4PT5A

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like protease
publication title Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 82
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4pt5A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4pt5A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4pt5A03
5E6JA 4RNAA 4OVZB 4M0WA 4P16A 3MJ5A 4PT5A 4REZA 5KO3A 4RF1A 4R3DA 4RF0A 4WURA 3E9SA 4OW0A 3MP2A 4OVZA 2FE8A 4MM3B
chains in the Genus database with same CATH superfamily
1PVJA 2Y5PA 2Y5BB 2DZIA 3NHEB 3L08A 3MHVC 4BFRA 1GCBA 5EE1A 2KLCA 2DAFA 2FS1A 4KODA 2HD5B 2KJ6A 1QUTA 2DI0A 1YQBA 2D10A 5EE0A 9PAPA 1IN4A 3FAHA 2M19A 1FD6A 1IXSA 1XF5L 2KOXA 3IG3A 3VH3B 2MROB 3IV2A 1VJKA 2J0KA 3E9SA 2KNAA 2WXMA 5L95C 2CE7A 4K3CA 4E74A 1L6UA 2W55A 4XWTA 2BDZA 2KFKB 1AYWA 2G8JA 1G71A 3L28A 4Z6YA 3RNFC 2CJNA 1TTEA 2JF5A 3M99A 3GB1A 4MB7A 1PXVA 1L2NA 4XGAB 3E21A 4YTMB 2DHZA 4TV3A 3B7QA 1M94A 3RD2A 4W9FA 1YE9A 1NL6A 4P7IA 1W5SA 3U7ZA 3HRDD 3AI5A 4B3SM 1N6ZA 4B7HA 1TKYA 4HJGE 4HRSA 3WXGA 2Z84A 2RDBC 3RNCC 2DWZB 1I4QA 4Q7JA 4DV3M 4CZWA 2Z8YM 3MC9A 4DXFA 3SASA 1AIPC 4JI8M 4DR4M 4EFOA 3IOQA 1PBHA 2L1AA 1YQ3B 1WJUA 3CWIA 2Z59B 1RAXA 4IW0A 2XU5A 1DGHB 4LGYA 2JVCA 3B89A 4M8MA 3W1YA 2I1JA 4F8CB 2E02A 1EWMA 2O6VA 2YJBA 2YQZA 3RCZA 2GFOA 3DBLI 2JZ1A 3BYTB 4JI4M 3L0WB 4HWYA 1R4MI 2ZVNA 3SYKA 4I6LB 1UWMA 1WGRA 3V60A 2F7DA 5CHFA 4OEMA 5D3DA 4YSYB 1EF7A 2G7YA 2ACZB 3IMAA 4QH6A 3RVWA 4LF9M 5FSWA 3NZUA 5G5HA 3P5UA 1VZ6A 3Q2AC 4L16A 3SMSA 4AUQC 1XXHB 1L2DA 5IREB 3RZWC 1IWDA 4JWUC 3RYTA 1AARA 1I7HA 3NRZA 3JAMS 2VDBB 2AU1A 4BBAA 1NYRA 4LRSA 4LJ8A 4XC2A 4KIKA 2KMMA 5GXGB 3TMPA 2NQGA 1BP4A 1TJEA 3KWVA 2M0AA 4I6PA 1R4NI 1QAQA 2ONQA 4W9GA 3N4CA 3GLIA 3EFCA 2UXBM 5H92C 3X0WA 1EU3A 3ZUAA 1J7BA 4GSWA 5GKNA 2XGNA 2BKRB 3AMZA 3KW9A 1WE7A 2YVCA 3K9OB 1RLFA 5DPSA 1UKFA 2ON8A 4XGIA 2EJSA 4S17A 2NR2A 5MPOA 1E8ZA 2LVAA 4JLCA 1VEKA 4WJPA 3GRUA 2F5OA 1DV0A 3PHUA 1WGNA 4DHJD 5EF4A 2CP8A 2RMMA 1BT0A 3WIMA 4AWJA 4BSQA 4JI2M 2WXKA 3P2BA 2PE9A 2ZVOA 4FHKA 3PSEA 1MHWA 1SG9A 4MH8A 2MLBA 5JHAA 4PYUA 4N79A 2DAJA 1TDZA 5EP4A 3P4QB 4LNIA 1WGYA 1K3XA 2QZ4A 2E5LM 3ZTDA 4IUMB 3USVA 2UUCM 1KF6B 2JZZA 3P5WA 4P6EA 1V8CA 3KWZA 1SJED 1XMQM 1JWSD 2L76A 4Y28F 4BOSC 4JE3B 4F7ZA 2BTWA 1WXVA 3KSJA 3VR9B 1STEA 2BNKA 3JSVB 4PD2A 1XHBA 5LMNM 2MBEA 2BYVE 4BBNF 4TUWA 2OJRA 2KZRA 5IA7A 1F4IA 2LVQA 2KZSA 3T1YM 1MHHE 2V4LA 3QK0A 3ZXVA 1I4PA 5EE9A 3EA6A 2XH9A 4PI3A 4G4NA 1F2RC 3GLFA 4G54A 4P6GA 2YEPB 8PCHA 1ZXHA 2UXDM 4MGZE 1FO4A 4P6VF 4BOPA 4D80A 2DXIA 4L4UA 1L2CA 1YJIA 4KLNA 4G4QA 2J7NA 2HL7A 3B2FA 3W1SA 2KDEB 4P17A 2R9CA 5KPRA 2NQ8C 4GDKA 3AEAB 4RGMA 1E9SA 3IG8A 2JWSA 4JYAM 1Q39A 1AU4A 2UWQA 1A70A 1T43A 2WU2B 3UINB 1NB5A 1WGLA 1IN7A 1TT5B 4FJCA 3GLFE 2L3ZA 1D5ZC 3A45A 4TSSA 1MEMA 4DR3M 3J9CA 1EF1A 4FADA 2CU3A 4PDGA 2L7IA 4LJ5A 2YJ2A 5DYGA 4C4VB 1Y08A 4HJKA 1FMAD 2CIOA 4I04A 2QMTA 3PPAA 2DWLA 4YYQA 1ET6A 2AHMA 4ITKA 4JI1M 4ARCA 3MORA 2M1MA 4YYUA 4KKIA 1PE6A 1F52A 5G5GA 1NVMA 3QA8A 2YJCA 2K3UA 4TQ0A 4LNNA 1E8XA 3BY4B 2UU7A 2D7GA 4NQLB 1VSNA 2N7EA 1OQYA 4FA6A 3D8BA 2J53A 2D3GA 4ZUXU 3VFKA 2FRAA 2V1CA 4LJ9A 1J5EM 3U5ZB 1M4VA 3FILB 2KN4A 3ETRA 5EP1A 1UD7A 4KGSA 2JXNA 3DDCB 4BB9A 2GI9A 2BTEA 3PHXA 4EE2A 2LRUA 5EZSA 2ZNVC 2CV2A 2KDFB 4GHAA 1OEYJ 3FRIA 4R71A 3RNAC 2HHNA 2Y0QA 2GRIA 3T3OA 3KQ4A 5A24A 5IWAM 1GKIA 4W5CA 1ZV1A 2LVOC 3PHWA 4ZRJA 1HUCB 4M00A 2JWZA 2L83A 1DGBA 1T6OA 4LY6A 5DPRA 5JZEB 3V6EA 1PJJA 1KM7A 1OTRB 2LFIA 3N9YC 2C7MB 3ZUNA 3N3KA 3NWLA 1AYUA 3DA1A 3UGJA 4AG6A 3ML8A 4G0NB 4IDIA 3B1LX 1N36M 3GLHE 3I5JC 4GKJM 3KUDB 3RNBC 3K9PB 3SHQA 3BK1A 1FXIA 1BGOA 1XKGA 1W5TA 4LFAM 4RM8A 3HM6X 2NQIA 4FIPA 2BQQA 3HK0A 1YSYA 1WJ6A 3Q8CA 2R65A 2YEPF 2KWDA 3WCQA 3VVWB 1TS3A 4LCDE 4B3RM 5C3JB 5E26A 4B08A 2DZJA 1YJ1A 4K3BA 3L26A 2CUZA 3H4JA 2D11A 2LTUA 2K39A 2DWNA 1PYWD 4IM0A 4GDLA 1AU2A 1AW7A 1DGJA 1ZAEA 3WAOA 1OAIA 3VTUA 2DC9A 3M6AA 4BKSD 5DFLA 1E7UA 4H2AA 2XZFA 4BOUA 2RGFA 2FYEA 1JRPA 3FYDA 1I94M 1QLBB 2BS2B 1L1ZA 3RFZB 3C8YA 1QVRA 2OOBA 2WDQB 4OZCA 1R5LA 2DZMA 2GBJA 3ZYYX 1ZQ9A 3AEGB 4PYZA 4GEWA 1D0MA 4NJ7A 1N77A 2FIDA 4BKGA 3N30A 2BYEA 3TPZA 1WR1A 1J19A 3AH7A 4GC5A 1ZPSA 2RPQA 3SAWA 3DVNV 1X9YA 3IUTA 2LI5A 2AWTA 1KJTA 1LFDA 4YHHM 3GCBA 1HA5A 2TSSA 4OVZB 1V1PB 1MVKA 3U4EG 8CATA 1PPDA 1J7CA 3NUHB 2XZUA 2DWQA 2FFJA 2JZ0A 4RH6A 4ITQA 3TEWA 2JXTA 4BOZA 3A4SC 3FYCA 4MEMA 5L8RF 4N4ZA 3KW6A 4JI3M 3IVFA 2NVUI 3V6CA 3GLGE 3BK2A 4NOOB 4B9KA 2L8JA 2ERCA 1LO5D 4FJVB 1I4WA 2ZNVB 3FTCA 4Q8HA 3UGBB 2R2OA 2DZNB 4LF6M 1ATKA 4BS5A 1V6EA 2M56B 3FUXA 3DBRB 3AEEB 1OAOC 1ORYB 4KVGB 4AOFA 3W68A 3KXEC 3AULA 1HNXM 2KLGA 2WX0A 2GBNA 1VLBA 4ICVA 4KO8A 3A1QB 2E01A 4N58A 3AE9B 4LJAA 3K8UA 1WJ4A 3OWEB 3SATA 1IN6A 2W3SA 2K1FA 1IGDA 4ZRIA 1VR9A 2D3AA 1GNUA 2DZZA 2WZJA 4HROA 3RULA 4GIPA 3U7DA 4KX6B 4LTUA 1DOXA 3D6SA 5FK9C 4AKGA 5H8YE 3MC0B 2Y21A 5ITQA 4NPNA 4FWGA 3TEYA 2QENA 2R9NA 1SXJD 4A20A 1ET9A 3AE4B 2V6ZM 1UNSA 5G55A 1J7AA 2ZTDA 5J18A 1G59A 5DPWA 3O65B 4XR7A 1TS2A 5A2QS 1F1HA 3CSFA 3A9KA 4XK8F 1WM2A 1TDHA 2KKCA 2VQFM 4MH0E 3IBEA 5HI1A 2INCC 4YYWA 2JY8A 2KNZA 3ZKJC 3M7GA 2NPTB 3CF0A 1PJTA 4IBBA 3KFUG 1Q6KA 5CVNB 4DV2M 3NVWA 3PGEA 3QT4A 3HM3A 3NS8A 4RGTA 2UYZB 3PREA 1VEJA 2R9OA 1C1KA 2PJHA 5AEKB 1TU6A 4D81A 2X49A 1MHXA 1QOBA 1TS5A 4NAWA 3LW5F 2AL6A 1FNNA 2IDYA 3LMMA 2RR9A 4W9IA 2C60A 5EE3A 1J8CA 4HCPB 1QMYA 3M62B 4AXLA 1PJQA 2QBYB 4Z8XA 2ZZPB 2AYOA 2F1GA 1KFXL 1PADA 2KQ7A 3LCVB 4NZLB 2DENA 4MGIE 1UBIA 1F2RI 1FNVA 4MT5A 2DCAA 2QSDA 2R6FA 3L13A 1UWXA 2G1EA 3HX3A 2EO2A 2B76B 1T0SC 1FFUA 2XK5B 5E6JA 1P1AA 4XUIA 3UJNA 3T6PA 3AI8A 3SR6A 1TBEA 2WXPA 4IBCA 3DWGC 3T8MA 4OHJA 1AU3A 3P63A 3B9JA 3PZ7A 2H88B 3KW5B 3S3QA 1IY1A 3NBXX 4BKSA 4IBJA 1Z5BA 4RGNA 3PBHA 1E7VA 2P86A 1IPGA 4PP2E 1QKZA 4HXDA 3B21A 1DOIA 4LZJA 2BS3B 2N1WA 4LG2A 2LH0A 4HPPA 3MTNB 2WHIA 3RVXA 2CB5A 2CKHB 4X62M 4KT0F 4MM3A 1A5RA 2O6VD 3DCGA 1MDWA 4CO7A 2IPKD 5J2RA 2WXLA 2JPHA 1YN5A 3RN9C 3GO8A 2VF7A 3WHLA 2F5QA 1BUIC 4MACA 3HJ8A 4LJPB 3KYDD 3DOAA 3T9LA 1N63A 3HHIA 1PGYA 3IHPA 3WA0A 1P7FA 3TUOA 2QCUA 4I5SA 3ZQ4A 1EWOA 1OGWA 1R2ZA 3M63B 2KANA 5LXHA 2FBWB 4I6NB 4Q2JA 3RT3B 3U8EA 1XNRM 2JZPA 1YVBA 2LWPA 3R66C 4J3OD 2R61A 2J7QA 1QOAA 1QDQA 4CDCB 5JXVA 2MJDA 3BCNA 4NXMM 3EIHA 4OU7A 3GRVA 1ROEA 3HD3A 3QAQA 1P0RA 2K9XA 4N8WA 4HK2A 3DVGX 4KLBA 3HWSA 3OAWA 2R62A 4URKA 4OZAA 1BVSA 7CATA 2DCCA 1HXYD 2JYEA 3GE8C 3H9DA 3CMMB 3V61A 4ZHOA 2VHSA 2GHUA 2PREA 1GB1A 1IN5A 3B7ZA 1WHCA 4REZA 4W4UA 2L4EA 3I04M 2ZPYA 1P98A 3CBJA 2LGYA 2R9MA 3K8ZA 2DZOB 3DFZA 1T0QC 1FRDA 2N7JA 4CDEB 2M8SA 1FRRA 5KQDA 4DV5M 1VZ7A 3TL4X 3PRPA 1Q10A 2HE7A 3HHZA 2ZCCA 5CTRC 1RM6C 2EMSA 4CJ6A 4P1BC 2MX2A 2LXEA 4NSOB 2F4VM 4X57B 3C19A 3J7AS 5EZQA 4LFCM 4LJ6A 3R2IA 3TQSA 4AKHA 2V0GA 3ZJUA 1SXJA 2FTDA 2YJ8A 5C2TB 1HQYE 4E3CA 4KDLB 3F92A 3ZNGC 4L8RC 2FT2A 2XFSA 4FWHA 2BVCA 3A9JA 2I2YA 4M9SA 4RF1A 2ASQA 2L52A 4GU2A 3HIZA 2X38A 3AJIB 4G6ZA 1GLNA 2R0IA 4L15A 1N5WA 3MHSD 2PMVA 5AZGA 1PPOA 5FTLA 1PGAA 2LVPC 2IZVB 4AJYB 3PRMA 2INNE 4L23A 4W9HA 4MZSA 1SXJE 1F77A 2C9WB 1K3BB 1SNKA 2EKIA 4ZPXA 2SEBD 4J6IA 4B3TM 1C79A 4AQ7A 1WJNA 2WXNA 3IEJA 4RFBA 4KSLC 2G3QA 3W5UB 1CK1A 3Q8BA 2ATOA 4ZDVA 1A5TA 4RKUF 4MGHA 3HHXA 1E32A 5EXXA 1GC6A 1HZ6A 2L7RA 3ALBA 1M6DA 4WQMA 1TTNA 2JYTA 3OVZA 2JWUA 1JWAD 3KYCD 1SBBB 2QDFA 1SE9A 5AZFA 5H37D 3ZIMA 1JWMD 2XU1A 5IZ7D 3CF6E 4GRIA 3ZRCA 3H8HA 3ZGZA 3TWMA 4M0WA 2MEKA 2KK8A 1L0YB 3GP1A 3QX1A 4RMAA 4FJYA 2VIIA 2DHYA 3KOYE 3Q6BA 1QILA 2KRKA 5HFYA 3K24A 4W5BA 2JRIA 2XBBC 2RGOA 1Z2MA 3WAMA 1QAOA 5E6NA 2I38A 2C96A 1XLNA 1KRHA 5DPTA 3FRHA 2Y3AA 4IG7B 1V5OA 2JT4B 3MP9A 3N1ZC 2CS4A 1T0YA 3VR8B 1KFYB 2DOSA 2QCZA 4FHJA 4EKUA 1SSNA 3GQ4A 2Z0DB 1BY8A 4JIOU 3GE3C 1UUPA 4GGQA 3PZDA 4GMVA 3BB7A 2MSED 1AUAA 3BC3A 2PNSA 2M0XA 4CQNA 2QIEB 1GPXA 1NO1A 3ZXRA 3FTFA 4YSXB 2O25A 1Z59A 3BZDB 4WW0A 1FM0D 1Z5AA 1PCIA 3FE3A 2BB6A 1UGMA 4RY2A 1J7KA 1NBFC 1MG8A 1TLOA 2K6QA 1OKSA 3MJ5A 4DK5A 2HTHA 2DC7A 3VUWA 5LMUM 2ICIA 3K92A 2YJ9A 1KYIA 3H8BA 3HY5A 3GZNI 2H1RA 2AUZA 2FRQA 5J17A 2G6DA 3E56A 4A90A 1GECE 3P5VA 2QP9X 4C7ZA 3TNXA 1R7SA 4DMXA 1N75A 4QHSA 1E7PB 1P9DU 1XLOA 2LEKA 3LYYA 4F2LA 3AKZA 2DNFA 2SAKA 1CB5A 2Z3XA 4L6V6 3J81S 1L6VA 2CRUA 2N35A 3BYYB 3OTOM 2CV1A 2DAMA 3MC8A 3P4RB 1IBLM 2JY5A 4IWPA 5DYIA 1YZBA 2L2DA 2OP3A 4WA6A 1VQ1A 3FD9A 3SD5A 1YX6B 1NHGC 3GLIE 1EU4A 2Y5BA 3NHEA 1WH3A 4IP3A 4QNRA 2WX1A 2JY6B 1H8CA 1E8YA 3QWZB 1E6EB 4B6WA 5LLIA 4LF4M 2HD5A 3JW0X 4QNMA 1JROA 2P5TA 3PHXB 4DWFA 5IAAC 5C1BA 4F1SA 3HHMA 4ZTBA 2PVOD 2QSFX 2FUHB 3J80S 2EKFA 1RFKA 3GLHB 4NQKE 4PS8A 3O13A 1N34M 3QJ3A 2KFKA 3V3XA 2AIMA 1CS8A 3DZDA 3LB8C 5PADA 2AEHA 2PADA 2V3NA 2KZUA 4II7A 3VDPA 2R18A 2KX3A 1EWLA 3MHSA 4DV1M 1EE8A 2OULA 2FCQA 3I06A 3MHHA 2FH0A 2K6DB 2BBCA 5CHVA 4LNFA 1WGKA 3PNRA 2V1YA 1FPYA 1TH2A 1JR3D 3VLFB 1DEUA 3QARA 2MP2B 4LNOA 1IN8A 5KPZA 4BLCA 4LJOB 5KHOA 4XZ4A 1QOLA 1IBXB 3EUB2 3H7DA 5BR8M 2BWEA 1IP9A 1FNWA 2XNAC 1OIPA 1QAMA 1HE8A 2N9KA 1MEGA 1DGGA 1YNTE 2D2QA 3NZ3A 1MN3A 1DGHA 4RM9A 3P1MA 2PIAA 3EFUA 5FTNA 5BYRA 2RDGA 4WH4A 4ANUA 3U6QA 4DHJB 2UZJA 2C99A 3N1XC 1MG4A 4O1NA 2ZTCA 3E1ZB 2KN5A 2JSVX 1F9JA 3OF9A 1IYFA 4AKIA 2MBOA 2V1UA 2N0SB 3AEFB 1GJSA 4ZOHC 3KUCB 3DHHC 3HVDA 1DYQA 2KJRA 3L27A 1B1ZA 1TH4A 3AE2B 3NS1A 1CQVA 3DBHB 1TGZB 1XXHA 3KLSX 3PVSA 1JMLA 3LVVA 1HZ5A 1E90A 2OQ4A 2CWBA 3ZO5B 5ITTA 3C58A 3FUTA 4KDIC 3CSTA 3MJWA 4XDCA 2JY7A 2UU9M 2IBIB 1QQWA 