4PT5A

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
319
Chain Sequence
b'LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like protease
publication title Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 82
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4pt5A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4pt5A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4pt5A03
2FE8A 4WURA 4RF0A 5E6JA 4PT5A 4OVZB 4RF1A 3MJ5A 5KO3A 3MP2A 3E9SA 4RNAA 4M0WA 4R3DA 4OVZA 4P16A 4OW0A 4REZA 4MM3B
chains in the Genus database with same CATH superfamily
4JI2M 3W1SC 4LDTD 3MFGA 4LNOA 2GFOA 1C76A 2BTEA 2BU3A 1ET6A 1N77A 2UXDM 3TMPB 2MJ3A 3VDUA 5H37D 3ZNHB 1TR8A 3M62B 1XKGA 2D7GA 2CEAA 1V8CA 1MVKA 3L17A 1N63A 2AQ1B 4G4QA 4YYRA 2WXLA 3N32A 1C78A 1NQCA 2J7QC 1R6BX 1YX5B 2FUG1 4REZA 4GC5A 3GLGA 2VZKB 2ZEQA 2LJIA 3A33B 2DWLA 2FAZA 4N9F4 4BOZB 5EQTA 4BOPA 3GO8A 1L4ZB 4NC6A 2JRIB 3PT2B 2DCDA 2IYDB 1N5WA 1T6OA 4ZRJA 2EMSA 3MHZA 3U6QA 1F2AA 1T3QA 3CTWB 3B79A 2VHFA 1E9RA 2KXEA 4UDUC 1E9SA 1BT0A 3R7RA 1NEKB 1F29A 1EM7A 1DF0A 4LJOB 4HPMB 5C1ZA 2KO3A 3U6OA 4DR4M 3L54A 4KZ0A 3TE6A 2IGHA 3DA1A 3I3TA 5K16A 3MTNB 2QSFX 3Q6BA 4P1BC 3VHTC 3GE8C 4I4LA 1QDTA 2F5PA 1WR6E 4ANXA 2H5XA 4DR3M 2L8JA 2KTFA 1XB2B 2L4FA 3DZDA 5EE1A 4A55A 3BPFA 3SAVA 4W4UA 2L7HA 3HJ8A 1FNWA 3B08A 4B3MM 1EF1A 3TMPA 1YALA 3R2IA 3I4YA 2CR5A 3ZNHA 2CUZA 4FWDA 1ET9A 1ZQ9A 4B7GA 2KA6B 4UN2B 1PGBA 4A90A 3DBLB 4NRWA 5DFLA 1SXTA 3A1QA 1G71A 4RGOS 1U9WA 1F52A 2WDTB 2JXXA 8CATA 4C7YA 1BMLC 4BOZA 5AEKB 2DWZB 4JI6M 1QOLA 4I05A 3HX3A 4WJQA 2PW9A 3FKYA 5AZHA 3Q8FA 5IOIA 4FJZA 5ITTA 4JLCA 1J5EM 1QUSA 3VRBB 3PT2A 1WJ6A 2CKHB 2AUXA 2EUCA 1VG5A 2PREA 2DAMA 1L4DB 4MJSB 2PVGC 2C98A 2KDEB 2KD0A 1WH3A 3I4VA 3KDSE 4RF1A 3C9EA 4CO7A 1WM2A 2KNVA 1MI0A 4FBJB 4M0WA 4IM2A 3EUB2 3KSXA 1AU0A 4K7SA 2IO1B 4RFBA 4G4RA 2W55A 4XBOA 4OVVA 2NQDB 1PRBA 3BBAA 2HTME 1IXZA 4MEMA 2ZM6M 2RDBC 2OZ2A 1JALA 1R2ZA 3ONSA 1F2CA 1QUTA 2LVOC 3AEBB 3KVFB 4DXAB 2XBBC 4C7ZA 5KHQA 2N9XA 2XU3A 3P63A 2N35A 1WI0A 1L8QA 1S3SA 3DF0A 3PVLA 2LGXA 2L0TA 4N59A 1TZOA 2BKFA 3DBHI 3A9JB 1XNRM 2WDRB 2P7UA 1ZKHA 2DOSA 1E0ZA 1YJIA 3HIZA 3NZSA 3DVNU 3HWNA 1Y8RC 1TH3A 3NVVA 4I8OA 4AW4A 1J0GA 3DOWA 3GRUA 3ERVA 4W9HA 4LF6M 3B7QA 4Z8XA 3IXSA 2LUMA 3N9YC 1AN8A 1Y56A 3U8EA 3UMMA 4MJSA 2FUDA 2LHDA 3V76A 2I7PA 3HJSA 3Q8XA 5ITUA 1TL9A 1G6JA 3I63C 2YJ9A 4MZOA 4IM3A 4BZAA 2R44A 2AWTA 5KPTA 3NOBA 2JZ1A 1LM8B 4FW9A 1WE7A 3SU8X 2J7NA 2XSZD 2DC7A 2I1KA 2C7NB 4A5UA 3GOEA 1UKFA 4E3CA 1OJLA 3HK0A 2L3ZA 1EWPA 1PJSA 3C19A 2Y0QA 3O1GA 3PVSA 3KYDD 3QQ8B 4DK5A 1V81A 3L13A 3PNRA 2C7HA 4OZBA 2KAJA 4PCZA 2J5YA 1UD7A 1GCBA 2BS3B 1VDVA 5GXGB 4QNRA 4F7ZA 2DZJA 8PCHA 4ZOHC 1DGGA 4RGTA 2NVUI 3PRZA 3LW5F 4HCPB 2CHVA 1SF0A 2J0MA 1ITOA 4MB7A 4HKQA 2LRUA 1E32A 5LXIB 4PADA 1QANA 3B9JA 4CISA 4QH6A 2FUHB 1RFKA 3RUIB 7PCKA 4J6IA 3D6SA 2WSFF 3A9JA 5HI1A 1IYFA 2J0JA 1NNUC 3V3XA 5D3IB 3TL5A 1EO6A 3K9OA 4OZCA 4NXMM 4QBBA 4IOIE 1BY8A 2KW0A 3RT3B 3KYCD 4WWNA 4JI1M 3B21A 3K1JA 4H2AA 4WJPA 2D07B 3NS1A 4BS6A 5EDSA 2Y5CA 2N9LA 3QX1A 5CHFA 1E7VA 2MRPA 3AM9A 1Q0WB 4TSSA 3MK6A 2GMIC 4R7GA 4KGSA 3SC3A 2LI5A 5EE0A 5AZFA 1I94M 4HLEA 4USAA 5C18A 1E90A 2FCNA 1G59A 2O6XA 4GN1A 2XNAC 3LMMA 5EXXA 4J3OD 1WJ7A 3NZ3A 2JQFR 3UGBB 2WXQA 4YXDB 1R4GA 1XLOA 5FSWA 3L29A 2IPKD 4CYEA 3UK6A 2X8AA 4XDCA 3ZCBB 3QWLA 2KN5A 3BWUD 2JT4B 4BAXA 3LVVA 4D81A 4ANUA 2AL3A 4AXLA 4WP2A 1J7AA 4C4VA 4LJ6A 4ITQA 4A3PA 3PNYA 2LD9A 4II7A 4YL8A 1QT9A 2OOAA 2KX0A 2R9OA 2C5LC 4MDKE 1YIWA 1WMHA 1NYRA 1XO3A 4DHJD 2BTWB 4GRIA 4YTMB 4IBBA 1Z2MA 1F77A 2K8HA 3P4PB 1SXJB 4JI5M 1HNWM 2UXBM 2K25A 3SATA 5G2NA 3JR4A 2GBJA 5KPRA 3IFUA 4FIPA 2FH0A 1HA5A 2B3TA 4LZJA 3Q8CA 1WXQA 1KLGD 1Z5SB 1F4IA 2EMTA 4N6EB 2R45A 3GLHA 1HNXM 1YNTE 4M8NA 6PADA 2E00A 1KLUD 2K1FA 1F2RI 2WXOA 4YTNB 4IKGA 2IO3B 4WJNA 2D10A 3V62A 4Q8GA 2Y5PA 1FNNA 3HHXA 1SSNA 3AU5A 1WZ3A 3L0WB 2M60A 4LK0M 3VDZA 1P3QU 3V6CA 2R9CA 1YD8U 4GB9A 3MP2A 1ZP0B 3HWSA 4ZTBA 4I6PA 1K3XA 2J52A 3DQVA 1JR3D 4DV6M 2XU1A 1TDHA 1XT9B 3KW6A 2WWZA 1WGRA 2Z59B 5JHAA 1W5SA 1ZW7A 2M56B 5H92C 1N5XA 3SDLC 2KZSA 2R62A 2MW5A 2AVWA 4BQVA 1MPEA 4N8WA 4G50A 5A24A 3TSSA 3PLVA 4G3OA 1IN7A 1OEYJ 4PP1A 2DJFB 1V6EA 4X66M 1C4CA 2LVPA 5JXVA 1EUVB 2JXNA 4KT0F 3WIMA 3ZRFA 2KNAA 2OOBB 3SMSA 3NVYA 2MP2B 3DOAA 2MGWA 4IBJA 4MELA 4JL9A 3HRDD 2ZZPB 5HFYA 3B9PA 4IJFA 1E6EB 2BTWA 1N33M 3NZUA 3KWLA 3ZVVA 1XXHA 1N62A 2QCZA 3AJIB 3QC8B 1NJGA 3ZTDA 3QK0A 5EZQA 1D4BA 1WX7A 5BO4B 3GPUA 4YSZB 1SXJA 2R46A 5EXTA 1I35A 1STFE 2DAJA 4LRSA 2JP7A 3GLIB 2I38A 3BIID 2W82A 2KJ6A 2ARYA 1PQSA 4B3SM 2UU7A 4K81A 1VEGA 2MHJA 4LDTB 4HPPA 4PK1A 1OFFA 3V61A 5F3WA 4L15A 2M4NA 2NMQA 2BKRB 3ALBA 4BOQA 1UH6A 5IP4D 1WGGA 2ZCCA 1KSFX 3IAM1 5CHTA 4NJCA 3NS8A 3QA8A 4C00A 3H8BA 4D8EA 1C4AA 2X38A 2KANA 3SHGB 4FHKA 4FULA 4EKUA 1VJVA 3KOWE 1WWTA 2ZJDA 3U6CA 2KHHA 4DHZB 1EFUB 4XC2A 3ZYYX 3C58A 3C0RB 1GJSA 3U30A 1J7KA 2JZZA 4AWJA 3BB7A 4LLGM 2KEBA 4NSOB 4FJVB 2JA2A 3N1YC 2DZIA 2DWNA 5CVMA 3KP0E 1V34A 5C2TB 4WWMA 3NVZA 2WLBA 3KLSX 3DBLI 2H89B 2MLBA 2YVCA 1XMOM 3DBRB 4X57B 1SJHD 2DAEA 2HAKA 4HDOA 1GOZA 2MP2A 2WXIA 4W9GA 5IAAC 1IBXA 3A9KB 2BNKA 3S3QA 2HH5A 2ZANA 5IA7A 1IGCA 2KC2A 4DR2M 1HZ5A 3N30A 3MTVA 3VR8B 5EP2A 3ZNZB 2BJWA 4P1CC 4OEMA 2WXMA 2P0RA 2H1RA 4LFAM 3GLIA 2RDGA 1UZXB 3RNBC 1IY1A 4IBEA 3T1HM 4PDIA 1QOAA 1D2NA 5EP3A 2IDYA 4NJ6A 3RULA 4GKKM 1WYGA 3EA6A 4E71A 2BJVA 2LVAA 1K3BB 3U61A 1HE8A 2JYTA 1P9DU 3GLIE 3BVMA 3ENEA 3CSFA 1TTNA 2KQ7A 1GC7A 3OVZA 4YYQA 3IAS1 3DHHC 2MQJA 2KDMA 4PI3A 3IHPC 5FTJA 3FTDA 1QVRA 2YFQA 3KUCB 4OHJA 1QQWA 3SR6A 3L4PA 2LXEA 1E9MA 1N6ZA 2XK5B 2E6XA 2NTSA 2NQAA 1WGNA 3I51A 2UUCM 2LVPC 3FC4A 2L4EA 1EWOA 2C9WB 3A45A 2BGFA 1N61A 2AYNA 3C0RA 1PPDA 2FNAA 4NPNA 4LCDE 5FLXS 4KV2A 1ME3A 2HJ8A 3T3NA 5PADA 1IXRC 1E8ZA 2DZMA 2VF7A 3M63B 4F1SA 1V5OA 4FVMA 2WXFA 4GMVA 4W9LA 5DNYA 2CB5A 3CWIA 3Q14C 4GIPA 2O6VD 3MC0B 3LFYA 1YOVB 3H8CA 4DHZE 4ZPXA 2INPE 3BZDB 2C7MB 2YJCA 2WZJA 1VD2A 3OAWA 1U5IA 2SAKA 4R3DA 1T0YA 1E94E 2M5ZA 4BKSD 1BQIA 3AKZA 3T38A 5D3DA 2VH1A 1V92A 1IXSA 3E46A 2JXTA 3A9KA 1WSPA 4LJAA 1TGUA 3VH3B 2K47A 1N60A 3BVGA 4G3XB 2WBFX 2B1NA 1D5ZC 3U52E 2G9HD 1H8CA 2Z0EB 3OF9A 3TWLA 3HD3A 2W54A 4KKJA 2KFJA 2RPVA 5CHWA 4QRXA 2ZPNA 1JWSD 3O13A 4LF9M 2AQ3B 2CU1A 2J53A 4KDLB 3WXEA 3O65B 2PBHA 1DEUA 3ZQJA 2XU5A 4GITA 3E9SA 5KPZA 3RVXA 1QOBA 2BB5A 1V97A 1CK1A 3J27B 1ZOYB 2DJGB 4NQLB 1PM5A 1TH4A 2DNFA 3T6PA 3OWEB 3PRMA 4PS8A 2ICIA 4RGMA 2CJOA 1HJPA 3USVA 1CMXB 4WAFA 2L09A 2O2VB 2HKJA 3H7DA 4LG2A 1RAXA 3FAHA 2ZNVC 2PPHA 2XK5A 3Q8AA 1QMYA 3ZUAA 1D0LA 1BP4A 4G0NB 2L7RA 2KK8A 1IGDA 3X0WA 4GSWA 1XWIA 4JQWC 3O0UA 1T5XD 2XH9A 4WQMA 4XUIA 1FO4A 2BDLA 3BOWA 5EP1A 2D3CA 2N9PC 3W9CB 1JCKB 4L78A 1BUIC 5DYIA 5JZEB 2BBCA 2JY6B 3W68A 3JAMS 3EGRA 2KQSA 4MM3B 3U6MA 2XEWA 2B3AA 2N9KA 3CF0A 1MG8A 2Y21A 4ACFA 3P4SB 1V1PA 2WXNA 4BVUC 2QJLA 2DKLA 1BGOA 3W31A 2K9DA 5D2MB 1J8CA 4EZJA 1X9YA 2V3PA 3CF2A 1LV7A 4W9JA 1WF9A 1QDQA 4IG7B 3OVXA 3SFEB 3NY5A 4K3BA 5ITXE 1TKEA 3ZJVA 2LWPA 1I4WA 3EFUA 3L08A 5D6JB 1H4RA 1O0EA 1M94A 2DXIA 1AU2A 3CBKA 4K3CA 4PYUA 2GQFA 1GAQB 3CH3X 2INNE 3B2FA 1DOIA 3U7DA 2LMCA 3OJ3A 2DHRA 3OJ4B 1AYUA 2FS1A 2NR2A 2JZPA 1I4PA 1QOFA 2MBBB 3PLUA 3AE5B 1C1KA 3VR9B 3APDA 3KOXE 1FCLA 1WGYA 4M01A 4ICVA 1SE9A 2Z8LA 3N1ZC 5TR5A 1L2CA 3Q3MC 1XXGA 1YQ4B 3RZWC 3SASA 2AYOB 3ML8A 1V33A 4BOUA 1TDZA 2FNJB 4PP2E 3F5VA 5C1BA 3PHWB 5J18A 4QNMA 1LO5D 4G4NA 3DWGC 3N3GA 3JVZX 3Q2AC 2YQZA 1N32M 4I07A 5JZEA 2JY6A 4HJGE 2K6BA 1L2BA 2EKEC 4QAYA 1AU3A 1PE6A 2JQGR 4DV2M 1TS2A 4AZFA 3RFZB 4MM3A 4X6IA 3I9V1 4AQYM 2XZFA 2GBNA 4RKXA 3M6AA 3H6NA 4G11A 3W1YA 3GB1A 1OIPA 3AN1A 1GO5A 1ATKA 3LVWA 2LXAA 2DCBA 4OW0A 5E26A 2F5SA 2LWXA 1RYJA 1L0YB 4A3VB 1LGRA 2HE7A 2Y6EA 1PJIA 3CIRB 2BS4B 2V1YA 4ZHPA 4O1NA 1WXMA 3EC8A 2N7JA 3HHYA 1Y8GA 1WX8A 4ZRKA 2YEPB 4OVUA 3U60B 2R4EA 4MH8A 4CDFB 4NRVA 1TY0A 3KQ4A 3AEDB 2JY8A 4GUAA 1RM6C 3QAUA 2CHWA 3FRIA 7CATA 2JZ3B 1VZ7A 3U4EG 1GB1A 4I6LB 2FIDA 3AE4B 1ZAEA 4DHJB 3F92A 2LUEA 2BT6A 3NUHB 3MMPA 1ZXHA 5TSSA 4HWYA 3A4SC 1NLJA 1W5TA 2KACA 2G8LA 1FFUA 4NNJB 3B89A 3UINB 3AOEC 1TTEA 1A6RA 1YJJA 4N79A 2MJDA 2AYOA 2QQ8A 1L1ZA 5FPWA 1QZEA 1M6DA 5JH5C 4RMAA 4R71A 1XLPA 1UNSA 2DHYA 1X1MA 4AG6A 4L6V6 4FJYA 3RNEC 2WSEF 2OULA 1ENFA 5IWAM 4W5CA 4IWPA 2K0BX 4B3RM 1Q10A 5BPVA 5J94A 4AQ7A 2AQ2B 1MN3A 3R2TA 5ITYA 1TZ1A 1GNUA 4FADA 2JRIA 2R9MA 2ASQA 1FMAD 5DPWA 3J2PB 4RKUF 2GLSA 2N9EB 1CQVA 1ZMWA 1VR9A 3IEJA 3HVZA 3VFDA 1VZ6A 2F1GA 3VUXA 3HKPA 2YR0A 2R6NA 3K24A 3H9DA 1GMYA 5HG2A 4S17A 4URKA 5DCNA 4P6VF 4CDEB 2J42A 5EXSA 1CS8A 4YYUA 4TQ0A 4MZSA 5BYSA 2QBYB 1XLNA 4WQOB 3MTNA 2WU5B 2KLGA 2R2QA 3KUZA 4IUMB 2FTDA 3JSVB 1K51A 4P6GA 5EE3A 2Y20A 1VJKA 3R8FA 3ZKJC 3TPZA 4MSMB 3NWLA 1JQPA 2KNZA 4KODA 4II2B 2QHOB 1KHQA 3OLMD 3PHXB 3D8BA 2W3SA 3AB5A 3UQAA 3JW0X 2HTHA 3ZGZA 5EZSA 1MIRA 1IUEA 4RNAA 1WZ0A 3V05A 2LVNC 2HDEA 2KZUA 1C9FA 3DBRI 1QAOA 1KFVA 1Z6TA 2AEHA 2PKOA 3RNFC 2C9OA 1TY2A 5GKNA 2L76A 4LFBM 3AXCA 4YHHM 4XX5A 3PZ8A 4NAWB 1JWAD 3GRVA 1Z5BA 2Y0TA 3IG5A 2YNMD 2FIFA 3QAQA 4LF4M 3AE1B 1QYRA 1NL6A 1PVJA 2CP8A 2JY5A 1GPXA 4N4ZA 1MX0A 2DYOA 3RFWA 3VUYA 4GMQA 2Z84A 3WALA 1F2RC 4G4OA 3R3MA 3BK2A 4MGIE 1JR3A 3PV1A 4OZAA 4P6EA 3W0LB 3ECIA 4FK5A 1JWMD 2WQYB 2KDLA 1PFDA 1MJDA 1A5RA 3AE7B 4D8IA 3KS8A 3FYCA 2ZPYA 1WIVA 2NBWB 3U6EA 4HDQA 4K1RB 3OF8A 1GJTA 4I6NB 2RRUA 2D7HA 4JV5M 1JR3E 4F1IA 1EIJA 2WSCF 3U8ZA 5HKHA 2G45B 