB5A 2E02A 1R4MI 5HG2A 1U9VA 4LNNA 4DV7M 1SE9A 3V62A 1SNKA 1U9QX 1JB0F 3FE3A 5A24A 1GJSA 2XEWA 5C18A 3A33B 1YSYA 1E9SA 2AL3A 2RDHA 5IN7A 5PADA 3IT4B 2C99A 1S4VA 2EJSA 2HL7A 4R3DA 1CQVA 2CHWA 4UN2B 4DQOC 4YYSA 4GHAA 1TKEA 2GRIA 2NVUI 3GE3C 1J19A 1QOAA 4S12A 5FK9C 2CEAA 3U6MA 4I05A 3GLIE 1OEYJ 3KS4A 1DYQA 1VJVA 4HLQA 2PREA 2BB5A 2KX3A 1ORYB 3AECB 4RGMA 2C9CA 1Q1OA 1YQ4B 2E5LM 3B0AA 1THEA 5CHVA 2OPFA 3KWBX 4HWIB 3UZUA 1WE6A 3JR4A 3GLFB 1SJHD 1WX7A 2G3QB 1GMYA 4HDOA 1FIQA 4QBBA 2FUHB 2MA9B 3QA8A 1WXAA 3AU4A 4LJ9A 5FTKA 1V1OA 1JCKB 4RF0A 1C4PA 2J7QC 3UINB 1TIFA 1HNWM 5EXPA 5JH3A 1N63A 2XNAC 2JQRB 4AKGA 2MH7A 3ERVA 3R3MA 3BINA 1WH3A 4UDUC 3LFYA 3TCAA 1TDZA 1YJJA 1JQPA 3GS2A 2OHFA 1ZAEA 2DYOA 4C56C 4PT5A 3AE7B 2ZNVC 4X57B 4JE3B 1MFWA 1R2ZA 1V33A 3FD9A 3PO0A 2RPVA 1WFYA 2JYTA 1ZW7A 3QSDA 2XH9A 2Y5BB 4M0WB 2K6DB 3A1QB 4LLGM 3IG8A 2BYVE 2DAKA 4W9LA 1PBHA 2M8SA 5KHQA 2L8JA 2I7PA 4XE0A 3APCA 1N75A 1XLPA 1FCCC 5EP2A 2LNHC 3FTDA 4AG6A 2AWTA 2LGXA 2J7QB 1A6RA 2QP9X 3HRDD 2DBYA 2K8HA 2M17A 3BY4B 2PW9A 1A5RA 4JI6M 3TWKA 2DCCA 4MB7A 3E56A 1WIVA 1DGFA 2CUZA 2ZTCA 1T6BX 2WXHA 3ILKA 3L10B 5I4DA 4ANXA 4OHJA 2KWDA 3W0LB 1T3TA 4R7GA 4DR1M 3ONSA 3CGWA 3PFIA 1SE2A 1PM5A 1SF0A 4JI0M 4EZKA 3VQIA 4LJ6A 2WU2B 3GPUA 2CIOA 4NZLB 4D8IA 1MVKA 1TR8A 1X1MA 3TNXA 2IGDA 3N4CA 3FUXA 4HKQA 1ZKHA 2B1NA 5IKCM 1WR6E 2F5QA 1CJEA 1WZ3A 3PVLA 1ATKA 4P7IA 1F2AA 3M7GA 4P16A 2DAJA 3L4PA 2H88B 4W9HA 1T5XD 3KXEC 2JZPA 4B9KA 4USAA 1FNWA 4FVMA 2DWNA 1HE8A 3RNGC 2R61A 1ITOA 4TKNA 4BQVA 1K3WA 3HX3A 4NRVA 4GN1A 2L32A 4DBGB 1SXJA 4FHKA 2V6ZM 2A5YB 3VUXA 3U8ZA 1YNTE 4RKUF 4GXBA 2KVRA 1EWMA 3EUB2 5EZSA 1QOFA 1HNXM 4WJQA 2KZUA 3VUYA 3WHKA 3DHGC 3RVWA 4CISA 2JX5A 4GITA 2GLSA 2GFOA 3C0RB 4F2LA 1YN4A 4US9A 3U52E 1MJDA 1G6JA 3O65B 1PFDA 4P1BC 1R5LA 1T0SC 3VHTC 4K7UA 1LO5D 2INCC 1TGUA 3ML8A 3AXCA 1TH3A 5LLIA 1WJ7A 1UF0A 1VEJA 4MDKE 3WAMA 3HM6X 2LVAA 5L8RF 4PK1A 3U5ZB 4DV4M 1KXRA 3RUIB 2WDQB 3U6CA 5FTJA 1HEZE 2L3ZA 5HFYA 3KOZE 3FKEA 1OFIA 3T3NA 3HZJA 5E26A 4JPSA 3LB8C 4AWJA 1NI2A 1ZP0B 1H8CA 3L26A 2MBEA 4ICUA 2DLBA 2M0AA 1HQYE 1OEYA 2VIIA 3VFKA 4A9AA 2AS8A 2HWKA 4OVZA 2Z59B 3W0FA 4BKGA 2MBOA 3PZ7A 2F7DA 2ZW0A 1J7AA 3J2PB 4LZJA 4E74A 1WRDB 4MZOA 2KW0A 2LZ6A 4BBNF 2WSFF 1WJUA 4K3BA 1J0GA 3VTWA 3U7DA 5BO4B 2KC2A 1Q02A 2G5GX 2JA2A 1AWDA 2PKOA 2DAMA 3DPDA 1PGXA 3KYDD 2Y6EA 3CSTA 1PJQA 3H8HA 2XF3A 3VAWA 1ZDVA 1C77A 4FJCA 3J81S 3QJZA 3BVMA 1HUCB 3SHFA 1JWBD 2QIEB 2G8LA 5TSSA 4D82A 2NQAA 2J7OA 2ACTA 2XU4A 2FS1A 3CF2A 1VR9A 3V76A 4M9ZA 3FC4A 1PUTA 3TL4X 3V61A 1IN6A 2K0PA 2MX2A 1GUAB 1Z6TA 1BGOA 2KTFA 2DZJA 1K53A 1V6EA 3DA1A 4KIKA 1GNUA 3GRUA 3P4PB 1VZ6A 1YALA 4TSSA 2MCNB 3VVWB 4LRTA 2Y5CA 1NDDA 3B9JA 3Q6BA 4KGTA 4BOUA 4FJYA 2JWZA 4D81A 3RULA 4GUAA 1TH4A 1PXVA 5CX3A 5A2QS 1SXJB 1JWSD 1K3BB 1IQPA 4OEMA 3MFGA 3Q3NC 4RF1A 2M5ZA 1BT0A 2JU6X 2E01A 5IP4D 3GLIB 2WXIA 3AEEB 3T1HM 2Y0TA 2PADA 5K16A 4CGYB 1CZPA 3MHVC 4FXCA 3WIMA 3B7NA 4LJOB 4W9DA 5FTLA 1YJ1A 1WHCA 1I4GA 4DXGA 2CU1A 2ZVOA 1YX6B 2LVPA 3JW0X 2K5PA 2KJHB 3MP9A 4URKA 3P63A 1VD2A 3HUIA 3OQCA 1IFYA 3DDCB 4MSMB 4WJNA 4YXDB 2KQ7A 3VDZA 2IGHA 3AI5A 5J18A 2ICIA 4LJ8A 3P4SB 4PYZA 3RNBC 4MH0E 2V1UA 2F5SA 4HKZE 1YN5A 1LTMA 4JV5M 3KS8A 1I4RA 3I4YA 1LXDA 4GIPA 2IO3B 2LRWA 4L23A 5FTMA 4L15A 4EE2A 2O6VB 3NOBA 4K3CA 4CDCB 1LGRA 1XC8A 3S2AA 2AU1A 4BAXA 4YSXB 1VDLA 4AQ7A 2R6NA 3PSEA 4DV2M 2KFJA 1K82A 1SEBD 2D10A 4IWOA 1ZQ9A 4CIZA 1LV7A 3MJWA 4S17A 4HDQA 1D4BA 2FCMA 1JROA 3AE6B 2NPTB 4LTUA 2JF5A 3ZW3A 3K24A 5EP4A 5LMNM 1XXGA 4N8WA 5FPWA 1PPPA 2CKHB 2PVGC 1N32M 2L83A 3I4VA 2IGGA 3IBEA 1YVBA 4ANRA 1CMXB 4W9JA 2D5GA 1CK1A 4KDLB 2ZJDA 1KM7A 3ZDTA 1WI0A 2XU5A 3PNVA 5E6OA 3AEBB 4ZYNA 4J3OD 1E32A 3TMPB 4C7ZA 4RM9A 4R71A 2BB6A 3IOQA 2L7IA 3KVFB 2JSVX 4TUUA 3ZRCA 2NMQA 3DBRB 4EZJA 2M19A 2LHGA 1VDDA 3W1YA 2VZKD 2BJWA 5IO9A 2BGFA 4Q8GA 2D7HA 2G1EA 2CHZA 2WX0A 2PNSA 3HK0A 1PGYA 2R46A 4LY6A 2JRHA 3FRHA 3QCAA 1GLOA 2WXJA 1HT2E 3BZDB 3V60A 1YN3A 2HCBA 2Y20A 1F77A 4RGTA 3ZXVA 5BYRA 2ATOA 1G3IA 4BOZB 3C8YA 3F75A 1C79A 2W82A 3KOWE 4WW0A 4DR7M 3LCUA 3PLUA 1D6EC 1OIPA 4LGMA 1XEEA 1WXMA 1Y8RC 2VQFM 1WYGA 2FNJB 2APLA 4CHKA 3U6LA 1KJTA 3A9JA 4PADA 1HA5A 4K81A 2YNMD 3N3KA 3UMMA 3H1UA 4YWGG 1EWCA 1XNQM 4PS3A 1MI0A 2JY8A 2FIDA 2OO9A 1PJJA 1U9XA 1Y8GA 1C4AA 4C80A 4LNFA 3SMSA 4AXMA 2XEPA 1EWYC 2K39A 4W5WA 4FN2A 3TIXA 3QT4A 3W31A 2KJRA 2PE9A 3KQ4A 1JWAD 1PDXA 4B6WA 1ZOYB 1H4RA 1STFE 4PP1A 3A4RA 4JL9A 1PCIA 3J80S 1N33M 3Q69A 1LM8B 3RCZA 4AKIA 3C3EA 2LHEA 2N1VA 3B74A 3N30A 5TR5A 2FE8A 4QAYA 1VDVA 1FCLA 1R2YA 3EC8A 3ZNHB 2ACZB 3KWZA 2ASQA 3U2SC 2MRPA 4W9FA 5FTNA 4FCTA 4ARCA 3SFEB 5EE1A 4BBAA 2E6XA 1EUVB 1X9YA 2XK5B 5G55A 1O0EA 4CDFB 2DAIA 5BYSA 3L54A 2K25A 2OOBA 3ZCBB 1V2YA 2KAJA 4HJKA 4RY2A 3P4QB 2X8AA 3PNRA 2SEBD 1MJGM 4IM3A 4QOSA 3K9PA 1TKYA 2AIMA 2M1MA 2WP9B 4PDGA 2R65A 3ALBA 3K2LA 2ZW1A 4MEMA 3ZO5B 1Q3BA 3NHEB 2C5LC 1SXJD 3DWMA 1HXYD 3CSFA 1HJPA 4IBKA 3GE8C 2IO2B 2BU3A 2KX0A 1EU4A 1NB3A 8CATA 1UM8A 1NI3A 4B08A 3GPXA 3SAVA 1K8RB 1SXTA 3BC3A 1DOIA 3DBRI 3AE1B 2O2VA 2HTHA 2KC1A 4LJ7A 3H7PA 4XGAB 3KUZA 2LVQD 2MR9A 4NRWA 1HZ5A 3GLFA 4MM3B 3LW5F 3D32A 5D3IB 2KDLA 1JALA 5CHWA 3RFZB 2LWXA 4NJCA 3KFQA 1WY8A 3GRYA 4DWFA 4MM3A 4S0RA 3VH4B 2N7JA 3PNYA 4NL4H 3AOGA 2EELA 3IV2A 3PLVA 3CBJA 4PDIA 2BTWB 1V81A 2LH0A 2LGSA 1D0KA 2WX1A 2N9PC 3UGBB 2JXNA 3IUTA 2LGIA 1L2NA 4MGYE 4GB9A 3OF9A 3RYTA 1XLOA 3GOEA 5KHOA 1UWXA 3HJSA 2C5RA 1WRIA 2WSEF 2DJFB 4JI3M 1PJIA 7CATA 1C1KA 3VKGA 1AUAA 2ZANA 3N3KB 4KZ0A 1P1AA 4AKHA 1D3ZA 1NHWC 1PQSA 4P17A 2INPE 3NS1A 4TMAB 3RFWA 3GLHE 3I63C 4L8RC 2ZTDA 1QILA 3PREA 4MGKE 1T3QA 1J09A 3UI3A 2GBNA 2Y5PA 3RGSA 4ZYSA 5JZEB 4G11A 1P3QQ 3BIID 2UWQA 2JNHA 3V6CA 3HM3A 1QQWA 3PHXB 4DMYA 1M94A 4NAWB 1Z5CA 1IN7A 1QAOA 1SE4A 4HPMB 1TLOA 3DQVA 5IREB 1L1TA 3SC3A 3JVZX 3LDZE 3DFZA 4HXDB 1TY0A 3ZTDA 9PAPA 2E03A 3VKHA 1TF0B 5ITTA 2I1JA 4II3B 2M56B 1ZXHA 2F5OA 1DO2A 1PJSA 5BR8M 1FNVA 3L0WB 3T3OA 3BYTB 4XDDA 4XGIA 2WLBA 4EZLA 1SIFA 3AM9A 2JTCA 3QWLA 3PW3A 3DHIC 3KW6A 3U61B 2GNOA 5CHFA 3HHXA 1E7UA 1WR1B 5FLXS 5KPZA 2N1WA 5C2TB 2O6VD 1QF6A 2PTLA 3RD2A 3SU8X 1EU3A 1QANA 4MACA 3ABVB 4ZRQA 4II7A 3AE8B 2K1FA 4FCWA 4NAMA 3AV8A 1I4HA 2HD5B 1EF5A 5JZEA 1WXQA 4DV0M 5D2MB 4LRSA 1I4PA 1UELA 3T6PA 3CF6E 2RRUA 1K50A 5JA7A 4CHTB 1ZCMA 4KT0F 5CHVC 4BS6A 3HJ8A 3GLGA 4FHJA 4KGSA 3BBAA 2N35A 2JVCA 3K9OB 2XK5A 1UKFA 2UXBM 3M62B 3AL0C 3BY4A 1E90A 4KX6B 4BLCA 1UFZA 3MTVA 3RNFC 2EO2A 3P2BA 3WCQA 2K8CA 4LNKA 3PS6A 3Q8AA 4CO7A 4G4RA 1L2BA 3X23A 3GLGE 1ZDXA 1KOTA 2P7UA 5DFLA 1AIPC 2XN9C 3P1MA 1DF0A 2K6BA 5FKAC 3AEGB 1P0RA 3UIPB 1OTRB 2RGFA 4REZA 1IP9A 2DI0A 3C3DA 4IJFA 3DCGA 4LF4M 5IAAC 3AE2B 3NG0A 3B79A 5EGWA 5G5GA 4GMVA 4OU7A 2OOAA 1GLNA 4ZRKA 2CP8A 4A3OA 3Q14C 4OELA 1TS5A 4IC7B 3M6AA 2L76A 2DWMA 5KO3A 4ZHPA 3B21A 3OAWA 2LEKA 5EE3A 2X49A 2R9OA 4J6IA 2DAGA 3T15A 1E8WA 3AI8A 1QKZA 3KSJA 4X66M 2KK8A 5BMHA 2D07B 4HCPB 2GMIC 3EGRA 1GG3A 3DOWA 3V6EA 4W4UA 1KFXL 3C9PA 4I07A 1KFVA 2JRIB 1OIZA 1D5ZC 2NBVB 4N58A 3MK6A 3U30A 1SXJC 2KWVB 3TBLD 3CMMB 5BYQA 4GH9A 5ITXA 1CUKA 3U6SA 3DBSA 1ESFA 2BW2A 4D8BA 2DNFA 4Z8XA 2IBIB 5JH5C 3EECA 1J7CA 1ME4A 1Q39A 2J0KA 1AIMA 4DV6M 2LD9A 2O6VA 2DXIA 3M63B 1RU3A 3ZXRA 4ICVA 1UWMA 4PD2A 5FSWA 1K52A 3QIJA 3B7ZA 3BCNA 1UBQA 4JGHB 3LCVB 3GLHA 2ZM6M 2QILA 4CQNA 1KLUD 1QDRA 1I42A 3K9MA 3P5WA 4CZWA 2JY7A 3K8ZA 2J52A 2ZEQA 2JXXA 4B3MM 3TEZA 1S3SA 5DPWA 1F52A 2RKOA 3ZC7B 2VQEM 4JI2M 2V3NA 1F0ZA 2WXKA 3H4MA 1GC7A 5EXTA 2WXPA 4H2AA 2WXMA 1KSFX 2RD0A 4K1RB 4JX1C 2DYBA 4ZRIA 2N4FA 5GMVA 2R4EA 3Q8BA 1FXAA 3AE9B 3L13A 4GDLA 1Q6KA 2H5XA 1MN3A 1Z5AA 2MSED 2WDTB 3PRPB 3AFHA 4W9GA 2BNKA 1MPEA 3R8BA 3J27B 2V9HA 4F8CB 4G4QA 5EE0A 1YQ3B 2J53A 2MQJA 2V0GA 1L6UA 4GKKM 1IBXB 1KYIA 1BXTA 4P6EA 4KODA 1WGNA 2KQ4X 4WQOB 3IFUA 3MMPA 2JZ3B 5C1BA 2J4XA 3WXGA 3VK7A 2L1AA 4HXDA 4LNOA 2L7HA 1TGZB 5EZQA 1IY0A 2N9LA 1ZGUB 4CYEA 1FNNA 3FILB 3A9KB 2LJ5A 4FBJB 2B3AA 5F02A 2QDFA 5CVOB 1E7PB 3K8UA 1FPYA 2YJCA 5LXHA 2N9KA 2FAZA 2ON8A 4ARIA 1V80A 1AYWA 2FBWB 5JHBA 3NZSA 1XF5L 3J7AS 2JYEA 4IBDA 2YEPB 3N32A 3DVNU 3NZ3A 1KLGD 2J7QA 2BPSA 3APDA 5G5HA 3U8EA 2QZ4A 3TMPA 2OEDA 4LF7M 2INNE 1UGJA 3ZQJA 2FUDA 4M02A 1D2NA 3URYA 5EDSA 4LJPB 3NWLA 4YL8A 4G6ZA 3PRZA 5GKNA 4MJSB 3N3GA 4KSKC 5HKHA 4IG7B 4YYWA 4DR4M 2WSCF 2BYEA 2L2DA 5KPRA 3BK2A 5AZFA 2P5TA 2ZPNA 4BVUC 1C76A 4FWGA 1G8PA 5KQDA 1EF1A 2AUXA 4M8NA 2DJGB 2QSFX 2QC8A 4K7WA 2MP2B 7PCKA 3DVGX 4OVZB 3ZNID 5EE9A 1SXJE 1JQ4A 3KWLA 3H89A 3FUVA 1OGWA 3O0UA 2HE7A 3RVXA 1F1HA 2AQ1B 2FQ9A 4HPLB 4Q2JA 1VZ7A 5ITRA 2DAFA 2R2QA 4FIPA 1VLBA 4DXFA 2DHRA 2F5PA 2DHZA 2KXEA 1E8ZA 4FW9A 4GDKB 4YV8A 3WA0A 4A90A 2MROB 1T6OA 4D2KA 2VH2A 2KTRA 1WZ0A 2AYNA 2WBFX 1NY6A 4KZCA 2KN5A 1CVZA 3L16A 2WXNA 3DBHB 2Q2EB 3QAQA 1SBBB 1WXSA 2C7HA 1EWPA 2UYZB 2C9WB 2FTDA 3CWIA 1XO3A 1N78A 3HY5A 2MHJA 2L6OA 5E6PA 4A3PA 2V1YA 4M0DA 1CTEA 2DENA 3N9YC 4BPVA 