2KHWB 1YT7A 3L29A 3GLGB 1WE6A 1PGBA 3I51A 2WDVB 4F1IA 1NLJA 4DDGD 4UN2B 3U6CA 2I7NA 2CFOA 4BPVA 3WXEA 2CHXA 4OX9M 2JU6X 2L4FA 3K9OA 4A3VB 4X64M 4A3OA 3BPMA 2D7EA 2IJ0A 2XSZA 1FNUA 2G8EA 2DWMA 1WZ3A 1X1MA 3WXFA 2O6XA 3AM9A 2BU3A 3Q8GA 4ZRQA 3SC3A 1GL6A 4KKJA 3PT2B 1TYGB 3AEBB 2WYQA 3AEDB 4ZRKA 2HKJA 5EXPA 5TSSA 1U9XA 4X6JA 3APFA 1NNUC 2F5PA 2RPVA 1ZCMA 4D8EA 2OJWA 2CHVA 3SEBA 1NYQA 4WJOA 1WZ0A 1TKGA 2FUG1 4AI6A 3PS6A 2IGGA 3E4RA 4QRGA 3DBSA 3CIRB 4LJ7A 2AL3A 3KS8A 2DAIA 1I4GA 1U9WA 4IUMA 3U6DA 2KW0A 4K7WA 2EMTA 3KOXE 3AFHA 3W0FA 1UGJA 3R8BA 1I42A 1XLQA 4E71A 2HXZA 3J7BA 2ZAOA 4W9EA 2LGXA 3L17A 1QOFA 4EZJA 4CGYB 4BOQA 3JSVA 2D5GA 4GB9A 1WGHA 1ME3A 4JXJA 2O01F 3IG5A 2Y5CA 3IFUA 2XU4A 1WF9A 2VH1A 3QJZA 2O2VB 2X4AA 4NAMA 1YALA 4IM2A 2MCNB 2QQ8A 1FXAA 2FOIC 1SJHD 3VUYA 1G4AE 5TR5A 3VKHA 2NBUA 2WXOA 1N78A 2JQRB 1ZIVA 1PM5A 2WWZA 1VRAB 1NV9A 4PDIA 1JW9D 2LXCA 1VG5A 2AX5A 4EIWA 3ZJTA 2R6NA 3NVZA 4C7YA 2GBMA 1SE3A 2XEWA 2EELA 3LDZE 3QAUA 1GVNA 2CV0A 1NENB 4LDTD 4RNAA 1ITOA 3FUWA 1TR8A 1GL7A 1KSFX 4AXMA 2INDC 3Q3OC 6PADA 3RUIB 1CSBB 2CEAA 3FTEA 2CHWA 5FTKA 2MRPA 4FN2A 4M9XA 2DC6A 4NC6A 1HJPA 4MJSB 4K1RB 4C4VA 3UIPB 4B0EA 3RZFA 1P3QU 1JR3A 2LVNC 5LXIB 1GC7A 4FLHA 1Q3BA 2DZKA 4W9DA 2JP7A 4QRVA 4YSZB 2DBYA 2AYOB 3UZUA 4IBEA 3APCA 2KWUB 4JI5M 1SXJC 1MIRA 2O5RA 2QHOB 4EUTA 2RSUA 3O0UA 3W31A 2WSEF 4ANRA 4DUYM 2QJLA 1CVZA 2C5LC 1KFVA 1MX0A 2B1MA 1V86A 3AE5B 3VRAB 3IXSA 3CGWA 2XFTA 1C1YB 1SXTA 1ZE3D 2JUOA 4HDOA 1C9FA 2ZPNA 1QXPA 2IY0B 1RWSA 1OIZA 3KKUA 3U6EA 3VFDA 1MU5A 1JR3E 3U5ZA 1K51A 2J42A 3FILA 4D8IA 2WLBA 4NY0A 3FKYA 1QZMA 4BKTA 2GQFA 3IT4B 2W3RA 1VEGA 2FAZA 3HVZA 4YYVA 4XX5A 2ZBKB 2FO5A 2MGWA 1E8WA 1ZUD2 3AE7B 2QC8A 3GPXA 2ARYA 1WR6E 3DVNU 3PLUA 1GLOA 2NQDB 4I8OA 1TY0A 2Q2EB 4DHZE 2M17A 4ACFA 2BWBA 1PPPA 4KGTA 1ME4A 5EP2A 1Y8GA 3AN1A 2BPSA 1D5XC 1EIJA 5ITYA 3PLVA 1L0VB 2CHGA 3U60B 5JZEA 1OTRA 1Y8RC 2KD0A 1WGGA 2L0FA 2HDEA 1HNZM 2KXJA 3C0RB 3C9PA 2JNHA 2QEJC 3PFIA 5FPWA 4QOZC 1BQIA 2C9OA 1R6BX 3K9PA 2C0YA 4BOSA 4HWIB 1IY0A 3NVVA 4G3XB 4HEOA 1VCBA 4D2KA 1SB3C 3P4PB 3ZNHB 2ZW1A 4DUZM 4YVAA 2VF8A 2KTRA 2NTSA 5JH3A 3VRBB 4MDKE 4ASWC 4NL4H 2DAKA 1PDXA 2K0PA 2MBHA 1PIPA 3TEZA 2MH7A 4W5WA 3HHAA 3TSSA 3N1YC 5EJCA 1DOYA 2GNOA 4LLGM 3FTDA 1KLVA 4FW9A 1IXZA 5E6OA 3A4RA 1QDTA 2DC8A 1WX7A 1KOTA 2V3SA 3DF0A 5F3WA 1XMOM 1QYRA 4YXDB 5L83A 3M95A 1V2YA 1UZXB 4FXCA 5BMIA 1X37A 5I4DA 3RI7C 4LF5M 1THEA 4DBGB 1I4HA 3BOWA 2K25A 3Q69A 1K82A 4IBKA 3Q8XA 2LHCA 2HJ8A 4WP2A 2KA6B 1L8QA 3TJPA 4FCTA 4PADA 1Z5SB 2FQ9A 2FIFA 1YK7A 4WWMA 3OJ4B 2B1NA 2KMCA 3NG0A 4HVBA 3I3TA 1YD8U 3AOEA 1ZMVA 2KACA 4ZRPA 4BQVA 4RGOS 1D0LA 4AW4A 2E6XA 3EECA 2D07B 3KP1E 2NBVB 1SF0A 1OFIA 1SXJB 1T5XD 3N32A 1IGCA 1V80A 2FUDA 2KO3A 3B08A 1Q3CA 4OVZA 2J52A 5C18A 2AUXA 4DV4M 3U61B 3HU2A 1K3WA 1XWIA 2ZCBA 1E0ZA 2LBCA 2CJOA 4EZKA 4BVUC 2FCSA 4CHKA 5BPVA 1JQJC 2N9XA 2AYNA 3HUIA 5FTMA 2JZ3B 2REXA 2Z8LA 3SFDB 3RVVA 1HQRD 4JGHB 1ZKHA 3ZCBB 3U6SA 1TGUA 3OG5A 3RNEC 3FKEA 3NJTA 2BYFA 3QQ8B 3VUXA 4C00A 4GKKM 5EQTA 1ZMWA 2DHRA 3HU3A 3GRYA 4LGMA 2LGIA 3JYUA 5FR6A 1D3ZA 2LVOA 1WXAA 4MI7A 1GB4A 1N62A 3QSDA 4FCVA 2PPHA 3AU4A 1IXSB 3JR5A 2RDHA 2KDIA 2WXFA 3A1QA 2R2QA 3IAS1 2LGDA 1H6UA 2JX5A 2WXRA 2MR9A 3KS4A 1VJVA 5BO4B 3BINA 3K9MA 1WXQA 2IPPB 1WGDA 4GUAA 3Q8FA 2OEDA 1WWTA 1HNWM 1C76A 3W2DA 1ZP0B 5IN7A 2WDTB 1R2YA 1V9JA 3DBRI 2MQJA 4WWPA 4WJQA 4DQOC 4YV8A 1DGFA 1GG3A 3H89A 2QILA 3VXWA 3DBLB 2ZANA 3BWKA 1KTKA 4GIVA 1QQRA 2KEBA 4DXAB 3O65A 5BYQA 4A8XC 1NPZA 3AE1B 3JVZX 3DQVA 4IIWA 1L1TA 1WYGA 3NVYA 1C3TA 2BWFA 2IO0B 4N6EB 4K7CA 4UDUC 3J2PB 2NPTA 3GPPA 3BOSA 4P1CC 3WHKA 2INPE 3ONSA 5ITXA 4CISA 3W1SC 2IYDB 3VK7A 2FCMA 4IBFA 5FLXS 4WURA 4IWQA 4IBIA 1FH0A 5AZHA 2NQAA 3MP2A 1Q1OA 3H1UA 4OZBA 2Z7JA 1LGRA 1NJGA 1U9QX 3B79A 2O6VB 4GHLA 1VD2A 1U4AA 4CDFB 1VDLA 2VZKB 4QHTA 3KVWA 1CQDA 5HHDG 3UMMA 3M3JA 1VZ8A 1ZGUB 2QBYA 1IY2A 3Q8EA 3NBIA 2F5NA 1FCCC 2WXIA 2WSFF 3Q3NC 1SEBD 5ITXE 1YX5B 2DX5B 1K52A 3LQQA 2BB5A 2APLA 4S12A 1GAQB 2XK5A 4IC7B 1HTOA 1G6JA 1CJLA 3HHWA 3BWUD 3B0AA 4ARIA 1QF6A 3U8ZA 1BXTA 1YN3A 3ECIA 3V62A 3VH4B 2X8AA 4FD2A 1E94E 4KIKB 2MH8A 2LUMA 3TMPB 3T15A 1O0EA 3KSXA 2PW9A 4ANWA 2BJVA 1YK8A 3GLIB 1YN4A 4ANVA 4B7GA 4KZCA 2WS3B 4EOYA 2Y6EA 2DAGA 4MSQB 2AS8A 3VTWA 1NSFA 2KNBA 3B7NA 4YT0B 2M5ZA 3AB5A 4EEWA 4YY3M 2F5SA 1CJEA 4NJ6A 4RKXA 3AE3B 3MTNA 4YWGG 4USAA 1G41A 1LTMA 2DJFB 4Q8GA 4CYEA 2LGSA 2XN9C 1ZW7A 3RMKC 5E6PA 3IECA 4XZXA 3V05A 3H8CA 4RCOA 3RGPA 1VDDA 2BKFA 4KHPM 1WRIA 3DVGY 3GOEA 3ZDTA 2L05A 5JHBA 2Y0TA 3SAUA 2K5PA 3RGSA 3PSEB 1SGHA 4DV6M 3H7PA 3ZQJA 2NS5A 3SMPA 2VQEM 2R44A 4FCWA 5HG2A 1EWPA 3SHFA 3SYLA 3UI3A 1HEZE 2BS4B 2LMCA 3BBAA 2G45B 3AE8B 2OOAA 1TZOA 1WYWB 4W9LA 4JI0M 1NY6A 2LUEA 5DCNA 1YUBA 3PDFA 2BTWB 1FFVA 1JQPA 2Z4RA 4FBJB 1UELA 3GQ3A 1QUSA 3HU1A 3F5VA 3P5XA 2K8HA 1OQQA 5IP4D 2YR0A 4JN6A 4MGKE 2N1VA 1MJDA 1ZOYB 4LNKA 3ZH9B 1NY5A 1FIQA 3GLFB 3VKGA 1WMHA 1OJLA 2JA2A 2RGHA 2Y20A 4LF8M 5EP3A 2DYMA 3BVZA 2YFQA 3PO0A 2BYTA 1D5MC 1MJGM 2UUBM 3TE6A 1QOGA 4HLQA 2UXCM 3I9V1 4NRWA 2H5XA 1LM8B 3APDA 1IQPA 2KXEA 3OLMD 4HKQA 1ICFA 3R7QA 2KJHB 4TMAB 2XSZD 4HPMB 3ZNZB 4A9AA 1KHQA 1C4PA 3UQAA 4GDKB 1OFHA 4YYSA 3KX1A 2IGHA 3UQBA 3HGIA 1L2BA 4N9F4 1FXTB 2I1KA 2MW5A 3BVMA 2LD9A 5EDSA 2C98A 3J27B 3H7SA 4LFBM 3M0EA 4IM3A 1MI0A 5IT9S 3TRKA 1SP4B 4AQYM 3PTFC 1KHPA 3PNVA 3OQCA 2GBKA 1CV8A 2WDRB 1ZDXA 4HLEA 1EO6A 1F2AA 5AUIA 3RNVA 3TWLA 3X23A 2X8XX 5K16A 2DZYA 1E10A 3ZC7B 1GABA 5JA7A 3ZRFA 1YLAA 1ESFA 1Q5WB 3W9CB 4BZAA 1JWUD 3P42A 2KDMA 2K9DA 2L6OA 1WIAA 3GRRA 3TIXA 4C56C 1ZXIA 2RKOA 2KC2A 1N33M 3GP7A 1V5TA 4XYCA 4JWSC 2NMQA 3L10B 5CHTA 3CF2A 3P4SB 1I4RA 3AOGA 1D0KA 3NZSA 4JI6M 2JXXA 3I01M 5CVOB 3U30A 1CMXB 1WI0A 4NNJB 2MBQA 4NXNM 4XDDA 2L7HA 2KAJA 1U5IA 2OZ2A 3ERVA 1V33A 2K8BA 2IO3B 3LJ3A 2K22A 3BIID 1EWCA 4I81A 2WSCF 3SU8X 3PHWB 4IKGA 2E3TA 3TL5A 3D32A 3V6EB 2HHHM 3DHIC 1WX9A 2NCNA 3B74A 5D2MB 2WNMA 4IJEA 3AL0C 1EUVB 2KVRA 3N3KB 2CR5A 4M8NA 3PNYA 1ZMUA 2FE8A 5KQ8A 1HT1E 2WXQA 1WM3A 4JX1C 3WALA 4DV0M 4GLSC 4EZLA 2ZM6M 1H4RA 3SDLC 3KH0A 2W82A 2AQ2B 1FEHA 4QRXA 1GUAB 1OQRA 1PJIA 2HWJA 2N9EB 3W5VB 1FJGM 3Q14C 3MK6A 2UUAM 1RYJA 2C9CA 4WWNA 4C80A 3OJ3A 1XC8A 3Q3FA 2LRWA 2ZJDA 4ANXA 5D7GA 3A33B 2LXAA 1UF0A 3R2TA 1UM8A 1L7YA 2NBWB 3QIJA 1S3SA 2KTFA 3KWBX 4IJFA 3L54A 1AYVA 1YOVB 2FNJB 4L78A 5CVMA 4GDLB 3HJSA 3ZJVA 4DR2M 2C7HA 2LHDA 1NI3A 2DCBA 1DO2A 1RU3A 2M4NA 2BDLA 3VK8A 1EF5A 3QYBA 2JRHA 1V1OA 1RRBA 1XXGA 4YTPB 1AN8A 2IO2B 5F02A 3TBLD 1Y4HA 4OW0A 4NSRA 1Y56A 2OOBB 2V4IB 2G8LA 1MPEA 1TS4A 2PBHA 2L09A 2MJ3A 5BMGA 5C23A 1I35A 2AGAA 2VH2A 4X66M 1KLUD 3L25A 4R7GA 2FNAA 2EUCA 5ITUA 1GO5A 2BW2A 3IFWB 1WR1B 3UIOB 1P3QQ 3R9XB 3SHGB 5FR3A 1F29A 4P16A 3AOEC 4LRTA 4B7FA 5C1ZA 3CH3X 1V49A 4B3MM 1XXHE 2L0TA 4QOSA 4A6QA 3GQ5A 1IUEA 2ZEQA 3T3NA 2MBBB 1KH0A 3GS2A 4IOIE 1TY2A 5FTJA 4WIPA 3MHZA 3T38A 2DAEA 1C4CA 2XEPA 3IT6B 5D6JB 1MS6A 4K0KM 1XCTL 2PTLA 2LVPA 1Q02A 2ZW0A 2LASA 3PRZA 1V34A 1WRDB 4DHZB 4MELA 3Q8AA 3MFGA 3FUUA 1QZEA 3HJQA 3H4MA 1NDDA 4KSKC 4W9JA 4BOZB 4AZFA 4BAXA 3U6MA 4WAAA 2ZAMA 3V6CB 3LFYA 4GOCA 2YLMA 1UBQA 1JQ4A 2E03A 2OPFA 2JY6A 4CIZA 4II2B 3OISA 3QWLA 4IBGA 2EA0A 1ENFA 5D3IB 2JUJA 3ABVB 4ICUA 5KPTA 3W30A 2KHHA 5BYSA 3AE6B 1FCLA 2KDBA 2W54A 3GLHA 4GH9A 4LJ4A 3F75A 1N61A 4OELA 3A42A 2VHFA 2EKKA 3L16A 2PEAA 1QT9A 2MWSB 3WANA 2QNJA 5T8IA 1WSPA 1JB0F 3IHPC 3W67A 2GLSA 3TEXA 1DF0A 1CZPA 1JALA 4WJNA 3PZ8A 1C78A 4PT5A 3U6OA 3UF8A 1N5XA 2KC1A 1XO3A 1E9MA 3C3DA 2V9HA 2LWXA 2GOWA 2MP2A 2HAKA 4D8BA 4KGRA 3I4VA 5ITRA 2ACTA 4NRVA 1IBXA 2J7QC 2Z4SA 1NNJA 2AVWA 1CUKA 2K6BA 1WJ7A 3B2GA 1CPJA 5IO9A 2GB1A 4K81A 2JQGR 2EKEC 3A9KB 2KTRB 2KWVB 3IAM1 1V92A 1HTQA 3KSEA 2K8CA 2HJ1A 4HCNB 2KT7A 3AV0A 4GMQA 2A5YB 5DNYA 2R45A 1JRUA 1A6RA 1ISNA 4JI7M 2IY1B 1TKEA 4XE0A 1NHWC 3AXCA 1AYFA 3TCAA 4MZOA 2AQ1B 7PCKA 3DPDA 4NAWB 2DVWB 2D3BA 2DNAA 3MTVA 3BPFA 2A4ZA 2C5RA 2HH5A 3W0LB 3RNGC 2WBFX 5CHWA 4FWDA 3KWLA 1PJSA 2J5YA 3L2AA 1JWBD 4WQOB 4BS6A 5JI3E 3VDZA 1PQSA 4W9CA 4B95A 4US9A 3K2LA 4HPLB 2DENB 1G8PA 5KHQA 3C9EA 4K7UA 3GPUA 1RFAA 4A5UA 3U6LA 3Q3MC 2G5GX 1F0ZA 2P0RA 2MHJA 4LK0M 3BY4A 1WXMA 2IBIA 3VHTC 3I3TB 3ZDMC 3KFQA 3Q3JA 4GITA 1IXRC 1T0RC 4L2YA 3OF8A 1S3SG 5AUKA 3GLGA 4PS7A 1DO0A 3RPFC 1BMLC 4QAYA 1XD3B 4PK1A 3KOZE 1NQCA 2YNMD 1WXSA 3AV8A 3DBHI 4TQ1A 1G3IA 2J7OA 4I07A 2WGSA 3AECB 3PW3A 1C7YA 1L4DB 2GBRA 3O1GA 1N60A 1Z5CA 2FCNA 4LDTB 1DKIA 4R3DA 2J0JA 4HXDB 3CTWB 3R8FA 2OO9A 4LCBA 4IWOA 3CBKA 4JPSA 3PT2A 4G4RA 1I4XA 2CU1A 3BVGA 3ILKA 4DV7M 3R3MA 3EC8A 3QYEA 3VQIA 2PVGC 2B3TA 3NY5A 4ZYNA 1K8RB 4MM3B 4OVVA 3LVWA 1XNQM 1S1QB 1GJZA 2E00A 1E5WA 3VAWA 1NI2A 2G4SA 2WXJA 1NVID 4JV5M 3QC8B 4PP1A 2DZLA 3N3GA 4WWOA 5D94A 2VRRB 2KFJA 1PRBA 1SE4A 3D8LA 1OEYA 2D7HA 2CHQA 1OFFA 3ZW3A 3AU5A 4MSMB 4HL4A 1T3QA 3C3EA 1L5PA 1GMYA 3ZNID 3ZVVA 1PGXA 2DCDA 1WY8A 3VTVA 2O2VA 3SAVA 2LHGA 2K47A 2MA9B 1KFUL 1WFYA 4A55A 1YMHE 3KUZA 5EXTA 1IBKM 2J7QB 4G11A 2CHZA 1LQBA 3URYA 3T1HM 1XLPA 3BXWA 2XLJA 3SARA 2N4FA 4W9KA 2P7UA 3I63C 1AIMA 2LNHC 3R7RA 1TF0B 1XCQL 2MJ5B 1XQQA 1V97A 2N9PC 4L1BA 1TZ1A 4I4LA 1S4VA 2C7NB 2JQFR 2DKLA 1F2CA 1V81A 2IO1B 3WAPA 1P7EA 2KVZA 2MJEA 2R4EA 2WXGA 3A98B 1B9RA 4JQWC 3H6SA 1NB3A 4LF7M 1HR0M 3A46A 2DLBA 3KOWE 1D6EC 4MJSA 3PRPB 1CTEA 1SE2A 2G9HD 4QBBA 3LCUA 1T3TA 3S2AA 1E9RA 1L0XB 1TIFA 4TUUA 4MGYE 2DYBA 4DR7M 4M0DA 2K0BX 3PXGA 4CHTB 3RE8A 1R4GA 1T6BX 2L00B 2A5UA 1XEEA 1V1PA 