2LFIA 4YSYB 1L6UA 4IUMA 3UZUA 3JSVA 4M00A 2L32A 1V9JA 2D11A 4BKTA 1XNQM 2ZW0A 4RCOA 5FR3A 1DGBA 3T15A 1JMLA 2V4IB 2QHOA 3U6LA 2XEPA 1QLBB 1IWDA 5F02A 1YX6B 2G4SA 4DBGB 3RNAC 3HHWA 3H89A 3LXFA 4W9EA 4HEA1 4WAAA 4BFRA 3W2DA 1YT7A 1ISNA 3RNVA 4LGYA 2ZAMA 2BQQA 1YK7A 4LNKA 4GIVA 4RF0A 3K9MA 3HHMA 3PTFC 3H4JA 2JSVX 2KKCA 2PVOD 1AW7A 4X62M 5DPTA 5G5GA 3MORA 3UF8A 4B3TM 2AS8A 1V2YA 4NAWA 4GGQA 2F7DA 3NVWA 1HT2E 2CV0A 3KFUG 3CSTA 4P16A 3QCAA 1POPA 5FTMA 1HXYD 5BR8M 2NTTA 1UGJA 2LASA 1EF7A 2UU9M 1QF6A 1SBBB 1PUTA 3HZJA 2WDVB 4DV3M 3IT6B 2CRUA 1HTOA 3LYYA 3SHQA 3U6DA 4DV1M 3Q3NC 1NENB 5BMHA 3KFQA 3SHFA 1RFAA 3KUDB 3RD2A 3PXGA 1IN5A 3PSEB 2GBMA 5KQ8A 2XU4A 1S3SG 3FE3A 2A5UA 2E03A 2VQEM 1P0RA 1VRAB 2EO2A 4LCBA 5LLIA 4ARCA 1NO1A 3RGSA 1WGKA 3V60A 2D5GA 2O6VB 2QNJA 3VK7A 2ERCA 2EA0A 4JXJA 1JW9D 1STEA 2F4VM 4HKZE 1R7RA 2YLMA 3VXWA 3P1MA 4FHJA 4Q8HA 2YJ8A 3P4RB 1GJZA 1I4RA 1JRPA 4ZRQA 1IY2A 1PGAA 2VF8A 2G8EA 1ZMVA 3Q69A 4DBGA 3K9PB 1T6BX 2B76B 3MHSD 1IN4A 2PEAA 4FA6A 3A98B 2WXPA 3UGJA 4AP4C 1GECE 5EF4A 2QENA 1CQDA 2LRWA 4L2YA 2C96A 4B7FA 4XR7A 3H1UA 4IP3A 1WXVA 5CX3A 1Q5WB 3LCUA 2MWSB 5AUKA 2GOWA 3GP7A 2BVCA 2F5NA 2RMMA 1QKZA 1PPNA 2LGSA 1XCQL 1C7YA 1XCTL 3AH7A 5L83A 1NY6A 2D3GA 3WHKA 4JGHB 2WYQA 3TRKA 2ZVNA 3HHIA 1UBQA 2MH7A 2LTUA 4NXNM 2QCUA 4KIKB 3H8HA 1EWLA 2HXZA 2N0SB 2Z4SA 5JI3E 4WWPA 5MPOA 1IM2A 4B7HA 3GE3C 3FTFA 4PYZA 3PBHA 1A70A 1K3WA 3HU1A 4LNFA 5BMIA 2EJSA 2FCMA 2R9FA 2CE7A 2WX1A 1MG4A 1L0XB 4MSQB 3BBZA 2NCNA 2O6VA 3RNGC 3ZTCA 2DENB 1YUBA 2J0KA 3I01M 3KP1E 2JYEA 2LVQD 3SAUA 3I06A 2MBQA 1JQJC 4GH9A 2GBKA 3A46A 3ABVB 3N3KB 2K0PA 1OFHA 1Q6KA 1N78A 2IGGA 3QIJA 2PNSA 2MR9A 3DVNV 1FJGM 3K9PA 4JI8M 1YN3A 1SNKA 2R9NA 2Y3AA 3BYTB 4JI0M 1SEBD 2K6QA 1BXTA 2NBUA 1N36M 2HHHM 2PJHA 2NQIA 3PPAA 4B0EA 3AE2B 1OIZA 4BLCA 1V1OA 5IKCM 4QRGA 1GL7A 2HCBA 3HM6X 4AG5A 3L10B 3CH2X 3AULA 3AV8A 1PPPA 3AECB 4X64M 2HWJA 2G3QB 2Y5BB 1TH2A 4B6WA 3R7QA 4BOSA 2H88B 1CTEA 2QC8A 3BVZA 4YYSA 2Q5WD 3ZJTA 1QILA 1YSYA 2FE8A 1ZGUB 4KIKA 4GC9A 2WXKA 3QSDA 3RVVA 4IC7B 3ZC7B 1I7HA 4PT5A 2C99A 4XE0A 1MEGA 5CVOB 5BMGA 4PS7A 4ICUA 4XWWA 3IOQA 1DYQA 2MJEA 4FCTA 3C9PA 3VTUA 4P7IA 4L8RC 4Q2JA 5E6PA 4PS3A 1GC6A 1YK8A 3Q3OC 4KLNA 4LGMA 3J81S 2PLPA 1GLOA 2KWVB 2FOIC 4HXDB 4OU7A 1Q3BA 1L6VA 2MBEA 3DDCB 4WJOA 3HU3A 2DZKA 3RCZA 3BCNA 4X6JA 4DV0M 1L0VB 4IBKA 1ZDVA 4RH6A 3ZUNA 4YTPB 5L95C 4MGYE 2BWEA 2OOBA 5LMNM 1I4XA 3N3KA 5CVNB 5CHVA 3ZH9B 3SFDB 1WE6A 1D5XC 3EHVA 3FUWA 2DBYA 4MACA 4C80A 3BINA 2J4XA 2RPQA 1GABA 5GMVA 3IUTA 3AEAB 2E01A 2DWQA 5EE9A 1DGJA 2BWFA 5E6NA 5T8IA 3HUIA 1PJQA 4CHTB 1UF0A 1ZE3D 1OQYA 2EKIA 3H4MA 1L2DA 2J7QB 3W67A 1YMHE 1MFWA 3TIXA 1N34M 3MJWA 3P5WA 4CQNA 1RWSA 1NY5A 4JPSA 2WHIA 2DNAA 1LTMA 2FCSA 2WXRA 5JH3A 1CUKA 4CJ6A 3IV2A 2YEPF 3UIPB 5EXPA 1PDXA 3AE8B 2KYWA 1F0ZA 4WWOA 2ZTDA 1YN4A 2INDC 1AIMA 2SEBD 2AIMA 1EF5A 4LJ4A 3TWKA 1R4MB 4YSXB 2DX5B 3DBSA 3VFKA 3GQ4A 4LFCM 2FRQA 3E56A 1UBIA 1NB5A 2LHEA 5D94A 3RGPA 1AYVA 1F9JA 2OHFA 2KVRA 2V0GA 4HXDA 1DGFA 2R2OA 1EWMA 3DVGY 1TU6A 1TT5B 2K3UA 3W1SA 1XHBA 4MGZE 4LJ8A 1WX9A 2DAGA 1HQYE 1SXJC 4PD2A 2O01F 4E74A 3TL4X 2NQGA 1KHPA 3R9XB 4X6HA 1P98A 1FNVA 2VHSA 2BYVE 3NBXX 5CTRC 3I57A 1JB0F 4GKJM 1I42A 3W30A 5H8YE 4ZUXU 3K8ZA 1OGWA 2UUAM 2DVWB 1ZDXA 2Z0DB 2L6OA 2LHGA 3TBLD 4OVZB 4AKIA 2J7QA 1KM7A 2UUBM 3CF6E 4B9KA 2BYTA 3P5VA 3GLFB 2CWBA 1SE4A 3KW5B 3Q8EA 3T9LA 4MT5A 2DWMA 3BC3A 4I5SA 2E5LM 1VLBA 1VZ8A 3VVWB 2JUJA 3EECA 1JQ4A 4KX6B 4CGYB 4Q7JA 3FTCA 3VKHA 2UWQA 4XDDA 3V6EB 4KLBA 1WFYA 2R61A 1AYFA 3FTEA 4AXMA 1G8PA 5IZ7D 1IFYA 1SIFA 1L7YA 3W0FA 2KDIA 2NPTB 3U6PA 2HHNA 1WR1B 5JI2E 2JPHA 1Q02A 2DAIA 4GXBA 2KMCA 2DZZA 1T0QC 4TUUA 4QHSA 1G3IA 2N7DA 4AI6A 3U6SA 1KFYB 5D7GA 5C23A 1PYWD 1ZPSA 4L16A 1HZ6A 1SE2A 3PRPB 4KSKC 3S3RA 4IWOA 4DR1M 1YE9A 3GQ3A 1UUPA 2WXHA 3AE3B 1WIAA 1AIPC 4HL4A 3WAOA 3DVGX 2H7JA 2DHZA 5A2QS 3WA0A 5ITRA 5JHBA 1IBMM 3SEBA 3PO0A 3P2BA 5HHDG 1I4QA 3ZIMA 3RNCC 2NBVB 3QYBA 4ASWC 1L1TA 5ITXA 1T43A 4YY3M 4RY2A 1IN6A 3GLGB 1IQPA 3U7ZA 2KTRB 5IT9S 1KJTA 2JVCA 3DHIC 2V1CA 2Z7JA 1F1HA 1T0RC 1Z59A 3TEWA 4OVZA 2N4FA 4L1BA 1OEYA 4IM0A 4LJPB 1HNZM 1MHHE 4JYAM 4IBDA 4QHTA 3GLFA 5AZGA 1CJEA 1J7BA 3OG5A 2E02A 5FR6A 3H6SA 3O65A 4G54A 4FN2A 4DR6M 2K22A 3N4CA 2CHGA 1P3QQ 3CGWA 3KVWA 3PZ7A 1ZMUA 4P17A 1U9VA 3NRZA 3LDZE 2R6FA 4FLHA 2BYFA 2HD5B 4LTUA 1Z5CA 3GLFE 3V6EA 2JY7A 1EU4A 2KWCA 3H7SA 2L05A 1NDDA 3VLFB 1Q1OA 2O2VA 1PCIA 2CHQA 3LJ3A 2X49A 1IPGA 3A42A 2NPTA 4DUYM 2RR9A 1WR1A 3K8UA 1L2NA 3K2LA 3GP1A 3Q3FA 2EELA 2K39A 1NPZA 2JWUA 1SJED 3KXEC 2G1EA 3LCVB 1XEEA 2M17A 4BBNC 1TKYA 1V49A 3PRPA 1C77A 1M4VA 2IO0B 3E4RA 4EUTA 2V3SA 4X65M 1AU4A 2XGNA 3PDFA 3EIHA 4HLQA 5LNK1 2DZOB 2IJ0A 3B1LX 4LZZA 1FD6A 2VRRB 2LVOA 3KOZE 3R66C 5FK9C 3A1QB 1PGXA 2KTRA 2CV2A 1OTRB 4EFOA 1S4VA 1QAMA 1PJTA 1AWDA 1C4PA 1TLOA 4AKGA 3AI5A 3GPXA 1AARA 1ICFA 1SGHA 3SARA 3Q8GA 4AS1A 3MC8A 3GLGE 2XSZA 1NBFC 3PREA 3RMKC 3PNVA 3W5UB 4LJ9A 2KFKB 2FFJA 1K53A 2G7YA 1DGHB 3OISA 1DO0A 5FTNA 2AU1A 4DV7M 4FJCA 1WM3A 1V86A 3KSEA 2ACZB 2K8CA 4B95A 1GG3A 2HD5A 2INCC 1WGLA 2UYZB 4QRVA 3HM3A 4DDID 1C3TA 4DR7M 1WHCA 4M0WB 4MGKE 2PE6B 2EKKA 2DZNB 1KFUL 2RGOA 4XZ4A 3BPMA 3GQ5A 3MHHA 2PIAA 1VSNA 3ZDTA 2JUOA 4A6QA 4JIOU 4EZKA 4AOFA 4IBGA 4HPLB 2I1JA 3BWKA 5E6OA 1PXVA 3QJ3A 3D32A 3Q3JA 1N75A 2FRAA 3QARA 2FYEA 3PHWA 3H7PB 1R4NB 1OQQA 1RRBA 1LFDA 1EE8A 4DWFA 2D7EA 5EGWA 3IFWB 3ZRCA 4BS5A 2J7OA 2EKFA 3J80S 1NI3A 2IY1B 4RM8A 3L2AA 1YN5A 3PFIA 3AEEB 3WANA 2KT7A 4DXFA 1CB5A 2LHCA 2M19A 5I4DA 2JRHA 1VDDA 3AOGA 2VQFM 1J7CA 1C79A 1KF6B 2WU2B 2LJ5A 1MS6A 4L23A 3K92A 1FEHA 4ZYNA 5BYRA 3SYKA 1UWXA 3D8LA 1HT1E 4JI7M 1X37A 4LF5M 4TQ1A 1VCBA 1OTRA 2DC9A 4ANVA 1WGHA 1SE3A 2NS5A 3TEZA 2PTLA 3TWMA 2MCNB 2MSED 4M0DA 2F5QA 2MJ5B 4S12A 2KOXA 2LH0A 1FXTB 1DOXA 2RSUA 4M9SA 5LMUM 3UI3A 2P86A 9PAPA 3U60A 2P5TA 3FD9A 3SMPA 3T8MA 2XF3A 1PADA 2KFKA 3QJZA 1DGHA 3ZW3A 3AL0C 4A8XC 2FCQA 3KWBX 4EIWA 2KXJA 3AEGB 3IG3A 3P42A 1ESFA 2WDQB 1QQRA 2TSSA 3T1YM 5KO3A 3ZDMC 4ZRPA 1D0MA 3MHSA 3NHEB 4OX9M 2Z4RA 3SYLA 1WXSA 4M9XA 2KRKA 1Q39A 1VQ1A 1TS3A 1WYWB 2ATOA 3KX1A 1P1AA 1B1ZA 1I4GA 3M7GA 4KO8A 2BB6A 3IVFA 3WAMA 4BSQA 1HEZE 1XD3B 2QP9X 1OFIA 3H7PA 2MX2A 1E8XA 4D8BA 2O5RA 3E21A 1MDWA 3EFCA 1SIJA 2K9XA 1ZCMA 2CU3A 4RGNA 2Z8YM 1HUCB 2W9NA 1RLFA 2JU6X 4XGAB 4GEWA 4TV3A 1GKIA 3GZNB 2L7IA 3W5VB 4A9AA 3C8YA 3MP9A 2CIOA 3PHUA 2R0IA 1Z5AA 3CMMB 3K9OB 2DI0A 2OEDA 3AE6B 3T3OA 2QBYA 3LQQA 1R7SA 4WIPA 4CDDB 5KQDA 1K50A 3HY5A 4NZLB 4FCWA 4JI4M 2C60A 2LVQA 2LGIA 2JWZA 1R4MI 2HWKA 1Y4HA 4IW0A 5FTKA 4W5BA 3ZXRA 3PHXA 3GS2A 4ZRIA 2I2YA 3TJPA 3APCA 2M0AA 3NHEA 4US9A 2KDBA 4BBNF 2Z3XA 3WAPA 4OELA 2CS4A 2IY0B 2JX5A 3BOSA 1V5TA 2CFOA 1GUAB 1SG9A 1NV8A 3MJ5A 3AE9B 4YT0B 3RYTA 4YV8A 4C4VB 2DYMA 2KLCA 1GLNA 4Z6YA 2OP3A 1NYQA 1R2YA 3N1XC 3JYUA 2O25A 4GDKB 4M9ZA 4DDGD 4HVBA 1WMHB 3NBIA 5DPSA 2XZUA 3AV0A 2L83A 2RDHA 2RGFA 3FYDA 3MC9A 4BKGA 4XK8F 3AMZA 1P7FA 4K7CA 3IECA 1CJLA 3WXGA 2VH2A 2K6DB 3UIOB 1ZIVA 3BK1A 5KHOA 4YYVA 1BVSA 2KJHB 2LEKA 3L28A 3ZNGC 3IG8A 2VZKD 3RN9C 2F5OA 3GLHB 3TQSA 3VDPA 1THEA 2DAFA 1MJGM 2PMVA 1J19A 1FPYA 4GLSC 2MEKA 2FT2A 3KW9A 3B74A 3I04M 1WJUA 1WY8A 3RE8A 4I81A 3R8BA 3V6CB 4WH4A 3ZLZA 2LBCA 2GRIA 3OTOM 3FUVA 1P7EA 3NG0A 2WGSA 4W9FA 2WS3B 3TEYA 3ZXVA 2N1WA 3QT4A 1NJFA 1WJNA 3IMAA 1JWUD 1VEKA 3OQCA 3KWVA 3HHZA 4DQOC 1VDLA 1QOGA 3PZDA 1WJ4A 2V1UA 1E7UA 2KMAA 5IREB 4ARIA 5IO9A 3URYA 1NVID 1DOYA 2R4JA 3BY4B 1XQQA 1U4AA 3HVDA 3C3DA 3ZQ4A 3B2GA 3SFZA 3EIEA 1R5LA 4W9DA 4MI7A 4PDGA 2W3RA 1SB3C 1QDRA 4L4UA 5L8RF 1FM0D 3B7ZA 2GHUA 4BB9A 5BYQA 2M1MA 1XF5L 4HEOA 2D3AA 1WRDB 3DCGA 3QYEA 1ZXIA 4GDKA 4ZHOA 2D2QA 1G4AE 4IBCA 4KDIC 1OAIA 3WHLA 2KHWB 1D3ZA 1NVMA 1XXHB 2D3BA 2BYEA 3F75A 1TGZB 1F2BA 4GHAA 3AU4A 3KWZA 4N58A 2BS2B 2MBOA 2AHMA 2RGHA 5FTLA 4B08A 3L27A 4FD2A 2IGDA 4HJKA 1UM8A 3BXWA 1IBKM 4W9CA 4LF8M 2K5PA 2N7EA 2B1MA 2G8JA 4DV5M 3RVWA 1QAQA 3ETRA 1NSFA 1KRHA 4DXGA 3PSEA 2ONQA 4YVAA 3M0EA 3KKUA 1IBLM 4WA6A 5J2RA 2V9HA 3NJTA 1A5TA 4K7WA 4YYWA 4XWTA 3GLHE 3DFZA 1FXIA 2WNMA 2BF8B 2GI9A 2VIIA 3LXSA 2KVZA 2JWSA 1YZBA 1DO2A 4HK2A 2QIEB 4BKSA 1WRIA 1K82A 2KC1A 1E10A 2LGYA 2E3TA 1D0KA 2HL7A 3IHPA 2G4DB 3VH4B 1LQBA 2QDFA 4ZYSA 1CPJA 4W9IA 4ITKA 3BYYB 3FILB 4XYCA 3JR5A 2ZNVB 3FUTA 3BY4A 1EU3A 1WXAA 4C56C 3WCQA 1E5WA 4US8A 5G5HA 3M95A 2ZVOA 2G6DA 2MROB 1GB4A 3SD5A 3HU2A 1CV8A 1EWCA 2LNHC 1NB3A 2WXGA 4F2LA 3L16A 4G6ZA 4M8MA 2DC6A 1ORYB 4LRTA 4MH0E 1KXRA 3VQIA 4GDLB 1IBXB 2DCCA 1HQCA 4KHPM 3HJQA 3U5ZB 4IJEA 2I7NA 1TS4A 3I5JC 3VTVA 4B0MA 3SAWA 3IBEA 4KVGB 2DC8A 4FWGA 2UZJA 4ANWA 3DHGC 2QILA 1FCCC 3VKGA 4AJYB 4EOYA 1PBHA 1NNJA 4LF7M 3SBJA 2BWES 3B0AA 1XXHE 3VRAB 3VTWA 3TUOA 1NI2A 3U2SC 1T3TA 3VK8A 1E7PB 3HGIA 3P5UA 3KH0A 1SXJE 4BBAA 3U61B 4KGRA 1RU3A 2R18A 4MSXA 2RKOA 1FH0A 3FUXA 3X23A 2GNOA 2GBRA 1E8YA 2MH8A 2JTCA 3APFA 1TS5A 2DENA 1UFZA 1TF0B 2QZ4A 1PJJA 1NV9A 3LB8C 2CHZA 2KWDA 4W9KA 1ZV1A 3GRRA 3MHVC 1KTKA 3QHTA 5AUIA 1E8WA 1WGDA 1FFVA 5E6JA 1YLAA 1TBEA 3HHAA 2DZYA 2OQ4A 4JE3B 1TKGA 1R4NI 4RM9A 5J17A 5JA7A 1KYIA 1UWMA 1K52A 3KOYE 2BW2A 2KN4A 2KWUB 4NY0A 1DV0A 3FILA 4AJWA 1AUAA 4KGTA 2OJRA 3VUWA 2C9CA 2GB1A 2LZ6A 2IBIB 3GRYA 1IP9A 1XC8A 2ZTCA 4JX1C 5FKAC 3AI8A 1UELA 2X4AA 2K8BA 2L1AA 3FRHA 3GPPA 2G3QA 3DBHB 3ILKA 1IXSB 1GVNA 2L2DA 4GDLA 2Y5BA 3U5ZA 2V6ZM 1FRDA 2KMMA 4DMYA 4NL4H 4MGHA 4HROA 3ZNID 3FUUA 1CVZA 5DYGA 1JRUA 1EWYC 2QMTA 1OQRA 2XN9C 3TEXA 2BDZA 2LGDA 4NQKE 4NSRA 2QSDA 