1SIJA 3U4EG 4M00A 4F1SA 3Q8GA 2I38A 4JYAM 3IFWB 3S3QA 3TJPA 4YSYB 3PDFA 3E4RA 5DYGA 2OJWA 4IUMB 2DENB 1WGGA 1EE8A 4MGHA 2DZKA 1HT1E 2KNZA 3AOEC 1WF9A 4LDTD 1S1QB 1WJ6A 4JWUC 1AN8A 1NV8A 1CQDA 4YYQA 3ZJVA 4I4LA 1TZOA 2WYQA 3GP7A 2G4DB 2JWUA 4HROA 2UUAM 1HQRD 1NYQA 1WSPA 3PV1A 3TSSA 4DR6M 4N79A 2DOSA 1N5XA 2XLJA 4GLSC 1IXSA 4KKJA 3GLHB 3UF8A 4ASWC 3L2AA 5HI1A 1AECA 1GJZA 3AV0A 1KH0A 4II2B 3QQ8B 2ZBKB 3GO8A 4BB9A 4E3CA 2XSZA 1X37A 2QEJC 2D3BA 4IOIE 2VDBB 3QYBA 2IY1B 2PIAA 1UGMA 3I01M 3QARA 4LK0M 1E6EB 2ZAMA 2HAKA 1J5EM 5CVMA 3IHPA 1L4DB 3NS8A 4WAAA 2O5RA 2V1CA 4GDLB 1ENFA 1XLNA 3WHLA 3A4SC 2TSSA 3FAHA 4P1CC 1TS4A 1F2BA 1PGAA 2BWFA 2C0YA 1IUEA 1FEHA 1YOVB 1R4NI 2FNAA 2LFIA 2PVOD 2RMMA 3RPFC 3AJIB 4OZBA 2R9MA 4W5CA 3S3RA 2KVZA 2OJRA 1FFVA 4DV1M 2XGNA 3FILA 4N4ZA 3OISA 2RGOA 2MEKA 2WXOA 1NJFA 1BVSA 1IN5A 3B7QA 4D80A 2ONQA 2EKIA 4XC2A 4LDTB 3OG5A 5LMUM 4GDKA 3SARA 1HTQA 4OX9M 4B3TM 2LVPC 3FKYA 1L6VA 1SP4B 3KWVA 1DGJA 3KUDB 1P9DU 2RDBC 1TL9A 3OTOM 1C4CA 2N7DA 1DV0A 3M99A 1Q0WB 3OLMD 1ZPSA 2JPHA 2VHSA 4QRVA 5DPTA 1IYFA 1ZMVA 2M60A 1FD6A 2M4NA 4IW0A 2LUEA 2AYOB 3A9KA 2LVOC 3SBJA 5BMIA 2JZZA 3VR9B 4ITQA 2KD0A 4PS7A 1NNUC 3E21A 1NPZA 3GRVA 1R4NB 1OQQA 1Q5WB 3D8BA 5ITQA 4RGOS 1QYRA 2RGHA 2DC6A 2UZJA 4JI7M 2KTRB 5AZGA 2GBJA 3PPAA 5IZ7D 1RM6C 1WM3A 2FYEA 1P98A 3GLGB 2KKCA 2UU7A 1QAMA 3HU2A 3LVWA 3IAM1 4WQMA 1E9MA 1NY5A 3M3JA 3QK0A 2NTSA 3HU1A 1WGKA 2CV0A 1CS8A 4ZPXA 1TS3A 1XXHE 3TUOA 2NBWB 1N5WA 2H1RA 1I7HA 3BWUD 2CHGA 3VLFB 3H4JA 4WJPA 5C1ZA 3ZJUA 1GJTA 3T1YM 2GBKA 5EXXA 1Z2MA 1HQCA 3AEAB 4OZAA 1TTEA 2XZFA 2K3UA 2MP2A 1GC6A 2PPHA 3OWEB 3ZUAA 2IZVB 3TEWA 3DF0A 4G0NB 3J9CA 4FJZA 4OZCA 4Q8HA 4IBEA 1NSFA 2QENA 3LQRA 5E6NA 2YJ2A 4LG2A 2Z8LA 1BY8A 3RNCC 2KMCA 2BS3B 3MORA 3Q3MC 4TQ1A 2GB1A 3V6EB 2IJ0A 3PXGA 1Z5BA 3UK6A 2CV2A 3CTWB 3SMPA 2KDIA 2ERCA 4FLHA 1XCTL 2DHYA 2QMTA 3I57A 1TZ1A 1QOBA 3WAPA 1C3TA 3ZJTA 3CH2X 4M0WA 3NVWA 4JI5M 2WQYB 2JT4B 4JLCA 4LJAA 3RN9C 2OQ4A 1SG9A 3GQ4A 1QVRA 4DHJB 2BDLA 1AU4A 1OQRA 4GHLA 1WX9A 4NXNM 3H7SA 2MWSB 5KQ8A 4JN6A 3NY5A 3WXEA 2O25A 2CR5A 1I4XA 2DCDA 1PE6A 2DWQA 1VQ1A 1KFYB 2Z4SA 3RE8A 1GB4A 1ZE3D 2W54A 2AHMA 2L0TA 3DVGY 1NLJA 3PT2A 3E46A 2UUBM 1JR3A 2BBCA 1ET6A 5AEKB 1Z59A 1OFHA 4RMAA 4X6IA 2WXQA 2MJDA 2HHHM 1STEA 4I5SA 3QX1A 2DZYA 2MBHA 3IHPC 3NJTA 4HCNB 1RWSA 2LVOA 2MH8A 3DBLB 4BKSA 3A1QA 2B1MA 2JUJA 2INDC 2D3AA 5GXGB 1T0RC 2Q5WD 4I8OA 1JR3E 1MEMA 1YIWA 2IPPB 1XB2B 2H7JA 3AULA 3TPZA 4Y28F 5T8IA 4QOZC 3U6EA 1QXPA 2L4FA 4G3OA 3OF8A 4LNIA 3HHAA 1PPNA 1ICFA 1QQRA 3ZLZA 5ITYA 5ITXE 3ZDMC 1P7FA 4B0MA 4WA6A 2VZKB 3W5VB 4ZDVA 2MGWA 2ZPYA 2NTTA 2OOBB 3CH3X 3SYLA 1IBKM 5JHAA 3CBKA 3U60B 3VTVA 1JMLA 1GOZA 1BP4A 2K47A 1NNJA 3DVNV 3VFDA 4YSZB 3U6OA 3VUWA 2KACA 3DZDA 2KMAA 4WURA 1NVMA 2G45B 4BOZA 4WWOA 2ZCCA 1UUPA 2K8BA 4G4NA 4AQYM 2XU3A 3ML9A 4FCVA 2BWEA 4BOQA 4B3RM 1TBEA 2HWJA 1V92A 1RLFA 1N6ZA 3DBLI 1F2CA 1GCBA 2PJHA 4LZZA 3ZNZB 1NV9A 2GI9A 4DBGA 2QCZA 1WGLA 2K6QA 4KIKB 2PBHA 1GL7A 2J5YA 3R9XB 3FUTA 2JQFR 4DHZE 3AH7A 1Y56A 2KNAA 2Z7JA 1V97A 2DZLA 1MHWA 1IN8A 3TWMA 1TT5B 1W5TA 3FTCA 2IDYA 4BFRA 2CB5A 5JI2E 1PADA 2R9NA 2LGDA 2XFTA 4I81A 4KLNA 1PVJA 4DK5A 5FR6A 1HR0M 4YHHM 2BJVA 3OJ3A 4BBNC 1MS6A 2F5NA 3ZNGC 3IXSA 1POPA 5EQTA 2UU9M 4LF6M 2BKFA 2DC7A 2PMVA 4G3XB 1T0QC 2J0MA 2V3SA 3HVZA 3PTFC 4AUQC 4E71A 3I3TA 4AS1A 2N9EB 5AUIA 1UZXB 4EEWA 2V3PA 3W1SC 3GQ3A 3C19A 3IMAA 3P5UA 2CS4A 3N1YC 4IM2A 2NQIA 4ZRPA 2I7NA 2JQGR 2UXCM 2DNAA 1LQBA 2B76B 3SATA 2D11A 1L8QA 1F9JA 1XNRM 5KPTA 1XMQM 5H92C 3MJ5A 3Q8XA 1ACCA 1YJIA 1PPOA 3BPFA 1YUBA 2E00A 4HK2A 2JY6B 2CJNA 2W55A 4LF5M 4RH6A 4ACFA 3UQBA 1RFAA 2WXLA 2ZZPB 4HPPA 3KDSE 3W9CB 3SFDB 1XQQA 3EHVA 1DKIA 4M9XA 3ZRFA 2R2OA 3VXWA 2G7YA 2LHDA 1YK7A 3AN1A 2NS5A 2KJ6A 2FRAA 2NQ8C 1TYGB 1QOLA 1R7RA 2H89B 4DDGD 2JRIA 2AQ3B 5H37D 2CHVA 2GBRA 3WXFA 3MHSA 1FM0D 1NENB 3H7DA 3OJ4B 4CJ6A 5IOIA 1WIAA 1B9RA 1TH2A 1DOXA 1L0XB 1K3XA 4FWDA 1M6DA 4MSXA 1EO6A 4GSWA 4HWYA 4K7SA 4HRSA 3BOSA 3C0RA 1VCBA 1EF7A 4A5UA 2D7EA 1I4WA 3GLIA 2F1GA 2WWZA 3A98B 1OTRA 1R4MB 1ZMUA 1G59A 2DAEA 1C7YA 1YX5B 2ZVNA 2QNJA 2DC9A 3USVA 4OW0A 2MLBA 1D0LA 4YVAA 3Q3FA 2VF7A 1EWOA 1Q3CA 4XZXA 4XYCA 2EA0A 3NVVA 3B2FA 4IBBA 3Q2AC 4IBGA 2KWCA 2LXAA 4L1BA 1WMHB 2Y5BA 1E5WA 2ARYA 4LF9M 2BDZA 1F29A 2V4IB 2BF8B 1KRHA 2CWBA 1TY2A 1R7SA 1UNSA 4BS5A 2R18A 1IXRC 1WWTA 4B7FA 4AJYB 4L2YA 3FUWA 2LWPA 2G4SA 1WGDA 2UUCM 1QOGA 3TE6A 1EIJA 1N62A 4GC9A 2JXTA 3BBZA 3BWKA 4D8EA 4DUYM 3KFUG 3C58A 3U6PA 3T8MA 1QZEA 2C96A 1V9JA 2A4ZA 3KSXA 4NOOB 2EUCA 4MH8A 2DKLA 3U7ZA 3AE4B 2KDBA 3M95A 3BB7A 2KFKB 3SYKA 4RCOA 2WDVB 1ROEA 3MC9A 4YTMB 2P0RA 5L95C 2LBCA 1IWDA 4PS8A 1GAQB 2DZZA 1QUSA 2NCNA 4Q7JA 1L2DA 2X8XX 5ITUA 2OZ2A 3GZNI 2D2QA 1D5MC 2OULA 4KO8A 3RZWC 2FCQA 2LTUA 3U6DA 3PSEB 3ZYYX 3U6QA 3U61A 3EIHA 1Q10A 4N59A 3P5XA 2X4AA 3DWGC 1L2CA 2KNVA 4FULA 3ECIA 1GKIA 3PGEA 3LYYA 3NZUA 4LFCM 2R9CA 2QHOB 1NB5A 3LXSA 4L78A 2X38A 1DGBA 3KUCB 4DXAB 3HGIA 5IWAM 3PHWA 1NYRA 2MBQA 3TEYA 1E8XA 4WJOA 2EMSA 2CHQA 2J0JA 1YZBA 2HHNA 3V6CB 2FFJA 4QNMA 1XCQL 3NVYA 1TKGA 4LJ5A 2O2VB 1MU5A 1G4AE 3DHHC 4GOCA 1IXZA 2Z84A 4IJEA 4DR2M 3RMKC 1TU6A 3QC8B 2EKFA 3SHQA 1J7BA 2QCUA 3B9PA 3ENEA 5JI3E 2M0XA 1J8CA 2DZNB 3GQ5A 1VEKA 2QBYA 1F2RI 3MC0B 1YQBA 4KSLC 1S3SG 3KYCD 2LI5A 3CIRB 1R6BX 2JZ1A 3ETRA 3I9V1 1UBIA 5L83A 5D7GA 1MDWA 1V1PA 4YT0B 1N36M 2BTWA 1JRUA 1N77A 3SR6A 1EFUB 3O13A 4QH6A 1IXSB 4W9EA 3R7RA 1NHGC 4ITKA 3RI7C 2BS4B 4HLEA 2L05A 2BTEA 2JUOA 1CV8A 4K7CA 4F7ZA 1XWIA 1KHQA 3HJQA 4FADA 3MHHA 2N0SB 4NSOB 2HJ1A 1OFFA 3HKPA 2KN4A 2KWUB 2RDGA 2W3SA 2G8EA 3FTEA 3QHTA 3OVZA 1E8YA 2NQGA 2FIFA 1I94M 3BVZA 4LF8M 2R6FA 2KXJA 4FD2A 3LMMA 2FO5A 1KHPA 3PRPA 4KVGB 2R0IA 4RGNA 4TQ0A 1WM2A 1YLAA 2LHCA 3SAUA 1E10A 1ZIVA 3PBHA 4QRGA 2HJ8A 3I3TB 1FH0A 3L17A 1QLBB 4I6LB 4DHZB 3W1SA 1P3QU 4MZSA 4L4UA 4LCBA 2NPTA 3T38A 2IYDB 1AW7A 4ZRJA 1GECE 4WWPA 5EJCA 1SGHA 2AYOA 1WR1A 4DUZM 2NBUA 3L29A 2QHOA 2YEPF 2WDRB 3BK1A 3PZ8A 4US8A 2GBMA 1R4GA 2JY6A 1CPJA 5MPOA 2K0BX 2DCAA 3W30A 3P42A 2ZCBA 3PRMB 4AI6A 2MJEA 2CU3A 4GKJM 4B7HA 4P6VF 5IA7A 4IBCA 4WP2A 2YJBA 3FYDA 2FH0A 4G4OA 3JR5A 2DYMA 4KLBA 2HTME 4TUWA 2QSDA 2Y3AA 3RNAC 3QYEA 4NAWA 2QQ8A 4GEWA 3W5UB 2R45A 3PHUA 1J7KA 2KEBA 4WWNA 1FRRA 2KOXA 3DBHI 1NO1A 1TDHA 1RAXA 1WGYA 3K92A 2JZ0A 3K9PB 5G2NA 1UH6A 4W5BA 3KP0E 4IWQA 3IEJA 2C9OA 1GO5A 3Q8FA 4X6HA 2L7RA 2YJ8A 2O6XA 4AOFA 2SAKA 2WGSA 1CB5A 3WANA 1TJEA 3VRAB 1MHHE 4DR3M 4AXLA 1T43A 2Z0EB 2BQQA 5J2RA 1MG4A 3E9SA 2C7NB 5E6JA 2KQSA 2JY5A 4A6QA 1L5PA 1QUTA 1BUIC 2LXCA 5FR3A 4FWHA 1ZMWA 4EFOA 5D3DA 4EOYA 4ZHOA 4HEOA 4IBFA 3U5ZA 3B08A 5J17A 4JI4M 4MT5A 2EKEC 2ZNVB 1KTKA 1WXVA 3JAMS 4NJ7A 3F5VA 4L6V6 2BVCA 3TQSA 4MSQB 2G8JA 3W67A 4ANVA 1IBXA 1YMHE 1DGHA 3J7BA 4IUMA 1FJGM 2XSZD 1Y08A 2P86A 3FRIA 2NR2A 3TL5A 3R7QA 3Q8CA 1SJED 2WNMA 2CHXA 2PEAA 2G9HD 1FNUA 4CDEB 1FXTB 3AKZA 4KGRA 3HHWA 4LFAM 2QPAA 1GB1A 2DZOB 3N1ZC 3W68A 1KFUL 4RKXA 1E0ZA 3AOEA 5EP1A 1WE7A 2D3CA 5CTRC 3MHZA 3HHYA 4RNAA 3FYCA 5CVNB 2N9XA 1WMHA 3P5VA 2KMMA 3WALA 3ZTCA 4BOPA 1TS2A 3HIZA 3KW5B 3BYYB 1ME3A 1E94E 1E7VA 4NC6A 1QAQA 2LGYA 5JXVA 1MX0A 1MEGA 1V86A 5H8YE 3SHGB 4IBIA 4YYVA 3K9OA 1NVID 5BMGA 4QNRA 2KO3A 1FXIA 3PVSA 4LJ4A 1IY1A 2XFSA 2HDEA 4CDDB 2LVNC 3WAOA 3I51A 4AW4A 2K22A 4GU2A 1OQYA 1IBLM 2MW5A 3SASA 2IY0B 3VTUA 3ZGZA 2YJ9A 2FCSA
chains in the Genus database with same CATH topology
3AEFB 3QAUA 1W5SA 3TWLA 1C78A 4GC5A 1IM2A 1PYWD 3L28A 3FTFA 1XHBA 1DO0A 4JWSC 4LFBM 3AE5B 2UXDM 2QJLA 4WAFA 1V8CA 2L52A 2J42A 2BYTA 2WXRA 4WIPA 1F2RC 5AUKA 3NVZA 5C3JB 1H6UA 4JI8M 2BT6A 4XBOA 3HHZA 1FRDA 1VJKA 2BS2B 2HKJA 3DOAA 2J7NA 4A3VB 5F3WA 2ZAOA 1N34M 2FUG1 3SFZA 4XWTA 1AYFA 1DGGA 1L1ZA 3M0EA 3K1JA 3VRBB 4DV5M 3R8FA 4ZOHC 3LVVA 2KDMA 3ZH9B 2K9XA 4MI7A 3A45A 3L27A 3V05A 3ZQ4A 1VZ8A 3IT6B 4HJGE 3NRZA 4QHSA 4IP3A 2YR0A 3PRMA 2WU5B 1NJGA 1GPXA 3UGJA 2CE7A 2AQ2B 1QZMA 4Z6YA 4B0EA 1M4VA 3GRRA 1E9RA 3NBIA 4HEA1 1YE9A 1C9FA 4WWMA 3V3XA 3RNVA 1IGCA 4L16A 1G41A 2KRUA 2MJ3A 3IAS1 3VK8A 1B1ZA 4YY3M 1GVNA 2I2YA 3HWSA 4DV3M 1VRAB 2Y0QA 4K0KM 4A8XC 3KOXE 4WH4A 5BPVA 3KP1E 3Q8EA 2Z3XA 1HNZM 2D7GA 1FMAD 3P4RB 2Y21A 3GP1A 3B2GA 4AG5A 2CV1A 3GPYA 1P7EA 1IGDA 4XWWA 3NUHB 1A70A 5DYIA 1MHXA 4ZTBA 3AMZA 3LQQA 3L25A 1HZ6A 1XXHB 1XMOM 2AX5A 3THGA 2DVWB 4GRIA 3UJNA 3R2TA 2LUMA 2CFOA 1FO4A 1L0VB 4LGYA 3KOYE 1JW9D 2QBYB 1RFKA 4GMQA 4JI1M 1L4ZB 3EIEA 2IPKD 4X64M 4IDIA 3D8LA 5DNYA 4RFBA 2LXEA 2CJOA 4MGIE 1N60A 1QT9A 3KLSX 2L09A 1JR3D 3VDUA 1ZUD2 1L0YB 4A55A 1ET9A 4X65M 2W3RA 4YTNB 2LJIA 4XDCA 3CF0A 1PGBA 1JQJC 4M9SA 3VDPA 4KKIA 2DWZB 5LNK1 2KZSA 2WXFA 3MP2A 1GL6A 4BOSA 5IT9S 3AE3B 2DWLA 3HU3A 1OJLA 4IBJA 3TEXA 3PHXA 4NXMM 1ZXIA 2KRKA 1V1PB 1JWUD 3IG5A 2C98A 4AZFA 4N6EB 1JRPA 1IN4A 3W2DA 1D5XC 1FFUA 2YFQA 3O65A 1DOYA 3SAWA 2Z4RA 4B7GA 4C7YA 4EIWA 5EP3A 2PLPA 2WXGA 3R2IA 3GB1A 4QHTA 1XXHA 3RGPA 3VR8B 1RYJA 3LXFA 1NEKB 