2QHOA 3SFZA 4NJCA 2GMIC 1UH6A 4DDID 1J0GA 2XU3A 3FUVA 2R46A 1K50A 2KRUA 1XT9B 3U6PA 2KYWA 2Q5WD 3A9JB 3H6NA 3THGA 4US8A 3I4YA 2BF8B 4AS1A 4GC9A 1ACCA 3PVLA 5BMHA 2QPAA 2LHEA 2H7JA 4KZ0A 5G2NA 4DMYA 1YJJA 3LQRA 4B0MA 1D2NA 1Q0WB 4LZZA 2R9FA 2HTME 3HWNA 3V76A 3PRMB 2H89B 2KX0A 2HCBA 1EM7A 4X6HA 3LXSA 1AECA 3K1JA 2WP9B 5FKAC 3ENEA 2WU5B 1YQ4B 1KXRA 4XWWA 2Z0EB 2G3QB 4FULA 2KQSA 1R7RA 5J94A 1NJFA 4TKNA 4K7SA 2I7PA 5IOIA 2OHFA 3EIEA 2XF3A 3LXFA 3U60A 1TH3A 1STFE 3KP0E 1C4AA 2LJIA 3DWMA 4GN1A 1EWYC 1AU0A 1NV8A 1Z6TA 3TWKA 4YYRA 4DXGA 3C0RA 3KDSE 2J4XA 2VZKD 1VDVA 5LNK1 3U52E 5EGWA 1SIJA 4DR1M 2LJ5A 3B9PA 3FC4A 1AWDA 4M0WB 4PS3A 4YTNB 3H7PB 5CHVC 2HWKA 4FJZA 4BBNC 4ZHPA 3ZNHA 5EXSA 1R4MB 1IFYA 1GJTA 3RFWA 1PFDA 2JRIB 3DHGC 1POPA 1LV7A 4JL9A 4DR6M 1LXDA 1PPNA 1HT2E 1IBMM 2J0MA 2JTCA 5IKCM 3NOBA 4II3B 4RF0A 4ZYSA 1QDRA 2KQ4X 2IGDA 3QCAA 3E46A 1MFWA 4G50A 3HZJA 4WAFA 2R4JA 5GMVA 2D3CA 3ZTCA 4G4OA 2AQ3B 2KMAA 1EFUB 5CX3A 4FK5A 5JI2E 1WMHB 3GZNB 3L4PA 3ML9A 2RD0A 4HKZE 3OVXA 1L4ZB 1N32M 1R4NB 2KWCA 2L32A 4X65M 4DBGA 4I05A 3BBZA 4MSXA 4FVMA 2B3AA 3UK6A 4IBDA 5KO3A 4XBOA 3HHYA 1PUTA 4AJWA 1HQCA 3CH2X 3QHTA 3U2SC 3EGRA 2BJWA 4DR5M 2PLPA 1SIFA 4OVUA 4AG5A 1WIVA 3SFEB 3I57A 4HDQA 4CDDB 1ZDVA 1IM2A 1WX8A 2DYOA 2PKOA 2V3PA 2W9NA 2WQYB 3KVFB 1JCKB 1KLGD 1YIWA 3VDUA 3N20C 2BGFA 4PCZA 2N7DA 1C77A 4M9ZA 2LZ6A 4GXBA 4HEA1 2M60A 2BWES 1J09A 1K53A 5HKHA 4G3OA 2RRUA 1F2BA 2BT6A 4YL8A 4M02A 1D4BA 2KDLA 1U9VA 2KNVA 3U61A 3PV1A 4N59A 4S0RA 4AP4C 3S3RA 3ZLZA 5JH5C 1XB2B 4D82A 1QANA 1TL9A 3JR4A 3GPYA 3EHVA 1UFZA 2G4DB 4A3PA 2NTTA 2N9LA 2WXHA 4KV2A 3DOWA 4M01A 1NEKB 1GOZA 3HKPA 2LVQD 3MMPA 4X6IA 2DJGB 2PE6B 3SBJA
chains in the Genus database with same CATH topology
1PVJA 2Y5PA 3MHVC 5EE1A 4KODA 5EE0A 1IN4A 3FAHA 2M19A 1FD6A 1XF5L 1VJKA 2WXMA 3E9SA 2CE7A 1L6UA 2W55A 4XWTA 4Z6YA 3L28A 2CJNA 3GB1A 4MB7A 4YTMB 1YE9A 1W5SA 3U7ZA 3HRDD 4B3SM 4B7HA 1TKYA 4HJGE 4HRSA 2Z84A 2DWZB 1I4QA 4DV3M 4DXFA 3SASA 4JI8M 4DR4M 2L1AA 1YQ3B 3CWIA 1DGHB 4LGYA 2YQZA 3BYTB 4JI4M 3SYKA 1UWMA 5D3DA 4YSYB 2ACZB 4LF9M 5FSWA 5G5HA 1VZ6A 4L16A 3SMSA 1XXHB 1L2DA 5IREB 4JWUC 1I7HA 3NRZA 3JAMS 4BBAA 1NYRA 4LRSA 4LJ8A 2KMMA 5GXGB 3TMPA 1TJEA 3KWVA 2M0AA 1QAQA 2ONQA 3GLIA 2UXBM 5H92C 1EU3A 1J7BA 5GKNA 2XGNA 3AMZA 1UKFA 2ON8A 4XGIA 5MPOA 3GRUA 2F5OA 3PHUA 2RMMA 4JI2M 2WXKA 3PSEA 4MH8A 1TDZA 5EP4A 3P4QB 1K3XA 2QZ4A 2E5LM 2UUCM 1KF6B 1V8CA 1SJED 1XMQM 1JWSD 2BTWA 4JE3B 3KSJA 3VR9B 1STEA 2BNKA 4PD2A 1XHBA 5LMNM 4TUWA 2KZSA 3T1YM 1MHHE 1I4PA 5EE9A 3EA6A 2XH9A 4G4NA 1F2RC 3GLFA 2YEPB 1ZXHA 2UXDM 4MGZE 1FO4A 4P6VF 4BOPA 4D80A 2DXIA 4L4UA 1L2CA 1YJIA 4KLNA 4G4QA 2J7NA 2HL7A 3B2FA 3W1SA 5KPRA 2NQ8C 3AEAB 4RGMA 1E9SA 3IG8A 4JYAM 1Q39A 1A70A 2WU2B 1IN7A 1D5ZC 3A45A 4TSSA 4DR3M 3J9CA 2CU3A 4PDGA 2L7IA 4LJ5A 5DYGA 1FMAD 2QMTA 2DWLA 1ET6A 2AHMA 4ITKA 4JI1M 4ARCA 4KKIA 5G5GA 1NVMA 2K3UA 4TQ0A 2D7GA 3D8BA 2J53A 2V1CA 4LJ9A 1J5EM 3U5ZB 1M4VA 3FILB 2KN4A 3ETRA 5EP1A 4KGSA 4BB9A 2GI9A 2BTEA 3PHXA 4EE2A 5EZSA 2CV2A 4GHAA 2Y0QA 2GRIA 3T3OA 3KQ4A 5IWAM 1GKIA 3PHWA 2L83A 1DGBA 4LY6A 1PJJA 2LFIA 3N9YC 3NWLA 3DA1A 3UGJA 4AG6A 4IDIA 1N36M 4GKJM 3BK1A 1FXIA 1W5TA 4LFAM 1YSYA 3Q8CA 2R65A 2YEPF 2KWDA 3WCQA 1TS3A 4B3RM 5C3JB 5E26A 4B08A 3L26A 2CUZA 2DWNA 1PYWD 1AW7A 1DGJA 1ZAEA 3M6AA 4H2AA 2XZFA 4BOUA 1JRPA 3FYDA 1I94M 1QLBB 2BS2B 1L1ZA 3RFZB 3C8YA 1QVRA 2WDQB 4OZCA 3ZYYX 1ZQ9A 3AEGB 1N77A 3TPZA 3AH7A 4GC5A 1ZPSA 3SAWA 3SBJA 4YHHM 1HA5A 2TSSA 4OVZB 1V1PB 1MVKA 3U4EG 8CATA 1J7CA 3NUHB 2XZUA 2DWQA 2FFJA 4RH6A 4ITQA 3TEWA 2JXTA 4BOZA 3FYCA 3KW6A 4JI3M 3BK2A 4NOOB 2ERCA 1LO5D 1I4WA 3FTCA 2DZNB 4LF6M 2M56B 3FUXA 3AEEB 1ORYB 3KXEC 1HNXM 1VLBA 4KO8A 4N58A 3AE9B 4LJAA 3OWEB 3SATA 1IN6A 2W3SA 1IGDA 1VR9A 4HROA 4GIPA 4KX6B 4LTUA 1DOXA 5FK9C 4AKGA 5H8YE 3MC0B 2Y21A 5ITQA 4FWGA 3TEYA 2QENA 1SXJD 1ET9A 3AE4B 2V6ZM 1UNSA 1J7AA 1G59A 1TS2A 5A2QS 1TDHA 2VQFM 4MH0E 5HI1A 3M7GA 3CF0A 4IBBA 3KFUG 4DV2M 3NVWA 4RGTA 1C1KA 4D81A 2X49A 1MHXA 1QOBA 1TS5A 1FNNA 2IDYA 3LMMA 5EE3A 2QBYB 4Z8XA 4NZLB 4MGIE 1F2RI 1FNVA 4MT5A 2QSDA 2G1EA 1UWXA 2EO2A 2B76B 1FFUA 5E6JA 3UJNA 3SR6A 2WXPA 4IBCA 3DWGC 4OHJA 3P63A 3B9JA 3PZ7A 2H88B 1IY1A 4IBJA 1Z5BA 4RGNA 1QKZA 3B21A 1DOIA 4LZJA 2BS3B 4LG2A 2LH0A 4X62M 2IPKD 2WXLA 1YN5A 3GO8A 1BUIC 3WHLA 2F5QA 4MACA 3HJ8A 3DOAA 1N63A 1P7FA 3TUOA 2QCUA 4I5SA 3ZQ4A 1R2ZA 2FBWB 4Q2JA 1XNRM 2JZPA 4J3OD 2R61A 2J7QA 1QOAA 5JXVA 2MJDA 4NXMM 3EIHA 4OU7A 3GRVA 1ROEA 2K9XA 3HWSA 2R62A 4OZAA 7CATA 1HXYD 2JYEA 4ZHOA 1GB1A 1IN5A 4REZA 3K8ZA 2DZOB 3DFZA 1FRDA 2N7JA 1FRRA 5KQDA 4DV5M 1VZ7A 3TL4X 3PRPA 1Q10A 3HHZA 1RM6C 2LXEA 4NSOB 2F4VM 3J7AS 5EZQA 4LFCM 4LJ6A 3R2IA 3TQSA 4AKHA 2V0GA 3ZJUA 1SXJA 5C2TB 1HQYE 4L8RC 2XFSA 4FWHA 2I2YA 4M9SA 4RF1A 2L52A 2X38A 3AJIB 4G6ZA 1GLNA 4L15A 1N5WA 2PMVA 5FTLA 1PGAA 3PRMA 2INNE 4L23A 1SXJE 1F77A 2EKIA 4ZPXA 2SEBD 4B3TM 1C79A 4AQ7A 2WXNA 4RFBA 3W5UB 1CK1A 3Q8BA 4MGHA 3HHXA 1E32A 5EXXA 1HZ6A 4WQMA 2JYTA 2JWUA 1JWAD 1SBBB 5H37D 1JWMD 5IZ7D 3CF6E 4GRIA 3H8HA 3ZGZA 3TWMA 4M0WA 2MEKA 1L0YB 3GP1A 2VIIA 3KOYE 1QILA 2KRKA 5HFYA 2JRIA 2RGOA 1QAOA 2I38A 2C96A 1XLNA 1KRHA 2Y3AA 3MP9A 3VR8B 1KFYB 2DOSA 1SSNA 3GQ4A 1UUPA 3BB7A 4CQNA 2QIEB 1GPXA 3FTFA 4YSXB 1Z59A 3BZDB 4WW0A 1FM0D 1Z5AA 2BB6A 1J7KA 3MJ5A 5LMUM 2ICIA 3K92A 1KYIA 2H1RA 3E56A 4A90A 2QP9X 4C7ZA 1R7SA 1N75A 4QHSA 1E7PB 1XLOA 2LEKA 3LYYA 3AKZA 2SAKA 2Z3XA 3J81S 1L6VA 3BYYB 3OTOM 2CV1A 3P4RB 1IBLM 5DYIA 1YZBA 3FD9A 1NHGC 1EU4A 4QNRA 1E6EB 4LF4M 4QNMA 1JROA 2P5TA 5C1BA 4ZTBA 2PVOD 3J80S 1RFKA 3GLHB 3O13A 1N34M 3V3XA 3DZDA 3LB8C 2V3NA 2KZUA 4II7A 3VDPA 2R18A 4DV1M 1EE8A 2BBCA 1WGKA 1TH2A 1JR3D 3VLFB 1IN8A 5KPZA 4BLCA 1IBXB 3EUB2 5BR8M 1FNWA 2XNAC 2N9KA 1QAMA 1DGGA 1YNTE 3NZ3A 1DGHA 3P1MA 2PIAA 5FTNA 5BYRA 2RDGA 4WH4A 3U6QA 2UZJA 2C99A 4O1NA 2JSVX 3AEFB 4AKIA 2V1UA 2N0SB 4ZOHC 3HVDA 1DYQA 3L27A 1B1ZA 1TH4A 3AE2B 3NS1A 1CQVA 1XXHA 3KLSX 3PVSA 1JMLA 3LVVA 1HZ5A 2OQ4A 5ITTA 3C58A 3FUTA 4XDCA 2UU9M 1QQWA 3L29A 3GLGB 2WDVB 1PGBA 3I51A 3U6CA 2I7NA 2CFOA 4OX9M 2JU6X 4X64M 4A3VB 2D7EA 2IJ0A 2XSZA 1FNUA 2DWMA 3AM9A 2BU3A 4ZRQA 3SC3A 1GL6A 4KKJA 3AEBB 1TYGB 3AEDB 2HKJA 5EXPA 5TSSA 1NNUC 2F5PA 2RPVA 4D8EA 2CHVA 3SEBA 1NYQA 1TKGA 2FUG1 4AI6A 2IGGA 3E4RA 3CIRB 4LJ7A 3KS8A 1I4GA 4IUMA 3U6DA 2KW0A 3KOXE 3AFHA 3W0FA 1UGJA 3R8BA 1XLQA 3J7BA 2ZAOA 1QOFA 4CGYB 4BOQA 2D5GA 4JXJA 3IG5A 2Y5CA 3IFUA 2X4AA 4NAMA 1FXAA 2FOIC 1SJHD 1G4AE 3VKHA 2WXOA 1N78A 2JQRB 1PM5A 1VRAB 4PDIA 1JW9D 2AX5A 4EIWA 3ZJTA 3NVZA 4C7YA 1SE3A 2EELA 3QAUA 1GVNA 2CV0A 1NENB 4RNAA 3FUWA 1GL7A 1KSFX 2CEAA 3FTEA 5FTKA 4M9XA 4B0EA 1JR3A 1Q3BA 4YSZB 2DBYA 3UZUA 4IBEA 4JI5M 1SXJC 2O5RA 3W31A 4DUYM 2QJLA 1KFVA 1MX0A 3AE5B 3VRAB 3IXSA 1SXTA 2XFTA 1C9FA 1ZE3D 1RWSA 3U6EA 3VFDA 1MU5A 3U5ZA 1K51A 2J42A 3FILA 4D8IA 2WLBA 1QZMA 3IT4B 2W3RA 3HVZA 2ZBKB 1ZUD2 3AE7B 3GPXA 4I8OA 1TY0A 2Q2EB 4KGTA 5EP2A 3AN1A 1D5XC 5ITYA 1L0VB 2CHGA 3U60B 5JZEA 2HDEA 1HNZM 2QEJC 3PFIA 4QOZC 2C9OA 1R6BX 4BOSA 1IY0A 3NVVA 4D2KA 1SB3C 3P4PB 2ZW1A 4DUZM 2NTSA 3VRBB 4NL4H 1PDXA 2K0PA 3TEZA 2MH7A 4W5WA 3TSSA 5EJCA 1DOYA 4LLGM 3FTDA 4FW9A 1IXZA 5F3WA 1XMOM 1QYRA 4YXDB 4FXCA 5BMIA 1X37A 5I4DA 4LF5M 1I4HA 3Q69A 1K82A 4IBKA 3Q8XA 2KA6B 1L8QA 4FCTA 4WWMA 3AOEA 2KACA 4ZRPA 4RGOS 2E6XA 4AW4A 3KP1E 1SF0A 1OFIA 1SXJB 1T5XD 1IGCA 1Q3CA 4OVZA 2J52A 5C18A 4DV4M 3U61B 3HU2A 1K3WA 1XWIA 1E0ZA 2CJOA 5BPVA 1JQJC 3HUIA 5FTMA 2Z8LA 3SFDB 1HQRD 3ZCBB 3U6SA 1TGUA 3FKEA 4GKKM 5EQTA 2DHRA 3HU3A 3GRYA 4LGMA 2LGIA 4MI7A 1GB4A 1N62A 4FCVA 1IXSB 3JR5A 2RDHA 2WXFA 3IAS1 1H6UA 2JX5A 2WXRA 3KS4A 1WXQA 4GUAA 3Q8FA 2OEDA 1WWTA 1HNWM 1C76A 3W2DA 1ZP0B 1R2YA 4DQOC 1DGFA 2QILA 2ZANA 3O65A 1KTKA 1QQRA 2KEBA 5BYQA 4A8XC 3AE1B 4IIWA 1L1TA 1WYGA 3NVYA 4N6EB 4UDUC 3J2PB 3GPPA 3BOSA 3WHKA 2INPE 5ITXA 4CISA 3VK7A 4IBFA 5FLXS 4WURA 4IBIA 3MP2A 4OZBA 2Z7JA 1NJGA 4GHLA 2VZKB 4QHTA 3KVWA 5HHDG 3UMMA 1VZ8A 2QBYA 1IY2A 3Q8EA 3NBIA 2F5NA 1FCCC 2WXIA 1SEBD 5ITXE 1K52A 3LQQA 2BB5A 4S12A 1GAQB 3HHWA 3BWUD 4ARIA 1QF6A 1BXTA 1YN3A 2X8AA 4FD2A 1E94E 2LUMA 3T15A 3KSXA 2PW9A 2BJVA 3GLIB 1YN4A 4B7GA 2WS3B 1NSFA 4YT0B 2M5ZA 3AB5A 4YY3M 2F5SA 1CJEA 4RKXA 3AE3B 4YWGG 4USAA 1G41A 2XN9C 4XZXA 3V05A 4RCOA 3RGPA 1VDDA 4KHPM 1WRIA 2Y0TA 3SAUA 2K5PA 3RGSA 4DV6M 3SMPA 2VQEM 4FCWA 5HG2A 3SHFA 3SYLA 3UI3A 1HEZE 2BS4B 2LMCA 3BBAA 3AE8B 1TZOA 4JI0M 1NY6A 1YUBA 2BTWB 1FFVA 2Z4RA 3GQ3A 3HU1A 1OQQA 2YR0A 4JN6A 4MGKE 1ZOYB 3ZH9B 1NY5A 1FIQA 3GLFB 3VKGA 1OJLA 2JA2A 2RGHA 2Y20A 4LF8M 5EP3A 3BVZA 2DYMA 2YFQA 3PO0A 2BYTA 1D5MC 2UUBM 3TE6A 1QOGA 4HLQA 3I9V1 2UXCM 4NRWA 1IQPA 2KXEA 4HKQA 4TMAB 2XSZD 4A9AA 1C4PA 4GDKB 1OFHA 2IGHA 3HGIA 1L2BA 3BVMA 2C98A 3J27B 4LFBM 3M0EA 1MI0A 5IT9S 3TRKA 4AQYM 3PNVA 3OQCA 2WDRB 1ZDXA 5AUIA 3RNVA 3TWLA 1E10A 3ZC7B 1ESFA 3W9CB 1JWUD 3P42A 2KDMA 2L6OA 3GRRA 4C56C 1ZXIA 2RKOA 1N33M 3GP7A 4JWSC 2NMQA 3CF2A 3P4SB 1I4RA 3AOGA 4JI6M 4NXNM 4XDDA 2L7HA 2KAJA 2K22A 3BIID 1EWCA 4I81A 4IKGA 2E3TA 2HHHM 2WNMA 4IJEA 3AL0C 3PNYA 2FE8A 5KQ8A 1HT1E 2WXQA 4JX1C 4DV0M 4GLSC 2ZM6M 2W82A 2AQ2B 1FEHA 1OQRA 1PJIA 3W5VB 1FJGM 3MK6A 2UUAM 1RYJA 2C9CA 4C80A 1XC8A 5D7GA 3R2TA 1UM8A 1S3SA 4IJFA 4L78A 4GDLB 3HJSA 3ZJVA 4DR2M 2LHDA 1NI3A 1DO2A 3VK8A 1V1OA 1XXGA 4YTPB 1AN8A 4OW0A 4NSRA 1Y56A 2V4IB 2G8LA 1MPEA 1TS4A 2L09A 2MJ3A 5BMGA 2AGAA 4X66M 1KLUD 3L25A 4R7GA 2FNAA 2EUCA 5ITUA 2BW2A 3R9XB 3SHGB 5FR3A 4P16A 3AOEC 4LRTA 4B7FA 4B3MM 4QOSA 4A6QA 