1PGYA 1MHXA 1DKIA 5C3JB 3CBJA 4GU2A 3RPFC 4KSLC 2IO2B 2M0XA 1ME4A 2XLJA 3UJNA 4M02A 4CIZA 1K8RB 4NOOB 4F8CB 2JF5A 4S0RA 4CZWA 1VEJA 2PE9A 3PS6A 2QEJC 1B9RA 3FKEA 3PRMB 2YJ2A 1MEMA 1FXAA 4EE2A 2FO5A 1T0SC 2Q2EB 2JQRB 4AUQC 1Y08A 2IPPB 1ACCA 4XZXA 4DMXA 4IWQA 1NHGC 2ON8A 3J9CA 3RZFA 2AX5A 4JI3M 4JN6A 1C1YB 1KLVA 5ITQA 2C0YA 2M8SA 2ZW1A 4A3OA 2HJ1A 2L0FA 2MBHA 2DLBA 2R65A 4DV4M 4JWUC 1MHWA 1JROA 4IIWA 2V4LA 1H6UA 4WURA 3DPDA 1U9QX 2L52A 3P4QB 2XFTA 4W5WA 1AECA 2JZ0A 4LNIA 4BOSC 3GPYA 1OAOC 3VAWA 3ML9A 2A4ZA 2DAKA 3M3JA 2IBIA 4K0KM 3E1ZB 1V80A 3N20C 4K7UA 4LY6A 1HQRD 3GZNI 2LXCA 2KRUA 1KH0A 4HCNB 4ZDVA 1QXPA 2FQ9A 1UGMA 2DYBA 1D6EC 4IBIA 2C5RA 3LQRA 4GHLA 1V1PB 3RI7C 4BPVA 4AKHA 2A5YB 2ZCBA 1YJ1A 1Q3CA 1FIQA 2N1VA 4IDIA 4TUWA 2FBWB 3PW3A 2ZAOA 3A4RA 4TKNA 2V3NA 1SXJD 3KS4A 2KZRA 2L00B 1KFXL 4CHKA 1HR0M 3M99A 4WW0A 3DWMA 3ZO5B 3WXFA 2JNHA 5LXHA 1SP4B 2WP9B 2PADA 2AL6A 1FRRA 1XLQA 2BWBA 1IY0A 1IN8A 3C3EA 2KX3A 1S1QB 2OJWA 2REXA 3AEFB 2DZLA 2MA9B 2CHXA 3J7AS 5CHVC 3KSJA 2BPSA 3B7NA 2APLA 1HTQA 4IBFA 1XMQM 4JWSC 4D80A 1CSBB 4CDCB 1YVBA 4YWGG 1I4HA 2ZBKB 4LJ5A 4I04A 2KNBA 3ZJUA 4EEWA 1FNUA 4LJ7A 3TCAA 1PIPA 2AGAA 1QZMA 3TNXA 3P5XA 3S2AA 2CV1A 1OKSA 1LXDA 1TIFA 4A20A 4Y28F 1JWBD 4TMAB 2CJNA 5EP4A 5IN7A 3QWZB 1ZUD2 1TYGB 4XGIA 4DR5M 3L26A 2QPAA 1YQBA 3AOEA 4NJ7A 3AFHA 3Q8BA 1MU5A 2UXCM 1G41A 2G5GX 1YQ3B 4NAMA 5DPRA 1AYWA 4KKIA 4LNNA 4EZLA 2AUZA 4HWIB 2NQ8C 2RD0A 3PGEA 4FXCA 4KZCA 4DUZM 1GL6A 1CZPA 2WXJA 3L25A 1PPOA 1U9XA 3THGA 3GCBA 2KJRA 4ANRA 1TJEA 1J09A 4D2KA 4QOSA 3J7BA 3UQBA 4QOZC 2VDBB 3IT4B 4HRSA 4II3B 2YJBA 3I3TB 2WX0A 1D5MC 2DCAA 5G55A 2XFSA 4FCVA 1ROEA 2KDFB 5EJCA 1NHWC 2KQ4X 4D82A 1KOTA 2OO9A 2ACTA 2X8XX 2IZVB 4FWHA 1L5PA 2OPFA 4GOCA
chains in the Genus database with same CATH topology
4JI2M 3MFGA 1C76A 2BTEA 2BU3A 1ET6A 1N77A 2UXDM 2MJ3A 3VDUA 5H37D 2D7GA 2CEAA 1V8CA 1MVKA 1N63A 2AQ1B 4G4QA 2WXLA 1C78A 2J7QC 1R6BX 2FUG1 4REZA 4GC5A 3GLGA 2VZKB 2LJIA 2DWLA 5EQTA 4BOPA 3GO8A 1L4ZB 1N5WA 3MHZA 3U6QA 1T3QA 3CTWB 1E9RA 2KXEA 4UDUC 1E9SA 1NEKB 1EM7A 3U6OA 4DR4M 3TE6A 2IGHA 3DA1A 4I4LA 2F5PA 4DR3M 4A55A 5EE1A 3DZDA 3SAVA 2L7HA 3HJ8A 1FNWA 4B3MM 3TMPA 3R2IA 3I4YA 3ZNHA 2CUZA 4FWDA 1ET9A 1ZQ9A 4B7GA 2KA6B 1PGBA 4A90A 4NRWA 1SXTA 4RGOS 4C7YA 8CATA 4BOZA 1BMLC 2DWZB 4JI6M 2PW9A 3Q8FA 5ITTA 1J5EM 3VRBB 3PT2A 2EUCA 1L4DB 2PVGC 2C98A 3I4VA 3KDSE 4RF1A 1MI0A 4M0WA 3EUB2 3KSXA 4RFBA 4G4RA 2W55A 4XBOA 3BBAA 2HTME 1IXZA 2ZM6M 1JALA 1R2ZA 3AEBB 4C7ZA 3P63A 1L8QA 1S3SA 4N59A 1TZOA 1XNRM 2WDRB 2DOSA 1E0ZA 1YJIA 1TH3A 3NVVA 4I8OA 4AW4A 3GRUA 4LF6M 4Z8XA 3IXSA 2LUMA 3N9YC 1AN8A 1Y56A 3UMMA 2LHDA 2I7PA 3HJSA 3Q8XA 5ITUA 5KPTA 4FW9A 2J7NA 2XSZD 4A5UA 1UKFA 1OJLA 2Y0QA 3PVSA 4OZBA 2KAJA 4PCZA 1VDVA 2BS3B 5GXGB 4QNRA 4ZOHC 1DGGA 4RGTA 2CHVA 1SF0A 4MB7A 4HKQA 1E32A 1QANA 3B9JA 4CISA 1RFKA 5HI1A 1NNUC 3V3XA 5D3IB 4OZCA 4NXMM 4IOIE 2KW0A 4JI1M 3B21A 3K1JA 4H2AA 3NS1A 2Y5CA 2N9LA 3AM9A 4TSSA 3MK6A 4R7GA 4KGSA 3SC3A 5EE0A 1I94M 4USAA 5C18A 1G59A 2XNAC 3LMMA 5EXXA 4J3OD 3NZ3A 2WXQA 4YXDB 1XLOA 5FSWA 3L29A 2IPKD 3UK6A 2X8AA 4XDCA 3ZCBB 3QWLA 3BWUD 3LVVA 4D81A 1J7AA 4LJ6A 4ITQA 3PNYA 4II7A 1QT9A 1NYRA 1XO3A 2BTWB 4GRIA 4YTMB 4IBBA 1F77A 3P4PB 1SXJB 4JI5M 1HNWM 2UXBM 3SATA 3JR4A 5KPRA 3IFUA 1HA5A 4LZJA 3Q8CA 1WXQA 1KLGD 4N6EB 2R45A 3GLHA 1HNXM 1YNTE 1KLUD 1F2RI 2WXOA 4YTNB 4IKGA 2Y5PA 1FNNA 3HHXA 1SSNA 4LK0M 2M60A 3MP2A 1ZP0B 3HWSA 4ZTBA 1K3XA 2J52A 1JR3D 4DV6M 1TDHA 3KW6A 1W5SA 2M56B 5H92C 1N5XA 2KZSA 2R62A 1MPEA 3TSSA 1IN7A 4X66M 1C4CA 5JXVA 3SMSA 3NVYA 3DOAA 4IBJA 3HRDD 5HFYA 3B9PA 4IJFA 1E6EB 2BTWA 1N33M 3KWLA 1XXHA 1N62A 3AJIB 1NJGA 5EZQA 1D4BA 3GPUA 4YSZB 1SXJA 2R46A 5EXTA 4LRSA 3GLIB 2I38A 3BIID 2W82A 4B3SM 1OFFA 5F3WA 4L15A 2NMQA 4BOQA 1KSFX 3IAM1 4NJCA 4D8EA 1C4AA 2X38A 3SHGB 3KOWE 1WWTA 3U6CA 3ZYYX 3C58A 1J7KA 3BB7A 4LLGM 2KEBA 4NSOB 2JA2A 2DWNA 3KP0E 5C2TB 4WWMA 3NVZA 2WLBA 3KLSX 2H89B 1XMOM 1SJHD 1GOZA 2WXIA 1IBXA 2BNKA 2ZANA 1IGCA 4DR2M 1HZ5A 3MTVA 3VR8B 5EP2A 2BJWA 2WXMA 2H1RA 4LFAM 2RDGA 3GLIA 1IY1A 4IBEA 3T1HM 4PDIA 1QOAA 1D2NA 5EP3A 2IDYA 4GKKM 1WYGA 3EA6A 2BJVA 3U61A 2JYTA 3BVMA 3IAS1 2KDMA 5FTJA 3FTDA 1QVRA 2YFQA 4OHJA 3SR6A 1QQWA 3L4PA 2LXEA 1E9MA 2E6XA 2NTSA 3I51A 2UUCM 3FC4A 3C0RA 3A45A 1N61A 2FNAA 5FLXS 3T3NA 1IXRC 4FVMA 2WXFA 5DNYA 3CWIA 4GIPA 3MC0B 4ZPXA 2INPE 3BZDB 2SAKA 4R3DA 1E94E 2M5ZA 3AKZA 3T38A 5D3DA 2JXTA 1WSPA 4LJAA 1TGUA 2K47A 1N60A 3BVGA 1D5ZC 3U52E 2G9HD 3TWLA 2W54A 4KKJA 2RPVA 1JWSD 3O13A 4LF9M 2AQ3B 2J53A 4GITA 3E9SA 5KPZA 1QOBA 2BB5A 1V97A 1CK1A 3J27B 1ZOYB 1PM5A 1TH4A 3OWEB 3PRMA 2ICIA 4RGMA 2CJOA 4WAFA 2L09A 2HKJA 4LG2A 3FAHA 3Q8AA 1IGDA 1XWIA 1T5XD 2XH9A 4WQMA 1FO4A 5EP1A 3W9CB 1JCKB 4L78A 1BUIC 5DYIA 2BBCA 3JAMS 3EGRA 4MM3B 3U6MA 2N9KA 3CF0A 2Y21A 3P4SB 1V1PA 2WXNA 2QJLA 3W31A 2V3PA 3CF2A 1LV7A 3SFEB 5ITXE 1TKEA 3ZJVA 1I4WA 2DXIA 1GAQB 2INNE 3B2FA 1DOIA 2LMCA 2DHRA 2JZPA 1I4PA 1QOFA 3AE5B 1C1KA 3VR9B 3KOXE 1FCLA 2Z8LA 1L2CA 1XXGA 1YQ4B 3SASA 4BOUA 1TDZA 5C1BA 4QNMA 1LO5D 4G4NA 3DWGC 2YQZA 1N32M 5JZEA 4HJGE 1L2BA 4DV2M 1TS2A 4AZFA 3RFZB 3I9V1 4AQYM 2XZFA 4RKXA 3M6AA 3GB1A 3AN1A 3LVWA 4OW0A 5E26A 2F5SA 2LWXA 1RYJA 1L0YB 4A3VB 1PJIA 3CIRB 2BS4B 4ZHPA 4O1NA 2N7JA 3HHYA 2YEPB 3U60B 2R4EA 4MH8A 4NRVA 1TY0A 3KQ4A 3AEDB 4GUAA 1RM6C 3QAUA 7CATA 1VZ7A 3U4EG 1GB1A 3AE4B 1ZAEA 5TSSA 2BT6A 3NUHB 1ZXHA 1W5TA 2KACA 2G8LA 1FFUA 3AOEC 1YJJA 2MJDA 1L1ZA 1XLPA 1UNSA 4AG6A 1ENFA 5IWAM 4B3RM 1Q10A 5BPVA 4AQ7A 2AQ2B 3R2TA 5ITYA 2JRIA 1FMAD 3J2PB 1CQVA 1VR9A 3HVZA 3VFDA 1VZ6A 3HKPA 2YR0A 5HG2A 4P6VF 2J42A 5EXSA 4TQ0A 5BYSA 2QBYB 1XLNA 2WU5B 1K51A 5EE3A 2Y20A 1VJKA 3R8FA 3TPZA 3NWLA 4KODA 3D8BA 2W3SA 3AB5A 3ZGZA 5EZSA 1IUEA 4RNAA 3V05A 2HDEA 2KZUA 1C9FA 1QAOA 1KFVA 1Z6TA 2PKOA 2C9OA 1TY2A 5GKNA 4LFBM 4YHHM 3PZ8A 4NAWB 1JWAD 3GRVA 1Z5BA 2Y0TA 3IG5A 2YNMD 4LF4M 3AE1B 1QYRA 1PVJA 1GPXA 1MX0A 2DYOA 3RFWA 4GMQA 2Z84A 1F2RC 4G4OA 3BK2A 4MGIE 1JR3A 4OZAA 3W0LB 1JWMD 2WQYB 1PFDA 3AE7B 4D8IA 3KS8A 3FYCA 3U6EA 2D7HA 4JV5M 2LFIA 4YSYB 1L6UA 4IUMA 3UZUA 2L32A 1XNQM 2ZW0A 4RCOA 5FR3A 1DGBA 3T15A 1JMLA 2V4IB 3U6LA 2XEPA 1QLBB 3HHWA 3LXFA 4HEA1 3W2DA 3RNVA 4LGYA 2ZAMA 4RF0A 2JSVX 2PVOD 1AW7A 4X62M 5G5GA 4B3TM 3NVWA 1HT2E 2CV0A 3KFUG 4P16A 5FTMA 1HXYD 5BR8M 2NTTA 1UGJA 2UU9M 1QF6A 1SBBB 1PUTA 2WDVB 4DV3M 3IT6B 3LYYA 3U6DA 4DV1M 1NENB 5BMHA 3SHFA 3PXGA 1IN5A 5KQ8A 2VQEM 1VRAB 4ARCA 2EO2A 4LCBA 3RGSA 1WGKA 2D5GA 3VK7A 2ERCA 2EA0A 4JXJA 1JW9D 1STEA 2F4VM 4HKZE 1R7RA 3P1MA 3P4RB 1I4RA 1JRPA 4ZRQA 1IY2A 1PGAA 3Q69A 1T6BX 2B76B 1IN4A 3A98B 2WXPA 3UGJA 2QENA 4L2YA 2C96A 4B7FA 4IP3A 5AUKA 3GP7A 2F5NA 2RMMA 1QKZA 1XCQL 1XCTL 3AH7A 1NY6A 3WHKA 3TRKA 2MH7A 4NXNM 2QCUA 3H8HA 2N0SB 2Z4SA 5JI3E 5MPOA 1IM2A 4B7HA 3FTFA 1A70A 1K3WA 3HU1A 5BMIA 2CE7A 1L0XB 1YUBA 3KP1E 2JYEA 3SAUA 1JQJC 4GH9A 3A46A 3ABVB 2K0PA 1OFHA 1N78A 2IGGA 1FJGM 4JI8M 1YN3A 2Y3AA 3BYTB 4JI0M 1SEBD 1BXTA 1N36M 2HHHM 4B0EA 3AE2B 4BLCA 1V1OA 1GL7A 2HCBA 4AG5A 3AV8A 3AECB 4X64M 1TH2A 4BOSA 2H88B 3BVZA 2Q5WD 3ZJTA 1QILA 1YSYA 2FE8A 4GC9A 2WXKA 3ZC7B 1I7HA 4PT5A 2C99A 4XE0A 5BMGA 4XWWA 1DYQA 2MJEA 4FCTA 4L8RC 4Q2JA 4KLNA 4LGMA 3J81S 2PLPA 2FOIC 4HXDB 4OU7A 1Q3BA 1L6VA 3HU3A 4DV0M 1L0VB 4IBKA 1ZDVA 4RH6A 4YTPB 4MGYE 5LMNM 1I4XA 3ZH9B 3SFDB 1D5XC 3FUWA 2DBYA 4MACA 4C80A 2J4XA 3AEAB 2DWQA 5EE9A 1DGJA 5T8IA 3HUIA 4CHTB 1ZE3D 2EKIA 3H4MA 1L2DA 1YMHE 1N34M 4CQNA 1RWSA 1NY5A 4JPSA 2WXRA 2YEPF 5EXPA 1PDXA 3AE8B 1F0ZA 1YN4A 2SEBD 4LJ4A 3TWKA 4YSXB 3GQ4A 4LFCM 3E56A 2LHEA 3RGPA 2OHFA 2V0GA 1DGFA 2K3UA 3W1SA 1XHBA 4MGZE 4LJ8A 1HQYE 1SXJC 4PD2A 3TL4X 3R9XB 1FNVA 3I57A 4GKJM 3W30A 5H8YE 3K8ZA 2UUAM 2DVWB 1ZDXA 2L6OA 4OVZB 4AKIA 2J7QA 2UUBM 3CF6E 2BYTA 3GLFB 1SE4A 3Q8EA 4MT5A 2DWMA 4I5SA 2E5LM 1VLBA 1VZ8A 1JQ4A 4KX6B 4CGYB 3FTCA 3VKHA 4XDDA 2R61A 1AYFA 3FTEA 1G8PA 5IZ7D 3W0FA 3U6PA 5JI2E 4QHSA 1G3IA 4AI6A 3U6SA 1KFYB 5D7GA 1PYWD 1ZPSA 4L16A 1HZ6A 1SE2A 4DR1M 1YE9A 3GQ3A 1UUPA 2WXHA 3AE3B 4HL4A 5A2QS 5ITRA 1IBMM 3SEBA 3PO0A 5HHDG 1I4QA 1L1TA 5ITXA 4YY3M 1IN6A 3GLGB 1IQPA 3U7ZA 5IT9S 2V1CA 2Z7JA 1Z59A 3TEWA 4OVZA 4L1BA 1HNZM 1MHHE 4JYAM 4IBDA 4QHTA 3GLFA 1CJEA 1J7BA 3O65A 4DR6M 2K22A 2CHGA 3KVWA 3PZ7A 3NRZA 4LTUA 1Z5CA 1EU4A 3VLFB 2CHQA 2X49A 3A42A 4DUYM 3K2LA 3GP1A 2EELA 2JWUA 1SJED 3KXEC 2G1EA 1XEEA 1TKYA 3PRPA 1C77A 1M4VA 3E4RA 4X65M 2XGNA 3EIHA 4HLQA 5LNK1 2DZOB 2IJ0A 4LZZA 1FD6A 3KOZE 5FK9C 1PGXA 2CV2A 1QAMA 1AWDA 1C4PA 4AKGA 3GPXA 3SARA 4AS1A 2XSZA 3PNVA 3W5UB 4LJ9A 2FFJA 1K53A 1DGHB 1DO0A 5FTNA 4DV7M 2ACZB 4DR7M 4MGKE 2DZNB 2RGOA 3GQ5A 2PIAA 4A6QA 4IBGA 1N75A 3PHWA 1OQQA 1EE8A 2D7EA 2J7OA 3J80S 1NI3A 3L2AA 1YN5A 3PFIA 3AEEB 4DXFA 2M19A 5I4DA 1VDDA 3AOGA 2VQFM 1J7CA 1C79A 1KF6B 2WU2B 4L23A 3K92A 1FEHA 5BYRA 3SYKA 1UWXA 3D8LA 1HT1E 4JI7M 1X37A 4LF5M 4TQ1A 1SE3A 3TEZA 2PTLA 3TWMA 4M0DA 2F5QA 4S12A 2LH0A 1DOXA 4M9SA 5LMUM 3UI3A 3U60A 2P5TA 3FD9A 3SMPA 2XF3A 1DGHA 3AL0C 4A8XC 4EIWA 3AEGB 3P42A 1ESFA 2WDQB 1QQRA 2TSSA 3T1YM 5KO3A 4ZRPA 4OX9M 2Z4RA 3SYLA 4M9XA 2KRKA 1Q39A 1TS3A 1B1ZA 1I4GA 3M7GA 4KO8A 2BB6A 1HEZE 1OFIA 2QP9X 4D8BA 2O5RA 1SIJA 2K9XA 2CU3A 4RGNA 2JU6X 1GKIA 2L7IA 3W5VB 4A9AA 3C8YA 3MP9A 3PHUA 1Z5AA 2OEDA 3AE6B 3T3OA 2QBYA 3LQQA 1R7SA 4WIPA 5KQDA 1K50A 4NZLB 4FCWA 4JI4M 2LGIA 2HWKA 5FTKA 3PHXA 3GS2A 2I2YA 2M0AA 4US9A 2Z3XA 2JX5A 3BOSA 2CFOA 3MJ5A 3AE9B 4YT0B 2DYMA 1GLNA 4Z6YA 1NYQA 1R2YA 4GDKB 4M9ZA 3NBIA 2XZUA 3AV0A 2L83A 2RDHA 3FYDA 