3BVGA 2R62A 4JXJA 1JWMD 3U60A 3KVWA 4IKGA 2XZUA 1IY2A 3EA6A 4O1NA 2F4VM 3A46A 1N61A 1SE3A 1IBMM 2R4JA 4IIWA 4B3SM 2AGAA 4MGZE 2LMCA 3AEDB 1I4QA 4NSRA 1EM7A 3A42A 5EXSA 4YTPB 1SSNA 3SEBA 3GPPA 1SB3C 2WS3B 2KA6B 2E3TA 1DGHB 4HL4A 1K51A 5HHDG 2YQZA 4KHPM 3TRKA 1XLQA 3ZNHA 1BMLC 2FOIC 3FUUA 4DR5M 1KF6B 3HVDA 4PCZA 4X62M 3AB5A 5HG2A 4DV7M 5C18A 1YSYA 1E9SA 2RDHA 3IT4B 2C99A 2HL7A 4R3DA 1CQVA 4DQOC 4GHAA 1TKEA 2GRIA 1QOAA 4S12A 5FK9C 2CEAA 3U6MA 3KS4A 1DYQA 4HLQA 2BB5A 1ORYB 3AECB 4RGMA 2C9CA 1YQ4B 2E5LM 2OPFA 3UZUA 3JR4A 3GLFB 1SJHD 1FIQA 4LJ9A 5FTKA 1V1OA 1JCKB 4RF0A 1C4PA 2J7QC 1HNWM 5EXPA 1N63A 2XNAC 2JQRB 4AKGA 2MH7A 4UDUC 1TDZA 1YJJA 3GS2A 2OHFA 1ZAEA 2DYOA 4C56C 4PT5A 3AE7B 4JE3B 1R2ZA 3PO0A 3FD9A 2RPVA 2JYTA 2XH9A 4LLGM 3IG8A 2I7PA 4XE0A 1N75A 1XLPA 1FCCC 5EP2A 2LNHC 3FTDA 4AG6A 2QP9X 3HRDD 2DBYA 2PW9A 4JI6M 3TWKA 4MB7A 3E56A 1DGFA 2CUZA 1T6BX 2WXHA 3ILKA 5I4DA 4OHJA 2KWDA 3W0LB 1T3TA 4R7GA 4DR1M 3PFIA 1SE2A 1PM5A 1SF0A 4JI0M 3VQIA 4LJ6A 2WU2B 3GPUA 4NZLB 4D8IA 1MVKA 2IGDA 3FUXA 4HKQA 2F5QA 1CJEA 3M7GA 4P16A 3L4PA 2H88B 1T5XD 3KXEC 2JZPA 4USAA 1FNWA 4FVMA 2DWNA 2R61A 1K3WA 4NRVA 2L32A 1SXJA 2V6ZM 2A5YB 1YNTE 3EUB2 5EZSA 1QOFA 1HNXM 2KZUA 3WHKA 4CISA 2JX5A 4GITA 1YN4A 4US9A 3U52E 1PFDA 1LO5D 1TGUA 1TH3A 3U5ZB 4DV4M 2WDQB 3U6CA 5FTJA 1HEZE 5HFYA 3KOZE 3FKEA 1OFIA 3T3NA 5E26A 4JPSA 3LB8C 1ZP0B 3L26A 2DLBA 2M0AA 1HQYE 2VIIA 4A9AA 2HWKA 4OVZA 3W0FA 3PZ7A 2ZW0A 1J7AA 3J2PB 4LZJA 2KW0A 1AWDA 2G5GX 2JA2A 2PKOA 1PGXA 3H8HA 2XF3A 1ZDVA 1C77A 3J81S 3BVMA 3SHFA 1JWBD 2QIEB 2G8LA 5TSSA 4D82A 2J7OA 3CF2A 1VR9A 4M9ZA 3FC4A 1PUTA 3TL4X 1IN6A 2K0PA 1Z6TA 1K53A 3DA1A 3GRUA 3P4PB 1VZ6A 4TSSA 4LRTA 2Y5CA 3B9JA 4KGTA 4BOUA 4D81A 4GUAA 1TH4A 5A2QS 1SXJB 1JWSD 1IQPA 3MFGA 4RF1A 2M5ZA 2JU6X 3GLIB 2WXIA 3AEEB 3T1HM 2Y0TA 4CGYB 1CZPA 3MHVC 4FXCA 5FTLA 1I4GA 4DXGA 2K5PA 3MP9A 3P63A 3HUIA 4YXDB 2IGHA 2ICIA 4LJ8A 3P4SB 4MH0E 2V1UA 2F5SA 4HKZE 1YN5A 4JV5M 3KS8A 1I4RA 3I4YA 4GIPA 4L23A 5FTMA 4L15A 4EE2A 1XC8A 4YSXB 4AQ7A 3PSEA 4DV2M 1K82A 1SEBD 1ZQ9A 1LV7A 1D4BA 1JROA 3AE6B 5EP4A 5LMNM 1XXGA 2PVGC 1N32M 2L83A 3I4VA 2IGGA 2D5GA 1CK1A 3PNVA 3AEBB 4J3OD 1E32A 4C7ZA 2BB6A 2L7IA 2JSVX 2NMQA 2M19A 1VDDA 2VZKD 2BJWA 2D7HA 2G1EA 2R46A 4LY6A 2WXJA 1HT2E 3BZDB 1YN3A 2HCBA 2Y20A 1F77A 4RGTA 5BYRA 1G3IA 3C8YA 1C79A 2W82A 3KOWE 4WW0A 4DR7M 1D6EC 4LGMA 1XEEA 1WYGA 2VQFM 3U6LA 1HA5A 2YNMD 3UMMA 4YWGG 1EWCA 1XNQM 1MI0A 1PJJA 1C4AA 4C80A 3SMSA 2XEPA 1EWYC 4W5WA 3W31A 3KQ4A 1JWAD 1PDXA 1ZOYB 3J80S 1N33M 3Q69A 4AKIA 2LHEA 2FE8A 1VDVA 1FCLA 1R2YA 2ACZB 3U2SC 5FTNA 4FCTA 4ARCA 3SFEB 5EE1A 4BBAA 2E6XA 5BYSA 3ZCBB 2KAJA 3P4QB 2X8AA 2SEBD 4QOSA 1TKYA 2WP9B 4PDGA 2R65A 3K2LA 2ZW1A 1Q3BA 1SXJD 3DWMA 1HXYD 4IBKA 2BU3A 1EU4A 8CATA 1UM8A 1NI3A 4B08A 3GPXA 3SAVA 1SXTA 1DOIA 3AE1B 4LJ7A 4NRWA 1HZ5A 3GLFA 4MM3B 5D3IB 1JALA 3RFZB 2LWXA 4NJCA 3GRYA 2N7JA 3PNYA 4NL4H 3AOGA 2EELA 4PDIA 2BTWB 2LH0A 2LGIA 4MGYE 1XLOA 1UWXA 3HJSA 2C5RA 1WRIA 4JI3M 1PJIA 7CATA 1C1KA 3VKGA 2ZANA 4AKHA 1NHWC 2INPE 3NS1A 4TMAB 3RFWA 4L8RC 1QILA 4MGKE 1T3QA 1J09A 3UI3A 2Y5PA 3RGSA 4ZYSA 3BIID 1QQWA 4NAWB 1Z5CA 1IN7A 1QAOA 1SE4A 5IREB 1L1TA 3SC3A 4HXDB 3DFZA 1TY0A 3VKHA 5ITTA 2M56B 1ZXHA 2F5OA 1DO2A 5BR8M 1FNVA 3T3OA 3BYTB 4XDDA 4XGIA 2WLBA 3AM9A 2JTCA 3QWLA 3KW6A 3U61B 3HHXA 5FLXS 5KPZA 5C2TB 1QF6A 2PTLA 1EU3A 1QANA 4MACA 3ABVB 4ZRQA 4II7A 3AE8B 4FCWA 4NAMA 3AV8A 1I4HA 5JZEA 1WXQA 4DV0M 4LRSA 1I4PA 3CF6E 1K50A 4CHTB 3HJ8A 3GLGA 4KGSA 3BBAA 1UKFA 2UXBM 3AL0C 3BY4A 4KX6B 4BLCA 3MTVA 2EO2A 3WCQA 3Q8AA 4G4RA 1L2BA 1ZDXA 2XN9C 3P1MA 5FKAC 3AEGB 4REZA 4IJFA 4LF4M 3AE2B 5G5GA 4OU7A 1GLNA 1TS5A 3M6AA 2DWMA 5KO3A 4ZHPA 3B21A 2LEKA 5EE3A 2X49A 3T15A 1QKZA 3KSJA 4X66M 5BMHA 3EGRA 1KFVA 1D5ZC 4N58A 3MK6A 1SXJC 5BYQA 4GH9A 5ITXA 3U6SA 1ESFA 2BW2A 4D8BA 4Z8XA 1J7CA 1Q39A 4DV6M 2DXIA 1UWMA 4PD2A 5FSWA 1K52A 3GLHA 2ZM6M 2QILA 4CQNA 1KLUD 3K8ZA 2J52A 4B3MM 3TEZA 1S3SA 2RKOA 3ZC7B 2VQEM 4JI2M 2V3NA 1F0ZA 2WXKA 3H4MA 5EXTA 2WXPA 4H2AA 2WXMA 1KSFX 4JX1C 2R4EA 3Q8BA 1FXAA 3AE9B 1Z5AA 3AFHA 2BNKA 1MPEA 3R8BA 3J27B 4G4QA 5EE0A 1YQ3B 2J53A 2V0GA 1L6UA 4GKKM 1IBXB 1KYIA 1BXTA 4KODA 2KQ4X 3IFUA 5C1BA 2J4XA 3VK7A 2L1AA 2L7HA 5EZQA 1IY0A 2N9LA 1FNNA 3FILB 1E7PB 2N9KA 2ON8A 4ARIA 2FBWB 1XF5L 3J7AS 2JYEA 4IBDA 2YEPB 3NZ3A 1KLGD 2J7QA 5G5HA 2QZ4A 3TMPA 2OEDA 4LF7M 2INNE 1UGJA 1D2NA 3URYA 3NWLA 4G6ZA 5GKNA 4DR4M 5KPRA 3BK2A 2P5TA 1C76A 4FWGA 1G8PA 5KQDA 4OVZB 5EE9A 1SXJE 1JQ4A 3KWLA 3FUVA 2AQ1B 4Q2JA 1VZ7A 5ITRA 1VLBA 4DXFA 2DHRA 2F5PA 2KXEA 4FW9A 4GDKB 4A90A 4D2KA 1NY6A 2WXNA 2Q2EB 1SBBB 3CWIA 1XO3A 1N78A 2L6OA 4M0DA 3N9YC 1SIJA 3U4EG 2I38A 4JYAM 4YSYB 3E4RA 5DYGA 1EE8A 4MGHA 1HT1E 3AOEC 4JWUC 1AN8A 3ZJVA 4I4LA 1TZOA 3GP7A 2JWUA 4HROA 2UUAM 1HQRD 1NYQA 1WSPA 3TSSA 4DR6M 2DOSA 1N5XA 2XLJA 4GLSC 4KKJA 3GLHB 3L2AA 5HI1A 3AV0A 1KH0A 2ZBKB 3GO8A 4BB9A 2XSZA 1X37A 2QEJC 4IOIE 2PIAA 4LK0M 1E6EB 2ZAMA 1J5EM 1L4DB 2O5RA 2V1CA 4GDLB 1ENFA 1XLNA 3WHLA 2TSSA 3FAHA 1TS4A 1PGAA 1IUEA 1FEHA 2FNAA 2LFIA 2PVOD 2RMMA 3RPFC 3AJIB 4OZBA 1FFVA 4DV1M 2XGNA 3FILA 2RGOA 2MEKA 2WXOA 1NJFA 4D80A 1IN5A 2ONQA 2EKIA 5LMUM 3SARA 4OX9M 4B3TM 1L6VA 3KWVA 1DGJA 3OTOM 1C4CA 1ZPSA 2M60A 1FD6A 3SBJA 5BMIA 3VR9B 4ITQA 1NNUC 3GRVA 1OQQA 3D8BA 5ITQA 4RGOS 1QYRA 2RGHA 2UZJA 4JI7M 5IZ7D 1RM6C 3GLGB 4WQMA 1QAMA 3HU2A 3LVWA 3IAM1 1E9MA 1NY5A 2NTSA 3HU1A 1WGKA 2CV0A 4ZPXA 1TS3A 3TUOA 1N5WA 2H1RA 1I7HA 3BWUD 2CHGA 3VLFB 3ZJUA 3T1YM 5EXXA 3AEAB 1HQCA 4OZAA 2XZFA 2K3UA 3OWEB 3TEWA 3J9CA 4OZCA 4IBEA 1NSFA 2QENA 3LQRA 4LG2A 2Z8LA 2BS3B 4TQ1A 2GB1A 2IJ0A 3PXGA 1Z5BA 3UK6A 2CV2A 3CTWB 3SMPA 2ERCA 1XCTL 2QMTA 3I57A 1QOBA 3ZJTA 4M0WA 3NVWA 4JI5M 2WQYB 4LJAA 2OQ4A 3GQ4A 1QVRA 1OQRA 4GHLA 4NXNM 5KQ8A 4JN6A 1I4XA 2DWQA 2Z4SA 1KFYB 3RE8A 1GB4A 1ZE3D 2W54A 2AHMA 3PT2A 2UUBM 1JR3A 2BBCA 1ET6A 1Z59A 1OFHA 2WXQA 2MJDA 2HHHM 1STEA 4I5SA 1RWSA 5GXGB 2Q5WD 4I8OA 3TPZA 5T8IA 4QOZC 3U6EA 1QQRA 5ITYA 5ITXE 1P7FA 4B0MA 2VZKB 3W5VB 2NTTA 3SYLA 1IBKM 3U60B 1JMLA 1GOZA 2K47A 1NNJA 3VFDA 4YSZB 3U6OA 2KACA 3DZDA 4WURA 1NVMA 4BOZA 1UUPA 4G4NA 4AQYM 4FCVA 4BOQA 4B3RM 4LZZA 2GI9A 1GL7A 3R9XB 3FUTA 3AH7A 1Y56A 2Z7JA 1V97A 1IN8A 3TWMA 1W5TA 3FTCA 2IDYA 5JI2E 2XFTA 4I81A 4KLNA 1PVJA 1HR0M 4YHHM 2BJVA 2F5NA 3IXSA 5EQTA 2UU9M 4LF6M 2PMVA 3HVZA 4AS1A 5AUIA 2V3PA 3GQ3A 4ZRPA 2I7NA 2UXCM 2B76B 3SATA 1L8QA 1XNRM 5KPTA 1XMQM 5H92C 3MJ5A 3Q8XA 1ACCA 1YJIA 1YUBA 2CJNA 2W55A 4LF5M 4RH6A 2WXLA 3KDSE 3W9CB 3SFDB 1DKIA 4M9XA 2LHDA 3AN1A 2NQ8C 1TYGB 1R7RA 2H89B 2JRIA 2AQ3B 5H37D 2CHVA 1FM0D 1NENB 1B9RA 1DOXA 1TH2A 1L0XB 1K3XA 4FWDA 4HRSA 3BOSA 3C0RA 4A5UA 2D7EA 1I4WA 3GLIA 3A98B 3OQCA 1G59A 4OW0A 1Q3CA 4XZXA 2EA0A 3NVVA 3B2FA 4IBBA 4IBGA 4L1BA 4LF9M 2V4IB 1KRHA 1TY2A 1R7SA 1UNSA 2R18A 1IXRC 1WWTA 4B7FA 4L2YA 3FUWA 2UUCM 1QOGA 3TE6A 2JXTA 4GC9A 1N62A 4D8EA 4DUYM 3KFUG 3C58A 3U6PA 2C96A 3U7ZA 4MH8A 3KSXA 4NOOB 2EUCA 3AE4B 3BB7A 3SYKA 4RCOA 2WDVB 1ROEA 4YTMB 1GAQB 1L2DA 5ITUA 1D5MC 4KO8A 3U6DA 3ZYYX 3U6QA 3U61A 3EIHA 1Q10A 4N59A 2X4AA 3DWGC 1L2CA 1GKIA 3LYYA 4LFCM 4L78A 2X38A 1DGBA 3HGIA 5IWAM 3PHWA 1NYRA 3TEYA 2CHQA 1YZBA 2FFJA 4QNMA 1XCQL 3NVYA 1TKGA 4LJ5A 1MU5A 1G4AE 1IXZA 2Z84A 4IJEA 4DR2M 1J7BA 2QCUA 3B9PA 5JI3E 2DZNB 3GQ5A 2QBYA 1F2RI 3MC0B 3CIRB 1R6BX 3ETRA 3I9V1 5D7GA 1V1PA 4YT0B 1N36M 2BTWA 1N77A 3SR6A 3O13A 1IXSB 1NHGC 4ITKA 2BS4B 2BTEA 1XWIA 3HJQA 2N0SB 4NSOB 2RDGA 1OFFA 3HKPA 2KN4A 2W3SA 3FTEA 1I94M 3BVZA 4LF8M 4FD2A 3LMMA 3PRPA 4RGNA 4TQ0A 3SAUA 1E10A 1QLBB 3W1SA 4L4UA 4LCBA 3T38A 1AW7A 5EJCA 4DUZM 3L29A 3BK1A 2YEPF 2WDRB 3PZ8A 4US8A 5MPOA 3W30A 3P42A 4AI6A 2MJEA 2CU3A 4GKJM 4B7HA 4P6VF 4IBCA 3FYDA 4G4OA 3JR5A 2DYMA 2HTME 4TUWA 2QSDA 2Y3AA 3W5UB 2R45A 3PHUA 1J7KA 2KEBA 1FRRA 1TDHA 3K92A 3KP0E 2C9OA 3Q8FA 2SAKA 1TJEA 3VRAB 1MHHE 4DR3M 3E9SA 5E6JA 4A6QA 1L5PA 1BUIC 5FR3A 4FWHA 5D3DA 4ZHOA 4IBFA 3U5ZA 4JI4M 4MT5A 1KTKA 3JAMS 3TQSA 1IBXA 1YMHE 1DGHA 3J7BA 4IUMA 1FJGM 2XSZD 3Q8CA 1SJED 2WNMA 2G9HD 1FNUA 4KGRA 3AKZA 3HHWA 4LFAM 2QPAA 1GB1A 2DZOB 4RKXA 1E0ZA 3AOEA 5EP1A 3MHZA 3HHYA 4RNAA 3FYCA 2KMMA 4BOPA 1TS2A 3BYYB 1E94E 1QAQA 5JXVA 1MX0A 5H8YE 3SHGB 4IBIA 1NVID 5BMGA 4QNRA 1FXIA 3PVSA 4LJ4A 1IY1A 2XFSA 2HDEA 3I51A 4AW4A 2K22A 1IBLM 3SASA 3ZGZA 4LTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ B;  3MP2 A;  3E9S A;  3MJ5 A;  2FE8 A;  4M0W A;  4OW0 A;  4R3D A;  4RNA A;  4RF0 A;  4WUR A;  5E6J A;  5KO3 A;  4P16 A;  4PT5 A;  4OVZ A;  4MM3 B;  4RF1 A;  4REZ A; 
#chains in the Genus database with same CATH topology