3GQ5A 1IUEA 3T3NA 3GS2A 1KH0A 4IOIE 1TY2A 5FTJA 4WIPA 3MHZA 3T38A 1C4CA 2XEPA 3IT6B 4K0KM 1XCTL 2PTLA 2ZW0A 3Q8AA 3MFGA 3FUUA 3HJQA 3H4MA 4AZFA 3U6MA 2ZAMA 1JQ4A 2OPFA 3QWLA 4IBGA 2EA0A 1ENFA 5D3IB 3ABVB 5KPTA 3W30A 5BYSA 3AE6B 1FCLA 2W54A 3GLHA 4GH9A 4LJ4A 1N61A 3A42A 1QT9A 5T8IA 1WSPA 3TEXA 1CZPA 1JALA 3PZ8A 1C78A 4PT5A 3U6OA 1N5XA 1XO3A 1E9MA 2LWXA 4D8BA 4KGRA 3I4VA 5ITRA 4NRVA 1IBXA 2J7QC 2Z4SA 1NNJA 3B2GA 2GB1A 3IAM1 3AV0A 4GMQA 2A5YB 5DNYA 2R45A 4JI7M 1TKEA 4XE0A 1NHWC 1AYFA 2AQ1B 4NAWB 2DVWB 3MTVA 2C5RA 3W0LB 4FWDA 3KWLA 3L2AA 1JWBD 5JI3E 4US9A 3K2LA 1G8PA 4A5UA 3GPUA 3U6LA 2G5GX 1F0ZA 4LK0M 3BY4A 4GITA 1IXRC 4L2YA 5AUKA 3GLGA 1DO0A 3RPFC 1BMLC 3KOZE 2YNMD 3AV8A 4TQ1A 1G3IA 2J7OA 3AECB 1L4DB 1N60A 1Z5CA 1DKIA 4R3DA 4HXDB 3CTWB 3R8FA 4LCBA 4JPSA 3PT2A 4G4RA 1I4XA 3BVGA 3ILKA 4DV7M 3VQIA 2PVGC 4MM3B 3LVWA 1XNQM 2WXJA 1NVID 4JV5M 1SE4A 3D8LA 2D7HA 2CHQA 1OFFA 4HL4A 1T3QA 1L5PA 1PGXA 3SAVA 2K47A 4A55A 1YMHE 5EXTA 1IBKM 3URYA 3T1HM 1XLPA 2XLJA 3SARA 2LNHC 1XCQL 1V97A 4L1BA 4I4LA 1P7EA 2MJEA 2R4EA 3A98B 1B9RA 4LF7M 1HR0M 3A46A 2DLBA 3KOWE 1D6EC 1SE2A 2G9HD 1T3TA 1E9RA 1L0XB 4MGYE 4DR7M 4M0DA 3PXGA 4CHTB 3RE8A 1T6BX 1XEEA 1V1PA 3SFZA 4NJCA 3FUVA 2R46A 1K50A 2KRUA 2Q5WD 3U6PA 3THGA 4US8A 3I4YA 4AS1A 4GC9A 1ACCA 5BMHA 2QPAA 2LHEA 1YJJA 3LQRA 4B0MA 1D2NA 4LZZA 2HTME 2H89B 2HCBA 1EM7A 3K1JA 2WP9B 5FKAC 2WU5B 1YQ4B 4XWWA 1R7RA 1NJFA 2I7PA 2OHFA 3EIEA 2XF3A 3LXFA 3U60A 1TH3A 3KP0E 1C4AA 2LJIA 3DWMA 1EWYC 1Z6TA 3TWKA 4DXGA 3C0RA 3KDSE 2J4XA 2VZKD 1VDVA 5LNK1 3U52E 1SIJA 4DR1M 3B9PA 3FC4A 1AWDA 4YTNB 2HWKA 4ZHPA 3ZNHA 5EXSA 3RFWA 1PFDA 1LV7A 4DR6M 1HT2E 1IBMM 2JTCA 4RF0A 4ZYSA 2KQ4X 2IGDA 4WAFA 2R4JA 4G4OA 2AQ3B 5JI2E 3L4PA 4HKZE 1L4ZB 1N32M 2L32A 4X65M 4FVMA 3UK6A 4IBDA 5KO3A 4XBOA 3HHYA 1PUTA 1HQCA 3U2SC 3EGRA 2BJWA 4DR5M 2PLPA 4AG5A 3SFEB 3I57A 1ZDVA 1IM2A 2DYOA 2PKOA 2WQYB 2V3PA 1JCKB 1KLGD 3VDUA 4PCZA 1C77A 4M9ZA 4HEA1 2M60A 1J09A 1K53A 2BT6A 1D4BA 3U61A 4N59A 4D82A 1QANA 3JR4A 3GPYA 2NTTA 2N9LA 2WXHA 1NEKB 1GOZA 3HKPA 4IP3A 2WXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6J A;  4RNA A;  4OVZ B;  4M0W A;  4P16 A;  3MJ5 A;  4PT5 A;  4REZ A;  5KO3 A;  4RF1 A;  4R3D A;  4RF0 A;  4WUR A;  3E9S A;  4OW0 A;  3MP2 A;  4OVZ A;  2FE8 A;  4MM3 B; 
#chains in the Genus database with same CATH topology
 1PVJ A;  2Y5P A;  2Y5B B;  2DZI A;  3NHE B;  3L08 A;  3MHV C;  4BFR A;  1GCB A;  5EE1 A;  2KLC A;  2DAF A;  2FS1 A;  4KOD A;  2HD5 B;  2KJ6 A;  1QUT A;  2DI0 A;  1YQB A;  2D10 A;  5EE0 A;  9PAP A;  1IN4 A;  3FAH A;  2M19 A;  1FD6 A;  1IXS A;  1XF5 L;  2KOX A;  3IG3 A;  3VH3 B;  2MRO B;  3IV2 A;  1VJK A;  2J0K A;  3E9S A;  2KNA A;  2WXM A;  5L95 C;  2CE7 A;  4K3C A;  4E74 A;  1L6U A;  2W55 A;  4XWT A;  2BDZ A;  2KFK B;  1AYW A;  2G8J A;  1G71 A;  3L28 A;  4Z6Y A;  3RNF C;  2CJN A;  1TTE A;  2JF5 A;  3M99 A;  3GB1 A;  4MB7 A;  1PXV A;  1L2N A;  4XGA B;  3E21 A;  4YTM B;  2DHZ A;  4TV3 A;  3B7Q A;  1M94 A;  3RD2 A;  4W9F A;  1YE9 A;  1NL6 A;  4P7I A;  1W5S A;  3U7Z A;  3HRD D;  3AI5 A;  4B3S M;  1N6Z A;  4B7H A;  1TKY A;  4HJG E;  4HRS A;  3WXG A;  2Z84 A;  2RDB C;  3RNC C;  2DWZ B;  1I4Q A;  4Q7J A;  4DV3 M;  4CZW A;  2Z8Y M;  3MC9 A;  4DXF A;  3SAS A;  1AIP C;  4JI8 M;  4DR4 M;  4EFO A;  3IOQ A;  1PBH A;  2L1A A;  1YQ3 B;  1WJU A;  3CWI A;  2Z59 B;  1RAX A;  4IW0 A;  2XU5 A;  1DGH B;  4LGY A;  2JVC A;  3B89 A;  4M8M A;  3W1Y A;  2I1J A;  4F8C B;  2E02 A;  1EWM A;  2O6V A;  2YJB A;  2YQZ A;  3RCZ A;  2GFO A;  3DBL I;  2JZ1 A;  3BYT B;  4JI4 M;  3L0W B;  4HWY A;  1R4M I;  2ZVN A;  3SYK A;  4I6L B;  1UWM A;  1WGR A;  3V60 A;  2F7D A;  5CHF A;  4OEM A;  5D3D A;  4YSY B;  1EF7 A;  2G7Y A;  2ACZ B;  3IMA A;  4QH6 A;  3RVW A;  4LF9 M;  5FSW A;  3NZU A;  5G5H A;  3P5U A;  1VZ6 A;  3Q2A C;  4L16 A;  3SMS A;  4AUQ C;  1XXH B;  1L2D A;  5IRE B;  3RZW C;  1IWD A;  4JWU C;  3RYT A;  1AAR A;  1I7H A;  3NRZ A;  3JAM S;  2VDB B;  2AU1 A;  4BBA A;  1NYR A;  4LRS A;  4LJ8 A;  4XC2 A;  4KIK A;  2KMM A;  5GXG B;  3TMP A;  2NQG A;  1BP4 A;  1TJE A;  3KWV A;  2M0A A;  4I6P A;  1R4N I;  1QAQ A;  2ONQ A;  4W9G A;  3N4C A;  3GLI A;  3EFC A;  2UXB M;  5H92 C;  3X0W A;  1EU3 A;  3ZUA A;  1J7B A;  4GSW A;  5GKN A;  2XGN A;  2BKR B;  3AMZ A;  3KW9 A;  1WE7 A;  2YVC A;  3K9O B;  1RLF A;  5DPS A;  1UKF A;  2ON8 A;  4XGI A;  2EJS A;  4S17 A;  2NR2 A;  5MPO A;  1E8Z A;  2LVA A;  4JLC A;  1VEK A;  4WJP A;  3GRU A;  2F5O A;  1DV0 A;  3PHU A;  1WGN A;  4DHJ D;  5EF4 A;  2CP8 A;  2RMM A;  1BT0 A;  3WIM A;  4AWJ A;  4BSQ A;  4JI2 M;  2WXK A;  3P2B A;  2PE9 A;  2ZVO A;  4FHK A;  3PSE A;  1MHW A;  1SG9 A;  4MH8 A;  2MLB A;  5JHA A;  4PYU A;  4N79 A;  2DAJ A;  1TDZ A;  5EP4 A;  3P4Q B;  4LNI A;  1WGY A;  1K3X A;  2QZ4 A;  2E5L M;  3ZTD A;  4IUM B;  3USV A;  2UUC M;  1KF6 B;  2JZZ A;  3P5W A;  4P6E A;  1V8C A;  3KWZ A;  1SJE D;  1XMQ M;  1JWS D;  2L76 A;  4Y28 F;  4BOS C;  4JE3 B;  4F7Z A;  2BTW A;  1WXV A;  3KSJ A;  3VR9 B;  1STE A;  2BNK A;  3JSV B;  4PD2 A;  1XHB A;  5LMN M;  2MBE A;  2BYV E;  4BBN F;  4TUW A;  2OJR A;  2KZR A;  5IA7 A;  1F4I A;  2LVQ A;  2KZS A;  3T1Y M;  1MHH E;  2V4L A;  3QK0 A;  3ZXV A;  1I4P A;  5EE9 A;  3EA6 A;  2XH9 A;  4PI3 A;  4G4N A;  1F2R C;  3GLF A;  4G54 A;  4P6G A;  2YEP B;  8PCH A;  1ZXH A;  2UXD M;  4MGZ E;  1FO4 A;  4P6V F;  4BOP A;  4D80 A;  2DXI A;  4L4U A;  1L2C A;  1YJI A;  4KLN A;  4G4Q A;  2J7N A;  2HL7 A;  3B2F A;  3W1S A;  2KDE B;  4P17 A;  2R9C A;  5KPR A;  2NQ8 C;  4GDK A;  3AEA B;  4RGM A;  1E9S A;  3IG8 A;  2JWS A;  4JYA M;  1Q39 A;  1AU4 A;  2UWQ A;  1A70 A;  1T43 A;  2WU2 B;  3UIN B;  1NB5 A;  1WGL A;  1IN7 A;  1TT5 B;  4FJC A;  3GLF E;  2L3Z A;  1D5Z C;  3A45 A;  4TSS A;  1MEM A;  4DR3 M;  3J9C A;  1EF1 A;  4FAD A;  2CU3 A;  4PDG A;  2L7I A;  4LJ5 A;  2YJ2 A;  5DYG A;  4C4V B;  1Y08 A;  4HJK A;  1FMA D;  2CIO A;  4I04 A;  2QMT A;  3PPA A;  2DWL A;  4YYQ A;  1ET6 A;  2AHM A;  4ITK A;  4JI1 M;  4ARC A;  3MOR A;  2M1M A;  4YYU A;  4KKI A;  1PE6 A;  1F52 A;  5G5G A;  1NVM A;  3QA8 A;  2YJC A;  2K3U A;  4TQ0 A;  4LNN A;  1E8X A;  3BY4 B;  2UU7 A;  2D7G A;  4NQL B;  1VSN A;  2N7E A;  1OQY A;  4FA6 A;  3D8B A;  2J53 A;  2D3G A;  4ZUX U;  3VFK A;  2FRA A;  2V1C A;  4LJ9 A;  1J5E M;  3U5Z B;  1M4V A;  3FIL B;  2KN4 A;  3ETR A;  5EP1 A;  1UD7 A;  4KGS A;  2JXN A;  3DDC B;  4BB9 A;  2GI9 A;  2BTE A;  3PHX A;  4EE2 A;  2LRU A;  5EZS A;  2ZNV C;  2CV2 A;  2KDF B;  4GHA A;  1OEY J;  3FRI A;  4R71 A;  3RNA C;  2HHN A;  2Y0Q A;  2GRI A;  3T3O A;  3KQ4 A;  5A24 A;  5IWA M;  1GKI A;  4W5C A;  1ZV1 A;  2LVO C;  3PHW A;  4ZRJ A;  1HUC B;  4M00 A;  2JWZ A;  2L83 A;  1DGB A;  1T6O A;  4LY6 A;  5DPR A;  5JZE B;  3V6E A;  1PJJ A;  1KM7 A;  1OTR B;  2LFI A;  3N9Y C;  2C7M B;  3ZUN A;  3N3K A;  3NWL A;  1AYU A;  3DA1 A;  3UGJ A;  4AG6 A;  3ML8 A;  4G0N B;  4IDI A;  3B1L X;  1N36 M;  3GLH E;  3I5J C;  4GKJ M;  3KUD B;  3RNB C;  3K9P B;  3SHQ A;  3BK1 A;  1FXI A;  1BGO A;  1XKG A;  1W5T A;  4LFA M;  4RM8 A;  3HM6 X;  2NQI A;  4FIP A;  2BQQ A;  3HK0 A;  1YSY A;  1WJ6 A;  3Q8C A;  2R65 A;  2YEP F;  2KWD A;  3WCQ A;  3VVW B;  1TS3 A;  4LCD E;  4B3R M;  5C3J B;  5E26 A;  4B08 A;  2DZJ A;  1YJ1 A;  4K3B A;  3L26 A;  2CUZ A;  3H4J A;  2D11 A;  2LTU A;  2K39 A;  2DWN A;  1PYW D;  4IM0 A;  4GDL A;  1AU2 A;  1AW7 A;  1DGJ A;  1ZAE A;  3WAO A;  1OAI A;  3VTU A;  2DC9 A;  3M6A A;  4BKS D;  5DFL A;  1E7U A;  4H2A A;  2XZF A;  4BOU A;  2RGF A;  2FYE A;  1JRP A;  3FYD A;  1I94 M;  1QLB B;  2BS2 B;  1L1Z A;  3RFZ B;  3C8Y A;  1QVR A;  2OOB A;  2WDQ B;  4OZC A;  1R5L A;  2DZM A;  2GBJ A;  3ZYY X;  1ZQ9 A;  3AEG B;  4PYZ A;  4GEW A;  1D0M A;  4NJ7 A;  1N77 A;  2FID A;  4BKG A;  3N30 A;  2BYE A;  3TPZ A;  1WR1 A;  1J19 A;  3AH7 A;  4GC5 A;  1ZPS A;  2RPQ A;  3SAW A;  3DVN V;  1X9Y A;  3IUT A;  2LI5 A;  2AWT A;  1KJT A;  1LFD A;  4YHH M;  3GCB A;  1HA5 A;  2TSS A;  4OVZ B;  1V1P B;  1MVK A;  3U4E G;  8CAT A;  1PPD A;  1J7C A;  3NUH B;  2XZU A;  2DWQ A;  2FFJ A;  2JZ0 A;  4RH6 A;  4ITQ A;  3TEW A;  2JXT A;  4BOZ A;  3A4S C;  3FYC A;  4MEM A;  5L8R F;  4N4Z A;  3KW6 A;  4JI3 M;  3IVF A;  2NVU I;  3V6C A;  3GLG E;  3BK2 A;  4NOO B;  4B9K A;  2L8J A;  2ERC A;  1LO5 D;  4FJV B;  1I4W A;  2ZNV B;  3FTC A;  4Q8H A;  3UGB B;  2R2O A;  2DZN B;  4LF6 M;  1ATK A;  4BS5 A;  1V6E A;  2M56 B;  3FUX A;  3DBR B;  3AEE B;  1OAO C;  1ORY B;  4KVG B;  4AOF A;  3W68 A;  3KXE C;  3AUL A;  1HNX M;  2KLG A;  2WX0 A;  2GBN A;  1VLB A;  4ICV A;  4KO8 A;  3A1Q B;  2E01 A;  4N58 A;  3AE9 B;  4LJA A;  3K8U A;  1WJ4 A;  3OWE B;  3SAT A;  1IN6 A;  2W3S A;  2K1F A;  1IGD A;  4ZRI A;  1VR9 A;  2D3A A;  1GNU A;  2DZZ A;  2WZJ A;  4HRO A;  3RUL A;  4GIP A;  3U7D A;  4KX6 B;  4LTU A;  1DOX A;  3D6S A;  5FK9 C;  4AKG A;  5H8Y E;  3MC0 B;  2Y21 A;  5ITQ A;  4NPN A;  4FWG A;  3TEY A;  2QEN A;  2R9N A;  1SXJ D;  4A20 A;  1ET9 A;  3AE4 B;  2V6Z M;  1UNS A;  5G55 A;  1J7A A;  2ZTD A;  5J18 A;  1G59 A;  5DPW A;  3O65 B;  4XR7 A;  1TS2 A;  5A2Q S;  1F1H A;  3CSF A;  3A9K A;  4XK8 F;  1WM2 A;  1TDH A;  2KKC A;  2VQF M;  4MH0 E;  3IBE A;  5HI1 A;  2INC C;  4YYW A;  2JY8 A;  2KNZ A;  3ZKJ C;  3M7G A;  2NPT B;  3CF0 A;  1PJT A;  4IBB A;  3KFU G;  1Q6K A;  5CVN B;  4DV2 M;  3NVW A;  3PGE A;  3QT4 A;  3HM3 A;  3NS8 A;  4RGT A;  2UYZ B;  