3AMZA 1P7FA 3BK1A 2LEKA 3L28A 3IG8A 2VZKD 2F5OA 3GLHB 3TQSA 3VDPA 2PMVA 4GLSC 2MEKA 3RE8A 4I81A 3R8BA 4WH4A 2GRIA 3OTOM 3FUVA 1P7EA 2WS3B 3TEYA 1NJFA 1JWUD 3OQCA 3KWVA 3HHZA 4DQOC 1QOGA 2V1UA 5IREB 4ARIA 3URYA 1NVID 1DOYA 2R4JA 3HVDA 3ZQ4A 3B2GA 3SFZA 3EIEA 4MI7A 4PDGA 2W3RA 1SB3C 4L4UA 1FM0D 4BB9A 5BYQA 1XF5L 1ZXIA 4ZHOA 1G4AE 4IBCA 3WHLA 1NVMA 1XXHB 4GHAA 4N58A 2BS2B 2AHMA 2RGHA 5FTLA 4B08A 3L27A 4FD2A 2IGDA 1UM8A 1IBKM 4LF8M 2K5PA 4DV5M 1QAQA 3ETRA 1NSFA 1KRHA 4DXGA 3PSEA 2ONQA 3M0EA 1IBLM 4XWTA 3DFZA 1FXIA 2WNMA 2GI9A 2VIIA 1YZBA 1DO2A 2QIEB 1WRIA 1K82A 1E10A 2E3TA 2HL7A 4ZYSA 4ITKA 3BYYB 3FILB 3JR5A 3BY4A 3FUTA 1EU3A 4C56C 3WCQA 4US8A 5G5HA 1GB4A 3HU2A 1EWCA 2LNHC 2WXGA 4G6ZA 1ORYB 4LRTA 4MH0E 3VQIA 4GDLB 1IBXB 1HQCA 4KHPM 3HJQA 3U5ZB 4IJEA 2I7NA 1TS4A 4B0MA 3SAWA 4FWGA 2UZJA 2QILA 1FCCC 3VKGA 1NNJA 4LF7M 3SBJA 3VRAB 3TUOA 3U2SC 1T3TA 3VK8A 1E7PB 3HGIA 1SXJE 4BBAA 3U61B 4KGRA 2R18A 2RKOA 3FUXA 2JTCA 1TS5A 1PJJA 2QZ4A 3LB8C 2KWDA 3GRRA 3MHVC 1KTKA 5AUIA 1FFVA 5E6JA 2OQ4A 4JE3B 1TKGA 1KYIA 1UWMA 1K52A 3KOYE 2BW2A 2KN4A 3FILA 4KGTA 2C9CA 2GB1A 3GRYA 1XC8A 4JX1C 5FKAC 2X4AA 2L1AA 3GPPA 3ILKA 1IXSB 1GVNA 3U5ZA 2V6ZM 1FRDA 2KMMA 4NL4H 4MGHA 4HROA 3FUUA 5DYGA 1EWYC 2QMTA 1OQRA 2XN9C 3TEXA 4NSRA 2QSDA 1MHXA 1DKIA 5C3JB 3RPFC 2XLJA 3UJNA 4NOOB 2QEJC 1B9RA 3FKEA 1FXAA 4EE2A 2Q2EB 2JQRB 4XZXA 1ACCA 1NHGC 2ON8A 3J9CA 2AX5A 4JI3M 4JN6A 5ITQA 2ZW1A 2DLBA 2R65A 4DV4M 4JWUC 1JROA 4IIWA 1H6UA 4WURA 2L52A 3P4QB 2XFTA 4W5WA 3GPYA 4K0KM 4LY6A 1HQRD 2KRUA 1KH0A 1D6EC 4IBIA 2C5RA 3LQRA 4GHLA 1V1PB 4AKHA 2A5YB 1Q3CA 1FIQA 4IDIA 4TUWA 2FBWB 2ZAOA 2V3NA 1SXJD 3KS4A 1HR0M 4WW0A 3DWMA 2WP9B 1FRRA 1XLQA 1IY0A 1IN8A 3AEFB 3J7AS 3KSJA 4IBFA 1XMQM 4JWSC 4D80A 4YWGG 1I4HA 2ZBKB 4LJ5A 3ZJUA 1FNUA 4LJ7A 2AGAA 1QZMA 2CV1A 1JWBD 4TMAB 2CJNA 5EP4A 1ZUD2 1TYGB 4XGIA 4DR5M 3L26A 2QPAA 3AOEA 3AFHA 3Q8BA 1MU5A 2UXCM 1G41A 2G5GX 1YQ3B 4NAMA 4KKIA 2NQ8C 4FXCA 4DUZM 1GL6A 1CZPA 2WXJA 3L25A 3THGA 1TJEA 1J09A 4D2KA 4QOSA 3J7BA 4QOZC 3IT4B 4HRSA 1D5MC 2XFSA 4FCVA 1ROEA 5EJCA 1NHWC 2KQ4X 4D82A 4FWHA 1L5PA 2OPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE8 A;  4WUR A;  4RF0 A;  5E6J A;  4PT5 A;  4OVZ B;  4RF1 A;  3MJ5 A;  5KO3 A;  3MP2 A;  3E9S A;  4RNA A;  4M0W A;  4R3D A;  4OVZ A;  4P16 A;  4OW0 A;  4REZ A;  4MM3 B; 
#chains in the Genus database with same CATH topology
 4JI2 M;  3W1S C;  4LDT D;  3MFG A;  4LNO A;  2GFO A;  1C76 A;  2BTE A;  2BU3 A;  1ET6 A;  1N77 A;  2UXD M;  3TMP B;  2MJ3 A;  3VDU A;  5H37 D;  3ZNH B;  1TR8 A;  3M62 B;  1XKG A;  2D7G A;  2CEA A;  1V8C A;  1MVK A;  3L17 A;  1N63 A;  2AQ1 B;  4G4Q A;  4YYR A;  2WXL A;  3N32 A;  1C78 A;  1NQC A;  2J7Q C;  1R6B X;  1YX5 B;  2FUG 1;  4REZ A;  4GC5 A;  3GLG A;  2VZK B;  2ZEQ A;  2LJI A;  3A33 B;  2DWL A;  2FAZ A;  4N9F 4;  4BOZ B;  5EQT A;  4BOP A;  3GO8 A;  1L4Z B;  4NC6 A;  2JRI B;  3PT2 B;  2DCD A;  2IYD B;  1N5W A;  1T6O A;  4ZRJ A;  2EMS A;  3MHZ A;  3U6Q A;  1F2A A;  1T3Q A;  3CTW B;  3B79 A;  2VHF A;  1E9R A;  2KXE A;  4UDU C;  1E9S A;  1BT0 A;  3R7R A;  1NEK B;  1F29 A;  1EM7 A;  1DF0 A;  4LJO B;  4HPM B;  5C1Z A;  2KO3 A;  3U6O A;  4DR4 M;  3L54 A;  4KZ0 A;  3TE6 A;  2IGH A;  3DA1 A;  3I3T A;  5K16 A;  3MTN B;  2QSF X;  3Q6B A;  4P1B C;  3VHT C;  3GE8 C;  4I4L A;  1QDT A;  2F5P A;  1WR6 E;  4ANX A;  2H5X A;  4DR3 M;  2L8J A;  2KTF A;  1XB2 B;  2L4F A;  3DZD A;  5EE1 A;  4A55 A;  3BPF A;  3SAV A;  4W4U A;  2L7H A;  3HJ8 A;  1FNW A;  3B08 A;  4B3M M;  1EF1 A;  3TMP A;  1YAL A;  3R2I A;  3I4Y A;  2CR5 A;  3ZNH A;  2CUZ A;  4FWD A;  1ET9 A;  1ZQ9 A;  4B7G A;  2KA6 B;  4UN2 B;  1PGB A;  4A90 A;  3DBL B;  4NRW A;  5DFL A;  1SXT A;  3A1Q A;  1G71 A;  4RGO S;  1U9W A;  1F52 A;  2WDT B;  2JXX A;  8CAT A;  4C7Y A;  1BML C;  4BOZ A;  5AEK B;  2DWZ B;  4JI6 M;  1QOL A;  4I05 A;  3HX3 A;  4WJQ A;  2PW9 A;  3FKY A;  5AZH A;  3Q8F A;  5IOI A;  4FJZ A;  5ITT A;  4JLC A;  1J5E M;  1QUS A;  3VRB B;  3PT2 A;  1WJ6 A;  2CKH B;  2AUX A;  2EUC A;  1VG5 A;  2PRE A;  2DAM A;  1L4D B;  4MJS B;  2PVG C;  2C98 A;  2KDE B;  2KD0 A;  1WH3 A;  3I4V A;  3KDS E;  4RF1 A;  3C9E A;  4CO7 A;  1WM2 A;  2KNV A;  1MI0 A;  4FBJ B;  4M0W A;  4IM2 A;  3EUB 2;  3KSX A;  1AU0 A;  4K7S A;  2IO1 B;  4RFB A;  4G4R A;  2W55 A;  4XBO A;  4OVV A;  2NQD B;  1PRB A;  3BBA A;  2HTM E;  1IXZ A;  4MEM A;  2ZM6 M;  2RDB C;  2OZ2 A;  1JAL A;  1R2Z A;  3ONS A;  1F2C A;  1QUT A;  2LVO C;  3AEB B;  3KVF B;  4DXA B;  2XBB C;  4C7Z A;  5KHQ A;  2N9X A;  2XU3 A;  3P63 A;  2N35 A;  1WI0 A;  1L8Q A;  1S3S A;  3DF0 A;  3PVL A;  2LGX A;  2L0T A;  4N59 A;  1TZO A;  2BKF A;  3DBH I;  3A9J B;  1XNR M;  2WDR B;  2P7U A;  1ZKH A;  2DOS A;  1E0Z A;  1YJI A;  3HIZ A;  3NZS A;  3DVN U;  3HWN A;  1Y8R C;  1TH3 A;  3NVV A;  4I8O A;  4AW4 A;  1J0G A;  3DOW A;  3GRU A;  3ERV A;  4W9H A;  4LF6 M;  3B7Q A;  4Z8X A;  3IXS A;  2LUM A;  3N9Y C;  1AN8 A;  1Y56 A;  3U8E A;  3UMM A;  4MJS A;  2FUD A;  2LHD A;  3V76 A;  2I7P A;  3HJS A;  3Q8X A;  5ITU A;  1TL9 A;  1G6J A;  3I63 C;  2YJ9 A;  4MZO A;  4IM3 A;  4BZA A;  2R44 A;  2AWT A;  5KPT A;  3NOB A;  2JZ1 A;  1LM8 B;  4FW9 A;  1WE7 A;  3SU8 X;  2J7N A;  2XSZ D;  2DC7 A;  2I1K A;  2C7N B;  4A5U A;  3GOE A;  1UKF A;  4E3C A;  1OJL A;  3HK0 A;  2L3Z A;  1EWP A;  1PJS A;  3C19 A;  2Y0Q A;  3O1G A;  3PVS A;  3KYD D;  3QQ8 B;  4DK5 A;  1V81 A;  3L13 A;  3PNR A;  2C7H A;  4OZB A;  2KAJ A;  4PCZ A;  2J5Y A;  1UD7 A;  1GCB A;  2BS3 B;  1VDV A;  5GXG B;  4QNR A;  4F7Z A;  2DZJ A;  8PCH A;  4ZOH C;  1DGG A;  4RGT A;  2NVU I;  3PRZ A;  3LW5 F;  4HCP B;  2CHV A;  1SF0 A;  2J0M A;  1ITO A;  4MB7 A;  4HKQ A;  2LRU A;  1E32 A;  5LXI B;  4PAD A;  1QAN A;  3B9J A;  4CIS A;  4QH6 A;  2FUH B;  1RFK A;  3RUI B;  7PCK A;  4J6I A;  3D6S A;  2WSF F;  3A9J A;  5HI1 A;  1IYF A;  2J0J A;  1NNU C;  3V3X A;  5D3I B;  3TL5 A;  1EO6 A;  3K9O A;  4OZC A;  4NXM M;  4QBB A;  4IOI E;  1BY8 A;  2KW0 A;  3RT3 B;  3KYC D;  4WWN A;  4JI1 M;  3B21 A;  3K1J A;  4H2A A;  4WJP A;  2D07 B;  3NS1 A;  4BS6 A;  5EDS A;  2Y5C A;  2N9L A;  3QX1 A;  5CHF A;  1E7V A;  2MRP A;  3AM9 A;  1Q0W B;  4TSS A;  3MK6 A;  2GMI C;  4R7G A;  4KGS A;  3SC3 A;  2LI5 A;  5EE0 A;  5AZF A;  1I94 M;  4HLE A;  4USA A;  5C18 A;  1E90 A;  2FCN A;  1G59 A;  2O6X A;  4GN1 A;  2XNA C;  3LMM A;  5EXX A;  4J3O D;  1WJ7 A;  3NZ3 A;  2JQF R;  3UGB B;  2WXQ A;  4YXD B;  1R4G A;  1XLO A;  5FSW A;  3L29 A;  2IPK D;  4CYE A;  3UK6 A;  2X8A A;  4XDC A;  3ZCB B;  3QWL A;  2KN5 A;  3BWU D;  2JT4 B;  4BAX A;  3LVV A;  4D81 A;  4ANU A;  2AL3 A;  4AXL A;  4WP2 A;  1J7A A;  4C4V A;  4LJ6 A;  4ITQ A;  4A3P A;  3PNY A;  2LD9 A;  4II7 A;  4YL8 A;  1QT9 A;  2OOA A;  2KX0 A;  2R9O A;  2C5L C;  4MDK E;  1YIW A;  1WMH A;  1NYR A;  1XO3 A;  4DHJ D;  2BTW B;  4GRI A;  4YTM B;  4IBB A;  1Z2M A;  1F77 A;  2K8H A;  3P4P B;  1SXJ B;  4JI5 M;  1HNW M;  2UXB M;  2K25 A;  3SAT A;  5G2N A;  3JR4 A;  2GBJ A;  5KPR A;  3IFU A;  4FIP A;  2FH0 A;  1HA5 A;  2B3T A;  4LZJ A;  3Q8C A;  1WXQ A;  1KLG D;  1Z5S B;  1F4I A;  2EMT A;  4N6E B;  2R45 A;  3GLH A;  1HNX M;  1YNT E;  4M8N A;  6PAD A;  2E00 A;  1KLU D;  2K1F A;  1F2R I;  2WXO A;  4YTN B;  4IKG A;  2IO3 B;  4WJN A;  2D10 A;  3V62 A;  4Q8G A;  2Y5P A;  1FNN A;  3HHX A;  1SSN A;  3AU5 A;  1WZ3 A;  3L0W B;  2M60 A;  4LK0 M;  3VDZ A;  1P3Q U;  3V6C A;  2R9C A;  1YD8 U;  4GB9 A;  3MP2 A;  1ZP0 B;  3HWS A;  4ZTB A;  4I6P A;  1K3X A;  2J52 A;  3DQV A;  1JR3 D;  4DV6 M;  2XU1 A;  1TDH A;  1XT9 B;  3KW6 A;  2WWZ A;  1WGR A;  2Z59 B;  5JHA A;  1W5S A;  1ZW7 A;  2M56 B;  5H92 C;  1N5X A;  3SDL C;  2KZS A;  2R62 A;  2MW5 A;  2AVW A;  4BQV A;  1MPE A;  4N8W A;  4G50 A;  5A24 A;  3TSS A;  3PLV A;  4G3O A;  1IN7 A;  1OEY J;  4PP1 A;  2DJF B;  1V6E A;  4X66 M;  1C4C A;  2LVP A;  5JXV A;  1EUV B;  2JXN A;  4KT0 F;  3WIM A;  3ZRF A;  2KNA A;  2OOB B;  3SMS A;  3NVY A;  2MP2 B;  3DOA A;  2MGW A;  4IBJ A;  4MEL A;  4JL9 A;  3HRD D;  2ZZP B;  5HFY A;  3B9P A;  4IJF A;  1E6E B;  2BTW A;  1N33 M;  3NZU A;  3KWL A;  3ZVV A;  1XXH A;  1N62 A;  2QCZ A;  3AJI B;  3QC8 B;  1NJG A;  3ZTD A;  3QK0 A;  5EZQ A;  1D4B A;  1WX7 A;  5BO4 B;  3GPU A;  4YSZ B;  1SXJ A;  2R46 A;  5EXT A;  1I35 A;  1STF E;  2DAJ A;  4LRS A;  2JP7 A;  3GLI B;  2I38 A;  3BII D;  2W82 A;  2KJ6 A;  2ARY A;  1PQS A;  4B3S M;  2UU7 A;  4K81 A;  1VEG A;  2MHJ A;  4LDT B;  4HPP A;  4PK1 A;  1OFF A;  3V61 A;  5F3W A;  4L15 A;  2M4N A;  2NMQ A;  2BKR B;  3ALB A;  4BOQ A;  1UH6 A;  5IP4 D;  1WGG A;  2ZCC A;  1KSF X;  3IAM 1;  5CHT A;  4NJC A;  3NS8 A;  3QA8 A;  4C00 A;  3H8B A;  4D8E A;  1C4A A;  2X38 A;  2KAN A;  3SHG B;  4FHK A;  4FUL A;  4EKU A;  1VJV A;  3KOW E;  1WWT A;  2ZJD A;  3U6C A;  2KHH A;  4DHZ B;  1EFU B;  4XC2 A;  3ZYY X;  3C58 A;  3C0R B;  1GJS A;  3U30 A;  1J7K A;  2JZZ A;  4AWJ A;  3BB7 A;  4LLG M;  2KEB A;  4NSO B;  4FJV B;  2JA2 A;  3N1Y C;  2DZI A;  2DWN A;  5CVM A;  3KP0 E;  1V34 A;  5C2T B;  4WWM A;  3NVZ A;  2WLB A;  3KLS X;  3DBL I;  2H89 B;  2MLB A;  2YVC A;  1XMO M;  3DBR B;  4X57 B;  1SJH D;  2DAE A;  2HAK A;  4HDO A;  1GOZ A;  2MP2 A;  2WXI A;  4W9G A;  5IAA C;  1IBX A;  3A9K B;  2BNK A;  3S3Q A;  2HH5 A;  2ZAN A;  5IA7 A;  1IGC A;  2KC2 A;  4DR2 M;  1HZ5 A;  3N30 A;  3MTV A;  3VR8 B;  5EP2 A;  3ZNZ B;  2BJW A;  4P1C C;  4OEM A;  2WXM