 4DMX A;  3AEF B;  3GLF E;  3QAU A;  1W5S A;  3TWL A;  2VF8 A;  1OKS A;  2L4E A;  4EKU A;  1C78 A;  4GC5 A;  1IM2 A;  1PYW D;  3L28 A;  3FTF A;  1XHB A;  4NQK E;  1DO0 A;  2VHF A;  4JWS C;  1VSN A;  3IEC A;  3QWZ B;  4LFB M;  3ZKJ C;  3AE5 B;  4G50 A;  2UXD M;  1AYV A;  2QJL A;  4WAF A;  1YD8 U;  1WX8 A;  1C1Y B;  1V8C A;  4BKS D;  2KT7 A;  2L52 A;  4DDI D;  2J42 A;  3KSE A;  2RSU A;  3KW9 A;  3D6S A;  2BYT A;  1Z5S B;  4XUI A;  1XD3 B;  2WXR A;  3H6N A;  4WIP A;  2HD5 A;  2D3G A;  4YYR A;  3VH3 B;  3H6S A;  1F2R C;  2BKR B;  5AUK A;  4FA6 A;  4NQL B;  3NVZ A;  5C3J B;  2DCB A;  1OAO C;  1H6U A;  4FK5 A;  3I06 A;  5DPR A;  4JI8 M;  2BT6 A;  4IWP A;  2XBB C;  4XBO A;  3L08 A;  4RM8 A;  1V49 A;  1I35 A;  3HHZ A;  1FRD A;  1VJK A;  2BS2 B;  1PJT A;  2HKJ A;  3DOA A;  2J7N A;  4A3V B;  5F3W A;  2KHW B;  2FRQ A;  2DZI A;  2KFK A;  3MHS D;  3N1X C;  2ZAO A;  2LAS A;  3UQA A;  2BYF A;  2KYW A;  4TV3 A;  4JQW C;  1N34 M;  2FUG 1;  3SFZ A;  4XWT A;  2GQF A;  1AYF A;  1DGG A;  1CSB B;  2LVQ A;  1L1Z A;  3M0E A;  1U4A A;  2O01 F;  3K1J A;  4PYU A;  3VRB B;  4HVB A;  4DV5 M;  3R8F A;  4ZOH C;  1WJN A;  1KLV A;  3I04 M;  2JP7 A;  4G54 A;  2GOW A;  3LVV A;  2KDM A;  3RNE C;  2KLC A;  2BWE S;  2KHH A;  3ZH9 B;  2K9X A;  4MI7 A;  1NL6 A;  5D94 A;  2NQD B;  3A45 A;  3L27 A;  3QJ3 A;  2EMT A;  3V05 A;  3ZQ4 A;  1VZ8 A;  3IT6 B;  4HJG E;  3EFC A;  4A20 A;  2AVW A;  3NRZ A;  4ANU A;  1MG8 A;  4QHS A;  4IP3 A;  2KDF B;  2YR0 A;  5LXI B;  1AU2 A;  3PRM A;  2WU5 B;  2C7M B;  2YLM A;  1YK8 A;  4BSQ A;  1NJG A;  1GPX A;  3UGJ A;  4M01 A;  2CE7 A;  1QMY A;  2AQ2 B;  1QZM A;  4Z6Y A;  4B0E A;  1M4V A;  4F1I A;  3GRR A;  1E9R A;  2DC8 A;  3NBI A;  4HEA 1;  4W9I A;  4XR7 A;  1YE9 A;  1C9F A;  4N9F 4;  4XZ4 A;  4WWM A;  3V3X A;  2G6D A;  4KDI C;  1CJL A;  1IGC A;  3RNV A;  1T0Y A;  4L16 A;  4AP4 C;  1G41 A;  2KRU A;  2MJ3 A;  3IAS 1;  4MEL A;  1RRB A;  3VK8 A;  1B1Z A;  2AUZ A;  2IO0 B;  3JSV A;  4YY3 M;  1GVN A;  1V34 A;  1ISN A;  1U5I A;  3GCB A;  1IPG A;  2I2Y A;  3HWS A;  4DV3 M;  1VRA B;  2Y0Q A;  2L00 B;  4K0K M;  4A8X C;  3KOX E;  3N20 C;  4WH4 A;  5BPV A;  3KP1 E;  2PE6 B;  3A9J B;  2YVC A;  3Q8E A;  2Z3X A;  5EF4 A;  1HNZ M;  2D7G A;  1FMA D;  3P4R B;  4OVU A;  2Y21 A;  1VG5 A;  3GP1 A;  3B2G A;  4M8M A;  4AG5 A;  2CV1 A;  3GPY A;  1P7E A;  2RPQ A;  3ZUN A;  4C4V A;  1IGD A;  4NJ6 A;  4XWW A;  1V5O A;  3NUH B;  5D6J B;  4BKT A;  2VH1 A;  1A70 A;  2C60 A;  3KH0 A;  5DYI A;  1MHX A;  4ZTB A;  2K9D A;  3AMZ A;  4BZA A;  3LQQ A;  3L25 A;  3APF A;  3PHW B;  1G71 A;  1XT9 B;  1HZ6 A;  1AU3 A;  1XXH B;  3JYU A;  1XMO M;  2AX5 A;  4XK8 F;  3THG A;  2DVW B;  4GRI A;  3UJN A;  3O1G A;  3R2T A;  3RT3 B;  3LJ3 A;  2LUM A;  4YYU A;  2CFO A;  1FO4 A;  3HD3 A;  1L0V B;  4LGY A;  3KOY E;  1JW9 D;  2QBY B;  1RFK A;  4GMQ A;  1L4Z B;  4JI1 M;  3EIE A;  2IPK D;  4X64 M;  1WJ4 A;  3ZIM A;  3MC8 A;  4BOS C;  4IDI A;  3D8L A;  5DNY A;  2XU1 A;  3MTN A;  4W9C A;  4RFB A;  2LXE A;  2CJO A;  2MJ5 B;  3T9L A;  1PRB A;  4MGI E;  1N60 A;  1QT9 A;  3KLS X;  3BOW A;  3NHE A;  2KDE B;  2L09 A;  4JIO U;  4OVV A;  5C23 A;  1JR3 D;  3VDU A;  1ZUD 2;  2BWB A;  4NPN A;  4MJS A;  4GIV A;  1BQI A;  3NBX X;  1L0Y B;  1AAR A;  1Y4H A;  4A55 A;  2V4L A;  1WYW B;  1ET9 A;  4I04 A;  3F92 A;  4X65 M;  2W3R A;  4YTN B;  4W9K A;  3X0W A;  2LJI A;  4XDC A;  3UIO B;  2A5U A;  1D0M A;  3CF0 A;  5CHT A;  1PGB A;  1JQJ C;  4M9S A;  3VDP A;  4KKI A;  2DWZ B;  2AL6 A;  3I5J C;  5LNK 1;  2KZS A;  1LFD A;  2WXF A;  4B95 A;  2LRU A;  3MP2 A;  3SD5 A;  1XKG A;  2WZJ A;  1GL6 A;  1VEG A;  4NY0 A;  2IBI A;  4BOS A;  5IT9 S;  2CRU A;  3HHM A;  3GZN B;  2REX A;  4DHJ D;  3AE3 B;  1U9W A;  4ZUX U;  2DWL A;  3HU3 A;  2JWS A;  1MIR A;  2DX5 B;  4P6G A;  1OJL A;  4IBJ A;  3TEX A;  3PHX A;  2HXZ A;  2KAN A;  4NXM M;  1ZXI A;  5AZH A;  4EUT A;  2KRK A;  1V1P B;  1JWU D;  2AEH A;  3B1L X;  3IG5 A;  3C9E A;  2C98 A;  4AZF A;  4N6E B;  1DEU A;  3OVX A;  1JRP A;  1IN4 A;  3W2D A;  1D5X C;  1FFU A;  2YFQ A;  3HHI A;  1EWL A;  2KLG A;  2KZR A;  1DOY A;  3O65 A;  2L0F A;  1AU0 A;  4NNJ B;  1PPD A;  3SAW A;  4AJW A;  2Z4R A;  4B7G A;  1QDQ A;  4C7Y A;  4EIW A;  3BPM A;  5EP3 A;  2PLP A;  3PT2 B;  2WXG A;  3R2I A;  1YT7 A;  1OAI A;  3GB1 A;  8PCH A;  2WHI A;  4QHT A;  4I6P A;  1XXH A;  1V5T A;  3RGP A;  4XX5 A;  2G3Q A;  3VR8 B;  1TTN A;  3KX1 A;  2Z8Y M;  4PP2 E;  4X6J A;  3Q3J A;  1RYJ A;  4FJV B;  3LXF A;  1NEK B;  3ZVV A;  1GAB A;  1F4I A;  4C4V B;  3BVG A;  2R62 A;  3BXW A;  2RR9 A;  3R66 C;  1L7Y A;  2R44 A;  3H7P B;  4JXJ A;  3IG3 A;  1JWM D;  3U60 A;  3MTN B;  1HTO A;  1UD7 A;  1WGR A;  2N7E A;  3KVW A;  2FCN A;  4IKG A;  4KV2 A;  2XZU A;  1IY2 A;  3EA6 A;  3KKU A;  4PI3 A;  4O1N A;  2IO1 B;  3H9D A;  2FT2 A;  2F4V M;  3A46 A;  3B89 A;  1NQC A;  3Q3O C;  2R9F A;  4LCD E;  1N61 A;  1SE3 A;  3SDL C;  3JSV B;  1IBM M;  2R4J A;  4IIW A;  3RVV A;  1PIP A;  4B3S M;  2AGA A;  2EKK A;  2W9N A;  4MGZ E;  2DZM A;  4GGQ A;  4ANW A;  2LMC A;  1NBF C;  2OP3 A;  3AED B;  3RZF A;  2MBB B;  3IVF A;  1AYU A;  3HWN A;  3EFU A;  1WGH A;  1I4Q A;  2VRR B;  4NSR A;  1EM7 A;  3A42 A;  5EXS A;  4YTP B;  2HH5 A;  1SSN A;  4IM0 A;  3SEB A;  3GPP A;  2GHU A;  1SB3 C;  2WS3 B;  5J94 A;  2KA6 B;  2E3T A;  2I1K A;  6PAD A;  1DGH B;  2Z0D B;  3PZD A;  3H8C A;  1A5T A;  4QRX A;  4HL4 A;  1K51 A;  5HHD G;  2YQZ A;  4C00 A;  5DPS A;  1ZV1 A;  3E1Z B;  4KHP M;  3TRK A;  1XLQ A;  5DCN A;  3ZNH A;  2KNB A;  1BML C;  2FOI C;  3FUU A;  4DR5 M;  1KF6 B;  1QDT A;  3HVD A;  3AU5 A;  4PCZ A;  4X62 M;  2B3T A;  4I6N B;  3H8B A;  3AB5 A;  2E02 A;  1R4M I;  5HG2 A;  1U9V A;  4LNN A;  4DV7 M;  1SE9 A;  3V62 A;  1SNK A;  1U9Q X;  1JB0 F;  3FE3 A;  5A24 A;  1GJS A;  2XEW A;  5C18 A;  3A33 B;  1YSY A;  1E9S A;  2AL3 A;  2RDH A;  5IN7 A;  5PAD A;  3IT4 B;  2C99 A;  1S4V A;  2EJS A;  2HL7 A;  4R3D A;  1CQV A;  2CHW A;  4UN2 B;  4DQO C;  4YYS A;  4GHA A;  1TKE A;  2GRI A;  2NVU I;  3GE3 C;  1J19 A;  1QOA A;  4S12 A;  5FK9 C;  2CEA A;  3U6M A;  4I05 A;  3GLI E;  1OEY J;  3KS4 A;  1DYQ A;  1VJV A;  4HLQ A;  2PRE A;  2BB5 A;  2KX3 A;  1ORY B;  3AEC B;  4RGM A;  2C9C A;  1Q1O A;  1YQ4 B;  2E5L M;  3B0A A;  1THE A;  5CHV A;  2OPF A;  3KWB X;  4HWI B;  3UZU A;  1WE6 A;  3JR4 A;  3GLF B;  1SJH D;  1WX7 A;  2G3Q B;  1GMY A;  4HDO A;  1FIQ A;  4QBB A;  2FUH B;  2MA9 B;  3QA8 A;  1WXA A;  3AU4 A;  4LJ9 A;  5FTK A;  1V1O A;  1JCK B;  4RF0 A;  1C4P A;  2J7Q C;  3UIN B;  1TIF A;  1HNW M;  5EXP A;  5JH3 A;  1N63 A;  2XNA C;  2JQR B;  4AKG A;  2MH7 A;  3ERV A;  3R3M A;  3BIN A;  1WH3 A;  4UDU C;  3LFY A;  3TCA A;  1TDZ A;  1YJJ A;  1JQP A;  3GS2 A;  2OHF A;  1ZAE A;  2DYO A;  4C56 C;  4PT5 A;  3AE7 B;  2ZNV C;  4X57 B;  4JE3 B;  1MFW A;  1R2Z A;  1V33 A;  3FD9 A;  3PO0 A;  2RPV A;  1WFY A;  2JYT A;  1ZW7 A;  3QSD A;  2XH9 A;  2Y5B B;  4M0W B;  2K6D B;  3A1Q B;  4LLG M;  3IG8 A;  2BYV E;  2DAK A;  4W9L A;  1PBH A;  2M8S A;  5KHQ A;  2L8J A;  2I7P A;  4XE0 A;  3APC A;  1N75 A;  1XLP A;  1FCC C;  5EP2 A;  2LNH C;  3FTD A;  4AG6 A;  2AWT A;  2LGX A;  2J7Q B;  1A6R A;  2QP9 X;  3HRD D;  2DBY A;  2K8H A;  2M17 A;  3BY4 B;  2PW9 A;  1A5R A;  4JI6 M;  3TWK A;  2DCC A;  4MB7 A;  3E56 A;  1WIV A;  1DGF A;  2CUZ A;  2ZTC A;  1T6B X;  2WXH A;  3ILK A;  3L10 B;  5I4D A;  4ANX A;  4OHJ A;  2KWD A;  3W0L B;  1T3T A;  4R7G A;  4DR1 M;  3ONS A;  3CGW A;  3PFI A;  1SE2 A;  1PM5 A;  1SF0 A;  4JI0 M;  4EZK A;  3VQI A;  4LJ6 A;  2WU2 B;  3GPU A;  2CIO A;  4NZL B;  4D8I A;  1MVK A;  1TR8 A;  1X1M A;  3TNX A;  2IGD A;  3N4C A;  3FUX A;  4HKQ A;  1ZKH A;  2B1N A;  5IKC M;  1WR6 E;  2F5Q A;  1CJE A;  1WZ3 A;  3PVL A;  1ATK A;  4P7I A;  1F2A A;  3M7G A;  4P16 A;  2DAJ A;  3L4P A;  2H88 B;  4W9H A;  1T5X D;  3KXE C;  2JZP A;  4B9K A;  4USA A;  1FNW A;  4FVM A;  2DWN A;  1HE8 A;  3RNG C;  2R61 A;  1ITO A;  4TKN A;  4BQV A;  1K3W A;  3HX3 A;  4NRV A;  4GN1 A;  2L32 A;  4DBG B;  1SXJ A;  4FHK A;  2V6Z M;  2A5Y B;  3VUX A;  3U8Z A;  1YNT E;  4RKU F;  4GXB A;  2KVR A;  1EWM A;  3EUB 2;  5EZS A;  1QOF A;  1HNX M;  4WJQ A;  2KZU A;  3VUY A;  3WHK A;  3DHG C;  3RVW A;  4CIS A;  2JX5 A;  4GIT A;  2GLS A;  2GFO A;  3C0R B;  4F2L A;  1YN4 A;  4US9 A;  3U52 E;  1MJD A;  1G6J A;  3O65 B;  1PFD A;  4P1B C;  1R5L A;  1T0S C;  3VHT C;  4K7U A;  1LO5 D;  2INC C;  1TGU A;  3ML8 A;  3AXC A;  1TH3 A;  5LLI A;  1WJ7 A;  1UF0 A;  1VEJ A;  4MDK E;  3WAM A;  3HM6 X;  2LVA A;  5L8R F;  4PK1 A;  3U5Z B;  4DV4 M;  1KXR A;  3RUI B;  2WDQ B;  3U6C A;  5FTJ A;  1HEZ E;  2L3Z A;  5HFY A;  3KOZ E;  3FKE A;  1OFI A;  3T3N A;  3HZJ A;  5E26 A;  4JPS A;  3LB8 C;  4AWJ A;  1NI2 A;  1ZP0 B;  1H8C A;  3L26 A;  2MBE A;  4ICU A;  2DLB A;  2M0A A;  1HQY E;  1OEY A;  2VII A;  3VFK A;  4A9A A;  2AS8 A;  2HWK A;  4OVZ A;  2Z59 B;  3W0F A;  4BKG A;  2MBO A;  3PZ7 A;  2F7D A;  2ZW0 A;  1J7A A;  3J2P B;  4LZJ A;  4E74 A;  1WRD B;  4MZO A;  2KW0 A;  2LZ6 A;  4BBN F;  2WSF F;  1WJU A;  4K3B A;  1J0G A;  3VTW A;  3U7D A;  5BO4 B;  2KC2 A;  1Q02 A;  2G5G X;  2JA2 A;  1AWD A;  2PKO A;  2DAM A;  3DPD A;  1PGX A;  3KYD D;  2Y6E A;  3CST A;  1PJQ A;  3H8H A;  2XF3 A;  3VAW A;  1ZDV A;  1C77 A;  4FJC A;  3J81 S;  3QJZ A;  3BVM A;  1HUC B;  3SHF A;  1JWB D;  2QIE B;  2G8L A;  5TSS A;  4D82 A;  2NQA A;  2J7O A;  2ACT A;  2XU4 A;  2FS1 A;  3CF2 A;  1VR9 A;  3V76 A;  4M9Z A;  3FC4 A;  1PUT A;  3TL4 X;  3V61 A;  1IN6 A;  2K0P A;  2MX2 A;  1GUA B;  1Z6T A;  1BGO A;  2KTF A;  2DZJ A;  1K53 A;  1V6E A;  3DA1 A;  4KIK A;  1GNU A;  3GRU A;  3P4P B;  1VZ6 A;  1YAL A;  4TSS A;  2MCN B;  3VVW B;  4LRT A;  2Y5C A;  1NDD A;  3B9J A;  3Q6B A;  4KGT A;  4BOU A;  4FJY A;  2JWZ A;  4D81 A;  3RUL A;  4GUA A;  1TH4 A;  1PXV A;  5CX3 A;  5A2Q S;  1SXJ B;  1JWS D;  1K3B B;  1IQP A;  4OEM A;  3MFG A;  3Q3N C;  4RF1 A;  2M5Z A;  1BT0 A;  2JU6 X;  2E01 A;  5IP4 D;  3GLI B;  2WXI A;  3AEE B;  3T1H M;  2Y0T A;  2PAD A;  5K16 A;  4CGY B;  1CZP A;  3MHV C;  4FXC A;  3WIM A;  3B7N A;  4LJO B;  4W9D A;  5FTL A;  1YJ1 A;  1WHC A;  1I4G A;  4DXG A;  2CU1 A;  2ZVO A;  1YX6 B;  2LVP A;  3JW0 X;  2K5P A;  2KJH B;  3MP9 A;  4URK A;  3P63 A;  1VD2 A;  3HUI A;  3OQC A;  1IFY A;  3DDC B;  4MSM B;  4WJN A;  4YXD B;  2KQ7 A;  3VDZ A;  2IGH A;  3AI5 A;  5J18 A;  2ICI A;  4LJ8 A;  3P4S B;  4PYZ A;  3RNB C;  4MH0 E;  2V1U A;  2F5S A;  4HKZ E;  1YN5 A;  1LTM A;  4JV5 M;  3KS8 A;  1I4R A;  3I4Y A;  1LXD A;  4GIP A;  2IO3 B;  2LRW A;  4L23 A;  5FTM A;  4L15 A;  4EE2 A;  2O6V B;  3NOB A;  4K3C A;  4CDC B;  1LGR A;  1XC8 A;  3S2A A;  2AU1 A;  4BAX A;  4YSX B;  1VDL A;  4AQ7 A;  2R6N A;  3PSE A;  4DV2 M;  2KFJ A;  1K82 A;  1SEB D;  2D10 A;  4IWO A;  1ZQ9 A;  4CIZ A;  1LV7 A;  3MJW A;  4S17 A;  4HDQ A;  1D4B A;  2FCM A;  1JRO A;  3AE6 B;  2NPT B;  4LTU A;  2JF5 A;  3ZW3 A;  3K24 A;  5EP4 A;  5LMN M;  1XXG A;  4N8W A;  5FPW A;  1PPP A;  2CKH B;  2PVG C;  1N32 M;  2L83 A;  3I4V A;  2IGG A;  3IBE A;  1YVB A;  4ANR A;  1CMX B;  4W9J A;  2D5G A;  1CK1 A;  4KDL B;  2ZJD A;  1KM7 A;  3ZDT A;  1WI0 A;  2XU5 A;  3PNV A;  5E6O A;  3AEB B;  4ZYN A;  4J3O D;  1E32 A;  3TMP B;  4C7Z A;  4RM9 A;  4R71 A;  2BB6 A;  3IOQ A;  2L7I A;  3KVF B;  2JSV X;  4TUU A;  3ZRC A;  2NMQ A;  3DBR B;  4EZJ A;  2M19 A;  2LHG A;  1VDD A;  3W1Y A;  2VZK D;  2BJW A;  5IO9 A;  2BGF A;  4Q8G A;  2D7H A;  2G1E A;  2CHZ A;  2WX0 A;  2PNS A;  3HK0 A;  1PGY A;  2R46 A;  4LY6 A;  2JRH A;  3FRH A;  3QCA A;  1GLO A;  2WXJ A;  1HT2 E;  3BZD B;  3V60 A;  1YN3 A;  2HCB A;  2Y20 A;  1F77 A;  4RGT A;  3ZXV A;  5BYR A;  2ATO A;  1G3I A;  4BOZ B;  3C8Y A;  3F75 A;  1C79 A;  2W82 A;  3KOW E;  4WW0 A;  4DR7 M;  3LCU A;  3PLU A;  1D6E C;  1OIP A;  4LGM A;  1XEE A;  1WXM A;  1Y8R C;  2VQF M;  1WYG A;  2FNJ B;  2APL A;  4CHK A;  3U6L A;  1KJT A;  3A9J A;  4PAD A;  1HA5 A;  4K81 A;  2YNM D;  3N3K A;  3UMM A;  3H1U A;  4YWG G;  1EWC A;  1XNQ M;  4PS3 A;  1MI0 A;  2JY8 A;  2FID A;  2OO9 A;  1PJJ A;  1U9X A;  1Y8G A;  1C4A A;  4C80 A;  4LNF A;  3SMS A;  4AXM A;  2XEP A;  1EWY C;  2K39 A;  4W5W A;  4FN2 A;  3TIX A;  3QT4 A;  3W31 A;  2KJR A;  2PE9 A;  3KQ4 A;  1JWA D;  1PDX A;  4B6W A;  1ZOY B;  1H4R A;  1STF E;  4PP1 A;  3A4R A;  4JL9 A;  1PCI A;  3J80 S;  1N33 M;  3Q69 A;  1LM8 B;  3RCZ A;  4AKI A;  3C3E A;  2LHE A;  2N1V A;  3B74 A;  3N30 A;  5TR5 A;  2FE8 A;  4QAY A;  1VDV A;  1FCL A;  1R2Y A;  3EC8 A;  3ZNH B;  2ACZ B;  3KWZ A;  2ASQ A;  3U2S C;  2MRP A;  4W9F A;  5FTN A;  4FCT A;  4ARC A;  3SFE B;  5EE1 A;  4BBA A;  2E6X A;  1EUV B;  1X9Y A;  2XK5 B;  5G55 A;  1O0E A;  4CDF B;  2DAI A;  5BYS A;  3L54 A;  2K25 A;  2OOB A;  3ZCB B;  1V2Y A;  2KAJ A;  4HJK A;  4RY2 A;  3P4Q B;  2X8A A;  3PNR A;  2SEB D;  1MJG M;  4IM3 A;  4QOS A;  3K9P A;  1TKY A;  2AIM A;  2M1M A;  2WP9 B;  4PDG A;  2R65 A;  3ALB A;  3K2L A;  2ZW1 A;  4MEM A;  3ZO5 B;  1Q3B A;  3NHE B;  2C5L C;  1SXJ D;  3DWM A;  1HXY D;  3CSF A;  1HJP A;  4IBK A;  3GE8 C;  2IO2 B;  2BU3 A;  2KX0 A;  1EU4 A;  1NB3 A;  8CAT A;  1UM8 A;  1NI3 A;  4B08 A;  3GPX A;  3SAV A;  1K8R B;  1SXT A;  3BC3 A;  1DOI A;  3DBR I;  3AE1 B;  2O2V A;  2HTH A;  2KC1 A;  4LJ7 A;  3H7P A;  4XGA B;  3KUZ A;  2LVQ D;  2MR9 A;  4NRW A;  1HZ5 A;  3GLF A;  4MM3 B;  3LW5 F;  3D32 A;  5D3I B;  2KDL A;  1JAL A;  5CHW A;  3RFZ B;  2LWX A;  4NJC A;  3KFQ A;  1WY8 A;  3GRY A;  4DWF A;  4MM3 A;  4S0R A;  3VH4 B;  2N7J A;  3PNY A;  4NL4 H;  3AOG A;  2EEL A;  3IV2 A;  3PLV A;  3CBJ A;  4PDI A;  2BTW B;  1V81 A;  2LH0 A;  2LGS A;  1D0K A;  2WX1 A;  2N9P C;  3UGB B;  2JXN A;  3IUT A;  2LGI A;  1L2N A;  4MGY E;  4GB9 A;  3OF9 A;  3RYT A;  1XLO A;  3GOE A;  5KHO A;  1UWX A;  3HJS A;  2C5R A;  1WRI A;  2WSE F;  2DJF B;  4JI3 M;  1PJI A;  7CAT A;  1C1K A;  3VKG A;  1AUA A;  2ZAN A;  3N3K B;  4KZ0 A;  1P1A A;  4AKH A;  1D3Z A;  1NHW C;  1PQS A;  4P17 A;  2INP E;  3NS1 A;  4TMA B;  3RFW A;  3GLH E;  3I63 C;  4L8R C;  2ZTD A;  1QIL A;  3PRE A;  4MGK E;  1T3Q A;  1J09 A;  3UI3 A;  2GBN A;  2Y5P A;  3RGS A;  4ZYS A;  5JZE B;  4G11 A;  1P3Q Q;  3BII D;  2UWQ A;  2JNH A;  3V6C A;  3HM3 A;  1QQW A;  3PHX B;  4DMY A;  1M94 A;  4NAW B;  1Z5C A;  1IN7 A;  1QAO A;  1SE4 A;  4HPM B;  1TLO A;  3DQV A;  5IRE B;  1L1T A;  3SC3 A;  3JVZ X;  3LDZ E;  3DFZ A;  4HXD B;  1TY0 A;  3ZTD A;  9PAP A;  2E03 A;  3VKH A;  1TF0 B;  5ITT A;  2I1J A;  4II3 B;  2M56 B;  1ZXH A;  2F5O A;  1DO2 A;  1PJS A;  5BR8 M;  1FNV A;  3L0W B;  3T3O A;  3BYT B;  4XDD A;  4XGI A;  2WLB A;  4EZL A;  1SIF A;  3AM9 A;  2JTC A;  3QWL A;  3PW3 A;  3DHI C;  3KW6 A;  3U61 B;  2GNO A;  5CHF A;  3HHX A;  1E7U A;  1WR1 B;  5FLX S;  5KPZ A;  2N1W A;  5C2T B;  2O6V D;  1QF6 A;  2PTL A;  3RD2 A;  3SU8 X;  1EU3 A;  1QAN A;  4MAC A;  3ABV B;  4ZRQ A;  4II7 A;  3AE8 B;  2K1F A;  4FCW A;  4NAM A;  3AV8 A;  1I4H A;  2HD5 B;  1EF5 A;  5JZE A;  1WXQ A;  4DV0 M;  5D2M B;  4LRS A;  1I4P A;  1UEL A;  3T6P A;  3CF6 E;  2RRU A;  1K50 A;  5JA7 A;  4CHT B;  1ZCM A;  4KT0 F;  5CHV C;  4BS6 A;  3HJ8 A;  3GLG A;  4FHJ A;  4KGS A;  3BBA A;  2N35 A;  2JVC A;  3K9O B;  2XK5 A;  1UKF A;  2UXB M;  3M62 B;  3AL0 C;  3BY4 A;  1E90 A;  4KX6 B;  4BLC A;  1UFZ A;  3MTV A;  3RNF C;  2EO2 A;  3P2B A;  3WCQ A;  2K8C A;  4LNK A;  3PS6 A;  3Q8A A;  4CO7 A;  4G4R A;  1L2B A;  3X23 A;  3GLG E;  1ZDX A;  1KOT A;  2P7U A;  5DFL A;  1AIP C;  2XN9 C;  3P1M A;  1DF0 A;  2K6B A;  5FKA C;  3AEG B;  1P0R A;  3UIP B;  1OTR B;  2RGF A;  4REZ A;  1IP9 A;  2DI0 A;  3C3D A;  4IJF A;  3DCG A;  4LF4 M;  5IAA C;  3AE2 B;  3NG0 A;  3B79 A;  5EGW A;  5G5G A;  4GMV A;  4OU7 A;  2OOA A;  1GLN A;  4ZRK A;  2CP8 A;  4A3O A;  3Q14 C;  4OEL A;  1TS5 A;  4IC7 B;  3M6A A;  2L76 A;  2DWM A;  5KO3 A;  4ZHP A;  3B21 A;  3OAW A;  2LEK A;  5EE3 A;  2X49 A;  2R9O A;  4J6I A;  2DAG A;  3T15 A;  1E8W A;  3AI8 A;  1QKZ A;  3KSJ A;  4X66 M;  2KK8 A;  5BMH A;  2D07 B;  4HCP B;  2GMI C;  3EGR A;  1GG3 A;  3DOW A;  3V6E A;  4W4U A;  1KFX L;  3C9P A;  4I07 A;  1KFV A;  2JRI B;  1OIZ A;  1D5Z C;  2NBV B;  4N58 A;  3MK6 A;  3U30 A;  1SXJ C;  2KWV B;  3TBL D;  3CMM B;  5BYQ A;  4GH9 A;  5ITX A;  1CUK A;  3U6S A;  3DBS A;  1ESF A;  2BW2 A;  4D8B A;  2DNF A;  4Z8X A;  2IBI B;  5JH5 C;  3EEC A;  1J7C A;  1ME4 A;  1Q39 A;  2J0K A;  1AIM A;  4DV6 M;  2LD9 A;  2O6V A;  2DXI A;  3M63 B;  1RU3 A;  3ZXR A;  4ICV A;  1UWM A;  4PD2 A;  5FSW A;  1K52 A;  3QIJ A;  3B7Z A;  3BCN A;  1UBQ A;  4JGH B;  3LCV B;  3GLH A;  2ZM6 M;  2QIL A;  4CQN A;  1KLU D;  1QDR A;  1I42 A;  3K9M A;  3P5W A;  4CZW A;  2JY7 A;  3K8Z A;  2J52 A;  2ZEQ A;  2JXX A;  4B3M M;  3TEZ A;  1S3S A;  5DPW A;  1F52 A;  2RKO A;  3ZC7 B;  2VQE M;  4JI2 M;  2V3N A;  1F0Z A;  2WXK A;  3H4M A;  1GC7 A;  5EXT A;  2WXP A;  4H2A A;  2WXM A;  1KSF X;  2RD0 A;  4K1R B;  4JX1 C;  2DYB A;  4ZRI A;  2N4F A;  5GMV A;  2R4E A;  3Q8B A;  1FXA A;  3AE9 B;  3L13 A;  4GDL A;  1Q6K A;  2H5X A;  1MN3 A;  1Z5A A;  2MSE D;  2WDT B;  3PRP B;  3AFH A;  4W9G A;  2BNK A;  1MPE A;  3R8B A;  3J27 B;  2V9H A;  4F8C B;  4G4Q A;  5EE0 A;  1YQ3 B;  2J53 A;  2MQJ A;  2V0G A;  1L6U A;  4GKK M;  1IBX B;  1KYI A;  1BXT A;  4P6E A;  4KOD A;  1WGN A;  2KQ4 X;  4WQO B;  3IFU A;  3MMP A;  2JZ3 B;  5C1B A;  2J4X A;  3WXG A;  3VK7 A;  2L1A A;  4HXD A;  4LNO A;  2L7H A;  1TGZ B;  5EZQ A;  1IY0 A;  2N9L A;  1ZGU B;  4CYE A;  1FNN A;  3FIL B;  3A9K B;  2LJ5 A;  4FBJ B;  2B3A A;  5F02 A;  2QDF A;  5CVO B;  1E7P B;  3K8U A;  1FPY A;  2YJC A;  5LXH A;  2N9K A;  2FAZ A;  2ON8 A;  4ARI A;  1V80 A;  1AYW A;  2FBW B;  5JHB A;  3NZS A;  1XF5 L;  3J7A S;  2JYE A;  4IBD A;  2YEP B;  3N32 A;  3DVN U;  3NZ3 A;  1KLG D;  2J7Q A;  2BPS A;  3APD A;  5G5H A;  3U8E A;  2QZ4 A;  3TMP A;  2OED A;  4LF7 M;  2INN E;  1UGJ A;  3ZQJ A;  2FUD A;  4M02 A;  1D2N A;  3URY A;  5EDS A;  4LJP B;  3NWL A;  4YL8 A;  4G6Z A;  3PRZ A;  5GKN A;  4MJS B;  3N3G A;  4KSK C;  5HKH A;  4IG7 