3PRE A;  1VEJ A;  2R9O A;  1C1K A;  2PJH A;  5AEK B;  1TU6 A;  4D81 A;  2X49 A;  1MHX A;  1QOB A;  1TS5 A;  4NAW A;  3LW5 F;  2AL6 A;  1FNN A;  2IDY A;  3LMM A;  2RR9 A;  4W9I A;  2C60 A;  5EE3 A;  1J8C A;  4HCP B;  1QMY A;  3M62 B;  4AXL A;  1PJQ A;  2QBY B;  4Z8X A;  2ZZP B;  2AYO A;  2F1G A;  1KFX L;  1PAD A;  2KQ7 A;  3LCV B;  4NZL B;  2DEN A;  4MGI E;  1UBI A;  1F2R I;  1FNV A;  4MT5 A;  2DCA A;  2QSD A;  2R6F A;  3L13 A;  1UWX A;  2G1E A;  3HX3 A;  2EO2 A;  2B76 B;  1T0S C;  1FFU A;  2XK5 B;  5E6J A;  1P1A A;  4XUI A;  3UJN A;  3T6P A;  3AI8 A;  3SR6 A;  1TBE A;  2WXP A;  4IBC A;  3DWG C;  3T8M A;  4OHJ A;  1AU3 A;  3P63 A;  3B9J A;  3PZ7 A;  2H88 B;  3KW5 B;  3S3Q A;  1IY1 A;  3NBX X;  4BKS A;  4IBJ A;  1Z5B A;  4RGN A;  3PBH A;  1E7V A;  2P86 A;  1IPG A;  4PP2 E;  1QKZ A;  4HXD A;  3B21 A;  1DOI A;  4LZJ A;  2BS3 B;  2N1W A;  4LG2 A;  2LH0 A;  4HPP A;  3MTN B;  2WHI A;  3RVX A;  2CB5 A;  2CKH B;  4X62 M;  4KT0 F;  4MM3 A;  1A5R A;  2O6V D;  3DCG A;  1MDW A;  4CO7 A;  2IPK D;  5J2R A;  2WXL A;  2JPH A;  1YN5 A;  3RN9 C;  3GO8 A;  2VF7 A;  3WHL A;  2F5Q A;  1BUI C;  4MAC A;  3HJ8 A;  4LJP B;  3KYD D;  3DOA A;  3T9L A;  1N63 A;  3HHI A;  1PGY A;  3IHP A;  3WA0 A;  1P7F A;  3TUO A;  2QCU A;  4I5S A;  3ZQ4 A;  1EWO A;  1OGW A;  1R2Z A;  3M63 B;  2KAN A;  5LXH A;  2FBW B;  4I6N B;  4Q2J A;  3RT3 B;  3U8E A;  1XNR M;  2JZP A;  1YVB A;  2LWP A;  3R66 C;  4J3O D;  2R61 A;  2J7Q A;  1QOA A;  1QDQ A;  4CDC B;  5JXV A;  2MJD A;  3BCN A;  4NXM M;  3EIH A;  4OU7 A;  3GRV A;  1ROE A;  3HD3 A;  3QAQ A;  1P0R A;  2K9X A;  4N8W A;  4HK2 A;  3DVG X;  4KLB A;  3HWS A;  3OAW A;  2R62 A;  4URK A;  4OZA A;  1BVS A;  7CAT A;  2DCC A;  1HXY D;  2JYE A;  3GE8 C;  3H9D A;  3CMM B;  3V61 A;  4ZHO A;  2VHS A;  2GHU A;  2PRE A;  1GB1 A;  1IN5 A;  3B7Z A;  1WHC A;  4REZ A;  4W4U A;  2L4E A;  3I04 M;  2ZPY A;  1P98 A;  3CBJ A;  2LGY A;  2R9M A;  3K8Z A;  2DZO B;  3DFZ A;  1T0Q C;  1FRD A;  2N7J A;  4CDE B;  2M8S A;  1FRR A;  5KQD A;  4DV5 M;  1VZ7 A;  3TL4 X;  3PRP A;  1Q10 A;  2HE7 A;  3HHZ A;  2ZCC A;  5CTR C;  1RM6 C;  2EMS A;  4CJ6 A;  4P1B C;  2MX2 A;  2LXE A;  4NSO B;  2F4V M;  4X57 B;  3C19 A;  3J7A S;  5EZQ A;  4LFC M;  4LJ6 A;  3R2I A;  3TQS A;  4AKH A;  2V0G A;  3ZJU A;  1SXJ A;  2FTD A;  2YJ8 A;  5C2T B;  1HQY E;  4E3C A;  4KDL B;  3F92 A;  3ZNG C;  4L8R C;  2FT2 A;  2XFS A;  4FWH A;  2BVC A;  3A9J A;  2I2Y A;  4M9S A;  4RF1 A;  2ASQ A;  2L52 A;  4GU2 A;  3HIZ A;  2X38 A;  3AJI B;  4G6Z A;  1GLN A;  2R0I A;  4L15 A;  1N5W A;  3MHS D;  2PMV A;  5AZG A;  1PPO A;  5FTL A;  1PGA A;  2LVP C;  2IZV B;  4AJY B;  3PRM A;  2INN E;  4L23 A;  4W9H A;  4MZS A;  1SXJ E;  1F77 A;  2C9W B;  1K3B B;  1SNK A;  2EKI A;  4ZPX A;  2SEB D;  4J6I A;  4B3T M;  1C79 A;  4AQ7 A;  1WJN A;  2WXN A;  3IEJ A;  4RFB A;  4KSL C;  2G3Q A;  3W5U B;  1CK1 A;  3Q8B A;  2ATO A;  4ZDV A;  1A5T A;  4RKU F;  4MGH A;  3HHX A;  1E32 A;  5EXX A;  1GC6 A;  1HZ6 A;  2L7R A;  3ALB A;  1M6D A;  4WQM A;  1TTN A;  2JYT A;  3OVZ A;  2JWU A;  1JWA D;  3KYC D;  1SBB B;  2QDF A;  1SE9 A;  5AZF A;  5H37 D;  3ZIM A;  1JWM D;  2XU1 A;  5IZ7 D;  3CF6 E;  4GRI A;  3ZRC A;  3H8H A;  3ZGZ A;  3TWM A;  4M0W A;  2MEK A;  2KK8 A;  1L0Y B;  3GP1 A;  3QX1 A;  4RMA A;  4FJY A;  2VII A;  2DHY A;  3KOY E;  3Q6B A;  1QIL A;  2KRK A;  5HFY A;  3K24 A;  4W5B A;  2JRI A;  2XBB C;  2RGO A;  1Z2M A;  3WAM A;  1QAO A;  5E6N A;  2I38 A;  2C96 A;  1XLN A;  1KRH A;  5DPT A;  3FRH A;  2Y3A A;  4IG7 B;  1V5O A;  2JT4 B;  3MP9 A;  3N1Z C;  2CS4 A;  1T0Y A;  3VR8 B;  1KFY B;  2DOS A;  2QCZ A;  4FHJ A;  4EKU A;  1SSN A;  3GQ4 A;  2Z0D B;  1BY8 A;  4JIO U;  3GE3 C;  1UUP A;  4GGQ A;  3PZD A;  4GMV A;  3BB7 A;  2MSE D;  1AUA A;  3BC3 A;  2PNS A;  2M0X A;  4CQN A;  2QIE B;  1GPX A;  1NO1 A;  3ZXR A;  3FTF A;  4YSX B;  2O25 A;  1Z59 A;  3BZD B;  4WW0 A;  1FM0 D;  1Z5A A;  1PCI A;  3FE3 A;  2BB6 A;  1UGM A;  4RY2 A;  1J7K A;  1NBF C;  1MG8 A;  1TLO A;  2K6Q A;  1OKS A;  3MJ5 A;  4DK5 A;  2HTH A;  2DC7 A;  3VUW A;  5LMU M;  2ICI A;  3K92 A;  2YJ9 A;  1KYI A;  3H8B A;  3HY5 A;  3GZN I;  2H1R A;  2AUZ A;  2FRQ A;  5J17 A;  2G6D A;  3E56 A;  4A90 A;  1GEC E;  3P5V A;  2QP9 X;  4C7Z A;  3TNX A;  1R7S A;  4DMX A;  1N75 A;  4QHS A;  1E7P B;  1P9D U;  1XLO A;  2LEK A;  3LYY A;  4F2L A;  3AKZ A;  2DNF A;  2SAK A;  1CB5 A;  2Z3X A;  4L6V 6;  3J81 S;  1L6V A;  2CRU A;  2N35 A;  3BYY B;  3OTO M;  2CV1 A;  2DAM A;  3MC8 A;  3P4R B;  1IBL M;  2JY5 A;  4IWP A;  5DYI A;  1YZB A;  2L2D A;  2OP3 A;  4WA6 A;  1VQ1 A;  3FD9 A;  3SD5 A;  1YX6 B;  1NHG C;  3GLI E;  1EU4 A;  2Y5B A;  3NHE A;  1WH3 A;  4IP3 A;  4QNR A;  2WX1 A;  2JY6 B;  1H8C A;  1E8Y A;  3QWZ B;  1E6E B;  4B6W A;  5LLI A;  4LF4 M;  2HD5 A;  3JW0 X;  4QNM A;  1JRO A;  2P5T A;  3PHX B;  4DWF A;  5IAA C;  5C1B A;  4F1S A;  3HHM A;  4ZTB A;  2PVO D;  2QSF X;  2FUH B;  3J80 S;  2EKF A;  1RFK A;  3GLH B;  4NQK E;  4PS8 A;  3O13 A;  1N34 M;  3QJ3 A;  2KFK A;  3V3X A;  2AIM A;  1CS8 A;  3DZD A;  3LB8 C;  5PAD A;  2AEH A;  2PAD A;  2V3N A;  2KZU A;  4II7 A;  3VDP A;  2R18 A;  2KX3 A;  1EWL A;  3MHS A;  4DV1 M;  1EE8 A;  2OUL A;  2FCQ A;  3I06 A;  3MHH A;  2FH0 A;  2K6D B;  2BBC A;  5CHV A;  4LNF A;  1WGK A;  3PNR A;  2V1Y A;  1FPY A;  1TH2 A;  1JR3 D;  3VLF B;  1DEU A;  3QAR A;  2MP2 B;  4LNO A;  1IN8 A;  5KPZ A;  4BLC A;  4LJO B;  5KHO A;  4XZ4 A;  1QOL A;  1IBX B;  3EUB 2;  3H7D A;  5BR8 M;  2BWE A;  1IP9 A;  1FNW A;  2XNA C;  1OIP A;  1QAM A;  1HE8 A;  2N9K A;  1MEG A;  1DGG A;  1YNT E;  2D2Q A;  3NZ3 A;  1MN3 A;  1DGH A;  4RM9 A;  3P1M A;  2PIA A;  3EFU A;  5FTN A;  5BYR A;  2RDG A;  4WH4 A;  4ANU A;  3U6Q A;  4DHJ B;  2UZJ A;  2C99 A;  3N1X C;  1MG4 A;  4O1N A;  2ZTC A;  3E1Z B;  2KN5 A;  2JSV X;  1F9J A;  3OF9 A;  1IYF A;  4AKI A;  2MBO A;  2V1U A;  2N0S B;  3AEF B;  1GJS A;  4ZOH C;  3KUC B;  3DHH C;  3HVD A;  1DYQ A;  2KJR A;  3L27 A;  1B1Z A;  1TH4 A;  3AE2 B;  3NS1 A;  1CQV A;  3DBH B;  1TGZ B;  1XXH A;  3KLS X;  3PVS A;  1JML A;  3LVV A;  1HZ5 A;  1E90 A;  2OQ4 A;  2CWB A;  3ZO5 B;  5ITT A;  3C58 A;  3FUT A;  4KDI C;  3CST A;  3MJW A;  4XDC A;  2JY7 A;  2UU9 M;  2IBI B;  1QQW A;  2KHW B;  1YT7 A;  3L29 A;  3GLG B;  1WE6 A;  1PGB A;  3I51 A;  2WDV B;  4F1I A;  1NLJ A;  4DDG D;  4UN2 B;  3U6C A;  2I7N A;  2CFO A;  4BPV A;  3WXE A;  2CHX A;  4OX9 M;  2JU6 X;  2L4F A;  3K9O A;  4A3V B;  4X64 M;  4A3O A;  3BPM A;  2D7E A;  2IJ0 A;  2XSZ A;  1FNU A;  2G8E A;  2DWM A;  1WZ3 A;  1X1M A;  3WXF A;  2O6X A;  3AM9 A;  2BU3 A;  3Q8G A;  4ZRQ A;  3SC3 A;  1GL6 A;  4KKJ A;  3PT2 B;  1TYG B;  3AEB B;  2WYQ A;  3AED B;  4ZRK A;  2HKJ A;  5EXP A;  5TSS A;  1U9X A;  4X6J A;  3APF A;  1NNU C;  2F5P A;  2RPV A;  1ZCM A;  4D8E A;  2OJW A;  2CHV A;  3SEB A;  1NYQ A;  4WJO A;  1WZ0 A;  1TKG A;  2FUG 1;  4AI6 A;  3PS6 A;  2IGG A;  3E4R A;  4QRG A;  3DBS A;  3CIR B;  4LJ7 A;  2AL3 A;  3KS8 A;  2DAI A;  1I4G A;  1U9W A;  4IUM A;  3U6D A;  2KW0 A;  4K7W A;  2EMT A;  3KOX E;  3AFH A;  3W0F A;  1UGJ A;  3R8B A;  1I42 A;  1XLQ A;  4E71 A;  2HXZ A;  3J7B A;  2ZAO A;  4W9E A;  2LGX A;  3L17 A;  1QOF A;  4EZJ A;  4CGY B;  4BOQ A;  3JSV A;  2D5G A;  4GB9 A;  1WGH A;  1ME3 A;  4JXJ A;  2O01 F;  3IG5 A;  2Y5C A;  3IFU A;  2XU4 A;  1WF9 A;  2VH1 A;  3QJZ A;  2O2V B;  2X4A A;  4NAM A;  1YAL A;  4IM2 A;  2MCN B;  2QQ8 A;  1FXA A;  2FOI C;  1SJH D;  3VUY A;  1G4A E;  5TR5 A;  3VKH A;  2NBU A;  2WXO A;  1N78 A;  2JQR B;  1ZIV A;  1PM5 A;  2WWZ A;  1VRA B;  1NV9 A;  4PDI A;  1JW9 D;  2LXC A;  1VG5 A;  2AX5 A;  4EIW A;  3ZJT A;  2R6N A;  3NVZ A;  4C7Y A;  2GBM A;  1SE3 A;  2XEW A;  2EEL A;  3LDZ E;  3QAU A;  1GVN A;  2CV0 A;  1NEN B;  4LDT D;  4RNA A;  1ITO A;  3FUW A;  1TR8 A;  1GL7 A;  1KSF X;  4AXM A;  2IND C;  3Q3O C;  6PAD A;  3RUI B;  1CSB B;  2CEA A;  3FTE A;  2CHW A;  5FTK A;  2MRP A;  4FN2 A;  4M9X A;  2DC6 A;  4NC6 A;  1HJP A;  4MJS B;  4K1R B;  4C4V A;  3UIP B;  4B0E A;  3RZF A;  1P3Q U;  1JR3 A;  2LVN C;  5LXI B;  1GC7 A;  4FLH A;  1Q3B A;  2DZK A;  4W9D A;  2JP7 A;  4QRV A;  4YSZ B;  2DBY A;  2AYO B;  3UZU A;  4IBE A;  3APC A;  2KWU B;  4JI5 M;  1SXJ C;  1MIR A;  2O5R A;  2QHO B;  4EUT A;  2RSU A;  3O0U A;  3W31 A;  2WSE F;  4ANR A;  4DUY M;  2QJL A;  1CVZ A;  2C5L C;  1KFV A;  1MX0 A;  2B1M A;  1V86 A;  3AE5 B;  3VRA B;  3IXS A;  3CGW A;  2XFT A;  1C1Y B;  1SXT A;  1ZE3 D;  2JUO A;  4HDO A;  1C9F A;  2ZPN A;  1QXP A;  2IY0 B;  1RWS A;  1OIZ A;  3KKU A;  3U6E A;  3VFD A;  1MU5 A;  1JR3 E;  3U5Z A;  1K51 A;  2J42 A;  3FIL A;  4D8I A;  2WLB A;  4NY0 A;  3FKY A;  1QZM A;  4BKT A;  2GQF A;  3IT4 B;  2W3R A;  1VEG A;  2FAZ A;  3HVZ A;  4YYV A;  4XX5 A;  2ZBK B;  2FO5 A;  2MGW A;  1E8W A;  1ZUD 2;  3AE7 B;  2QC8 A;  3GPX A;  2ARY A;  1WR6 E;  3DVN U;  3PLU A;  1GLO A;  2NQD B;  4I8O A;  1TY0 A;  2Q2E B;  4DHZ E;  2M17 A;  4ACF A;  2BWB A;  1PPP A;  4KGT A;  1ME4 A;  5EP2 A;  1Y8G A;  3AN1 A;  2BPS A;  1D5X C;  1EIJ A;  5ITY A;  3PLV A;  1L0V B;  2CHG A;  3U60 B;  5JZE A;  1OTR A;  1Y8R C;  2KD0 A;  1WGG A;  2L0F A;  2HDE A;  1HNZ M;  2KXJ A;  3C0R B;  3C9P A;  2JNH A;  2QEJ C;  3PFI A;  5FPW A;  4QOZ C;  1BQI A;  2C9O A;  1R6B X;  3K9P A;  2C0Y A;  4BOS A;  4HWI B;  1IY0 A;  3NVV A;  4G3X B;  4HEO A;  1VCB A;  4D2K A;  1SB3 C;  