A;  2P0R A;  2H1R A;  4LFA M;  3GLI A;  2RDG A;  1UZX B;  3RNB C;  1IY1 A;  4IBE A;  3T1H M;  4PDI A;  1QOA A;  1D2N A;  5EP3 A;  2IDY A;  4NJ6 A;  3RUL A;  4GKK M;  1WYG A;  3EA6 A;  4E71 A;  2BJV A;  2LVA A;  1K3B B;  3U61 A;  1HE8 A;  2JYT A;  1P9D U;  3GLI E;  3BVM A;  3ENE A;  3CSF A;  1TTN A;  2KQ7 A;  1GC7 A;  3OVZ A;  4YYQ A;  3IAS 1;  3DHH C;  2MQJ A;  2KDM A;  4PI3 A;  3IHP C;  5FTJ A;  3FTD A;  1QVR A;  2YFQ A;  3KUC B;  4OHJ A;  1QQW A;  3SR6 A;  3L4P A;  2LXE A;  1E9M A;  1N6Z A;  2XK5 B;  2E6X A;  2NTS A;  2NQA A;  1WGN A;  3I51 A;  2UUC M;  2LVP C;  3FC4 A;  2L4E A;  1EWO A;  2C9W B;  3A45 A;  2BGF A;  1N61 A;  2AYN A;  3C0R A;  1PPD A;  2FNA A;  4NPN A;  4LCD E;  5FLX S;  4KV2 A;  1ME3 A;  2HJ8 A;  3T3N A;  5PAD A;  1IXR C;  1E8Z A;  2DZM A;  2VF7 A;  3M63 B;  4F1S A;  1V5O A;  4FVM A;  2WXF A;  4GMV A;  4W9L A;  5DNY A;  2CB5 A;  3CWI A;  3Q14 C;  4GIP A;  2O6V D;  3MC0 B;  3LFY A;  1YOV B;  3H8C A;  4DHZ E;  4ZPX A;  2INP E;  3BZD B;  2C7M B;  2YJC A;  2WZJ A;  1VD2 A;  3OAW A;  1U5I A;  2SAK A;  4R3D A;  1T0Y A;  1E94 E;  2M5Z A;  4BKS D;  1BQI A;  3AKZ A;  3T38 A;  5D3D A;  2VH1 A;  1V92 A;  1IXS A;  3E46 A;  2JXT A;  3A9K A;  1WSP A;  4LJA A;  1TGU A;  3VH3 B;  2K47 A;  1N60 A;  3BVG A;  4G3X B;  2WBF X;  2B1N A;  1D5Z C;  3U52 E;  2G9H D;  1H8C A;  2Z0E B;  3OF9 A;  3TWL A;  3HD3 A;  2W54 A;  4KKJ A;  2KFJ A;  2RPV A;  5CHW A;  4QRX A;  2ZPN A;  1JWS D;  3O13 A;  4LF9 M;  2AQ3 B;  2CU1 A;  2J53 A;  4KDL B;  3WXE A;  3O65 B;  2PBH A;  1DEU A;  3ZQJ A;  2XU5 A;  4GIT A;  3E9S A;  5KPZ A;  3RVX A;  1QOB A;  2BB5 A;  1V97 A;  1CK1 A;  3J27 B;  1ZOY B;  2DJG B;  4NQL B;  1PM5 A;  1TH4 A;  2DNF A;  3T6P A;  3OWE B;  3PRM A;  4PS8 A;  2ICI A;  4RGM A;  2CJO A;  1HJP A;  3USV A;  1CMX B;  4WAF A;  2L09 A;  2O2V B;  2HKJ A;  3H7D A;  4LG2 A;  1RAX A;  3FAH A;  2ZNV C;  2PPH A;  2XK5 A;  3Q8A A;  1QMY A;  3ZUA A;  1D0L A;  1BP4 A;  4G0N B;  2L7R A;  2KK8 A;  1IGD A;  3X0W A;  4GSW A;  1XWI A;  4JQW C;  3O0U A;  1T5X D;  2XH9 A;  4WQM A;  4XUI A;  1FO4 A;  2BDL A;  3BOW A;  5EP1 A;  2D3C A;  2N9P C;  3W9C B;  1JCK B;  4L78 A;  1BUI C;  5DYI A;  5JZE B;  2BBC A;  2JY6 B;  3W68 A;  3JAM S;  3EGR A;  2KQS A;  4MM3 B;  3U6M A;  2XEW A;  2B3A A;  2N9K A;  3CF0 A;  1MG8 A;  2Y21 A;  4ACF A;  3P4S B;  1V1P A;  2WXN A;  4BVU C;  2QJL A;  2DKL A;  1BGO A;  3W31 A;  2K9D A;  5D2M B;  1J8C A;  4EZJ A;  1X9Y A;  2V3P A;  3CF2 A;  1LV7 A;  4W9J A;  1WF9 A;  1QDQ A;  4IG7 B;  3OVX A;  3SFE B;  3NY5 A;  4K3B A;  5ITX E;  1TKE A;  3ZJV A;  2LWP A;  1I4W A;  3EFU A;  3L08 A;  5D6J B;  1H4R A;  1O0E A;  1M94 A;  2DXI A;  1AU2 A;  3CBK A;  4K3C A;  4PYU A;  2GQF A;  1GAQ B;  3CH3 X;  2INN E;  3B2F A;  1DOI A;  3U7D A;  2LMC A;  3OJ3 A;  2DHR A;  3OJ4 B;  1AYU A;  2FS1 A;  2NR2 A;  2JZP A;  1I4P A;  1QOF A;  2MBB B;  3PLU A;  3AE5 B;  1C1K A;  3VR9 B;  3APD A;  3KOX E;  1FCL A;  1WGY A;  4M01 A;  4ICV A;  1SE9 A;  2Z8L A;  3N1Z C;  5TR5 A;  1L2C A;  3Q3M C;  1XXG A;  1YQ4 B;  3RZW C;  3SAS A;  2AYO B;  3ML8 A;  1V33 A;  4BOU A;  1TDZ A;  2FNJ B;  4PP2 E;  3F5V A;  5C1B A;  3PHW B;  5J18 A;  4QNM A;  1LO5 D;  4G4N A;  3DWG C;  3N3G A;  3JVZ X;  3Q2A C;  2YQZ A;  1N32 M;  4I07 A;  5JZE A;  2JY6 A;  4HJG E;  2K6B A;  1L2B A;  2EKE C;  4QAY A;  1AU3 A;  1PE6 A;  2JQG R;  4DV2 M;  1TS2 A;  4AZF A;  3RFZ B;  4MM3 A;  4X6I A;  3I9V 1;  4AQY M;  2XZF A;  2GBN A;  4RKX A;  3M6A A;  3H6N A;  4G11 A;  3W1Y A;  3GB1 A;  1OIP A;  3AN1 A;  1GO5 A;  1ATK A;  3LVW A;  2LXA A;  2DCB A;  4OW0 A;  5E26 A;  2F5S A;  2LWX A;  1RYJ A;  1L0Y B;  4A3V B;  1LGR A;  2HE7 A;  2Y6E A;  1PJI A;  3CIR B;  2BS4 B;  2V1Y A;  4ZHP A;  4O1N A;  1WXM A;  3EC8 A;  2N7J A;  3HHY A;  1Y8G A;  1WX8 A;  4ZRK A;  2YEP B;  4OVU A;  3U60 B;  2R4E A;  4MH8 A;  4CDF B;  4NRV A;  1TY0 A;  3KQ4 A;  3AED B;  2JY8 A;  4GUA A;  1RM6 C;  3QAU A;  2CHW A;  3FRI A;  7CAT A;  2JZ3 B;  1VZ7 A;  3U4E G;  1GB1 A;  4I6L B;  2FID A;  3AE4 B;  1ZAE A;  4DHJ B;  3F92 A;  2LUE A;  2BT6 A;  3NUH B;  3MMP A;  1ZXH A;  5TSS A;  4HWY A;  3A4S C;  1NLJ A;  1W5T A;  2KAC A;  2G8L A;  1FFU A;  4NNJ B;  3B89 A;  3UIN B;  3AOE C;  1TTE A;  1A6R A;  1YJJ A;  4N79 A;  2MJD A;  2AYO A;  2QQ8 A;  1L1Z A;  5FPW A;  1QZE A;  1M6D A;  5JH5 C;  4RMA A;  4R71 A;  1XLP A;  1UNS A;  2DHY A;  1X1M A;  4AG6 A;  4L6V 6;  4FJY A;  3RNE C;  2WSE F;  2OUL A;  1ENF A;  5IWA M;  4W5C A;  4IWP A;  2K0B X;  4B3R M;  1Q10 A;  5BPV A;  5J94 A;  4AQ7 A;  2AQ2 B;  1MN3 A;  3R2T A;  5ITY A;  1TZ1 A;  1GNU A;  4FAD A;  2JRI A;  2R9M A;  2ASQ A;  1FMA D;  5DPW A;  3J2P B;  4RKU F;  2GLS A;  2N9E B;  1CQV A;  1ZMW A;  1VR9 A;  3IEJ A;  3HVZ A;  3VFD A;  1VZ6 A;  2F1G A;  3VUX A;  3HKP A;  2YR0 A;  2R6N A;  3K24 A;  3H9D A;  1GMY A;  5HG2 A;  4S17 A;  4URK A;  5DCN A;  4P6V F;  4CDE B;  2J42 A;  5EXS A;  1CS8 A;  4YYU A;  4TQ0 A;  4MZS A;  5BYS A;  2QBY B;  1XLN A;  4WQO B;  3MTN A;  2WU5 B;  2KLG A;  2R2Q A;  3KUZ A;  4IUM B;  2FTD A;  3JSV B;  1K51 A;  4P6G A;  5EE3 A;  2Y20 A;  1VJK A;  3R8F A;  3ZKJ C;  3TPZ A;  4MSM B;  3NWL A;  1JQP A;  2KNZ A;  4KOD A;  4II2 B;  2QHO B;  1KHQ A;  3OLM D;  3PHX B;  3D8B A;  2W3S A;  3AB5 A;  3UQA A;  3JW0 X;  2HTH A;  3ZGZ A;  5EZS A;  1MIR A;  1IUE A;  4RNA A;  1WZ0 A;  3V05 A;  2LVN C;  2HDE A;  2KZU A;  1C9F A;  3DBR I;  1QAO A;  1KFV A;  1Z6T A;  2AEH A;  2PKO A;  3RNF C;  2C9O A;  1TY2 A;  5GKN A;  2L76 A;  4LFB M;  3AXC A;  4YHH M;  4XX5 A;  3PZ8 A;  4NAW B;  1JWA D;  3GRV A;  1Z5B A;  2Y0T A;  3IG5 A;  2YNM D;  2FIF A;  3QAQ A;  4LF4 M;  3AE1 B;  1QYR A;  1NL6 A;  1PVJ A;  2CP8 A;  2JY5 A;  1GPX A;  4N4Z A;  1MX0 A;  2DYO A;  3RFW A;  3VUY A;  4GMQ A;  2Z84 A;  3WAL A;  1F2R C;  4G4O A;  3R3M A;  3BK2 A;  4MGI E;  1JR3 A;  3PV1 A;  4OZA A;  4P6E A;  3W0L B;  3ECI A;  4FK5 A;  1JWM D;  2WQY B;  2KDL A;  1PFD A;  1MJD A;  1A5R A;  3AE7 B;  4D8I A;  3KS8 A;  3FYC A;  2ZPY A;  1WIV A;  2NBW B;  3U6E A;  4HDQ A;  4K1R B;  3OF8 A;  1GJT A;  4I6N B;  2RRU A;  2D7H A;  4JV5 M;  1JR3 E;  4F1I A;  1EIJ A;  2WSC F;  3U8Z A;  5HKH A;  2G45 B;  2LFI A;  4YSY B;  1L6U A;  4IUM A;  3UZU A;  3JSV A;  4M00 A;  2L32 A;  1V9J A;  2D11 A;  4BKT A;  1XNQ M;  2ZW0 A;  4RCO A;  5FR3 A;  1DGB A;  3T15 A;  1JML A;  2V4I B;  2QHO A;  3U6L A;  2XEP A;  1QLB B;  1IWD A;  5F02 A;  1YX6 B;  2G4S A;  4DBG B;  3RNA C;  3HHW A;  3H89 A;  3LXF A;  4W9E A;  4HEA 1;  4WAA A;  4BFR A;  3W2D A;  1YT7 A;  1ISN A;  3RNV A;  4LGY A;  2ZAM A;  2BQQ A;  1YK7 A;  4LNK A;  4GIV A;  4RF0 A;  3K9M A;  3HHM A;  3PTF C;  3H4J A;  2JSV X;  2KKC A;  2PVO D;  1AW7 A;  4X62 M;  5DPT A;  5G5G A;  3MOR A;  3UF8 A;  4B3T M;  2AS8 A;  1V2Y A;  4NAW A;  4GGQ A;  2F7D A;  3NVW A;  1HT2 E;  2CV0 A;  3KFU G;  3CST A;  4P16 A;  3QCA A;  1POP A;  5FTM A;  1HXY D;  5BR8 M;  2NTT A;  1UGJ A;  2LAS A;  1EF7 A;  2UU9 M;  1QF6 A;  1SBB B;  1PUT A;  3HZJ A;  2WDV B;  4DV3 M;  3IT6 B;  2CRU A;  1HTO A;  3LYY A;  3SHQ A;  3U6D A;  4DV1 M;  3Q3N C;  1NEN B;  5BMH A;  3KFQ A;  3SHF A;  1RFA A;  3KUD B;  3RD2 A;  3PXG A;  1IN5 A;  3PSE B;  2GBM A;  5KQ8 A;  2XU4 A;  1S3S G;  3FE3 A;  2A5U A;  2E03 A;  2VQE M;  1P0R A;  1VRA B;  2EO2 A;  4LCB A;  5LLI A;  4ARC A;  1NO1 A;  3RGS A;  1WGK A;  3V60 A;  2D5G A;  2O6V B;  2QNJ A;  3VK7 A;  2ERC A;  2EA0 A;  4JXJ A;  1JW9 D;  1STE A;  2F4V M;  4HKZ E;  1R7R A;  2YLM A;  3VXW A;  3P1M A;  4FHJ A;  4Q8H A;  2YJ8 A;  3P4R B;  1GJZ A;  1I4R A;  1JRP A;  4ZRQ A;  1IY2 A;  1PGA A;  2VF8 A;  2G8E A;  1ZMV A;  3Q69 A;  4DBG A;  3K9P B;  1T6B X;  2B76 B;  3MHS D;  1IN4 A;  2PEA A;  4FA6 A;  3A98 B;  2WXP A;  3UGJ A;  4AP4 C;  1GEC E;  5EF4 A;  2QEN A;  1CQD A;  2LRW A;  4L2Y A;  2C96 A;  4B7F A;  4XR7 A;  3H1U A;  4IP3 A;  1WXV A;  5CX3 A;  1Q5W B;  3LCU A;  2MWS B;  5AUK A;  2GOW A;  3GP7 A;  2BVC A;  2F5N A;  2RMM A;  1QKZ A;  1PPN A;  2LGS A;  1XCQ L;  1C7Y A;  1XCT L;  3AH7 A;  5L83 A;  1NY6 A;  2D3G A;  3WHK A;  4JGH B;  2WYQ A;  3TRK A;  2ZVN A;  3HHI A;  1UBQ A;  2MH7 A;  2LTU A;  4NXN M;  2QCU A;  4KIK B;  3H8H A;  1EWL A;  2HXZ A;  2N0S B;  2Z4S A;  5JI3 E;  4WWP A;  5MPO A;  1IM2 A;  4B7H A;  3GE3 C;  3FTF A;  4PYZ A;  3PBH A;  1A70 A;  1K3W A;  3HU1 A;  4LNF A;  5BMI A;  2EJS A;  2FCM A;  2R9F A;  2CE7 A;  2WX1 A;  1MG4 A;  1L0X B;  4MSQ B;  3BBZ A;  2NCN A;  2O6V A;  3RNG C;  3ZTC A;  2DEN B;  1YUB A;  2J0K A;  3I01 M;  3KP1 E;  2JYE A;  2LVQ D;  3SAU A;  3I06 A;  2MBQ A;  1JQJ C;  4GH9 A;  2GBK A;  3A46 A;  3ABV B;  3N3K B;  2K0P A;  1OFH A;  1Q6K A;  1N78 A;  2IGG A;  3QIJ A;  2PNS A;  2MR9 A;  3DVN V;  1FJG M;  3K9P A;  4JI8 M;  1YN3 A;  1SNK A;  2R9N A;  2Y3A A;  3BYT B;  4JI0 M;  1SEB D;  2K6Q A;  1BXT A;  2NBU A;  1N36 M;  2HHH M;  2PJH A;  2NQI A;  3PPA A;  4B0E A;  3AE2 B;  1OIZ A;  4BLC A;  1V1O A;  5IKC M;  4QRG A;  1GL7 A;  2HCB A;  3HM6 X;  4AG5 A;  3L10 B;  3CH2 X;  3AUL A;  3AV8 A;  1PPP A;  3AEC B;  4X64 M;  2HWJ A;  2G3Q B;  2Y5B B;  1TH2 A;  4B6W A;  3R7Q A;  4BOS A;  2H88 B;  1CTE A;  2QC8 A;  3BVZ A;  4YYS A;  2Q5W D;  3ZJT A;  1QIL A;  1YSY A;  2FE8 A;  1ZGU B;  4KIK A;  4GC9 A;  2WXK A;  3QSD A;  3RVV A;  4IC7 B;  3ZC7 B;  1I7H A;  4PT5 A;  2C99 A;  4XE0 A;  1MEG A;  5CVO B;  5BMG A;  4PS7 A;  4ICU A;  4XWW A;  3IOQ A;  1DYQ A;  2MJE A;  4FCT A;  3C9P A;  3VTU A;  4P7I A;  4L8R C;  4Q2J A;  5E6P A;  4PS3 A;  1GC6 A;  1YK8 A;  3Q3O C;  4KLN A;  4LGM A;  3J81 S;  2PLP A;  1GLO A;  2KWV B;  2FOI C;  4HXD B;  4OU7 A;  1Q3B A;  1L6V A;  2MBE A;  3DDC B;  4WJO A;  3HU3 A;  2DZK A;  3RCZ A;  3BCN A;  4X6J A;  4DV0 M;  1L0V B;  4IBK A;  1ZDV A;  4RH6 A;  3ZUN A;  4YTP B;  5L95 C;  4MGY E;  2BWE A;  2OOB A;  5LMN M;  1I4X A;  3N3K A;  5CVN B;  5CHV A;  3ZH9 B;  3SFD B;  1WE6 A;  1D5X C;  3EHV A;  3FUW A;  2DBY A;  4MAC A;  4C80 A;  3BIN A;  2J4X A;  2RPQ A;  1GAB A;  5GMV A;  3IUT A;  3AEA B;  2E01 A;  2DWQ A;  5EE9 A;  1DGJ A;  2BWF A;  5E6N A;  5T8I A;  3HUI A;  1PJQ A;  4CHT B;  1UF0 A;  1ZE3 D;  1OQY A;  2EKI A;  3H4M A;  1L2D A;  2J7Q B;  3W67 A;  1YMH E;  1MFW A;  3TIX A;  1N34 M;  3MJW A;  3P5W A;  4CQN A;  1RWS A;  1NY5 A;  4JPS A;  2WHI A;  2DNA A;  1LTM A;  2FCS A;  2WXR A;  5JH3 A;  1CUK A;  4CJ6 A;  3IV2 A;  2YEP F;  3UIP B;  5EXP A;  1PDX A;  3AE8 B;  2KYW A;  1F0Z A;  4WWO A;  2ZTD A;  1YN4 A;  2IND C;  1AIM A;  2SEB D;  2AIM A;  1EF5 A;  4LJ4 A;  3TWK A;  1R4M B;  4YSX B;  2DX5 B;  3DBS A;  3VFK A;  3GQ4 A;  4LFC M;  2FRQ A;  3E56 A;  1UBI A;  1NB5 A;  2LHE A;  5D94 A;  3RGP A;  1AYV A;  1F9J A;  2OHF A;  2KVR A;  2V0G A;  4HXD A;  1DGF A;  2R2O A;  1EWM A;  3DVG Y;  1TU6 A;  1TT5 B;  2K3U A;  3W1S A;  1XHB A;  4MGZ E;  4LJ8 A;  1WX9 A;  2DAG A;  1HQY E;  1SXJ C;  4PD2 A;  2O01 F;  4E74 A;  3TL4 X;  2NQG A;  1KHP A;  3R9X B;  4X6H A;  1P98 A;  1FNV A;  2VHS A;  2BYV E;  3NBX X;  5CTR C;  3I57 A;  1JB0 F;  4GKJ M;  1I42 A;  3W30 A;  5H8Y E;  4ZUX U;  3K8Z A;  1OGW A;  2UUA M;  2DVW B;  1ZDX A;  2Z0D B;  2L6O A;  2LHG A;  3TBL D;  4OVZ B;  4AKI A;  2J7Q A;  1KM7 A;  2UUB M;  3CF6 E;  4B9K A;  2BYT A;  3P5V A;  3GLF B;  2CWB A;  1SE4 A;  3KW5 B;  3Q8E A;  3T9L A;  4MT5 A;  2DWM A;  3BC3 A;  4I5S A;  2E5L M;  1VLB A;  1VZ8 A;  3VVW B;  2JUJ A;  3EEC A;  1JQ4 A;  4KX6 B;  4CGY B;  4Q7J A;  3FTC A;  3VKH A;  2UWQ A;  4XDD A;  3V6E B;  4KLB A;  1WFY A;  2R61 A;  1AYF A;  3FTE A;  4AXM A;  1G8P A;  5IZ7 D;  1IFY A;  1SIF A;  1L7Y A;  3W0F A;  2KDI A;  2NPT B;  3U6P A;  2HHN A;  1WR1 B;  5JI2 E;  2JPH A;  1Q02 A;  2DAI A;  4GXB A;  2KMC A;  2DZZ A;  1T0Q C;  4TUU A;  4QHS A;  1G3I A;  2N7D A;  4AI6 A;  3U6S A;  1KFY B;  5D7G A;  5C23 A;  1PYW D;  1ZPS A;  4L16 A;  1HZ6 A;  1SE2 A;  3PRP B;  4KSK C;  3S3R A;  4IWO A;  4DR1 M;  1YE9 A;  3GQ3 A;  1UUP A;  2WXH A;  3AE3 B;  1WIA A;  1AIP C;  4HL4 A;  3WAO A;  3DVG X;  2H7J A;  2DHZ A;  5A2Q S;  3WA0 A;  5ITR A;  5JHB A;  1IBM M;  3SEB A;  3PO0 A;  3P2B A;  5HHD G;  1I4Q A;  3ZIM A;  3RNC C;  2NBV B;  3QYB A;  4ASW C;  1L1T A;  5ITX A;  1T43 A;  4YY3 M;  4RY2 A;  1IN6 A;  3GLG B;  1IQP A;  3U7Z A;  2KTR B;  5IT9 S;  1KJT A;  2JVC A;  3DHI C;  2V1C A;  2Z7J A;  1F1H A;  1T0R C;  1Z59 A;  3TEW A;  4OVZ A;  2N4F A;  4L1B A;  1OEY A;  4IM0 A;  4LJP B;  1HNZ M;  1MHH E;  4JYA M;  4IBD A;  4QHT A;  3GLF A;  5AZG A;  1CJE A;  1J7B A;  3OG5 A;  2E02 A;  5FR6 A;  3H6S A;  3O65 A;  4G54 A;  4FN2 A;  4DR6 M;  2K22 A;  3N4C A;  2CHG A;  1P3Q Q;  3CGW A;  3KVW A;  3PZ7 A;  1ZMU A;  4P17 A;  1U9V A;  3NRZ A;  3LDZ E;  2R6F A;  4FLH A;  2BYF A;  2HD5 B;  4LTU A;  1Z5C A;  3GLF E;  3V6E A;  2JY7 A;  1EU4 A;  2KWC A;  3H7S A;  2L05 A;  1NDD A;  3VLF B;  1Q1O A;  2O2V A;  1PCI A;  2CHQ A;  3LJ3 A;  2X49 A;  1IPG A;  3A42 A;  2NPT A;  4DUY M;  2RR9 A;  1WR1 A;  3K8U A;  1L2N A;  3K2L A;  3GP1 A;  3Q3F A;  2EEL A;  2K39 A;  1NPZ A;  2JWU A;  1SJE D;  3KXE C;  2G1E A;  3LCV B;  1XEE A;  2M17 A;  4BBN C;  1TKY A;  1V49 A;  3PRP A;  1C77 A;  1M4V A;  2IO0 B;  3E4R A;  4EUT A;  2V3S A;  4X65 M;  1AU4 A;  2XGN A;  3PDF A;  3EIH A;  4HLQ A;  5LNK 1;  2DZO B;  2IJ0 A;  3B1L X;  4LZZ A;  1FD6 A;  2VRR B;  2LVO A;  3KOZ E;  3R66 C;  5FK9 C;  3A1Q B;  1PGX A;  2KTR A;  2CV2 A;  1OTR B;  4EFO A;  1S4V A;  1QAM A;  1PJT A;  1AWD A;  1C4P A;  1TLO A;  4AKG A;  3AI5 A;  3GPX A;  1AAR A;  1ICF A;  1SGH A;  3SAR A;  3Q8G A;  4AS1 A;  3MC8 A;  3GLG E;  2XSZ A;  1NBF C;  3PRE A;  3RMK C;  3PNV A;  3W5U B;  4LJ9 A;  2KFK B;  2FFJ A;  1K53 A;  2G7Y A;  1DGH B;  3OIS A;  1DO0 A;  5FTN A;  2AU1 A;  4DV7 M;  4FJC A;  1WM3 A;  1V86 A;  3KSE A;  2ACZ B;  2K8C A;  4B95 A;  1GG3 A;  2HD5 A;  2INC C;  1WGL A;  2UYZ B;  4QRV A;  3HM3 A;  4DDI D;  1C3T A;  4DR7 M;  1WHC A;  4M0W B;  4MGK E;  2PE6 B;  2EKK A;  2DZN B;  1KFU L;  2RGO A;  4XZ4 A;  3BPM A;  3GQ5 A;  3MHH A;  2PIA A;  1VSN A;  3ZDT A;  2JUO A;  4A6Q A;  4JIO U;  4EZK A;  4AOF A;  4IBG A;  4HPL B;  2I1J A;  3BWK A;  5E6O A;  1PXV A;  3QJ3 A;  3D32 A;  3Q3J A;  1N75 A;  2FRA A;  3QAR A;  2FYE A;  3PHW A;  3H7P B;  1R4N B;  1OQQ A;  1RRB A;  1LFD A;  1EE8 A;  4DWF A;  2D7E A;  5EGW A;  3IFW B;  3ZRC A;  4BS5 A;  2J7O A;  2EKF A;  3J80 S;  1NI3 A;  2IY1 B;  4RM8 A;  3L2A A;  1YN5 A;  3PFI A;  3AEE B;  3WAN A;  2KT7 A;  4DXF A;  1CB5 A;  2LHC A;  2M19 A;  5I4D A;  2JRH A;  1VDD A;  3AOG A;  2VQF M;  1J7C A;  1C79 A;  1KF6 B;  2WU2 B;  2LJ5 A;  1MS6 A;  4L23 A;  3K92 A;  1FEH A;  4ZYN A;  5BYR A;  3SYK A;  1UWX A;  3D8L A;  1HT1 E;  4JI7 M;  1X37 A;  4LF5 M;  4TQ1 A;  1VCB A;  1OTR A;  2DC9 A;  4ANV A;  1WGH A;  1SE3 A;  2NS5 A;  3TEZ A;  2PTL A;  3TWM A;  2MCN B;  2MSE D;  4M0D A;  2F5Q A;  2MJ5 B;  4S12 A;  2KOX A;  2LH0 A;  1FXT B;  1DOX A;  2RSU A;  4M9S A;  5LMU M;  3UI3 A;  2P86 A;  9PAP A;  3U60 A;  2P5T A;  3FD9 A;  3SMP A;  3T8M A;  2XF3 A;  1PAD A;  2KFK A;  3QJZ A;  1DGH A;  3ZW3 A;  3AL0 C;  4A8X C;  2FCQ A;  3KWB X;  4EIW A;  2KXJ A;  3AEG B;  3IG3 A;  3P42 A;  1ESF A;  2WDQ B;  1QQR A;  2TSS A;  3T1Y M;  5KO3 A;  3ZDM C;  4ZRP A;  1D0M A;  3MHS A;  3NHE B;  4OX9 M;  2Z4R A;  3SYL A;  1WXS A;  4M9X A;  2KRK A;  1Q39 A;  1VQ1 A;  1TS3 A;  1WYW B;  2ATO A;  3KX1 A;  1P1A A;  1B1Z A;  1I4G A;  3M7G A;  4KO8 A;  2BB6 A;  3IVF A;  3WAM A;  4BSQ A;  1HEZ E;  1XD3 B;  2QP9 X;  1OFI A;  3H7P A;  2MX2 A;  1E8X A;  4D8B A;  2O5R A;  3E21 A;  1MDW A;  3EFC A;  1SIJ A;  2K9X A;  1ZCM A;  2CU3 A;  4RGN A;  2Z8Y M;  1HUC B;  2W9N A;  1RLF A;  2JU6 X;  4XGA B;  4GEW A;  4TV3 A;  1GKI A;  3GZN B;  2L7I A;  3W5V B;  4A9A A;  3C8Y A;  3MP9 A;  2CIO A;  3PHU A;  2R0I A;  1Z5A A;  3CMM B;  3K9O B;  2DI0 A;  2OED A;  3AE6 B;  3T3O A;  2QBY A;  3LQQ A;  1R7S A;  4WIP A;  4CDD B;  5KQD A;  1K50 A;  3HY5 A;  4NZL B;  4FCW A;  4JI4 M;  2C60 A;  2LVQ A;  2LGI A;  2JWZ A;  1R4M I;  2HWK A;  1Y4H A;  4IW0 A;  5FTK A;  4W5B A;  3ZXR A;  3PHX A;  3GS2 A;  4ZRI A;  2I2Y A;  3TJP A;  3APC A;  2M0A A;  3NHE A;  4US9 A;  2KDB A;  4BBN F;  2Z3X A;  3WAP A;  4OEL A;  2CS4 A;  2IY0 B;  2JX5 A;  3BOS A;  1V5T A;  2CFO A;  1GUA B;  1SG9 A;  1NV8 A;  3MJ5 A;  3AE9 B;  4YT0 B;  3RYT A;  4YV8 A;  4C4V B;  2DYM A;  2KLC A;  1GLN A;  4Z6Y A;  2OP3 A;  1NYQ A;  1R2Y A;  3N1X C;  3JYU A;  2O25 A;  4GDK B;  4M9Z A;  4DDG D;  4HVB A;  1WMH B;  3NBI A;  5DPS A;  2XZU A;  3AV0 A;  2L83 A;  2RDH A;  2RGF A;  3FYD A;  3MC9 A;  4BKG A;  4XK8 F;  3AMZ A;  1P7F A;  4K7C A;  3IEC A;  1CJL A;  3WXG A;  2VH2 A;  2K6D B;  3UIO B;  1ZIV A;  3BK1 A;  5KHO A;  4YYV A;  1BVS A;  2KJH B;  2LEK A;  3L28 A;  3ZNG C;  3IG8 A;  2VZK D;  3RN9 C;  2F5O A;  3GLH B;  3TQS A;  3VDP A;  1THE A;  2DAF A;  1MJG M;  2PMV A;  1J19 A;  1FPY A;  4GLS C;  2MEK A;  2FT2 A;  3KW9 A;  3B74 A;  3I04 M;  1WJU A;  1WY8 A;  3RE8 A;  4I81 A;  3R8B A;  3V6C B;  4WH4 A;  3ZLZ A;  2LBC A;  2GRI A;  3OTO M;  3FUV A;  1P7E A;  3NG0 A;  2WGS A;  4W9F A;  2WS3 B;  3TEY A;  3ZXV A;  2N1W A;  3QT4 A;  1NJF A;  1WJN A;  3IMA A;  1JWU D;  1VEK A;  3OQC A;  3KWV A;  3HHZ A;  4DQO C;  1VDL A;  1QOG A;  3PZD A;  1WJ4 A;  2V1U A;  1E7U A;  2KMA A;  5IRE B;  4ARI A;  5IO9 A;  3URY A;  1NVI D;  1DOY A;  2R4J A;  3BY4 B;  1XQQ A;  1U4A A;  3HVD A;  3C3D A;  3ZQ4 A;  3B2G A;  3SFZ A;  3EIE A;  1R5L A;  4W9D A;  4MI7 A;  4PDG A;  2W3R A;  1SB3 C;  1QDR A;  4L4U A;  5L8R F;  1FM0 D;  3B7Z A;  2GHU A;  4BB9 A;  5BYQ A;  2M1M A;  1XF5 L;  4HEO A;  2D3A A;  1WRD B;  3DCG A;  3QYE A;  1ZXI A;  4GDK A;  4ZHO A;  2D2Q A;  1G4A E;  4IBC A;  4KDI C;  1OAI A;  3WHL A;  2KHW B;  1D3Z A;  1NVM A;  1XXH B;  2D3B A;  2BYE A;  3F75 A;  1TGZ B;  1F2B A;  4GHA A;  3AU4 A;  3KWZ A;  4N58 A;  2BS2 B;  2MBO A;  2AHM A;  2RGH A;  5FTL A;  4B08 A;  3L27 A;  4FD2 A;  2IGD A;  4HJK A;  1UM8 A;  3BXW A;  1IBK M;  4W9C A;  4LF8 M;  2K5P A;  2N7E A;  2B1M A;  2G8J A;  4DV5 M;  3RVW A;  1QAQ A;  3ETR A;  1NSF A;  1KRH A;  4DXG A;  3PSE A;  2ONQ A;  4YVA A;  3M0E A;  3KKU A;  1IBL M;  4WA6 A;  5J2R A;  2V9H A;  3NJT A;  1A5T A;  4K7W A;  4YYW A;  4XWT A;  3GLH E;  3DFZ A;  1FXI A;  2WNM A;  2BF8 B;  2GI9 A;  2VII A;  3LXS A;  2KVZ A;  2JWS A;  1YZB A;  1DO2 A;  4HK2 A;  2QIE B;  4BKS A;  1WRI A;  1K82 A;  2KC1 A;  1E10 A;  2LGY A;  2E3T A;  1D0K A;  2HL7 A;  3IHP A;  2G4D B;  3VH4 B;  1LQB A;  2QDF A;  4ZYS A;  1CPJ A;  4W9I A;  4ITK A;  3BYY B;  3FIL B;  4XYC A;  3JR5 A;  2ZNV B;  3FUT A;  3BY4 A;  1EU3 A;  1WXA A;  4C56 C;  3WCQ A;  1E5W A;  4US8 A;  5G5H A;  3M95 A;  2ZVO A;  2G6D A;  2MRO B;  1GB4 A;  3SD5 A;  3HU2 A;  1CV8 A;  1EWC A;  2LNH C;  1NB3 A;  2WXG A;  4F2L A;  3L16 A;  4G6Z A;  4M8M A;  2DC6 A;  1ORY B;  4LRT A;  4MH0 