B;  4YYW A;  4DR4 M;  2WSC F;  2BYE A;  2L2D A;  5KPR A;  3BK2 A;  5AZF A;  2P5T A;  2ZPN A;  4BVU C;  1C76 A;  4FWG A;  1G8P A;  5KQD A;  1EF1 A;  2AUX A;  4M8N A;  2DJG B;  2QSF X;  2QC8 A;  4K7W A;  2MP2 B;  7PCK A;  3DVG X;  4OVZ B;  3ZNI D;  5EE9 A;  1SXJ E;  1JQ4 A;  3KWL A;  3H89 A;  3FUV A;  1OGW A;  3O0U A;  2HE7 A;  3RVX A;  1F1H A;  2AQ1 B;  2FQ9 A;  4HPL B;  4Q2J A;  1VZ7 A;  5ITR A;  2DAF A;  2R2Q A;  4FIP A;  1VLB A;  4DXF A;  2DHR A;  2F5P A;  2DHZ A;  2KXE A;  1E8Z A;  4FW9 A;  4GDK B;  4YV8 A;  3WA0 A;  4A90 A;  2MRO B;  1T6O A;  4D2K A;  2VH2 A;  2KTR A;  1WZ0 A;  2AYN A;  2WBF X;  1NY6 A;  4KZC A;  2KN5 A;  1CVZ A;  3L16 A;  2WXN A;  3DBH B;  2Q2E B;  3QAQ A;  1SBB B;  1WXS A;  2C7H A;  1EWP A;  2UYZ B;  2C9W B;  2FTD A;  3CWI A;  1XO3 A;  1N78 A;  3HY5 A;  2MHJ A;  2L6O A;  5E6P A;  4A3P A;  2V1Y A;  4M0D A;  1CTE A;  2DEN A;  3N9Y C;  4BPV A;  1SIJ A;  3U4E G;  4M00 A;  4F1S A;  3Q8G A;  2I38 A;  4JYA M;  3IFW B;  3S3Q A;  3TJP A;  4YSY B;  3PDF A;  3E4R A;  5DYG A;  2OJW A;  4IUM B;  2DEN B;  1WGG A;  1EE8 A;  4MGH A;  2DZK A;  1HT1 E;  2KNZ A;  3AOE C;  1WF9 A;  4LDT D;  1S1Q B;  1WJ6 A;  4JWU C;  1AN8 A;  1NV8 A;  1CQD A;  4YYQ A;  3ZJV A;  4I4L A;  1TZO A;  2WYQ A;  3GP7 A;  2G4D B;  2JWU A;  4HRO A;  2UUA M;  1HQR D;  1NYQ A;  1WSP A;  3PV1 A;  3TSS A;  4DR6 M;  4N79 A;  2DOS A;  1N5X A;  2XLJ A;  4GLS C;  1IXS A;  4KKJ A;  3GLH B;  3UF8 A;  4ASW C;  3L2A A;  5HI1 A;  1AEC A;  1GJZ A;  3AV0 A;  1KH0 A;  4II2 B;  3QQ8 B;  2ZBK B;  3GO8 A;  4BB9 A;  4E3C A;  2XSZ A;  1X37 A;  2QEJ C;  2D3B A;  4IOI E;  2VDB B;  3QYB A;  2IY1 B;  2PIA A;  1UGM A;  3I01 M;  3QAR A;  4LK0 M;  1E6E B;  2ZAM A;  2HAK A;  1J5E M;  5CVM A;  3IHP A;  1L4D B;  3NS8 A;  4WAA A;  2O5R A;  2V1C A;  4GDL B;  1ENF A;  1XLN A;  3WHL A;  3A4S C;  2TSS A;  3FAH A;  4P1C C;  1TS4 A;  1F2B A;  1PGA A;  2BWF A;  2C0Y A;  1IUE A;  1FEH A;  1YOV B;  1R4N I;  2FNA A;  2LFI A;  2PVO D;  2RMM A;  3RPF C;  3AJI B;  4OZB A;  2R9M A;  4W5C A;  3S3R A;  2KVZ A;  2OJR A;  1FFV A;  4DV1 M;  2XGN A;  3FIL A;  4N4Z A;  3OIS A;  2RGO A;  2MEK A;  2WXO A;  1NJF A;  1BVS A;  1IN5 A;  3B7Q A;  4D80 A;  2ONQ A;  2EKI A;  4XC2 A;  4LDT B;  3OG5 A;  5LMU M;  4GDK A;  3SAR A;  1HTQ A;  4OX9 M;  4B3T M;  2LVP C;  3FKY A;  1L6V A;  1SP4 B;  3KWV A;  1DGJ A;  3KUD B;  1P9D U;  2RDB C;  1TL9 A;  3OTO M;  1C4C A;  2N7D A;  1DV0 A;  3M99 A;  1Q0W B;  3OLM D;  1ZPS A;  2JPH A;  2VHS A;  4QRV A;  5DPT A;  1IYF A;  1ZMV A;  2M60 A;  1FD6 A;  2M4N A;  4IW0 A;  2LUE A;  2AYO B;  3A9K A;  2LVO C;  3SBJ A;  5BMI A;  2JZZ A;  3VR9 B;  4ITQ A;  2KD0 A;  4PS7 A;  1NNU C;  3E21 A;  1NPZ A;  3GRV A;  1R4N B;  1OQQ A;  1Q5W B;  3D8B A;  5ITQ A;  4RGO S;  1QYR A;  2RGH A;  2DC6 A;  2UZJ A;  4JI7 M;  2KTR B;  5AZG A;  2GBJ A;  3PPA A;  5IZ7 D;  1RM6 C;  1WM3 A;  2FYE A;  1P98 A;  3GLG B;  2KKC A;  2UU7 A;  1QAM A;  3HU2 A;  3LVW A;  3IAM 1;  4WQM A;  1E9M A;  1NY5 A;  3M3J A;  3QK0 A;  2NTS A;  3HU1 A;  1WGK A;  2CV0 A;  1CS8 A;  4ZPX A;  1TS3 A;  1XXH E;  3TUO A;  2NBW B;  1N5W A;  2H1R A;  1I7H A;  3BWU D;  2CHG A;  3VLF B;  3H4J A;  4WJP A;  5C1Z A;  3ZJU A;  1GJT A;  3T1Y M;  2GBK A;  5EXX A;  1Z2M A;  1HQC A;  3AEA B;  4OZA A;  1TTE A;  2XZF A;  2K3U A;  2MP2 A;  1GC6 A;  2PPH A;  3OWE B;  3ZUA A;  2IZV B;  3TEW A;  3DF0 A;  4G0N B;  3J9C A;  4FJZ A;  4OZC A;  4Q8H A;  4IBE A;  1NSF A;  2QEN A;  3LQR A;  5E6N A;  2YJ2 A;  4LG2 A;  2Z8L A;  1BY8 A;  3RNC C;  2KMC A;  2BS3 B;  3MOR A;  3Q3M C;  4TQ1 A;  2GB1 A;  3V6E B;  2IJ0 A;  3PXG A;  1Z5B A;  3UK6 A;  2CV2 A;  3CTW B;  3SMP A;  2KDI A;  2ERC A;  4FLH A;  1XCT L;  2DHY A;  2QMT A;  3I57 A;  1TZ1 A;  1QOB A;  3WAP A;  1C3T A;  3ZJT A;  3CH2 X;  4M0W A;  3NVW A;  4JI5 M;  2WQY B;  2JT4 B;  4JLC A;  4LJA A;  3RN9 C;  2OQ4 A;  1SG9 A;  3GQ4 A;  1QVR A;  4DHJ B;  2BDL A;  1AU4 A;  1OQR A;  4GHL A;  1WX9 A;  4NXN M;  3H7S A;  2MWS B;  5KQ8 A;  4JN6 A;  3NY5 A;  3WXE A;  2O25 A;  2CR5 A;  1I4X A;  2DCD A;  1PE6 A;  2DWQ A;  1VQ1 A;  1KFY B;  2Z4S A;  3RE8 A;  1GB4 A;  1ZE3 D;  2W54 A;  2AHM A;  2L0T A;  3DVG Y;  1NLJ A;  3PT2 A;  3E46 A;  2UUB M;  1JR3 A;  2BBC A;  1ET6 A;  5AEK B;  1Z59 A;  1OFH A;  4RMA A;  4X6I A;  2WXQ A;  2MJD A;  2HHH M;  1STE A;  4I5S A;  3QX1 A;  2DZY A;  2MBH A;  3IHP C;  3NJT A;  4HCN B;  1RWS A;  2LVO A;  2MH8 A;  3DBL B;  4BKS A;  3A1Q A;  2B1M A;  2JUJ A;  2IND C;  2D3A A;  5GXG B;  1T0R C;  2Q5W D;  4I8O A;  1JR3 E;  1MEM A;  1YIW A;  2IPP B;  1XB2 B;  2H7J A;  3AUL A;  3TPZ A;  4Y28 F;  5T8I A;  4QOZ C;  3U6E A;  1QXP A;  2L4F A;  4G3O A;  3OF8 A;  4LNI A;  3HHA A;  1PPN A;  1ICF A;  1QQR A;  3ZLZ A;  5ITY A;  5ITX E;  3ZDM C;  1P7F A;  4B0M A;  4WA6 A;  2VZK B;  3W5V B;  4ZDV A;  2MGW A;  2ZPY A;  2NTT A;  2OOB B;  3CH3 X;  3SYL A;  1IBK M;  5JHA A;  3CBK A;  3U60 B;  3VTV A;  1JML A;  1GOZ A;  1BP4 A;  2K47 A;  1NNJ A;  3DVN V;  3VFD A;  4YSZ B;  3U6O A;  3VUW A;  2KAC A;  3DZD A;  2KMA A;  4WUR A;  1NVM A;  2G45 B;  4BOZ A;  4WWO A;  2ZCC A;  1UUP A;  2K8B A;  4G4N A;  4AQY M;  2XU3 A;  3ML9 A;  4FCV A;  2BWE A;  4BOQ A;  4B3R M;  1TBE A;  2HWJ A;  1V92 A;  1RLF A;  1N6Z A;  3DBL I;  1F2C A;  1GCB A;  2PJH A;  4LZZ A;  3ZNZ B;  1NV9 A;  2GI9 A;  4DBG A;  2QCZ A;  1WGL A;  2K6Q A;  4KIK B;  2PBH A;  1GL7 A;  2J5Y A;  3R9X B;  3FUT A;  2JQF R;  4DHZ E;  3AH7 A;  1Y56 A;  2KNA A;  2Z7J A;  1V97 A;  2DZL A;  1MHW A;  1IN8 A;  3TWM A;  1TT5 B;  1W5T A;  3FTC A;  2IDY A;  4BFR A;  2CB5 A;  5JI2 E;  1PAD A;  2R9N A;  2LGD A;  2XFT A;  4I81 A;  4KLN A;  1PVJ A;  4DK5 A;  5FR6 A;  1HR0 M;  4YHH M;  2BJV A;  3OJ3 A;  4BBN C;  1MS6 A;  2F5N A;  3ZNG C;  3IXS A;  1POP A;  5EQT A;  2UU9 M;  4LF6 M;  2BKF A;  2DC7 A;  2PMV A;  4G3X B;  1T0Q C;  2J0M A;  2V3S A;  3HVZ A;  3PTF C;  4AUQ C;  4E71 A;  3I3T A;  4AS1 A;  2N9E B;  5AUI A;  1UZX B;  4EEW A;  2V3P A;  3W1S C;  3GQ3 A;  3C19 A;  3IMA A;  3P5U A;  2CS4 A;  3N1Y C;  4IM2 A;  2NQI A;  4ZRP A;  2I7N A;  2JQG R;  2UXC M;  2DNA A;  1LQB A;  2B76 B;  3SAT A;  2D11 A;  1L8Q A;  1F9J A;  1XNR M;  5KPT A;  1XMQ M;  5H92 C;  3MJ5 A;  3Q8X A;  1ACC A;  1YJI A;  1PPO A;  3BPF A;  1YUB A;  2E00 A;  4HK2 A;  2JY6 B;  2CJN A;  2W55 A;  4LF5 M;  4RH6 A;  4ACF A;  3UQB A;  1RFA A;  2WXL A;  2ZZP B;  4HPP A;  3KDS E;  3W9C B;  3SFD B;  1XQQ A;  3EHV A;  1DKI A;  4M9X A;  3ZRF A;  2R2O A;  3VXW A;  2G7Y A;  2LHD A;  1YK7 A;  3AN1 A;  2NS5 A;  2KJ6 A;  2FRA A;  2NQ8 C;  1TYG B;  1QOL A;  1R7R A;  2H89 B;  4DDG D;  2JRI A;  2AQ3 B;  5H37 D;  2CHV A;  2GBR A;  3WXF A;  3MHS A;  1FM0 D;  1NEN B;  3H7D A;  3OJ4 B;  4CJ6 A;  5IOI A;  1WIA A;  1B9R A;  1TH2 A;  1DOX A;  1L0X B;  1K3X A;  4FWD A;  1M6D A;  4MSX A;  1EO6 A;  4GSW A;  4HWY A;  4K7S A;  4HRS A;  3BOS A;  3C0R A;  1VCB A;  1EF7 A;  4A5U A;  2D7E A;  1I4W A;  3GLI A;  2F1G A;  2WWZ A;  3A98 B;  1OTR A;  1R4M B;  1ZMU A;  1G59 A;  2DAE A;  1C7Y A;  1YX5 B;  2ZVN A;  2QNJ A;  2DC9 A;  3USV A;  4OW0 A;  2MLB A;  1D0L A;  4YVA A;  3Q3F A;  2VF7 A;  1EWO A;  1Q3C A;  4XZX A;  4XYC A;  2EA0 A;  3NVV A;  3B2F A;  4IBB A;  3Q2A C;  4IBG A;  2KWC A;  2LXA A;  4L1B A;  1WMH B;  2Y5B A;  1E5W A;  2ARY A;  4LF9 M;  2BDZ A;  1F29 A;  2V4I B;  2BF8 B;  1KRH A;  2CWB A;  1TY2 A;  1R7S A;  1UNS A;  4BS5 A;  2R18 A;  1IXR C;  1WWT A;  4B7F A;  4AJY B;  4L2Y A;  3FUW A;  2LWP A;  2G4S A;  1WGD A;  2UUC M;  1QOG A;  3TE6 A;  1EIJ A;  1N62 A;  4GC9 A;  2JXT A;  3BBZ A;  3BWK A;  4D8E A;  4DUY M;  3KFU G;  3C58 A;  3U6P A;  3T8M A;  1QZE A;  2C96 A;  1V9J A;  2A4Z A;  3KSX A;  4NOO B;  2EUC A;  4MH8 A;  2DKL A;  3U7Z A;  3AE4 B;  2KDB A;  3M95 A;  3BB7 A;  2KFK B;  3SYK A;  4RCO A;  2WDV B;  1ROE A;  3MC9 A;  4YTM B;  2P0R A;  5L95 C;  2LBC A;  1IWD A;  4PS8 A;  1GAQ B;  2DZZ A;  1QUS A;  2NCN A;  4Q7J A;  1L2D A;  2X8X X;  5ITU A;  2OZ2 A;  3GZN I;  2D2Q A;  1D5M C;  2OUL A;  4KO8 A;  3RZW C;  2FCQ A;  2LTU A;  3U6D A;  3PSE B;  3ZYY X;  3U6Q A;  3U61 A;  3EIH A;  1Q10 A;  4N59 A;  3P5X A;  2X4A A;  3DWG C;  1L2C A;  2KNV A;  4FUL A;  3ECI A;  1GKI A;  3PGE A;  3LYY A;  3NZU A;  4LFC M;  2R9C A;  2QHO B;  1NB5 A;  3LXS A;  4L78 A;  2X38 A;  1DGB A;  3KUC B;  4DXA B;  3HGI A;  5IWA M;  3PHW A;  1NYR A;  2MBQ A;  3TEY A;  1E8X A;  4WJO A;  2EMS A;  2CHQ A;  2J0J A;  1YZB A;  2HHN A;  3V6C B;  2FFJ A;  4QNM A;  1XCQ L;  3NVY A;  1TKG A;  4LJ5 A;  2O2V B;  1MU5 A;  1G4A E;  3DHH C;  4GOC A;  1IXZ A;  2Z84 A;  4IJE A;  4DR2 M;  3RMK C;  1TU6 A;  3QC8 B;  2EKF A;  3SHQ A;  1J7B A;  2QCU A;  3B9P A;  3ENE A;  5JI3 E;  2M0X A;  1J8C A;  2DZN B;  3GQ5 A;  1VEK A;  2QBY A;  1F2R I;  3MC0 B;  1YQB A;  4KSL C;  1S3S G;  3KYC D;  2LI5 A;  3CIR B;  1R6B X;  2JZ1 