3P4P B;  3ZNH B;  2ZW1 A;  4DUZ M;  4YVA A;  2VF8 A;  2KTR A;  2NTS A;  5JH3 A;  3VRB B;  4MDK E;  4ASW C;  4NL4 H;  2DAK A;  1PDX A;  2K0P A;  2MBH A;  1PIP A;  3TEZ A;  2MH7 A;  4W5W A;  3HHA A;  3TSS A;  3N1Y C;  5EJC A;  1DOY A;  2GNO A;  4LLG M;  3FTD A;  1KLV A;  4FW9 A;  1IXZ A;  5E6O A;  3A4R A;  1QDT A;  2DC8 A;  1WX7 A;  1KOT A;  2V3S A;  3DF0 A;  5F3W A;  1XMO M;  1QYR A;  4YXD B;  5L83 A;  3M95 A;  1V2Y A;  1UZX B;  4FXC A;  5BMI A;  1X37 A;  5I4D A;  3RI7 C;  4LF5 M;  1THE A;  4DBG B;  1I4H A;  3BOW A;  2K25 A;  3Q69 A;  1K82 A;  4IBK A;  3Q8X A;  2LHC A;  2HJ8 A;  4WP2 A;  2KA6 B;  1L8Q A;  3TJP A;  4FCT A;  4PAD A;  1Z5S B;  2FQ9 A;  2FIF A;  1YK7 A;  4WWM A;  3OJ4 B;  2B1N A;  2KMC A;  3NG0 A;  4HVB A;  3I3T A;  1YD8 U;  3AOE A;  1ZMV A;  2KAC A;  4ZRP A;  4BQV A;  4RGO S;  1D0L A;  4AW4 A;  2E6X A;  3EEC A;  2D07 B;  3KP1 E;  2NBV B;  1SF0 A;  1OFI A;  1SXJ B;  1T5X D;  3N32 A;  1IGC A;  1V80 A;  2FUD A;  2KO3 A;  3B08 A;  1Q3C A;  4OVZ A;  2J52 A;  5C18 A;  2AUX A;  4DV4 M;  3U61 B;  3HU2 A;  1K3W A;  1XWI A;  2ZCB A;  1E0Z A;  2LBC A;  2CJO A;  4EZK A;  4BVU C;  2FCS A;  4CHK A;  5BPV A;  1JQJ C;  2N9X A;  2AYN A;  3HUI A;  5FTM A;  2JZ3 B;  2REX A;  2Z8L A;  3SFD B;  3RVV A;  1HQR D;  4JGH B;  1ZKH A;  3ZCB B;  3U6S A;  1TGU A;  3OG5 A;  3RNE C;  3FKE A;  3NJT A;  2BYF A;  3QQ8 B;  3VUX A;  4C00 A;  4GKK M;  5EQT A;  1ZMW A;  2DHR A;  3HU3 A;  3GRY A;  4LGM A;  2LGI A;  3JYU A;  5FR6 A;  1D3Z A;  2LVO A;  1WXA A;  4MI7 A;  1GB4 A;  1N62 A;  3QSD A;  4FCV A;  2PPH A;  3AU4 A;  1IXS B;  3JR5 A;  2RDH A;  2KDI A;  2WXF A;  3A1Q A;  2R2Q A;  3IAS 1;  2LGD A;  1H6U A;  2JX5 A;  2WXR A;  2MR9 A;  3KS4 A;  1VJV A;  5BO4 B;  3BIN A;  3K9M A;  1WXQ A;  2IPP B;  1WGD A;  4GUA A;  3Q8F A;  2OED A;  1WWT A;  1HNW M;  1C76 A;  3W2D A;  1ZP0 B;  5IN7 A;  2WDT B;  1R2Y A;  1V9J A;  3DBR I;  2MQJ A;  4WWP A;  4WJQ A;  4DQO C;  4YV8 A;  1DGF A;  1GG3 A;  3H89 A;  2QIL A;  3VXW A;  3DBL B;  2ZAN A;  3BWK A;  1KTK A;  4GIV A;  1QQR A;  2KEB A;  4DXA B;  3O65 A;  5BYQ A;  4A8X C;  1NPZ A;  3AE1 B;  3JVZ X;  3DQV A;  4IIW A;  1L1T A;  1WYG A;  3NVY A;  1C3T A;  2BWF A;  2IO0 B;  4N6E B;  4K7C A;  4UDU C;  3J2P B;  2NPT A;  3GPP A;  3BOS A;  4P1C C;  3WHK A;  2INP E;  3ONS A;  5ITX A;  4CIS A;  3W1S C;  2IYD B;  3VK7 A;  2FCM A;  4IBF A;  5FLX S;  4WUR A;  4IWQ A;  4IBI A;  1FH0 A;  5AZH A;  2NQA A;  3MP2 A;  1Q1O A;  3H1U A;  4OZB A;  2Z7J A;  1LGR A;  1NJG A;  1U9Q X;  3B79 A;  2O6V B;  4GHL A;  1VD2 A;  1U4A A;  4CDF B;  1VDL A;  2VZK B;  4QHT A;  3KVW A;  1CQD A;  5HHD G;  3UMM A;  3M3J A;  1VZ8 A;  1ZGU B;  2QBY A;  1IY2 A;  3Q8E A;  3NBI A;  2F5N A;  1FCC C;  2WXI A;  2WSF F;  3Q3N C;  1SEB D;  5ITX E;  1YX5 B;  2DX5 B;  1K52 A;  3LQQ A;  2BB5 A;  2APL A;  4S12 A;  1GAQ B;  2XK5 A;  4IC7 B;  1HTO A;  1G6J A;  1CJL A;  3HHW A;  3BWU D;  3B0A A;  4ARI A;  1QF6 A;  3U8Z A;  1BXT A;  1YN3 A;  3ECI A;  3V62 A;  3VH4 B;  2X8A A;  4FD2 A;  1E94 E;  4KIK B;  2MH8 A;  2LUM A;  3TMP B;  3T15 A;  1O0E A;  3KSX A;  2PW9 A;  4ANW A;  2BJV A;  1YK8 A;  3GLI B;  1YN4 A;  4ANV A;  4B7G A;  4KZC A;  2WS3 B;  4EOY A;  2Y6E A;  2DAG A;  4MSQ B;  2AS8 A;  3VTW A;  1NSF A;  2KNB A;  3B7N A;  4YT0 B;  2M5Z A;  3AB5 A;  4EEW A;  4YY3 M;  2F5S A;  1CJE A;  4NJ6 A;  4RKX A;  3AE3 B;  3MTN A;  4YWG G;  4USA A;  1G41 A;  1LTM A;  2DJF B;  4Q8G A;  4CYE A;  2LGS A;  2XN9 C;  1ZW7 A;  3RMK C;  5E6P A;  3IEC A;  4XZX A;  3V05 A;  3H8C A;  4RCO A;  3RGP A;  1VDD A;  2BKF A;  4KHP M;  1WRI A;  3DVG Y;  3GOE A;  3ZDT A;  2L05 A;  5JHB A;  2Y0T A;  3SAU A;  2K5P A;  3RGS A;  3PSE B;  1SGH A;  4DV6 M;  3H7P A;  3ZQJ A;  2NS5 A;  3SMP A;  2VQE M;  2R44 A;  4FCW A;  5HG2 A;  1EWP A;  3SHF A;  3SYL A;  3UI3 A;  1HEZ E;  2BS4 B;  2LMC A;  3BBA A;  2G45 B;  3AE8 B;  2OOA A;  1TZO A;  1WYW B;  4W9L A;  4JI0 M;  1NY6 A;  2LUE A;  5DCN A;  1YUB A;  3PDF A;  2BTW B;  1FFV A;  1JQP A;  2Z4R A;  4FBJ B;  1UEL A;  3GQ3 A;  1QUS A;  3HU1 A;  3F5V A;  3P5X A;  2K8H A;  1OQQ A;  5IP4 D;  2YR0 A;  4JN6 A;  4MGK E;  2N1V A;  1MJD A;  1ZOY B;  4LNK A;  3ZH9 B;  1NY5 A;  1FIQ A;  3GLF B;  3VKG A;  1WMH A;  1OJL A;  2JA2 A;  2RGH A;  2Y20 A;  4LF8 M;  5EP3 A;  2DYM A;  3BVZ A;  2YFQ A;  3PO0 A;  2BYT A;  1D5M C;  1MJG M;  2UUB M;  3TE6 A;  1QOG A;  4HLQ A;  2UXC M;  3I9V 1;  4NRW A;  2H5X A;  1LM8 B;  3APD A;  1IQP A;  2KXE A;  3OLM D;  4HKQ A;  1ICF A;  3R7Q A;  2KJH B;  4TMA B;  2XSZ D;  4HPM B;  3ZNZ B;  4A9A A;  1KHQ A;  1C4P A;  3UQA A;  4GDK B;  1OFH A;  4YYS A;  3KX1 A;  2IGH A;  3UQB A;  3HGI A;  1L2B A;  4N9F 4;  1FXT B;  2I1K A;  2MW5 A;  3BVM A;  2LD9 A;  5EDS A;  2C98 A;  3J27 B;  3H7S A;  4LFB M;  3M0E A;  4IM3 A;  1MI0 A;  5IT9 S;  3TRK A;  1SP4 B;  4AQY M;  3PTF C;  1KHP A;  3PNV A;  3OQC A;  2GBK A;  1CV8 A;  2WDR B;  1ZDX A;  4HLE A;  1EO6 A;  1F2A A;  5AUI A;  3RNV A;  3TWL A;  3X23 A;  2X8X X;  5K16 A;  2DZY A;  1E10 A;  3ZC7 B;  1GAB A;  5JA7 A;  3ZRF A;  1YLA A;  1ESF A;  1Q5W B;  3W9C B;  4BZA A;  1JWU D;  3P42 A;  2KDM A;  2K9D A;  2L6O A;  1WIA A;  3GRR A;  3TIX A;  4C56 C;  1ZXI A;  2RKO A;  2KC2 A;  1N33 M;  3GP7 A;  1V5T A;  4XYC A;  4JWS C;  2NMQ A;  3L10 B;  5CHT A;  3CF2 A;  3P4S B;  1I4R A;  3AOG A;  1D0K A;  3NZS A;  4JI6 M;  2JXX A;  3I01 M;  5CVO B;  3U30 A;  1CMX B;  1WI0 A;  4NNJ B;  2MBQ A;  4NXN M;  4XDD A;  2L7H A;  2KAJ A;  1U5I A;  2OZ2 A;  3ERV A;  1V33 A;  2K8B A;  2IO3 B;  3LJ3 A;  2K22 A;  3BII D;  1EWC A;  4I81 A;  2WSC F;  3SU8 X;  3PHW B;  4IKG A;  2E3T A;  3TL5 A;  3D32 A;  3V6E B;  2HHH M;  3DHI C;  1WX9 A;  2NCN A;  3B74 A;  5D2M B;  2WNM A;  4IJE A;  3AL0 C;  1EUV B;  2KVR A;  3N3K B;  2CR5 A;  4M8N A;  3PNY A;  1ZMU A;  2FE8 A;  5KQ8 A;  1HT1 E;  2WXQ A;  1WM3 A;  4JX1 C;  3WAL A;  4DV0 M;  4GLS C;  4EZL A;  2ZM6 M;  1H4R A;  3SDL C;  3KH0 A;  2W82 A;  2AQ2 B;  1FEH A;  4QRX A;  1GUA B;  1OQR A;  1PJI A;  2HWJ A;  2N9E B;  3W5V B;  1FJG M;  3Q14 C;  3MK6 A;  2UUA M;  1RYJ A;  2C9C A;  4WWN A;  4C80 A;  3OJ3 A;  1XC8 A;  3Q3F A;  2LRW A;  2ZJD A;  4ANX A;  5D7G A;  3A33 B;  2LXA A;  1UF0 A;  3R2T A;  1UM8 A;  1L7Y A;  2NBW B;  3QIJ A;  1S3S A;  2KTF A;  3KWB X;  4IJF A;  3L54 A;  1AYV A;  1YOV B;  2FNJ B;  4L78 A;  5CVM A;  4GDL B;  3HJS A;  3ZJV A;  4DR2 M;  2C7H A;  2LHD A;  1NI3 A;  2DCB A;  1DO2 A;  1RU3 A;  2M4N A;  2BDL A;  3VK8 A;  1EF5 A;  3QYB A;  2JRH A;  1V1O A;  1RRB A;  1XXG A;  4YTP B;  1AN8 A;  2IO2 B;  5F02 A;  3TBL D;  1Y4H A;  4OW0 A;  4NSR A;  1Y56 A;  2OOB B;  2V4I B;  2G8L A;  1MPE A;  1TS4 A;  2PBH A;  2L09 A;  2MJ3 A;  5BMG A;  5C23 A;  1I35 A;  2AGA A;  2VH2 A;  4X66 M;  1KLU D;  3L25 A;  4R7G A;  2FNA A;  2EUC A;  5ITU A;  1GO5 A;  2BW2 A;  3IFW B;  1WR1 B;  3UIO B;  1P3Q Q;  3R9X B;  3SHG B;  5FR3 A;  1F29 A;  4P16 A;  3AOE C;  4LRT A;  4B7F A;  5C1Z A;  3CH3 X;  1V49 A;  4B3M M;  1XXH E;  2L0T A;  4QOS A;  4A6Q A;  3GQ5 A;  1IUE A;  2ZEQ A;  3T3N A;  2MBB B;  1KH0 A;  3GS2 A;  4IOI E;  1TY2 A;  5FTJ A;  4WIP A;  3MHZ A;  3T38 A;  2DAE A;  1C4C A;  2XEP A;  3IT6 B;  5D6J B;  1MS6 A;  4K0K M;  1XCT L;  2PTL A;  2LVP A;  1Q02 A;  2ZW0 A;  2LAS A;  3PRZ A;  1V34 A;  1WRD B;  4DHZ B;  4MEL A;  3Q8A A;  3MFG A;  3FUU A;  1QZE A;  3HJQ A;  3H4M A;  1NDD A;  4KSK C;  4W9J A;  4BOZ B;  4AZF A;  4BAX A;  3U6M A;  4WAA A;  2ZAM A;  3V6C B;  3LFY A;  4GOC A;  2YLM A;  1UBQ A;  1JQ4 A;  2E03 A;  2OPF A;  2JY6 A;  4CIZ A;  4II2 B;  3OIS A;  3QWL A;  4IBG A;  2EA0 A;  1ENF A;  5D3I B;  2JUJ A;  3ABV B;  4ICU A;  5KPT A;  3W30 A;  2KHH A;  5BYS A;  3AE6 B;  1FCL A;  2KDB A;  2W54 A;  3GLH A;  4GH9 A;  4LJ4 A;  3F75 A;  1N61 A;  4OEL A;  3A42 A;  2VHF A;  2EKK A;  3L16 A;  2PEA A;  1QT9 A;  2MWS B;  3WAN A;  2QNJ A;  5T8I A;  1WSP A;  1JB0 F;  3IHP C;  3W67 A;  2GLS A;  3TEX A;  1DF0 A;  1CZP A;  1JAL A;  4WJN A;  3PZ8 A;  1C78 A;  4PT5 A;  3U6O A;  3UF8 A;  1N5X A;  2KC1 A;  1XO3 A;  1E9M A;  3C3D A;  2V9H A;  2LWX A;  2GOW A;  2MP2 A;  2HAK A;  4D8B A;  4KGR A;  3I4V A;  5ITR A;  2ACT A;  4NRV A;  1IBX A;  2J7Q C;  2Z4S A;  1NNJ A;  2AVW A;  1CUK A;  2K6B A;  1WJ7 A;  3B2G A;  1CPJ A;  5IO9 A;  2GB1 A;  4K81 A;  2JQG R;  2EKE C;  3A9K B;  2KTR B;  2KWV B;  3IAM 1;  1V92 A;  1HTQ A;  3KSE A;  2K8C A;  2HJ1 A;  4HCN B;  2KT7 A;  3AV0 A;  4GMQ A;  2A5Y B;  5DNY A;  2R45 A;  1JRU A;  1A6R A;  1ISN A;  4JI7 M;  2IY1 B;  1TKE A;  4XE0 A;  1NHW C;  3AXC A;  1AYF A;  3TCA A;  4MZO A;  2AQ1 B;  7PCK A;  3DPD A;  4NAW B;  2DVW B;  2D3B A;  2DNA A;  3MTV A;  3BPF A;  2A4Z A;  2C5R A;  2HH5 A;  3W0L B;  3RNG C;  2WBF X;  5CHW A;  4FWD A;  3KWL A;  1PJS A;  2J5Y A;  3L2A A;  1JWB D;  4WQO B;  4BS6 A;  5JI3 E;  3VDZ A;  1PQS A;  4W9C A;  4B95 A;  4US9 A;  3K2L A;  4HPL B;  2DEN B;  1G8P A;  5KHQ A;  3C9E A;  4K7U A;  3GPU A;  1RFA A;  4A5U A;  3U6L A;  3Q3M C;  2G5G X;  1F0Z A;  2P0R A;  2MHJ A;  4LK0 M;  3BY4 A;  1WXM A;  2IBI A;  3VHT C;  3I3T B;  3ZDM C;  3KFQ A;  3Q3J A;  4GIT A;  1IXR C;  1T0R C;  4L2Y A;  3OF8 A;  1S3S G;  5AUK A;  3GLG A;  4PS7 A;  1DO0 A;  3RPF C;  1BML C;  4QAY A;  1XD3 B;  4PK1 A;  3KOZ E;  1NQC A;  2YNM D;  1WXS A;  3AV8 A;  3DBH I;  4TQ1 A;  1G3I A;  2J7O A;  4I07 A;  2WGS A;  3AEC B;  3PW3 A;  1C7Y A;  1L4D