E;  1KXR A;  3VQI A;  4GDL B;  1IBX B;  2DCC A;  1HQC A;  4KHP M;  3HJQ A;  3U5Z B;  4IJE A;  2I7N A;  1TS4 A;  3I5J C;  3VTV A;  4B0M A;  3SAW A;  3IBE A;  4KVG B;  2DC8 A;  4FWG A;  2UZJ A;  4ANW A;  3DHG C;  2QIL A;  1FCC C;  3VKG A;  4AJY B;  4EOY A;  1PBH A;  1NNJ A;  4LF7 M;  3SBJ A;  2BWE S;  3B0A A;  1XXH E;  3VRA B;  3VTW A;  3TUO A;  1NI2 A;  3U2S C;  1T3T A;  3VK8 A;  1E7P B;  3HGI A;  3P5U A;  3KH0 A;  1SXJ E;  4BBA A;  3U61 B;  4KGR A;  1RU3 A;  2R18 A;  4MSX A;  2RKO A;  1FH0 A;  3FUX A;  3X23 A;  2GNO A;  2GBR A;  1E8Y A;  2MH8 A;  2JTC A;  3APF A;  1TS5 A;  2DEN A;  1UFZ A;  1TF0 B;  2QZ4 A;  1PJJ A;  1NV9 A;  3LB8 C;  2CHZ A;  2KWD A;  4W9K A;  1ZV1 A;  3GRR A;  3MHV C;  1KTK A;  3QHT A;  5AUI A;  1E8W A;  1WGD A;  1FFV A;  5E6J A;  1YLA A;  1TBE A;  3HHA A;  2DZY A;  2OQ4 A;  4JE3 B;  1TKG A;  1R4N I;  4RM9 A;  5J17 A;  5JA7 A;  1KYI A;  1UWM A;  1K52 A;  3KOY E;  2BW2 A;  2KN4 A;  2KWU B;  4NY0 A;  1DV0 A;  3FIL A;  4AJW A;  1AUA A;  4KGT A;  2OJR A;  3VUW A;  2C9C A;  2GB1 A;  2LZ6 A;  2IBI B;  3GRY A;  1IP9 A;  1XC8 A;  2ZTC A;  4JX1 C;  5FKA C;  3AI8 A;  1UEL A;  2X4A A;  2K8B A;  2L1A A;  3FRH A;  3GPP A;  2G3Q A;  3DBH B;  3ILK A;  1IXS B;  1GVN A;  2L2D A;  4GDL A;  2Y5B A;  3U5Z A;  2V6Z M;  1FRD A;  2KMM A;  4DMY A;  4NL4 H;  4MGH A;  4HRO A;  3ZNI D;  3FUU A;  1CVZ A;  5DYG A;  1JRU A;  1EWY C;  2QMT A;  1OQR A;  2XN9 C;  3TEX A;  2BDZ A;  2LGD A;  4NQK E;  4NSR A;  2QSD A;  1PGY A;  1MHX A;  1DKI A;  5C3J B;  3CBJ A;  4GU2 A;  3RPF C;  4KSL C;  2IO2 B;  2M0X A;  1ME4 A;  2XLJ A;  3UJN A;  4M02 A;  4CIZ A;  1K8R B;  4NOO B;  4F8C B;  2JF5 A;  4S0R A;  4CZW A;  1VEJ A;  2PE9 A;  3PS6 A;  2QEJ C;  1B9R A;  3FKE A;  3PRM B;  2YJ2 A;  1MEM A;  1FXA A;  4EE2 A;  2FO5 A;  1T0S C;  2Q2E B;  2JQR B;  4AUQ C;  1Y08 A;  2IPP B;  1ACC A;  4XZX A;  4DMX A;  4IWQ A;  1NHG C;  2ON8 A;  3J9C A;  3RZF A;  2AX5 A;  4JI3 M;  4JN6 A;  1C1Y B;  1KLV A;  5ITQ A;  2C0Y A;  2M8S A;  2ZW1 A;  4A3O A;  2HJ1 A;  2L0F A;  2MBH A;  2DLB A;  2R65 A;  4DV4 M;  4JWU C;  1MHW A;  1JRO A;  4IIW A;  2V4L A;  1H6U A;  4WUR A;  3DPD A;  1U9Q X;  2L52 A;  3P4Q B;  2XFT A;  4W5W A;  1AEC A;  2JZ0 A;  4LNI A;  4BOS C;  3GPY A;  1OAO C;  3VAW A;  3ML9 A;  2A4Z A;  2DAK A;  3M3J A;  2IBI A;  4K0K M;  3E1Z B;  1V80 A;  3N20 C;  4K7U A;  4LY6 A;  1HQR D;  3GZN I;  2LXC A;  2KRU A;  1KH0 A;  4HCN B;  4ZDV A;  1QXP A;  2FQ9 A;  1UGM A;  2DYB A;  1D6E C;  4IBI A;  2C5R A;  3LQR A;  4GHL A;  1V1P B;  3RI7 C;  4BPV A;  4AKH A;  2A5Y B;  2ZCB A;  1YJ1 A;  1Q3C A;  1FIQ A;  2N1V A;  4IDI A;  4TUW A;  2FBW B;  3PW3 A;  2ZAO A;  3A4R A;  4TKN A;  2V3N A;  1SXJ D;  3KS4 A;  2KZR A;  2L00 B;  1KFX L;  4CHK A;  1HR0 M;  3M99 A;  4WW0 A;  3DWM A;  3ZO5 B;  3WXF A;  2JNH A;  5LXH A;  1SP4 B;  2WP9 B;  2PAD A;  2AL6 A;  1FRR A;  1XLQ A;  2BWB A;  1IY0 A;  1IN8 A;  3C3E A;  2KX3 A;  1S1Q B;  2OJW A;  2REX A;  3AEF B;  2DZL A;  2MA9 B;  2CHX A;  3J7A S;  5CHV C;  3KSJ A;  2BPS A;  3B7N A;  2APL A;  1HTQ A;  4IBF A;  1XMQ M;  4JWS C;  4D80 A;  1CSB B;  4CDC B;  1YVB A;  4YWG G;  1I4H A;  2ZBK B;  4LJ5 A;  4I04 A;  2KNB A;  3ZJU A;  4EEW A;  1FNU A;  4LJ7 A;  3TCA A;  1PIP A;  2AGA A;  1QZM A;  3TNX A;  3P5X A;  3S2A A;  2CV1 A;  1OKS A;  1LXD A;  1TIF A;  4A20 A;  4Y28 F;  1JWB D;  4TMA B;  2CJN A;  5EP4 A;  5IN7 A;  3QWZ B;  1ZUD 2;  1TYG B;  4XGI A;  4DR5 M;  3L26 A;  2QPA A;  1YQB A;  3AOE A;  4NJ7 A;  3AFH A;  3Q8B A;  1MU5 A;  2UXC M;  1G41 A;  2G5G X;  1YQ3 B;  4NAM A;  5DPR A;  1AYW A;  4KKI A;  4LNN A;  4EZL A;  2AUZ A;  4HWI B;  2NQ8 C;  2RD0 A;  3PGE A;  4FXC A;  4KZC A;  4DUZ M;  1GL6 A;  1CZP A;  2WXJ A;  3L25 A;  1PPO A;  1U9X A;  3THG A;  3GCB A;  2KJR A;  4ANR A;  1TJE A;  1J09 A;  4D2K A;  4QOS A;  3J7B A;  3UQB A;  4QOZ C;  2VDB B;  3IT4 B;  4HRS A;  4II3 B;  2YJB A;  3I3T B;  2WX0 A;  1D5M C;  2DCA A;  5G55 A;  2XFS A;  4FCV A;  1ROE A;  2KDF B;  5EJC A;  1NHW C;  2KQ4 X;  4D82 A;  1KOT A;  2OO9 A;  2ACT A;  2X8X X;  2IZV B;  4FWH A;  1L5P A;  2OPF A;  4GOC A; 
#chains in the Genus database with same CATH homology
 4JI2 M;  3MFG A;  1C76 A;  2BTE A;  2BU3 A;  1ET6 A;  1N77 A;  2UXD M;  2MJ3 A;  3VDU A;  5H37 D;  2D7G A;  2CEA A;  1V8C A;  1MVK A;  1N63 A;  2AQ1 B;  4G4Q A;  2WXL A;  1C78 A;  2J7Q C;  1R6B X;  2FUG 1;  4REZ A;  4GC5 A;  3GLG A;  2VZK B;  2LJI A;  2DWL A;  5EQT A;  4BOP A;  3GO8 A;  1L4Z B;  1N5W A;  3MHZ A;  3U6Q A;  1T3Q A;  3CTW B;  1E9R A;  2KXE A;  4UDU C;  1E9S A;  1NEK B;  1EM7 A;  3U6O A;  4DR4 M;  3TE6 A;  2IGH A;  3DA1 A;  4I4L A;  2F5P A;  4DR3 M;  4A55 A;  5EE1 A;  3DZD A;  3SAV A;  2L7H A;  3HJ8 A;  1FNW A;  4B3M M;  3TMP A;  3R2I A;  3I4Y A;  3ZNH A;  2CUZ A;  4FWD A;  1ET9 A;  1ZQ9 A;  4B7G A;  2KA6 B;  1PGB A;  4A90 A;  4NRW A;  1SXT A;  4RGO S;  4C7Y A;  8CAT A;  4BOZ A;  1BML C;  2DWZ B;  4JI6 M;  2PW9 A;  3Q8F A;  5ITT A;  1J5E M;  3VRB B;  3PT2 A;  2EUC A;  1L4D B;  2PVG C;  2C98 A;  3I4V A;  3KDS E;  4RF1 A;  1MI0 A;  4M0W A;  3EUB 2;  3KSX A;  4RFB A;  4G4R A;  2W55 A;  4XBO A;  3BBA A;  2HTM E;  1IXZ A;  2ZM6 M;  1JAL A;  1R2Z A;  3AEB B;  4C7Z A;  3P63 A;  1L8Q A;  1S3S A;  4N59 A;  1TZO A;  1XNR M;  2WDR B;  2DOS A;  1E0Z A;  1YJI A;  1TH3 A;  3NVV A;  4I8O A;  4AW4 A;  3GRU A;  4LF6 M;  4Z8X A;  3IXS A;  2LUM A;  3N9Y C;  1AN8 A;  1Y56 A;  3UMM A;  2LHD A;  2I7P A;  3HJS A;  3Q8X A;  5ITU A;  5KPT A;  4FW9 A;  2J7N A;  2XSZ D;  4A5U A;  1UKF A;  1OJL A;  2Y0Q A;  3PVS A;  4OZB A;  2KAJ A;  4PCZ A;  1VDV A;  2BS3 B;  5GXG B;  4QNR A;  4ZOH C;  1DGG A;  4RGT A;  2CHV A;  1SF0 A;  4MB7 A;  4HKQ A;  1E32 A;  1QAN A;  3B9J A;  4CIS A;  1RFK A;  5HI1 A;  1NNU C;  3V3X A;  5D3I B;  4OZC A;  4NXM M;  4IOI E;  2KW0 A;  4JI1 M;  3B21 A;  3K1J A;  4H2A A;  3NS1 A;  2Y5C A;  2N9L A;  3AM9 A;  4TSS A;  3MK6 A;  4R7G A;  4KGS A;  3SC3 A;  5EE0 A;  1I94 M;  4USA A;  5C18 A;  1G59 A;  2XNA C;  3LMM A;  5EXX A;  4J3O D;  3NZ3 A;  2WXQ A;  4YXD B;  1XLO A;  5FSW A;  3L29 A;  2IPK D;  3UK6 A;  2X8A A;  4XDC A;  3ZCB B;  3QWL A;  3BWU D;  3LVV A;  4D81 A;  1J7A A;  4LJ6 A;  4ITQ A;  3PNY A;  4II7 A;  1QT9 A;  1NYR A;  1XO3 A;  2BTW B;  4GRI A;  4YTM B;  4IBB A;  1F77 A;  3P4P B;  1SXJ B;  4JI5 M;  1HNW M;  2UXB M;  3SAT A;  3JR4 A;  5KPR A;  3IFU A;  1HA5 A;  4LZJ A;  3Q8C A;  1WXQ A;  1KLG D;  4N6E B;  2R45 A;  3GLH A;  1HNX M;  1YNT E;  1KLU D;  1F2R I;  2WXO A;  4YTN B;  4IKG A;  2Y5P A;  1FNN A;  3HHX A;  1SSN A;  4LK0 M;  2M60 A;  3MP2 A;  1ZP0 B;  3HWS A;  4ZTB A;  1K3X A;  2J52 A;  1JR3 D;  4DV6 M;  1TDH A;  3KW6 A;  1W5S A;  2M56 B;  5H92 C;  1N5X A;  2KZS A;  2R62 A;  1MPE A;  3TSS A;  1IN7 A;  4X66 M;  1C4C A;  5JXV A;  3SMS A;  3NVY A;  3DOA A;  4IBJ A;  3HRD D;  5HFY A;  3B9P A;  4IJF A;  1E6E B;  2BTW A;  1N33 M;  3KWL A;  1XXH A;  1N62 A;  3AJI B;  1NJG A;  5EZQ A;  1D4B A;  3GPU A;  4YSZ B;  1SXJ A;  2R46 A;  5EXT A;  4LRS A;  3GLI B;  2I38 A;  3BII D;  2W82 A;  4B3S M;  1OFF A;  5F3W A;  4L15 A;  2NMQ A;  4BOQ A;  1KSF X;  3IAM 1;  4NJC A;  4D8E A;  1C4A A;  2X38 A;  3SHG B;  3KOW E;  1WWT A;  3U6C A;  3ZYY X;  3C58 A;  1J7K A;  3BB7 A;  4LLG M;  2KEB A;  4NSO B;  2JA2 A;  2DWN A;  3KP0 E;  5C2T B;  4WWM A;  3NVZ A;  2WLB A;  3KLS X;  2H89 B;  1XMO M;  1SJH D;  1GOZ A;  2WXI A;  1IBX A;  2BNK A;  2ZAN A;  1IGC A;  4DR2 M;  1HZ5 A;  3MTV A;  3VR8 B;  5EP2 A;  2BJW A;  2WXM A;  2H1R A;  4LFA M;  2RDG A;  3GLI A;  1IY1 A;  4IBE A;  3T1H M;  4PDI A;  1QOA A;  1D2N A;  5EP3 A;  2IDY A;  4GKK M;  1WYG A;  3EA6 A;  2BJV A;  3U61 A;  2JYT A;  3BVM A;  3IAS 1;  2KDM A;  5FTJ A;  3FTD A;  1QVR A;  2YFQ A;  4OHJ A;  3SR6 A;  1QQW A;  3L4P A;  2LXE A;  1E9M A;  2E6X A;  2NTS A;  3I51 A;  2UUC M;  3FC4 A;  3C0R A;  3A45 A;  1N61 A;  2FNA A;  5FLX S;  3T3N A;  1IXR C;  4FVM A;  2WXF A;  5DNY A;  3CWI A;  4GIP A;  3MC0 B;  4ZPX A;  2INP E;  3BZD B;  2SAK A;  4R3D A;  1E94 E;  2M5Z A;  3AKZ A;  3T38 A;  5D3D A;  2JXT A;  1WSP A;  4LJA A;  1TGU A;  2K47 A;  1N60 A;  3BVG A;  1D5Z C;  3U52 E;  2G9H D;  3TWL A;  2W54 A;  4KKJ A;  2RPV A;  1JWS D;  3O13 A;  4LF9 M;  2AQ3 B;  2J53 A;  4GIT A;  3E9S A;  5KPZ A;  1QOB A;  2BB5 A;  1V97 A;  1CK1 A;  3J27 B;  1ZOY B;  1PM5 A;  1TH4 A;  3OWE B;  3PRM A;  2ICI A;  4RGM A;  2CJO A;  4WAF A;  2L09 A;  2HKJ A;  4LG2 A;  3FAH A;  3Q8A A;  1IGD A;  1XWI A;  1T5X D;  2XH9 A;  4WQM A;  1FO4 A;  5EP1 A;  3W9C B;  1JCK B;  4L78 A;  1BUI C;  5DYI A;  2BBC A;  3JAM S;  3EGR A;  4MM3 B;  3U6M A;  2N9K A;  3CF0 A;  2Y21 A;  3P4S B;  1V1P A;  2WXN A;  2QJL A;  3W31 A;  2V3P A;  3CF2 A;  1LV7 A;  3SFE B;  5ITX E;  1TKE A;  3ZJV A;  1I4W A;  2DXI A;  1GAQ B;  2INN E;  3B2F A;  1DOI A;  2LMC A;  2DHR A;  2JZP A;  1I4P A;  1QOF A;  3AE5 B;  1C1K A;  3VR9 B;  3KOX E;  1FCL A;  2Z8L A;  1L2C A;  1XXG A;  1YQ4 B;  3SAS A;  4BOU A;  1TDZ A;  5C1B A;  4QNM A;  1LO5 D;  4G4N A;  3DWG C;  2YQZ A;  1N32 M;  5JZE A;  4HJG E;  1L2B A;  4DV2 M;  1TS2 A;  4AZF A;  3RFZ B;  3I9V 1;  4AQY M;  2XZF A;  4RKX A;  3M6A A;  3GB1 A;  3AN1 A;  3LVW A;  4OW0 A;  5E26 A;  2F5S A;  2LWX A;  1RYJ A;  1L0Y B;  4A3V B;  1PJI A;  3CIR B;  2BS4 B;  4ZHP A;  4O1N A;  2N7J A;  3HHY A;  2YEP B;  3U60 B;  2R4E A;  4MH8 A;  4NRV A;  1TY0 A;  3KQ4 A;  3AED