A;  3ETR A;  3I9V 1;  1UBI A;  5L83 A;  5D7G A;  1MDW A;  1V1P A;  4YT0 B;  1N36 M;  2BTW A;  1JRU A;  1N77 A;  3SR6 A;  1EFU B;  3O13 A;  4QH6 A;  1IXS B;  4W9E A;  3R7R A;  1NHG C;  4ITK A;  3RI7 C;  2BS4 B;  4HLE A;  2L05 A;  2BTE A;  2JUO A;  1CV8 A;  4K7C A;  4F7Z A;  1XWI A;  1KHQ A;  3HJQ A;  4FAD A;  3MHH A;  2N0S B;  4NSO B;  2HJ1 A;  1OFF A;  3HKP A;  2KN4 A;  2KWU B;  2RDG A;  2W3S A;  2G8E A;  3FTE A;  3QHT A;  3OVZ A;  1E8Y A;  2NQG A;  2FIF A;  1I94 M;  3BVZ A;  4LF8 M;  2R6F A;  2KXJ A;  4FD2 A;  3LMM A;  2FO5 A;  1KHP A;  3PRP A;  4KVG B;  2R0I A;  4RGN A;  4TQ0 A;  1WM2 A;  1YLA A;  2LHC A;  3SAU A;  1E10 A;  1ZIV A;  3PBH A;  4QRG A;  2HJ8 A;  3I3T B;  1FH0 A;  3L17 A;  1QLB B;  4I6L B;  4DHZ B;  3W1S A;  1P3Q U;  4MZS A;  4L4U A;  4LCB A;  2NPT A;  3T38 A;  2IYD B;  1AW7 A;  4ZRJ A;  1GEC E;  4WWP A;  5EJC A;  1SGH A;  2AYO A;  1WR1 A;  4DUZ M;  2NBU A;  3L29 A;  2QHO A;  2YEP F;  2WDR B;  3BK1 A;  3PZ8 A;  4US8 A;  2GBM A;  1R4G A;  2JY6 A;  1CPJ A;  5MPO A;  2K0B X;  2DCA A;  3W30 A;  3P42 A;  2ZCB A;  3PRM B;  4AI6 A;  2MJE A;  2CU3 A;  4GKJ M;  4B7H A;  4P6V F;  5IA7 A;  4IBC A;  4WP2 A;  2YJB A;  3FYD A;  2FH0 A;  4G4O A;  3JR5 A;  2DYM A;  4KLB A;  2HTM E;  4TUW A;  2QSD A;  2Y3A A;  3RNA C;  3QYE A;  4NAW A;  2QQ8 A;  4GEW A;  3W5U B;  2R45 A;  3PHU A;  1J7K A;  2KEB A;  4WWN A;  1FRR A;  2KOX A;  3DBH I;  1NO1 A;  1TDH A;  1RAX A;  1WGY A;  3K92 A;  2JZ0 A;  3K9P B;  5G2N A;  1UH6 A;  4W5B A;  3KP0 E;  4IWQ A;  3IEJ A;  2C9O A;  1GO5 A;  3Q8F A;  4X6H A;  2L7R A;  2YJ8 A;  2O6X A;  4AOF A;  2SAK A;  2WGS A;  1CB5 A;  3WAN A;  1TJE A;  3VRA B;  1MHH E;  4DR3 M;  4AXL A;  1T43 A;  2Z0E B;  2BQQ A;  5J2R A;  1MG4 A;  3E9S A;  2C7N B;  5E6J A;  2KQS A;  2JY5 A;  4A6Q A;  1L5P A;  1QUT A;  1BUI C;  2LXC A;  5FR3 A;  4FWH A;  1ZMW A;  4EFO A;  5D3D A;  4EOY A;  4ZHO A;  4HEO A;  4IBF A;  3U5Z A;  3B08 A;  5J17 A;  4JI4 M;  4MT5 A;  2EKE C;  2ZNV B;  1KTK A;  1WXV A;  3JAM S;  4NJ7 A;  3F5V A;  4L6V 6;  2BVC A;  3TQS A;  4MSQ B;  2G8J A;  3W67 A;  4ANV A;  1IBX A;  1YMH E;  1DGH A;  3J7B A;  4IUM A;  1FJG M;  2XSZ D;  1Y08 A;  2P86 A;  3FRI A;  2NR2 A;  3TL5 A;  3R7Q A;  3Q8C A;  1SJE D;  2WNM A;  2CHX A;  2PEA A;  2G9H D;  1FNU A;  4CDE B;  1FXT B;  3AKZ A;  4KGR A;  3HHW A;  4LFA M;  2QPA A;  1GB1 A;  2DZO B;  3N1Z C;  3W68 A;  1KFU L;  4RKX A;  1E0Z A;  3AOE A;  5EP1 A;  1WE7 A;  2D3C A;  5CTR C;  3MHZ A;  3HHY A;  4RNA A;  3FYC A;  5CVN B;  2N9X A;  1WMH A;  3P5V A;  2KMM A;  3WAL A;  3ZTC A;  4BOP A;  1TS2 A;  3HIZ A;  3KW5 B;  3BYY B;  1ME3 A;  1E94 E;  1E7V A;  4NC6 A;  1QAQ A;  2LGY A;  5JXV A;  1MX0 A;  1MEG A;  1V86 A;  5H8Y E;  3SHG B;  4IBI A;  4YYV A;  3K9O A;  1NVI D;  5BMG A;  4QNR A;  2KO3 A;  1FXI A;  3PVS A;  4LJ4 A;  1IY1 A;  2XFS A;  2HDE A;  4CDD B;  2LVN C;  3WAO A;  3I51 A;  4AW4 A;  2K22 A;  4GU2 A;  1OQY A;  1IBL M;  2MW5 A;  3SAS A;  2IY0 B;  3VTU A;  3ZGZ A;  2YJ9 A;  2FCS A; 
#chains in the Genus database with same CATH homology
 3AEF B;  3QAU A;  1W5S A;  3TWL A;  1C78 A;  4GC5 A;  1IM2 A;  1PYW D;  3L28 A;  3FTF A;  1XHB A;  1DO0 A;  4JWS C;  4LFB M;  3AE5 B;  2UXD M;  2QJL A;  4WAF A;  1V8C A;  2L52 A;  2J42 A;  2BYT A;  2WXR A;  4WIP A;  1F2R C;  5AUK A;  3NVZ A;  5C3J B;  1H6U A;  4JI8 M;  2BT6 A;  4XBO A;  3HHZ A;  1FRD A;  1VJK A;  2BS2 B;  2HKJ A;  3DOA A;  2J7N A;  4A3V B;  5F3W A;  2ZAO A;  1N34 M;  2FUG 1;  3SFZ A;  4XWT A;  1AYF A;  1DGG A;  1L1Z A;  3M0E A;  3K1J A;  3VRB B;  4DV5 M;  3R8F A;  4ZOH C;  3LVV A;  2KDM A;  3ZH9 B;  2K9X A;  4MI7 A;  3A45 A;  3L27 A;  3V05 A;  3ZQ4 A;  1VZ8 A;  3IT6 B;  4HJG E;  3NRZ A;  4QHS A;  4IP3 A;  2YR0 A;  3PRM A;  2WU5 B;  1NJG A;  1GPX A;  3UGJ A;  2CE7 A;  2AQ2 B;  1QZM A;  4Z6Y A;  4B0E A;  1M4V A;  3GRR A;  1E9R A;  3NBI A;  4HEA 1;  1YE9 A;  1C9F A;  4WWM A;  3V3X A;  3RNV A;  1IGC A;  4L16 A;  1G41 A;  2KRU A;  2MJ3 A;  3IAS 1;  3VK8 A;  1B1Z A;  4YY3 M;  1GVN A;  2I2Y A;  3HWS A;  4DV3 M;  1VRA B;  2Y0Q A;  4K0K M;  4A8X C;  3KOX E;  4WH4 A;  5BPV A;  3KP1 E;  3Q8E A;  2Z3X A;  1HNZ M;  2D7G A;  1FMA D;  3P4R B;  2Y21 A;  3GP1 A;  3B2G A;  4AG5 A;  2CV1 A;  3GPY A;  1P7E A;  1IGD A;  4XWW A;  3NUH B;  1A70 A;  5DYI A;  1MHX A;  4ZTB A;  3AMZ A;  3LQQ A;  3L25 A;  1HZ6 A;  1XXH B;  1XMO M;  2AX5 A;  3THG A;  2DVW B;  4GRI A;  3UJN A;  3R2T A;  2LUM A;  2CFO A;  1FO4 A;  1L0V B;  4LGY A;  3KOY E;  1JW9 D;  2QBY B;  1RFK A;  4GMQ A;  4JI1 M;  1L4Z B;  3EIE A;  2IPK D;  4X64 M;  4IDI A;  3D8L A;  5DNY A;  4RFB A;  2LXE A;  2CJO A;  4MGI E;  1N60 A;  1QT9 A;  3KLS X;  2L09 A;  1JR3 D;  3VDU A;  1ZUD 2;  1L0Y B;  4A55 A;  1ET9 A;  4X65 M;  2W3R A;  4YTN B;  2LJI A;  4XDC A;  3CF0 A;  1PGB A;  1JQJ C;  4M9S A;  3VDP A;  4KKI A;  2DWZ B;  5LNK 1;  2KZS A;  2WXF A;  3MP2 A;  1GL6 A;  4BOS A;  5IT9 S;  3AE3 B;  2DWL A;  3HU3 A;  1OJL A;  4IBJ A;  3TEX A;  3PHX A;  4NXM M;  1ZXI A;  2KRK A;  1V1P B;  1JWU D;  3IG5 A;  2C98 A;  4AZF A;  4N6E B;  1JRP A;  1IN4 A;  3W2D A;  1D5X C;  1FFU A;  2YFQ A;  3O65 A;  1DOY A;  3SAW A;  2Z4R A;  4B7G A;  4C7Y A;  4EIW A;  5EP3 A;  2PLP A;  2WXG A;  3R2I A;  3GB1 A;  4QHT A;  1XXH A;  3RGP A;  3VR8 B;  1RYJ A;  3LXF A;  1NEK B;  3BVG A;  2R62 A;  4JXJ A;  1JWM D;  3U60 A;  3KVW A;  4IKG A;  2XZU A;  1IY2 A;  3EA6 A;  4O1N A;  2F4V M;  3A46 A;  1N61 A;  1SE3 A;  1IBM M;  2R4J A;  4IIW A;  4B3S M;  2AGA A;  4MGZ E;  2LMC A;  3AED B;  1I4Q A;  4NSR A;  1EM7 A;  3A42 A;  5EXS A;  4YTP B;  1SSN A;  3SEB A;  3GPP A;  1SB3 C;  2WS3 B;  2KA6 B;  2E3T A;  1DGH B;  4HL4 A;  1K51 A;  5HHD G;  2YQZ A;  4KHP M;  3TRK A;  1XLQ A;  3ZNH A;  1BML C;  2FOI C;  3FUU A;  4DR5 M;  1KF6 B;  3HVD A;  4PCZ A;  4X62 M;  3AB5 A;  5HG2 A;  4DV7 M;  5C18 A;  1YSY A;  1E9S A;  2RDH A;  3IT4 B;  2C99 A;  2HL7 A;  4R3D A;  1CQV A;  4DQO C;  4GHA A;  1TKE A;  2GRI A;  1QOA A;  4S12 A;  5FK9 C;  2CEA A;  3U6M A;  3KS4 A;  1DYQ A;  4HLQ A;  2BB5 A;  1ORY B;  3AEC B;  4RGM A;  2C9C A;  1YQ4 B;  2E5L M;  2OPF A;  3UZU A;  3JR4 A;  3GLF B;  1SJH D;  1FIQ A;  4LJ9 A;  5FTK A;  1V1O A;  1JCK B;  4RF0 A;  1C4P A;  2J7Q C;  1HNW M;  5EXP A;  1N63 A;  2XNA C;  2JQR B;  4AKG A;  2MH7 A;  4UDU C;  1TDZ A;  1YJJ A;  3GS2 A;  2OHF A;  1ZAE A;  2DYO A;  4C56 C;  4PT5 A;  3AE7 B;  4JE3 B;  1R2Z A;  3PO0 A;  3FD9 A;  2RPV A;  2JYT A;  2XH9 A;  4LLG M;  3IG8 A;  2I7P A;  4XE0 A;  1N75 A;  1XLP A;  1FCC C;  5EP2 A;  2LNH C;  3FTD A;  4AG6 A;  2QP9 X;  3HRD D;  2DBY A;  2PW9 A;  4JI6 M;  3TWK A;  4MB7 A;  3E56 A;  1DGF A;  2CUZ A;  1T6B X;  2WXH A;  3ILK A;  5I4D A;  4OHJ A;  2KWD A;  3W0L B;  1T3T A;  4R7G A;  4DR1 M;  3PFI A;  1SE2 A;  1PM5 A;  1SF0 A;  4JI0 M;  3VQI A;  4LJ6 A;  2WU2 B;  3GPU A;  4NZL B;  4D8I A;  1MVK A;  2IGD A;  3FUX A;  4HKQ A;  2F5Q A;  1CJE A;  3M7G A;  4P16 A;  3L4P A;  2H88 B;  1T5X D;  3KXE C;  2JZP A;  4USA A;  1FNW A;  4FVM A;  2DWN A;  2R61 A;  1K3W A;  4NRV A;  2L32 A;  1SXJ A;  2V6Z M;  2A5Y B;  1YNT E;  3EUB 2;  5EZS A;  1QOF A;  1HNX M;  2KZU A;  3WHK A;  4CIS A;  2JX5 A;  4GIT A;  1YN4 A;  4US9 A;  3U52 E;  1PFD A;  1LO5 D;  1TGU A;  1TH3 A;  3U5Z B;  4DV4 M;  2WDQ B;  3U6C A;  5FTJ A;  1HEZ E;  5HFY A;  3KOZ E;  3FKE A;  1OFI A;  3T3N A;  5E26 A;  4JPS A;  3LB8 C;  1ZP0 B;  3L26 A;  2DLB A;  2M0A A;  1HQY E;  2VII A;  4A9A A;  2HWK A;  4OVZ A;  3W0F A;  3PZ7 A;  2ZW0 A;  1J7A A;  3J2P B;  4LZJ A;  2KW0 A;  1AWD A;  2G5G X;  2JA2 A;  2PKO A;  1PGX A;  3H8H A;  2XF3 A;  1ZDV A;  1C77 A;  3J81 S;  3BVM A;  3SHF A;  1JWB D;  2QIE B;  2G8L A;  5TSS A;  4D82 A;  2J7O A;  3CF2 A;  1VR9 A;  4M9Z A;  3FC4 A;  1PUT A;  3TL4 X;  1IN6 A;  2K0P A;  1Z6T A;  1K53 A;  3DA1 A;  3GRU A;  3P4P B;  1VZ6 A;  4TSS A;  4LRT A;  2Y5C A;  3B9J A;  4KGT A;  4BOU A;  4D81 A;  4GUA A;  1TH4 A;  5A2Q S;  1SXJ B;  1JWS D;  1IQP A;  3MFG A;  4RF1 A;  2M5Z A;  2JU6 X;  3GLI B;  2WXI A;  3AEE B;  3T1H M;  2Y0T A;  4CGY B;  1CZP A;  3MHV C;  4FXC A;  5FTL A;  1I4G A;  4DXG A;  2K5P A;  3MP9 A;  3P63 A;  3HUI A;  4YXD B;  2IGH A;  2ICI A;  4LJ8 A;  3P4S B;  4MH0 E;  2V1U A;  2F5S A;  4HKZ E;  1YN5 A;  4JV5 M;  3KS8 A;  1I4R A;  3I4Y A;  4GIP A;  4L23 A;  5FTM A;  4L15 A;  4EE2 A;  1XC8 A;  4YSX B;  4AQ7 A;  3PSE A;  4DV2 M;  1K82 A;  1SEB D;  1ZQ9 A;  1LV7 A;  1D4B A;  1JRO A;  3AE6 B;  5EP4 A;  5LMN M;  1XXG A;  2PVG C;  1N32 M;  2L83 A;  3I4V A;  2IGG A;  2D5G A;  1CK1 A;  3PNV A;  3AEB B;  4J3O D;  1E32 A;  4C7Z A;  2BB6 A;  2L7I A;  2JSV X;  2NMQ A;  2M19 A;  1VDD A;  2VZK D;  2BJW A;  2D7H A;  2G1E A;  2R46 A;  4LY6 A;  2WXJ A;  1HT2 E;  3BZD B;  1YN3 A;  2HCB A;  2Y20 A;  1F77 A;  4RGT A;  5BYR A;  1G3I A;  3C8Y A;  1C79 A;  2W82 A;  3KOW E;  4WW0 