B;  2GBR A;  3O1G A;  1N60 A;  1Z5C A;  2FCN A;  4LDT B;  1DKI A;  4R3D A;  2J0J A;  4HXD B;  3CTW B;  3R8F A;  2OO9 A;  4LCB A;  4IWO A;  3CBK A;  4JPS A;  3PT2 A;  4G4R A;  1I4X A;  2CU1 A;  3BVG A;  3ILK A;  4DV7 M;  3R3M A;  3EC8 A;  3QYE A;  3VQI A;  2PVG C;  2B3T A;  3NY5 A;  4ZYN A;  1K8R B;  4MM3 B;  4OVV A;  3LVW A;  1XNQ M;  1S1Q B;  1GJZ A;  2E00 A;  1E5W A;  3VAW A;  1NI2 A;  2G4S A;  2WXJ A;  1NVI D;  4JV5 M;  3QC8 B;  4PP1 A;  2DZL A;  3N3G A;  4WWO A;  5D94 A;  2VRR B;  2KFJ A;  1PRB A;  1SE4 A;  3D8L A;  1OEY A;  2D7H A;  2CHQ A;  1OFF A;  3ZW3 A;  3AU5 A;  4MSM B;  4HL4 A;  1T3Q A;  3C3E A;  1L5P A;  1GMY A;  3ZNI D;  3ZVV A;  1PGX A;  2DCD A;  1WY8 A;  3VTV A;  2O2V A;  3SAV A;  2LHG A;  2K47 A;  2MA9 B;  1KFU L;  1WFY A;  4A55 A;  1YMH E;  3KUZ A;  5EXT A;  1IBK M;  2J7Q B;  4G11 A;  2CHZ A;  1LQB A;  3URY A;  3T1H M;  1XLP A;  3BXW A;  2XLJ A;  3SAR A;  2N4F A;  4W9K A;  2P7U A;  3I63 C;  1AIM A;  2LNH C;  3R7R A;  1TF0 B;  1XCQ L;  2MJ5 B;  1XQQ A;  1V97 A;  2N9P C;  4L1B A;  1TZ1 A;  4I4L A;  1S4V A;  2C7N B;  2JQF R;  2DKL A;  1F2C A;  1V81 A;  2IO1 B;  3WAP A;  1P7E A;  2KVZ A;  2MJE A;  2R4E A;  2WXG A;  3A98 B;  1B9R A;  4JQW C;  3H6S A;  1NB3 A;  4LF7 M;  1HR0 M;  3A46 A;  2DLB A;  3KOW E;  1D6E C;  4MJS A;  3PRP B;  1CTE A;  1SE2 A;  2G9H D;  4QBB A;  3LCU A;  1T3T A;  3S2A A;  1E9R A;  1L0X B;  1TIF A;  4TUU A;  4MGY E;  2DYB A;  4DR7 M;  4M0D A;  2K0B X;  3PXG A;  4CHT B;  3RE8 A;  1R4G A;  1T6B X;  2L00 B;  2A5U A;  1XEE A;  1V1P A;  2QHO A;  3SFZ A;  4NJC A;  2GMI C;  1UH6 A;  4DDI D;  1J0G A;  2XU3 A;  3FUV A;  2R46 A;  1K50 A;  2KRU A;  1XT9 B;  3U6P A;  2KYW A;  2Q5W D;  3A9J B;  3H6N A;  3THG A;  4US8 A;  3I4Y A;  2BF8 B;  4AS1 A;  4GC9 A;  1ACC A;  3PVL A;  5BMH A;  2QPA A;  2LHE A;  2H7J A;  4KZ0 A;  5G2N A;  4DMY A;  1YJJ A;  3LQR A;  4B0M A;  1D2N A;  1Q0W B;  4LZZ A;  2R9F A;  2HTM E;  3HWN A;  3V76 A;  3PRM B;  2H89 B;  2KX0 A;  2HCB A;  1EM7 A;  4X6H A;  3LXS A;  1AEC A;  3K1J A;  2WP9 B;  5FKA C;  3ENE A;  2WU5 B;  1YQ4 B;  1KXR A;  4XWW A;  2Z0E B;  2G3Q B;  4FUL A;  2KQS A;  1R7R A;  5J94 A;  1NJF A;  4TKN A;  4K7S A;  2I7P A;  5IOI A;  2OHF A;  3EIE A;  2XF3 A;  3LXF A;  3U60 A;  1TH3 A;  1STF E;  3KP0 E;  1C4A A;  2LJI A;  3DWM A;  4GN1 A;  1EWY C;  1AU0 A;  1NV8 A;  1Z6T A;  3TWK A;  4YYR A;  4DXG A;  3C0R A;  3KDS E;  2J4X A;  2VZK D;  1VDV A;  5LNK 1;  3U52 E;  5EGW A;  1SIJ A;  4DR1 M;  2LJ5 A;  3B9P A;  3FC4 A;  1AWD A;  4M0W B;  4PS3 A;  4YTN B;  3H7P B;  5CHV C;  2HWK A;  4FJZ A;  4BBN C;  4ZHP A;  3ZNH A;  5EXS A;  1R4M B;  1IFY A;  1GJT A;  3RFW A;  1PFD A;  2JRI B;  3DHG C;  1POP A;  1LV7 A;  4JL9 A;  4DR6 M;  1LXD A;  1PPN A;  1HT2 E;  1IBM M;  2J0M A;  2JTC A;  5IKC M;  3NOB A;  4II3 B;  4RF0 A;  4ZYS A;  1QDR A;  2KQ4 X;  2IGD A;  3QCA A;  3E46 A;  1MFW A;  4G50 A;  3HZJ A;  4WAF A;  2R4J A;  5GMV A;  2D3C A;  3ZTC A;  4G4O A;  2AQ3 B;  2KMA A;  1EFU B;  5CX3 A;  4FK5 A;  5JI2 E;  1WMH B;  3GZN B;  3L4P A;  3ML9 A;  2RD0 A;  4HKZ E;  3OVX A;  1L4Z B;  1N32 M;  1R4N B;  2KWC A;  2L32 A;  4X65 M;  4DBG A;  4I05 A;  3BBZ A;  4MSX A;  4FVM A;  2B3A A;  3UK6 A;  4IBD A;  5KO3 A;  4XBO A;  3HHY A;  1PUT A;  4AJW A;  1HQC A;  3CH2 X;  3QHT A;  3U2S C;  3EGR A;  2BJW A;  4DR5 M;  2PLP A;  1SIF A;  4OVU A;  4AG5 A;  1WIV A;  3SFE B;  3I57 A;  4HDQ A;  4CDD B;  1ZDV A;  1IM2 A;  1WX8 A;  2DYO A;  2PKO A;  2V3P A;  2W9N A;  2WQY B;  3KVF B;  1JCK B;  1KLG D;  1YIW A;  3VDU A;  3N20 C;  2BGF A;  4PCZ A;  2N7D A;  1C77 A;  4M9Z A;  2LZ6 A;  4GXB A;  4HEA 1;  2M60 A;  2BWE S;  1J09 A;  1K53 A;  5HKH A;  4G3O A;  2RRU A;  1F2B A;  2BT6 A;  4YL8 A;  4M02 A;  1D4B A;  2KDL A;  1U9V A;  2KNV A;  3U61 A;  3PV1 A;  4N59 A;  4S0R A;  4AP4 C;  3S3R A;  3ZLZ A;  5JH5 C;  1XB2 B;  4D82 A;  1QAN A;  1TL9 A;  3JR4 A;  3GPY A;  3EHV A;  1UFZ A;  2G4D B;  4A3P A;  2NTT A;  2N9L A;  2WXH A;  4KV2 A;  3DOW A;  4M01 A;  1NEK B;  1GOZ A;  3HKP A;  2LVQ D;  3MMP A;  4X6I A;  2DJG B;  2PE6 B;  3SBJ A; 
#chains in the Genus database with same CATH homology
 1PVJ A;  2Y5P A;  3MHV C;  5EE1 A;  4KOD A;  5EE0 A;  1IN4 A;  3FAH A;  2M19 A;  1FD6 A;  1XF5 L;  1VJK A;  2WXM A;  3E9S A;  2CE7 A;  1L6U A;  2W55 A;  4XWT A;  4Z6Y A;  3L28 A;  2CJN A;  3GB1 A;  4MB7 A;  4YTM B;  1YE9 A;  1W5S A;  3U7Z A;  3HRD D;  4B3S M;  4B7H A;  1TKY A;  4HJG E;  4HRS A;  2Z84 A;  2DWZ B;  1I4Q A;  4DV3 M;  4DXF A;  3SAS A;  4JI8 M;  4DR4 M;  2L1A A;  1YQ3 B;  3CWI A;  1DGH B;  4LGY A;  2YQZ A;  3BYT B;  4JI4 M;  3SYK A;  1UWM A;  5D3D A;  4YSY B;  2ACZ B;  4LF9 M;  5FSW A;  5G5H A;  1VZ6 A;  4L16 A;  3SMS A;  1XXH B;  1L2D A;  5IRE B;  4JWU C;  1I7H A;  3NRZ A;  3JAM S;  4BBA A;  1NYR A;  4LRS A;  4LJ8 A;  2KMM A;  5GXG B;  3TMP A;  1TJE A;  3KWV A;  2M0A A;  1QAQ A;  2ONQ A;  3GLI A;  2UXB M;  5H92 C;  1EU3 A;  1J7B A;  5GKN A;  2XGN A;  3AMZ A;  1UKF A;  2ON8 A;  4XGI A;  5MPO A;  3GRU A;  2F5O A;  3PHU A;  2RMM A;  4JI2 M;  2WXK A;  3PSE A;  4MH8 A;  1TDZ A;  5EP4 A;  3P4Q B;  1K3X A;  2QZ4 A;  2E5L M;  2UUC M;  1KF6 B;  1V8C A;  1SJE D;  1XMQ M;  1JWS D;  2BTW A;  4JE3 B;  3KSJ A;  3VR9 B;  1STE A;  2BNK A;  4PD2 A;  1XHB A;  5LMN M;  4TUW A;  2KZS A;  3T1Y M;  1MHH E;  1I4P A;  5EE9 A;  3EA6 A;  2XH9 A;  4G4N A;  1F2R C;  3GLF A;  2YEP B;  1ZXH A;  2UXD M;  4MGZ E;  1FO4 A;  4P6V F;  4BOP A;  4D80 A;  2DXI A;  4L4U A;  1L2C A;  1YJI A;  4KLN A;  4G4Q A;  2J7N A;  2HL7 A;  3B2F A;  3W1S A;  5KPR A;  2NQ8 C;  3AEA B;  4RGM A;  1E9S A;  3IG8 A;  4JYA M;  1Q39 A;  1A70 A;  2WU2 B;  1IN7 A;  1D5Z C;  3A45 A;  4TSS A;  4DR3 M;  3J9C A;  2CU3 A;  4PDG A;  2L7I A;  4LJ5 A;  5DYG A;  1FMA D;  2QMT A;  2DWL A;  1ET6 A;  2AHM A;  4ITK A;  4JI1 M;  4ARC A;  4KKI A;  5G5G A;  1NVM A;  2K3U A;  4TQ0 A;  2D7G A;  3D8B A;  2J53 A;  2V1C A;  4LJ9 A;  1J5E M;  3U5Z B;  1M4V A;  3FIL B;  2KN4 A;  3ETR A;  5EP1 A;  4KGS A;  4BB9 A;  2GI9 A;  2BTE A;  3PHX A;  4EE2 A;  5EZS A;  2CV2 A;  4GHA A;  2Y0Q A;  2GRI A;  3T3O A;  3KQ4 A;  5IWA M;  1GKI A;  3PHW A;  2L83 A;  1DGB A;  4LY6 A;  1PJJ A;  2LFI A;  3N9Y C;  3NWL A;  3DA1 A;  3UGJ A;  4AG6 A;  4IDI A;  1N36 M;  4GKJ M;  3BK1 A;  1FXI A;  1W5T A;  4LFA M;  1YSY A;  3Q8C A;  2R65 A;  2YEP F;  2KWD A;  3WCQ A;  1TS3 A;  4B3R M;  5C3J B;  5E26 A;  4B08 A;  3L26 A;  2CUZ A;  2DWN A;  1PYW D;  1AW7 A;  1DGJ A;  1ZAE A;  3M6A A;  4H2A A;  2XZF A;  4BOU A;  1JRP A;  3FYD A;  1I94 M;  1QLB B;  2BS2 B;  1L1Z A;  3RFZ B;  3C8Y A;  1QVR A;  2WDQ B;  4OZC A;  3ZYY X;  1ZQ9 A;  3AEG B;  1N77 A;  3TPZ A;  3AH7 A;  4GC5 A;  1ZPS A;  3SAW A;  3SBJ A;  4YHH M;  1HA5 A;  2TSS A;  4OVZ B;  1V1P B;  1MVK A;  3U4E G;  8CAT A;  1J7C A;  3NUH B;  2XZU A;  2DWQ A;  2FFJ A;  4RH6 A;  4ITQ A;  3TEW A;  2JXT A;  4BOZ A;  3FYC A;  3KW6 A;  4JI3 M;  3BK2 A;  4NOO B;  2ERC A;  1LO5 D;  1I4W A;  3FTC A;  2DZN B;  4LF6 M;  2M56 B;  3FUX A;  3AEE B;  1ORY B;  3KXE C;  1HNX M;  1VLB A;  4KO8 A;  4N58 A;  3AE9 B;  4LJA A;  3OWE B;  3SAT A;  1IN6 A;  2W3S A;  1IGD A;  1VR9 A;  4HRO A;  4GIP A;  4KX6 B;  4LTU A;  1DOX A;  5FK9 C;  4AKG A;  5H8Y E;  3MC0 B;  2Y21 A;  5ITQ A;  4FWG A;  3TEY A;  2QEN A;  1SXJ D;  1ET9 A;  3AE4 B;  2V6Z M;  1UNS A;  1J7A A;  1G59 A;  1TS2 A;  5A2Q S;  1TDH A;  2VQF M;  4MH0 E;  5HI1 A;  3M7G A;  3CF0 A;  4IBB A;  3KFU G;  4DV2 M;  3NVW A;  4RGT A;  1C1K A;  4D81 A;  2X49 A;  1MHX A;  1QOB A;  1TS5 A;  1FNN A;  2IDY A;  3LMM A;  5EE3 A;  2QBY B;  4Z8X A;  4NZL B;  4MGI E;  1F2R I;  1FNV A;  4MT5 A;  2QSD A;  2G1E A;  1UWX A;  2EO2 A;  2B76 B;  1FFU A;  5E6J A;  3UJN A;  3SR6 A;  2WXP A;  4IBC A;  3DWG C;  4OHJ A;  3P63 A;  3B9J A;  3PZ7 A;  2H88 B;  1IY1 A;  4IBJ A;  1Z5B A;  4RGN A;  1QKZ A;  3B21 A;  1DOI A;  4LZJ A;  2BS3 B;  4LG2 A;  2LH0 A;  4X62 M;  2IPK D;  2WXL A;  1YN5 A;  3GO8 A;  1BUI C;  3WHL A;  2F5Q A;  4MAC A;  3HJ8 A;  3DOA A;  1N63 A;  1P7F A;  3TUO A;  2QCU A;  4I5S A;  3ZQ4 A;  1R2Z A;  2FBW B;  4Q2J A;  1XNR M;  2JZP A;  4J3O D;  2R61 A;  2J7Q A;  1QOA A;  5JXV A;  2MJD A;  4NXM M;  3EIH A;  4OU7 A;  3GRV A;  1ROE A;  2K9X A;  3HWS A;  2R62 A;  4OZA A;  7CAT A;  1HXY D;  2JYE A;  4ZHO A;  1GB1 A;  1IN5 A;  4REZ A;  3K8Z A;  2DZO B;  3DFZ A;  1FRD A;  2N7J A;  1FRR A;  5KQD A;  4DV5 M;  1VZ7 A;  3TL4 X;  3PRP A;  1Q10 A;  3HHZ A;  1RM6 C;  2LXE A;  4NSO B;  2F4V M;  3J7A S;  5EZQ A;  4LFC M;  4LJ6 A;  3R2I A;  3TQS A;  4AKH A;  2V0G A;  3ZJU A;  1SXJ A;  5C2T B;  1HQY E;  4L8R C;  2XFS A;  4FWH A;  2I2Y A;  4M9S A;  4RF1 A;  2L52 A;  2X38 A;  3AJI B;  4G6Z A;  1GLN A;  4L15 A;  1N5W A;  2PMV A;  5FTL A;  1PGA A;  3PRM A;  2INN E;  4L23 A;  1SXJ E;  1F77 A;  2EKI A;  4ZPX A;  2SEB D;  4B3T M;  1C79 A;  4AQ7 A;  2WXN A;  4RFB A;  3W5U B;  1CK1 A;  3Q8B A;  4MGH A;  3HHX A;  1E32 A;  5EXX A;  1HZ6 A;  4WQM A;  2JYT A;  2JWU A;  1JWA D;  1SBB B;  5H37 D;  1JWM D;  5IZ7 D;  3CF6 E;  4GRI A;  3H8H A;  3ZGZ A;  3TWM A;  4M0W A;  2MEK A;  1L0Y B;  3GP1 A;  2VII A;  3KOY E;  1QIL A;  2KRK A;  5HFY A;  2JRI A;  2RGO A;  1QAO A;  2I38 A;  2C96 A;  1XLN A;  1KRH A;  2Y3A A;  3MP9 A;  3VR8 B;  1KFY B;  2DOS A;  1SSN A;  3GQ4 A;  1UUP A;  3BB7 A;  4CQN A;  2QIE B;  1GPX A;  3FTF A;  4YSX B;  1Z59 A;  3BZD