B;  4GUA A;  1RM6 C;  3QAU A;  7CAT A;  1VZ7 A;  3U4E G;  1GB1 A;  3AE4 B;  1ZAE A;  5TSS A;  2BT6 A;  3NUH B;  1ZXH A;  1W5T A;  2KAC A;  2G8L A;  1FFU A;  3AOE C;  1YJJ A;  2MJD A;  1L1Z A;  1XLP A;  1UNS A;  4AG6 A;  1ENF A;  5IWA M;  4B3R M;  1Q10 A;  5BPV A;  4AQ7 A;  2AQ2 B;  3R2T A;  5ITY A;  2JRI A;  1FMA D;  3J2P B;  1CQV A;  1VR9 A;  3HVZ A;  3VFD A;  1VZ6 A;  3HKP A;  2YR0 A;  5HG2 A;  4P6V F;  2J42 A;  5EXS A;  4TQ0 A;  5BYS A;  2QBY B;  1XLN A;  2WU5 B;  1K51 A;  5EE3 A;  2Y20 A;  1VJK A;  3R8F A;  3TPZ A;  3NWL A;  4KOD A;  3D8B A;  2W3S A;  3AB5 A;  3ZGZ A;  5EZS A;  1IUE A;  4RNA A;  3V05 A;  2HDE A;  2KZU A;  1C9F A;  1QAO A;  1KFV A;  1Z6T A;  2PKO A;  2C9O A;  1TY2 A;  5GKN A;  4LFB M;  4YHH M;  3PZ8 A;  4NAW B;  1JWA D;  3GRV A;  1Z5B A;  2Y0T A;  3IG5 A;  2YNM D;  4LF4 M;  3AE1 B;  1QYR A;  1PVJ A;  1GPX A;  1MX0 A;  2DYO A;  3RFW A;  4GMQ A;  2Z84 A;  1F2R C;  4G4O A;  3BK2 A;  4MGI E;  1JR3 A;  4OZA A;  3W0L B;  1JWM D;  2WQY B;  1PFD A;  3AE7 B;  4D8I A;  3KS8 A;  3FYC A;  3U6E A;  2D7H A;  4JV5 M;  2LFI A;  4YSY B;  1L6U A;  4IUM A;  3UZU A;  2L32 A;  1XNQ M;  2ZW0 A;  4RCO A;  5FR3 A;  1DGB A;  3T15 A;  1JML A;  2V4I B;  3U6L A;  2XEP A;  1QLB B;  3HHW A;  3LXF A;  4HEA 1;  3W2D A;  3RNV A;  4LGY A;  2ZAM A;  4RF0 A;  2JSV X;  2PVO D;  1AW7 A;  4X62 M;  5G5G A;  4B3T M;  3NVW A;  1HT2 E;  2CV0 A;  3KFU G;  4P16 A;  5FTM A;  1HXY D;  5BR8 M;  2NTT A;  1UGJ A;  2UU9 M;  1QF6 A;  1SBB B;  1PUT A;  2WDV B;  4DV3 M;  3IT6 B;  3LYY A;  3U6D A;  4DV1 M;  1NEN B;  5BMH A;  3SHF A;  3PXG A;  1IN5 A;  5KQ8 A;  2VQE M;  1VRA B;  4ARC A;  2EO2 A;  4LCB A;  3RGS A;  1WGK A;  2D5G A;  3VK7 A;  2ERC A;  2EA0 A;  4JXJ A;  1JW9 D;  1STE A;  2F4V M;  4HKZ E;  1R7R A;  3P1M A;  3P4R B;  1I4R A;  1JRP A;  4ZRQ A;  1IY2 A;  1PGA A;  3Q69 A;  1T6B X;  2B76 B;  1IN4 A;  3A98 B;  2WXP A;  3UGJ A;  2QEN A;  4L2Y A;  2C96 A;  4B7F A;  4IP3 A;  5AUK A;  3GP7 A;  2F5N A;  2RMM A;  1QKZ A;  1XCQ L;  1XCT L;  3AH7 A;  1NY6 A;  3WHK A;  3TRK A;  2MH7 A;  4NXN M;  2QCU A;  3H8H A;  2N0S B;  2Z4S A;  5JI3 E;  5MPO A;  1IM2 A;  4B7H A;  3FTF A;  1A70 A;  1K3W A;  3HU1 A;  5BMI A;  2CE7 A;  1L0X B;  1YUB A;  3KP1 E;  2JYE A;  3SAU A;  1JQJ C;  4GH9 A;  3A46 A;  3ABV B;  2K0P A;  1OFH A;  1N78 A;  2IGG A;  1FJG M;  4JI8 M;  1YN3 A;  2Y3A A;  3BYT B;  4JI0 M;  1SEB D;  1BXT A;  1N36 M;  2HHH M;  4B0E A;  3AE2 B;  4BLC A;  1V1O A;  1GL7 A;  2HCB A;  4AG5 A;  3AV8 A;  3AEC B;  4X64 M;  1TH2 A;  4BOS A;  2H88 B;  3BVZ A;  2Q5W D;  3ZJT A;  1QIL A;  1YSY A;  2FE8 A;  4GC9 A;  2WXK A;  3ZC7 B;  1I7H A;  4PT5 A;  2C99 A;  4XE0 A;  5BMG A;  4XWW A;  1DYQ A;  2MJE A;  4FCT A;  4L8R C;  4Q2J A;  4KLN A;  4LGM A;  3J81 S;  2PLP A;  2FOI C;  4HXD B;  4OU7 A;  1Q3B A;  1L6V A;  3HU3 A;  4DV0 M;  1L0V B;  4IBK A;  1ZDV A;  4RH6 A;  4YTP B;  4MGY E;  5LMN M;  1I4X A;  3ZH9 B;  3SFD B;  1D5X C;  3FUW A;  2DBY A;  4MAC A;  4C80 A;  2J4X A;  3AEA B;  2DWQ A;  5EE9 A;  1DGJ A;  5T8I A;  3HUI A;  4CHT B;  1ZE3 D;  2EKI A;  3H4M A;  1L2D A;  1YMH E;  1N34 M;  4CQN A;  1RWS A;  1NY5 A;  4JPS A;  2WXR A;  2YEP F;  5EXP A;  1PDX A;  3AE8 B;  1F0Z A;  1YN4 A;  2SEB D;  4LJ4 A;  3TWK A;  4YSX B;  3GQ4 A;  4LFC M;  3E56 A;  2LHE A;  3RGP A;  2OHF A;  2V0G A;  1DGF A;  2K3U A;  3W1S A;  1XHB A;  4MGZ E;  4LJ8 A;  1HQY E;  1SXJ C;  4PD2 A;  3TL4 X;  3R9X B;  1FNV A;  3I57 A;  4GKJ M;  3W30 A;  5H8Y E;  3K8Z A;  2UUA M;  2DVW B;  1ZDX A;  2L6O A;  4OVZ B;  4AKI A;  2J7Q A;  2UUB M;  3CF6 E;  2BYT A;  3GLF B;  1SE4 A;  3Q8E A;  4MT5 A;  2DWM A;  4I5S A;  2E5L M;  1VLB A;  1VZ8 A;  1JQ4 A;  4KX6 B;  4CGY B;  3FTC A;  3VKH A;  4XDD A;  2R61 A;  1AYF A;  3FTE A;  1G8P A;  5IZ7 D;  3W0F A;  3U6P A;  5JI2 E;  4QHS A;  1G3I A;  4AI6 A;  3U6S A;  1KFY B;  5D7G A;  1PYW D;  1ZPS A;  4L16 A;  1HZ6 A;  1SE2 A;  4DR1 M;  1YE9 A;  3GQ3 A;  1UUP A;  2WXH A;  3AE3 B;  4HL4 A;  5A2Q S;  5ITR A;  1IBM M;  3SEB A;  3PO0 A;  5HHD G;  1I4Q A;  1L1T A;  5ITX A;  4YY3 M;  1IN6 A;  3GLG B;  1IQP A;  3U7Z A;  5IT9 S;  2V1C A;  2Z7J A;  1Z59 A;  3TEW A;  4OVZ A;  4L1B A;  1HNZ M;  1MHH E;  4JYA M;  4IBD A;  4QHT A;  3GLF A;  1CJE A;  1J7B A;  3O65 A;  4DR6 M;  2K22 A;  2CHG A;  3KVW A;  3PZ7 A;  3NRZ A;  4LTU A;  1Z5C A;  1EU4 A;  3VLF B;  2CHQ A;  2X49 A;  3A42 A;  4DUY M;  3K2L A;  3GP1 A;  2EEL A;  2JWU A;  1SJE D;  3KXE C;  2G1E A;  1XEE A;  1TKY A;  3PRP A;  1C77 A;  1M4V A;  3E4R A;  4X65 M;  2XGN A;  3EIH A;  4HLQ A;  5LNK 1;  2DZO B;  2IJ0 A;  4LZZ A;  1FD6 A;  3KOZ E;  5FK9 C;  1PGX A;  2CV2 A;  1QAM A;  1AWD A;  1C4P A;  4AKG A;  3GPX A;  3SAR A;  4AS1 A;  2XSZ A;  3PNV A;  3W5U B;  4LJ9 A;  2FFJ A;  1K53 A;  1DGH B;  1DO0 A;  5FTN A;  4DV7 M;  2ACZ B;  4DR7 M;  4MGK E;  2DZN B;  2RGO A;  3GQ5 A;  2PIA A;  4A6Q A;  4IBG A;  1N75 A;  3PHW A;  1OQQ A;  1EE8 A;  2D7E A;  2J7O A;  3J80 S;  1NI3 A;  3L2A A;  1YN5 A;  3PFI A;  3AEE B;  4DXF A;  2M19 A;  5I4D A;  1VDD A;  3AOG A;  2VQF M;  1J7C A;  1C79 A;  1KF6 B;  2WU2 B;  4L23 A;  3K92 A;  1FEH A;  5BYR A;  3SYK A;  1UWX A;  3D8L A;  1HT1 E;  4JI7 M;  1X37 A;  4LF5 M;  4TQ1 A;  1SE3 A;  3TEZ A;  2PTL A;  3TWM A;  4M0D A;  2F5Q A;  4S12 A;  2LH0 A;  1DOX A;  4M9S A;  5LMU M;  3UI3 A;  3U60 A;  2P5T A;  3FD9 A;  3SMP A;  2XF3 A;  1DGH A;  3AL0 C;  4A8X C;  4EIW A;  3AEG B;  3P42 A;  1ESF A;  2WDQ B;  1QQR A;  2TSS A;  3T1Y M;  5KO3 A;  4ZRP A;  4OX9 M;  2Z4R A;  3SYL A;  4M9X A;  2KRK A;  1Q39 A;  1TS3 A;  1B1Z A;  1I4G A;  3M7G A;  4KO8 A;  2BB6 A;  1HEZ E;  1OFI A;  2QP9 X;  4D8B A;  2O5R A;  1SIJ A;  2K9X A;  2CU3 A;  4RGN A;  2JU6 X;  1GKI A;  2L7I A;  3W5V B;  4A9A A;  3C8Y A;  3MP9 A;  3PHU A;  1Z5A A;  2OED A;  3AE6 B;  3T3O A;  2QBY A;  3LQQ A;  1R7S A;  4WIP A;  5KQD A;  1K50 A;  4NZL B;  4FCW A;  4JI4 M;  2LGI A;  2HWK A;  5FTK A;  3PHX A;  3GS2 A;  2I2Y A;  2M0A A;  4US9 A;  2Z3X A;  2JX5 A;  3BOS A;  2CFO A;  3MJ5 A;  3AE9 B;  4YT0 B;  2DYM A;  1GLN A;  4Z6Y A;  1NYQ A;  1R2Y A;  4GDK B;  4M9Z A;  3NBI A;  2XZU A;  3AV0 A;  2L83 A;  2RDH A;  3FYD A;  3AMZ A;  1P7F A;  3BK1 A;  2LEK A;  3L28 A;  3IG8 A;  2VZK D;  2F5O A;  3GLH B;  3TQS A;  3VDP A;  2PMV A;  4GLS C;  2MEK A;  3RE8 A;  4I81 A;  3R8B A;  4WH4 A;  2GRI A;  3OTO M;  3FUV A;  1P7E A;  2WS3 B;  3TEY A;  1NJF A;  1JWU D;  3OQC A;  3KWV A;  3HHZ A;  4DQO C;  1QOG A;  2V1U A;  5IRE B;  4ARI A;  3URY A;  1NVI D;  1DOY A;  2R4J A;  3HVD A;  3ZQ4 A;  3B2G A;  3SFZ A;  3EIE A;  4MI7 A;  4PDG A;  2W3R A;  1SB3 C;  4L4U A;  1FM0 D;  4BB9 A;  5BYQ A;  1XF5 L;  1ZXI A;  4ZHO A;  1G4A E;  4IBC A;  3WHL A;  1NVM A;  1XXH B;  4GHA A;  4N58 A;  2BS2 B;  2AHM A;  2RGH A;  5FTL A;  4B08 A;  3L27 A;  4FD2 A;  2IGD A;  1UM8 A;  1IBK M;  4LF8 M;  2K5P A;  4DV5 M;  1QAQ A;  3ETR A;  1NSF A;  1KRH A;  4DXG A;  3PSE A;  2ONQ A;  3M0E A;  1IBL M;  4XWT A;  3DFZ A;  1FXI A;  2WNM A;  2GI9 A;  2VII A;  1YZB A;  1DO2 A;  2QIE B;  1WRI A;  1K82 A;  1E10 A;  2E3T A;  2HL7 A;  4ZYS A;  4ITK A;  3BYY B;  3FIL B;  3JR5 A;  3BY4 A;  3FUT A;  1EU3 A;  4C56 C;  3WCQ A;  4US8 A;  5G5H A;  1GB4 A;  3HU2 A;  1EWC A;  2LNH C;  2WXG A;  4G6Z A;  1ORY B;  4LRT A;  4MH0 E;  3VQI A;  4GDL B;  1IBX B;  1HQC A;  4KHP M;  3HJQ A;  3U5Z B;  4IJE A;  2I7N A;  1TS4 A;  4B0M A;  3SAW A;  4FWG A;  2UZJ A;  2QIL A;  1FCC C;  3VKG A;  1NNJ A;  4LF7 M;  3SBJ A;  3VRA B;  3TUO A;  3U2S C;  1T3T A;  3VK8 A;  1E7P B;  3HGI A;  1SXJ E;  4BBA A;  3U61 B;  4KGR A;  2R18 A;  2RKO A;  3FUX A;  2JTC A;  1TS5 A;  1PJJ A;  2QZ4 A;  3LB8 C;  2KWD A;  3GRR A;  3MHV C;  1KTK A;  5AUI A;  1FFV A;  5E6J A;  2OQ4 A;  4JE3 B;  1TKG A;  1KYI A;  1UWM A;  1K52 A;  3KOY E;  2BW2 A;  2KN4 A;  3FIL A;  4KGT A;  2C9C A;  2GB1 A;  3GRY A;  1XC8 A;  4JX1 C;  5FKA C;  2X4A A;  2L1A A;  3GPP A;  3ILK A;  1IXS B;  1GVN A;  3U5Z A;  2V6Z M;  1FRD A;  2KMM A;  4NL4 H;  4MGH A;  4HRO A;  3FUU A;  5DYG A;  1EWY C;  2QMT A;  1OQR A;  2XN9 C;  3TEX A;  4NSR A;  2QSD A;  1MHX A;  1DKI A;  5C3J B;  3RPF C;  2XLJ A;  3UJN A;  4NOO B;  2QEJ C;  1B9R A;  3FKE A;  1FXA A;  4EE2 A;  2Q2E B;  2JQR B;  4XZX A;  1ACC A;  1NHG C;  2ON8 A;  3J9C A;  2AX5 A;  4JI3 M;  4JN6 A;  5ITQ A;  2ZW1 A;  2DLB A;  2R65 A;  4DV4 M;  4JWU C;  1JRO A;  4IIW A;  1H6U A;  4WUR A;  2L52 A;  3P4Q B;  2XFT A;  4W5W A;  3GPY A;  4K0K M;  4LY6 A;  1HQR D;  2KRU A;  1KH0 A;  1D6E C;  4IBI A;  2C5R A;  3LQR A;  4GHL A;  1V1P B;  4AKH A;  2A5Y B;  1Q3C A;  1FIQ A;  4IDI A;  4TUW A;  2FBW B;  2ZAO A;  2V3N A;  1SXJ D;  3KS4 A;  1HR0 M;  4WW0 A;  3DWM A;  2WP9 B;  1FRR A;  1XLQ A;  1IY0 A;  1IN8 A;  3AEF B;  3J7A S;  3KSJ A;  4IBF A;  1XMQ M;  4JWS C;  4D80 A;  4YWG G;  1I4H A;  2ZBK B;  4LJ5 A;  3ZJU A;  1FNU A;  4LJ7 A;  2AGA A;  1QZM A;  2CV1 A;  1JWB D;  4TMA B;  2CJN A;  5EP4 A;  1ZUD 2;  1TYG B;  4XGI A;  4DR5 M;  3L26 A;  2QPA A;  3AOE A;  3AFH A;  3Q8B A;  1MU5 A;  2UXC M;  1G41 A;  2G5G X;  1YQ3 B;  4NAM A;  4KKI A;  2NQ8 C;  4FXC A;  4DUZ M;  1GL6 A;  1CZP A;  2WXJ A;  3L25 A;  3THG A;  1TJE A;  1J09 A;  4D2K A;  4QOS A;  3J7B A;  4QOZ C;  3IT4 B;  4HRS A;  1D5M C;  2XFS A;  4FCV A;  1ROE A;  5EJC A;  1NHW C;  2KQ4 X;  4D82 A;  4FWH A;  1L5P A;  2OPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...