A;  4DR7 M;  1D6E C;  4LGM A;  1XEE A;  1WYG A;  2VQF M;  3U6L A;  1HA5 A;  2YNM D;  3UMM A;  4YWG G;  1EWC A;  1XNQ M;  1MI0 A;  1PJJ A;  1C4A A;  4C80 A;  3SMS A;  2XEP A;  1EWY C;  4W5W A;  3W31 A;  3KQ4 A;  1JWA D;  1PDX A;  1ZOY B;  3J80 S;  1N33 M;  3Q69 A;  4AKI A;  2LHE A;  2FE8 A;  1VDV A;  1FCL A;  1R2Y A;  2ACZ B;  3U2S C;  5FTN A;  4FCT A;  4ARC A;  3SFE B;  5EE1 A;  4BBA A;  2E6X A;  5BYS A;  3ZCB B;  2KAJ A;  3P4Q B;  2X8A A;  2SEB D;  4QOS A;  1TKY A;  2WP9 B;  4PDG A;  2R65 A;  3K2L A;  2ZW1 A;  1Q3B A;  1SXJ D;  3DWM A;  1HXY D;  4IBK A;  2BU3 A;  1EU4 A;  8CAT A;  1UM8 A;  1NI3 A;  4B08 A;  3GPX A;  3SAV A;  1SXT A;  1DOI A;  3AE1 B;  4LJ7 A;  4NRW A;  1HZ5 A;  3GLF A;  4MM3 B;  5D3I B;  1JAL A;  3RFZ B;  2LWX A;  4NJC A;  3GRY A;  2N7J A;  3PNY A;  4NL4 H;  3AOG A;  2EEL A;  4PDI A;  2BTW B;  2LH0 A;  2LGI A;  4MGY E;  1XLO A;  1UWX A;  3HJS A;  2C5R A;  1WRI A;  4JI3 M;  1PJI A;  7CAT A;  1C1K A;  3VKG A;  2ZAN A;  4AKH A;  1NHW C;  2INP E;  3NS1 A;  4TMA B;  3RFW A;  4L8R C;  1QIL A;  4MGK E;  1T3Q A;  1J09 A;  3UI3 A;  2Y5P A;  3RGS A;  4ZYS A;  3BII D;  1QQW A;  4NAW B;  1Z5C A;  1IN7 A;  1QAO A;  1SE4 A;  5IRE B;  1L1T A;  3SC3 A;  4HXD B;  3DFZ A;  1TY0 A;  3VKH A;  5ITT A;  2M56 B;  1ZXH A;  2F5O A;  1DO2 A;  5BR8 M;  1FNV A;  3T3O A;  3BYT B;  4XDD A;  4XGI A;  2WLB A;  3AM9 A;  2JTC A;  3QWL A;  3KW6 A;  3U61 B;  3HHX A;  5FLX S;  5KPZ A;  5C2T B;  1QF6 A;  2PTL A;  1EU3 A;  1QAN A;  4MAC A;  3ABV B;  4ZRQ A;  4II7 A;  3AE8 B;  4FCW A;  4NAM A;  3AV8 A;  1I4H A;  5JZE A;  1WXQ A;  4DV0 M;  4LRS A;  1I4P A;  3CF6 E;  1K50 A;  4CHT B;  3HJ8 A;  3GLG A;  4KGS A;  3BBA A;  1UKF A;  2UXB M;  3AL0 C;  3BY4 A;  4KX6 B;  4BLC A;  3MTV A;  2EO2 A;  3WCQ A;  3Q8A A;  4G4R A;  1L2B A;  1ZDX A;  2XN9 C;  3P1M A;  5FKA C;  3AEG B;  4REZ A;  4IJF A;  4LF4 M;  3AE2 B;  5G5G A;  4OU7 A;  1GLN A;  1TS5 A;  3M6A A;  2DWM A;  5KO3 A;  4ZHP A;  3B21 A;  2LEK A;  5EE3 A;  2X49 A;  3T15 A;  1QKZ A;  3KSJ A;  4X66 M;  5BMH A;  3EGR A;  1KFV A;  1D5Z C;  4N58 A;  3MK6 A;  1SXJ C;  5BYQ A;  4GH9 A;  5ITX A;  3U6S A;  1ESF A;  2BW2 A;  4D8B A;  4Z8X A;  1J7C A;  1Q39 A;  4DV6 M;  2DXI A;  1UWM A;  4PD2 A;  5FSW A;  1K52 A;  3GLH A;  2ZM6 M;  2QIL A;  4CQN A;  1KLU D;  3K8Z A;  2J52 A;  4B3M M;  3TEZ A;  1S3S A;  2RKO A;  3ZC7 B;  2VQE M;  4JI2 M;  2V3N A;  1F0Z A;  2WXK A;  3H4M A;  5EXT A;  2WXP A;  4H2A A;  2WXM A;  1KSF X;  4JX1 C;  2R4E A;  3Q8B A;  1FXA A;  3AE9 B;  1Z5A A;  3AFH A;  2BNK A;  1MPE A;  3R8B A;  3J27 B;  4G4Q A;  5EE0 A;  1YQ3 B;  2J53 A;  2V0G A;  1L6U A;  4GKK M;  1IBX B;  1KYI A;  1BXT A;  4KOD A;  2KQ4 X;  3IFU A;  5C1B A;  2J4X A;  3VK7 A;  2L1A A;  2L7H A;  5EZQ A;  1IY0 A;  2N9L A;  1FNN A;  3FIL B;  1E7P B;  2N9K A;  2ON8 A;  4ARI A;  2FBW B;  1XF5 L;  3J7A S;  2JYE A;  4IBD A;  2YEP B;  3NZ3 A;  1KLG D;  2J7Q A;  5G5H A;  2QZ4 A;  3TMP A;  2OED A;  4LF7 M;  2INN E;  1UGJ A;  1D2N A;  3URY A;  3NWL A;  4G6Z A;  5GKN A;  4DR4 M;  5KPR A;  3BK2 A;  2P5T A;  1C76 A;  4FWG A;  1G8P A;  5KQD A;  4OVZ B;  5EE9 A;  1SXJ E;  1JQ4 A;  3KWL A;  3FUV A;  2AQ1 B;  4Q2J A;  1VZ7 A;  5ITR A;  1VLB A;  4DXF A;  2DHR A;  2F5P A;  2KXE A;  4FW9 A;  4GDK B;  4A90 A;  4D2K A;  1NY6 A;  2WXN A;  2Q2E B;  1SBB B;  3CWI A;  1XO3 A;  1N78 A;  2L6O A;  4M0D A;  3N9Y C;  1SIJ A;  3U4E G;  2I38 A;  4JYA M;  4YSY B;  3E4R A;  5DYG A;  1EE8 A;  4MGH A;  1HT1 E;  3AOE C;  4JWU C;  1AN8 A;  3ZJV A;  4I4L A;  1TZO A;  3GP7 A;  2JWU A;  4HRO A;  2UUA M;  1HQR D;  1NYQ A;  1WSP A;  3TSS A;  4DR6 M;  2DOS A;  1N5X A;  2XLJ A;  4GLS C;  4KKJ A;  3GLH B;  3L2A A;  5HI1 A;  3AV0 A;  1KH0 A;  2ZBK B;  3GO8 A;  4BB9 A;  2XSZ A;  1X37 A;  2QEJ C;  4IOI E;  2PIA A;  4LK0 M;  1E6E B;  2ZAM A;  1J5E M;  1L4D B;  2O5R A;  2V1C A;  4GDL B;  1ENF A;  1XLN A;  3WHL A;  2TSS A;  3FAH A;  1TS4 A;  1PGA A;  1IUE A;  1FEH A;  2FNA A;  2LFI A;  2PVO D;  2RMM A;  3RPF C;  3AJI B;  4OZB A;  1FFV A;  4DV1 M;  2XGN A;  3FIL A;  2RGO A;  2MEK A;  2WXO A;  1NJF A;  4D80 A;  1IN5 A;  2ONQ A;  2EKI A;  5LMU M;  3SAR A;  4OX9 M;  4B3T M;  1L6V A;  3KWV A;  1DGJ A;  3OTO M;  1C4C A;  1ZPS A;  2M60 A;  1FD6 A;  3SBJ A;  5BMI A;  3VR9 B;  4ITQ A;  1NNU C;  3GRV A;  1OQQ A;  3D8B A;  5ITQ A;  4RGO S;  1QYR A;  2RGH A;  2UZJ A;  4JI7 M;  5IZ7 D;  1RM6 C;  3GLG B;  4WQM A;  1QAM A;  3HU2 A;  3LVW A;  3IAM 1;  1E9M A;  1NY5 A;  2NTS A;  3HU1 A;  1WGK A;  2CV0 A;  4ZPX A;  1TS3 A;  3TUO A;  1N5W A;  2H1R A;  1I7H A;  3BWU D;  2CHG A;  3VLF B;  3ZJU A;  3T1Y M;  5EXX A;  3AEA B;  1HQC A;  4OZA A;  2XZF A;  2K3U A;  3OWE B;  3TEW A;  3J9C A;  4OZC A;  4IBE A;  1NSF A;  2QEN A;  3LQR A;  4LG2 A;  2Z8L A;  2BS3 B;  4TQ1 A;  2GB1 A;  2IJ0 A;  3PXG A;  1Z5B A;  3UK6 A;  2CV2 A;  3CTW B;  3SMP A;  2ERC A;  1XCT L;  2QMT A;  3I57 A;  1QOB A;  3ZJT A;  4M0W A;  3NVW A;  4JI5 M;  2WQY B;  4LJA A;  2OQ4 A;  3GQ4 A;  1QVR A;  1OQR A;  4GHL A;  4NXN M;  5KQ8 A;  4JN6 A;  1I4X A;  2DWQ A;  2Z4S A;  1KFY B;  3RE8 A;  1GB4 A;  1ZE3 D;  2W54 A;  2AHM A;  3PT2 A;  2UUB M;  1JR3 A;  2BBC A;  1ET6 A;  1Z59 A;  1OFH A;  2WXQ A;  2MJD A;  2HHH M;  1STE A;  4I5S A;  1RWS A;  5GXG B;  2Q5W D;  4I8O A;  3TPZ A;  5T8I A;  4QOZ C;  3U6E A;  1QQR A;  5ITY A;  5ITX E;  1P7F A;  4B0M A;  2VZK B;  3W5V B;  2NTT A;  3SYL A;  1IBK M;  3U60 B;  1JML A;  1GOZ A;  2K47 A;  1NNJ A;  3VFD A;  4YSZ B;  3U6O A;  2KAC A;  3DZD A;  4WUR A;  1NVM A;  4BOZ A;  1UUP A;  4G4N A;  4AQY M;  4FCV A;  4BOQ A;  4B3R M;  4LZZ A;  2GI9 A;  1GL7 A;  3R9X B;  3FUT A;  3AH7 A;  1Y56 A;  2Z7J A;  1V97 A;  1IN8 A;  3TWM A;  1W5T A;  3FTC A;  2IDY A;  5JI2 E;  2XFT A;  4I81 A;  4KLN A;  1PVJ A;  1HR0 M;  4YHH M;  2BJV A;  2F5N A;  3IXS A;  5EQT A;  2UU9 M;  4LF6 M;  2PMV A;  3HVZ A;  4AS1 A;  5AUI A;  2V3P A;  3GQ3 A;  4ZRP A;  2I7N A;  2UXC M;  2B76 B;  3SAT A;  1L8Q A;  1XNR M;  5KPT A;  1XMQ M;  5H92 C;  3MJ5 A;  3Q8X A;  1ACC A;  1YJI A;  1YUB A;  2CJN A;  2W55 A;  4LF5 M;  4RH6 A;  2WXL A;  3KDS E;  3W9C B;  3SFD B;  1DKI A;  4M9X A;  2LHD A;  3AN1 A;  2NQ8 C;  1TYG B;  1R7R A;  2H89 B;  2JRI A;  2AQ3 B;  5H37 D;  2CHV A;  1FM0 D;  1NEN B;  1B9R A;  1DOX A;  1TH2 A;  1L0X B;  1K3X A;  4FWD A;  4HRS A;  3BOS A;  3C0R A;  4A5U A;  2D7E A;  1I4W A;  3GLI A;  3A98 B;  3OQC A;  1G59 A;  4OW0 A;  1Q3C A;  4XZX A;  2EA0 A;  3NVV A;  3B2F A;  4IBB A;  4IBG A;  4L1B A;  4LF9 M;  2V4I B;  1KRH A;  1TY2 A;  1R7S A;  1UNS A;  2R18 A;  1IXR C;  1WWT A;  4B7F A;  4L2Y A;  3FUW A;  2UUC M;  1QOG A;  3TE6 A;  2JXT A;  4GC9 A;  1N62 A;  4D8E A;  4DUY M;  3KFU G;  3C58 A;  3U6P A;  2C96 A;  3U7Z A;  4MH8 A;  3KSX A;  4NOO B;  2EUC A;  3AE4 B;  3BB7 A;  3SYK A;  4RCO A;  2WDV B;  1ROE A;  4YTM B;  1GAQ B;  1L2D A;  5ITU A;  1D5M C;  4KO8 A;  3U6D A;  3ZYY X;  3U6Q A;  3U61 A;  3EIH A;  1Q10 A;  4N59 A;  2X4A A;  3DWG C;  1L2C A;  1GKI A;  3LYY A;  4LFC M;  4L78 A;  2X38 A;  1DGB A;  3HGI A;  5IWA M;  3PHW A;  1NYR A;  3TEY A;  2CHQ A;  1YZB A;  2FFJ A;  4QNM A;  1XCQ L;  3NVY A;  1TKG A;  4LJ5 A;  1MU5 A;  1G4A E;  1IXZ A;  2Z84 A;  4IJE A;  4DR2 M;  1J7B A;  2QCU A;  3B9P A;  5JI3 E;  2DZN B;  3GQ5 A;  2QBY A;  1F2R I;  3MC0 B;  3CIR B;  1R6B X;  3ETR A;  3I9V 1;  5D7G A;  1V1P A;  4YT0 B;  1N36 M;  2BTW A;  1N77 A;  3SR6 A;  3O13 A;  1IXS B;  1NHG C;  4ITK A;  2BS4 B;  2BTE A;  1XWI A;  3HJQ A;  2N0S B;  4NSO B;  2RDG A;  1OFF A;  3HKP A;  2KN4 A;  2W3S A;  3FTE A;  1I94 M;  3BVZ A;  4LF8 M;  4FD2 A;  3LMM A;  3PRP A;  4RGN A;  4TQ0 A;  3SAU A;  1E10 A;  1QLB B;  3W1S A;  4L4U A;  4LCB A;  3T38 A;  1AW7 A;  5EJC A;  4DUZ M;  3L29 A;  3BK1 A;  2YEP F;  2WDR B;  3PZ8 A;  4US8 A;  5MPO A;  3W30 A;  3P42 A;  4AI6 A;  2MJE A;  2CU3 A;  4GKJ M;  4B7H A;  4P6V F;  4IBC A;  3FYD A;  4G4O A;  3JR5 A;  2DYM A;  2HTM E;  4TUW A;  2QSD A;  2Y3A A;  3W5U B;  2R45 A;  3PHU A;  1J7K A;  2KEB A;  1FRR A;  1TDH A;  3K92 A;  3KP0 E;  2C9O A;  3Q8F A;  2SAK A;  1TJE A;  3VRA B;  1MHH E;  4DR3 M;  3E9S A;  5E6J A;  4A6Q A;  1L5P A;  1BUI C;  5FR3 A;  4FWH A;  5D3D A;  4ZHO A;  4IBF A;  3U5Z A;  4JI4 M;  4MT5 A;  1KTK A;  3JAM S;  3TQS A;  1IBX A;  1YMH E;  1DGH A;  3J7B A;  4IUM A;  1FJG M;  2XSZ D;  3Q8C A;  1SJE D;  2WNM A;  2G9H D;  1FNU A;  4KGR A;  3AKZ A;  3HHW A;  4LFA M;  2QPA A;  1GB1 A;  2DZO B;  4RKX A;  1E0Z A;  3AOE A;  5EP1 A;  3MHZ A;  3HHY A;  4RNA A;  3FYC A;  2KMM A;  4BOP A;  1TS2 A;  3BYY B;  1E94 E;  1QAQ A;  5JXV A;  1MX0 A;  5H8Y E;  3SHG B;  4IBI A;  1NVI D;  5BMG A;  4QNR A;  1FXI A;  3PVS A;  4LJ4 A;  1IY1 A;  2XFS A;  2HDE A;  3I51 A;  4AW4 A;  2K22 A;  1IBL M;  3SAS A;  3ZGZ A;  4LTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...