B;  4WW0 A;  1FM0 D;  1Z5A A;  2BB6 A;  1J7K A;  3MJ5 A;  5LMU M;  2ICI A;  3K92 A;  1KYI A;  2H1R A;  3E56 A;  4A90 A;  2QP9 X;  4C7Z A;  1R7S A;  1N75 A;  4QHS A;  1E7P B;  1XLO A;  2LEK A;  3LYY A;  3AKZ A;  2SAK A;  2Z3X A;  3J81 S;  1L6V A;  3BYY B;  3OTO M;  2CV1 A;  3P4R B;  1IBL M;  5DYI A;  1YZB A;  3FD9 A;  1NHG C;  1EU4 A;  4QNR A;  1E6E B;  4LF4 M;  4QNM A;  1JRO A;  2P5T A;  5C1B A;  4ZTB A;  2PVO D;  3J80 S;  1RFK A;  3GLH B;  3O13 A;  1N34 M;  3V3X A;  3DZD A;  3LB8 C;  2V3N A;  2KZU A;  4II7 A;  3VDP A;  2R18 A;  4DV1 M;  1EE8 A;  2BBC A;  1WGK A;  1TH2 A;  1JR3 D;  3VLF B;  1IN8 A;  5KPZ A;  4BLC A;  1IBX B;  3EUB 2;  5BR8 M;  1FNW A;  2XNA C;  2N9K A;  1QAM A;  1DGG A;  1YNT E;  3NZ3 A;  1DGH A;  3P1M A;  2PIA A;  5FTN A;  5BYR A;  2RDG A;  4WH4 A;  3U6Q A;  2UZJ A;  2C99 A;  4O1N A;  2JSV X;  3AEF B;  4AKI A;  2V1U A;  2N0S B;  4ZOH C;  3HVD A;  1DYQ A;  3L27 A;  1B1Z A;  1TH4 A;  3AE2 B;  3NS1 A;  1CQV A;  1XXH A;  3KLS X;  3PVS A;  1JML A;  3LVV A;  1HZ5 A;  2OQ4 A;  5ITT A;  3C58 A;  3FUT A;  4XDC A;  2UU9 M;  1QQW A;  3L29 A;  3GLG B;  2WDV B;  1PGB A;  3I51 A;  3U6C A;  2I7N A;  2CFO A;  4OX9 M;  2JU6 X;  4X64 M;  4A3V B;  2D7E A;  2IJ0 A;  2XSZ A;  1FNU A;  2DWM A;  3AM9 A;  2BU3 A;  4ZRQ A;  3SC3 A;  1GL6 A;  4KKJ A;  3AEB B;  1TYG B;  3AED B;  2HKJ A;  5EXP A;  5TSS A;  1NNU C;  2F5P A;  2RPV A;  4D8E A;  2CHV A;  3SEB A;  1NYQ A;  1TKG A;  2FUG 1;  4AI6 A;  2IGG A;  3E4R A;  3CIR B;  4LJ7 A;  3KS8 A;  1I4G A;  4IUM A;  3U6D A;  2KW0 A;  3KOX E;  3AFH A;  3W0F A;  1UGJ A;  3R8B A;  1XLQ A;  3J7B A;  2ZAO A;  1QOF A;  4CGY B;  4BOQ A;  2D5G A;  4JXJ A;  3IG5 A;  2Y5C A;  3IFU A;  2X4A A;  4NAM A;  1FXA A;  2FOI C;  1SJH D;  1G4A E;  3VKH A;  2WXO A;  1N78 A;  2JQR B;  1PM5 A;  1VRA B;  4PDI A;  1JW9 D;  2AX5 A;  4EIW A;  3ZJT A;  3NVZ A;  4C7Y A;  1SE3 A;  2EEL A;  3QAU A;  1GVN A;  2CV0 A;  1NEN B;  4RNA A;  3FUW A;  1GL7 A;  1KSF X;  2CEA A;  3FTE A;  5FTK A;  4M9X A;  4B0E A;  1JR3 A;  1Q3B A;  4YSZ B;  2DBY A;  3UZU A;  4IBE A;  4JI5 M;  1SXJ C;  2O5R A;  3W31 A;  4DUY M;  2QJL A;  1KFV A;  1MX0 A;  3AE5 B;  3VRA B;  3IXS A;  1SXT A;  2XFT A;  1C9F A;  1ZE3 D;  1RWS A;  3U6E A;  3VFD A;  1MU5 A;  3U5Z A;  1K51 A;  2J42 A;  3FIL A;  4D8I A;  2WLB A;  1QZM A;  3IT4 B;  2W3R A;  3HVZ A;  2ZBK B;  1ZUD 2;  3AE7 B;  3GPX A;  4I8O A;  1TY0 A;  2Q2E B;  4KGT A;  5EP2 A;  3AN1 A;  1D5X C;  5ITY A;  1L0V B;  2CHG A;  3U60 B;  5JZE A;  2HDE A;  1HNZ M;  2QEJ C;  3PFI A;  4QOZ C;  2C9O A;  1R6B X;  4BOS A;  1IY0 A;  3NVV A;  4D2K A;  1SB3 C;  3P4P B;  2ZW1 A;  4DUZ M;  2NTS A;  3VRB B;  4NL4 H;  1PDX A;  2K0P A;  3TEZ A;  2MH7 A;  4W5W A;  3TSS A;  5EJC A;  1DOY A;  4LLG M;  3FTD A;  4FW9 A;  1IXZ A;  5F3W A;  1XMO M;  1QYR A;  4YXD B;  4FXC A;  5BMI A;  1X37 A;  5I4D A;  4LF5 M;  1I4H A;  3Q69 A;  1K82 A;  4IBK A;  3Q8X A;  2KA6 B;  1L8Q A;  4FCT A;  4WWM A;  3AOE A;  2KAC A;  4ZRP A;  4RGO S;  2E6X A;  4AW4 A;  3KP1 E;  1SF0 A;  1OFI A;  1SXJ B;  1T5X D;  1IGC A;  1Q3C A;  4OVZ A;  2J52 A;  5C18 A;  4DV4 M;  3U61 B;  3HU2 A;  1K3W A;  1XWI A;  1E0Z A;  2CJO A;  5BPV A;  1JQJ C;  3HUI A;  5FTM A;  2Z8L A;  3SFD B;  1HQR D;  3ZCB B;  3U6S A;  1TGU A;  3FKE A;  4GKK M;  5EQT A;  2DHR A;  3HU3 A;  3GRY A;  4LGM A;  2LGI A;  4MI7 A;  1GB4 A;  1N62 A;  4FCV A;  1IXS B;  3JR5 A;  2RDH A;  2WXF A;  3IAS 1;  1H6U A;  2JX5 A;  2WXR A;  3KS4 A;  1WXQ A;  4GUA A;  3Q8F A;  2OED A;  1WWT A;  1HNW M;  1C76 A;  3W2D A;  1ZP0 B;  1R2Y A;  4DQO C;  1DGF A;  2QIL A;  2ZAN A;  3O65 A;  1KTK A;  1QQR A;  2KEB A;  5BYQ A;  4A8X C;  3AE1 B;  4IIW A;  1L1T A;  1WYG A;  3NVY A;  4N6E B;  4UDU C;  3J2P B;  3GPP A;  3BOS A;  3WHK A;  2INP E;  5ITX A;  4CIS A;  3VK7 A;  4IBF A;  5FLX S;  4WUR A;  4IBI A;  3MP2 A;  4OZB A;  2Z7J A;  1NJG A;  4GHL A;  2VZK B;  4QHT A;  3KVW A;  5HHD G;  3UMM A;  1VZ8 A;  2QBY A;  1IY2 A;  3Q8E A;  3NBI A;  2F5N A;  1FCC C;  2WXI A;  1SEB D;  5ITX E;  1K52 A;  3LQQ A;  2BB5 A;  4S12 A;  1GAQ B;  3HHW A;  3BWU D;  4ARI A;  1QF6 A;  1BXT A;  1YN3 A;  2X8A A;  4FD2 A;  1E94 E;  2LUM A;  3T15 A;  3KSX A;  2PW9 A;  2BJV A;  3GLI B;  1YN4 A;  4B7G A;  2WS3 B;  1NSF A;  4YT0 B;  2M5Z A;  3AB5 A;  4YY3 M;  2F5S A;  1CJE A;  4RKX A;  3AE3 B;  4YWG G;  4USA A;  1G41 A;  2XN9 C;  4XZX A;  3V05 A;  4RCO A;  3RGP A;  1VDD A;  4KHP M;  1WRI A;  2Y0T A;  3SAU A;  2K5P A;  3RGS A;  4DV6 M;  3SMP A;  2VQE M;  4FCW A;  5HG2 A;  3SHF A;  3SYL A;  3UI3 A;  1HEZ E;  2BS4 B;  2LMC A;  3BBA A;  3AE8 B;  1TZO A;  4JI0 M;  1NY6 A;  1YUB A;  2BTW B;  1FFV A;  2Z4R A;  3GQ3 A;  3HU1 A;  1OQQ A;  2YR0 A;  4JN6 A;  4MGK E;  1ZOY B;  3ZH9 B;  1NY5 A;  1FIQ A;  3GLF B;  3VKG A;  1OJL A;  2JA2 A;  2RGH A;  2Y20 A;  4LF8 M;  5EP3 A;  3BVZ A;  2DYM A;  2YFQ A;  3PO0 A;  2BYT A;  1D5M C;  2UUB M;  3TE6 A;  1QOG A;  4HLQ A;  3I9V 1;  2UXC M;  4NRW A;  1IQP A;  2KXE A;  4HKQ A;  4TMA B;  2XSZ D;  4A9A A;  1C4P A;  4GDK B;  1OFH A;  2IGH A;  3HGI A;  1L2B A;  3BVM A;  2C98 A;  3J27 B;  4LFB M;  3M0E A;  1MI0 A;  5IT9 S;  3TRK A;  4AQY M;  3PNV A;  3OQC A;  2WDR B;  1ZDX A;  5AUI A;  3RNV A;  3TWL A;  1E10 A;  3ZC7 B;  1ESF A;  3W9C B;  1JWU D;  3P42 A;  2KDM A;  2L6O A;  3GRR A;  4C56 C;  1ZXI A;  2RKO A;  1N33 M;  3GP7 A;  4JWS C;  2NMQ A;  3CF2 A;  3P4S B;  1I4R A;  3AOG A;  4JI6 M;  4NXN M;  4XDD A;  2L7H A;  2KAJ A;  2K22 A;  3BII D;  1EWC A;  4I81 A;  4IKG A;  2E3T A;  2HHH M;  2WNM A;  4IJE A;  3AL0 C;  3PNY A;  2FE8 A;  5KQ8 A;  1HT1 E;  2WXQ A;  4JX1 C;  4DV0 M;  4GLS C;  2ZM6 M;  2W82 A;  2AQ2 B;  1FEH A;  1OQR A;  1PJI A;  3W5V B;  1FJG M;  3MK6 A;  2UUA M;  1RYJ A;  2C9C A;  4C80 A;  1XC8 A;  5D7G A;  3R2T A;  1UM8 A;  1S3S A;  4IJF A;  4L78 A;  4GDL B;  3HJS A;  3ZJV A;  4DR2 M;  2LHD A;  1NI3 A;  1DO2 A;  3VK8 A;  1V1O A;  1XXG A;  4YTP B;  1AN8 A;  4OW0 A;  4NSR A;  1Y56 A;  2V4I B;  2G8L A;  1MPE A;  1TS4 A;  2L09 A;  2MJ3 A;  5BMG A;  2AGA A;  4X66 M;  1KLU D;  3L25 A;  4R7G A;  2FNA A;  2EUC A;  5ITU A;  2BW2 A;  3R9X B;  3SHG B;  5FR3 A;  4P16 A;  3AOE C;  4LRT A;  4B7F A;  4B3M M;  4QOS A;  4A6Q A;  3GQ5 A;  1IUE A;  3T3N A;  3GS2 A;  1KH0 A;  4IOI E;  1TY2 A;  5FTJ A;  4WIP A;  3MHZ A;  3T38 A;  1C4C A;  2XEP A;  3IT6 B;  4K0K M;  1XCT L;  2PTL A;  2ZW0 A;  3Q8A A;  3MFG A;  3FUU A;  3HJQ A;  3H4M A;  4AZF A;  3U6M A;  2ZAM A;  1JQ4 A;  2OPF A;  3QWL A;  4IBG A;  2EA0 A;  1ENF A;  5D3I B;  3ABV B;  5KPT A;  3W30 A;  5BYS A;  3AE6 B;  1FCL A;  2W54 A;  3GLH A;  4GH9 A;  4LJ4 A;  1N61 A;  3A42 A;  1QT9 A;  5T8I A;  1WSP A;  3TEX A;  1CZP A;  1JAL A;  3PZ8 A;  1C78 A;  4PT5 A;  3U6O A;  1N5X A;  1XO3 A;  1E9M A;  2LWX A;  4D8B A;  4KGR A;  3I4V A;  5ITR A;  4NRV A;  1IBX A;  2J7Q C;  2Z4S A;  1NNJ A;  3B2G A;  2GB1 A;  3IAM 1;  3AV0 A;  4GMQ A;  2A5Y B;  5DNY A;  2R45 A;  4JI7 M;  1TKE A;  4XE0 A;  1NHW C;  1AYF A;  2AQ1 B;  4NAW B;  2DVW B;  3MTV A;  2C5R A;  3W0L B;  4FWD A;  3KWL A;  3L2A A;  1JWB D;  5JI3 E;  4US9 A;  3K2L A;  1G8P A;  4A5U A;  3GPU A;  3U6L A;  2G5G X;  1F0Z A;  4LK0 M;  3BY4 A;  4GIT A;  1IXR C;  4L2Y A;  5AUK A;  3GLG A;  1DO0 A;  3RPF C;  1BML C;  3KOZ E;  2YNM D;  3AV8 A;  4TQ1 A;  1G3I A;  2J7O A;  3AEC B;  1L4D B;  1N60 A;  1Z5C A;  1DKI A;  4R3D A;  4HXD B;  3CTW B;  3R8F A;  4LCB A;  4JPS A;  3PT2 A;  4G4R A;  1I4X A;  3BVG A;  3ILK A;  4DV7 M;  3VQI A;  2PVG C;  4MM3 B;  3LVW A;  1XNQ M;  2WXJ A;  1NVI D;  4JV5 M;  1SE4 A;  3D8L A;  2D7H A;  2CHQ A;  1OFF A;  4HL4 A;  1T3Q A;  1L5P A;  1PGX A;  3SAV A;  2K47 A;  4A55 A;  1YMH E;  5EXT A;  1IBK M;  3URY A;  3T1H M;  1XLP A;  2XLJ A;  3SAR A;  2LNH C;  1XCQ L;  1V97 A;  4L1B A;  4I4L A;  1P7E A;  2MJE A;  2R4E A;  3A98 B;  1B9R A;  4LF7 M;  1HR0 M;  3A46 A;  2DLB A;  3KOW E;  1D6E C;  1SE2 A;  2G9H D;  1T3T A;  1E9R A;  1L0X B;  4MGY E;  4DR7 M;  4M0D A;  3PXG A;  4CHT B;  3RE8 A;  1T6B X;  1XEE A;  1V1P A;  3SFZ A;  4NJC A;  3FUV A;  2R46 A;  1K50 A;  2KRU A;  2Q5W D;  3U6P A;  3THG A;  4US8 A;  3I4Y A;  4AS1 A;  4GC9 A;  1ACC A;  5BMH A;  2QPA A;  2LHE A;  1YJJ A;  3LQR A;  4B0M A;  1D2N A;  4LZZ A;  2HTM E;  2H89 B;  2HCB A;  1EM7 A;  3K1J A;  2WP9 B;  5FKA C;  2WU5 B;  1YQ4 B;  4XWW A;  1R7R A;  1NJF A;  2I7P A;  2OHF A;  3EIE A;  2XF3 A;  3LXF A;  3U60 A;  1TH3 A;  3KP0 E;  1C4A A;  2LJI A;  3DWM A;  1EWY C;  1Z6T A;  3TWK A;  4DXG A;  3C0R A;  3KDS E;  2J4X A;  2VZK D;  1VDV A;  5LNK 1;  3U52 E;  1SIJ A;  4DR1 M;  3B9P A;  3FC4 A;  1AWD A;  4YTN B;  2HWK A;  4ZHP A;  3ZNH A;  5EXS A;  3RFW A;  1PFD A;  1LV7 A;  4DR6 M;  1HT2 E;  1IBM M;  2JTC A;  4RF0 A;  4ZYS A;  2KQ4 X;  2IGD A;  4WAF A;  2R4J A;  4G4O A;  2AQ3 B;  5JI2 E;  3L4P A;  4HKZ E;  1L4Z B;  1N32 M;  2L32 A;  4X65 M;  4FVM A;  3UK6 A;  4IBD A;  5KO3 A;  4XBO A;  3HHY A;  1PUT A;  1HQC A;  3U2S C;  3EGR A;  2BJW A;  4DR5 M;  2PLP A;  4AG5 A;  3SFE B;  3I57 A;  1ZDV A;  1IM2 A;  2DYO A;  2PKO A;  2WQY B;  2V3P A;  1JCK B;  1KLG D;  3VDU A;  4PCZ A;  1C77 A;  4M9Z A;  4HEA 1;  2M60 A;  1J09 A;  1K53 A;  2BT6 A;  1D4B A;  3U61 A;  4N59 A;  4D82 A;  1QAN A;  3JR4 A;  3GPY A;  2NTT A;  2N9L A;  2WXH A;  1NEK B;  1GOZ A;  3HKP A;  4IP3 A;  2WXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...