4PTLA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iic-gm
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
310
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 100
structure length 310
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ptlA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ptlA01
3M6AA 1XEFA 4TT3A 4XOIA 4KVGA 4C0HA 3WBKA 2WSMA 3GJ5A 2IYZA 2ZSDA 2Y8EA 3PUVA 5KPDA 2IW3A 4JS0A 2VHUA 1II0A 3PFIA 3DOFA 5EJEA 2ZREA 3C7KA 3AB3A 2O8DB 1KJWA 1TQ6A 2JATA 1KK3A 5FL7A 3VX4A 1UDWA 2J87A 1X6VA 1G3IA 2NOAA 2ZANA 4IJMA 4AD8A 3REFA 2WVJA 4KITB 1QHIA 3LRPA 2ZRHA 2FF7A 3ZGXA 2QGZA 1KGDA 1YZKA 1Z0FA 1EFRA 2P6NA 4HLUC 3Q5DA 2BEKA 1VMAA 3OIYA 4XTRA 1J99A 4HAXA 3K0SA 4GL2A 4UXIA 5A4JA 2J0QA 3ZVMA 4X8LA 1KY2A 2J0UB 5CK5A 4WA7A 5KDDA 2ZUCA 4LV6A 1G19A 3QIAA 2IF2A 2QUZA 2VRWA 2XEXA 1IXSB 3I73A 3VR3A 3A8TA 1DO0A 3K0CC 3FKSA 2W2XA 5FOUA 2FNAA 3K8YA 3I1FA 3VKGA 4IVQA 1HUQA 3B1ZA 4B32A 1ZMXA 4HZUB 1XJQA 4GSYA 5DYGA 4YLGA 4I81A 4FD2A 2GCOB 4C0BA 1NIPA 1ZYUA 4A9AA 3OEEA 2ZR9A 1U9IC 5B30A 4O0MA 1IY0A 2CEAA 3UANA 1EX7A 5JMTA 3A1WA 3W6OA 2O8BB 1P4SA 4RD4A 1N25A 2FE4A 2ZITA 2PEYA 4QG7A 3X1YA 5C2JB 4OKSA 4CEIA 4OI0A 5L3SA 1E4YA 1KNQA 3SNHA 3OESA 4US0R 3KXLA 4WOPA 3UMFA 2FWRA 1CKEA 3QG5A 2ZAMA 2BMFA 1OFHA 4HLDA 4Y0VA 1MO6A 3GEIA 3CPJB 4C30A 3O47A 1ZC4A 2YOHA 1Q0UA 1WRBA 4PTLA 2EWWA 5KNCA 1OH7A 1OH8A 1TQDA 3RSOA 1V5WA 1XNJA 2PL3A 1N5IA 4IDPA 4PO8A 2OFOA 2PMKA 3KZ1E 1J8MF 1EX6A 3HU1A 1G3UA 4TSFA 3IGFA 4UJ3A 4LJ4A 4KSCA 3GLHA 4FCVA 2A5GA 4GDFA 4OI1A 1X8LA 2GNOA 3H0KA 1Z5ZA 4LV8B 2VQSA 3HJNA 1U8ZA 1YZGA 1Z07A 3T35A 3ADCA 2DWQA 1II8B 3WMEA 4UNPA 5KOYA 1JXOA 2J0SA 1J2JA 2EWVA 1GITA 2ZI7A 1KO5A 1R0WA 4IDQA 4OJKA 1QHGA 4NU0A 4B6EA 1CRPA 4MGIR 5J40A 1OXUA 1Q1QA 3DEFA 1QHHB 3IEUA 4JYBA 4BUJA 3LW8A 1U8AA 1R7RA 3U3RA 1Z83A 1FUUA 2AX4A 4BFYA 3UKDA 4CDGA 1G3MA 4KSBA 4C7OA 1HV8A 3IQXA 3LQRA 3EW9A 3R9IA 4EKDA 2E87A 4M1MA 2GXQA 2BJWA 2HJVA 3EC1A 1NF3A 1TUIA 1FPMA 1G4UR 2WPDA 3O8RA 1D9ZA 4UNSA 2P2LA 1ETUA 5EXXA 3BOSA 1P2SA 1KMQA 3W5JA 4A0RA 3GJ6A 2QNRA 4P32A 4MKHA 1WDTA 3E2IA 2PEZA 4P33A 4JLJA 4Z54A 2K5UA 1TMKA 1KJZA 4O2RA 4Q5IA 2P0EA 4WBSA 5FPHA 2J41A 1AQYA 3LVQE 4FCWA 3UATA 1G7SA 3CNNA 1UKYA 4EJSB 4K81B 3NTUA 2GJAA 1IONA 3IBYA 1Z28A 4A15A 2OAP1 3LO5A 1UBFA 2AD5A 1GAJA 4NYJR 1PUIA 4HAVA 4L9SA 4P0TA 5DI3B 4L8GA 3HPQA 4D4MA 2GAAA 3SU8A 4IDNA 4LJ6A 3IO3A 4ACBA 4YMVA 3UK6A 3IIKA 4TYWA 3GCGA 4ILEA 4XWOA 4A36A 2R6AA 3KFVA 3IBGA 4LBWA 1FX0B 2ZRPA 3L0IB 4DDTA 1RC8A 5CB8A 1XZQA 2ECKA 2EFHB 2G3YA 3PR1A 4DIDA 1UBCA 4TL6A 4F91B 3AVYA 1KSJA 1M74A 1WQ1R 2O5VA 3S1AB 4E03A 4R9UC 1AZTA 5KNDA 4CT4B 2YWEA 1KI4A 2QPAA 4QJ4A 5SZKB 2GZHA 5FR1A 3W6PA 5FR2A 1T8TA 5B2ZA 3WNDA 1HQCA 2J59A 1W4RA 2V3CC 3F3YA 2PLFA 1L4UA 3QY0A 1CR0A 4Q4LA 1YZUA 4BFVA 3ZH9B 1OFIA 4PSVA 4HLQB 1FW6A 3KQUA 3NIBA 5FOXA 1FMJA 3GJ7A 1L7VC 3B1XA 3VR6A 5GVSA 2QI9C 1HQYE 4PZZA 1XJ0A 5G53C 3Q7PA 2FZ4A 3DL0A 4BFWA 3IKJA 1CIPA 5CLQA 4ASUD 2ZSBA 1E2PA 4NCHA 3TIFA 2QPOA 4HYYA 2B7CA 4PAOA 4XIGS 1NVWQ 2Q9AA 3LWNA 4BFXA 3K70B 1W47A 1AM4D 2E9SA 2GF0A 2W00A 5HCNA 2J45A 2F3TA 4TLEA 4EJSA 1N5LA 2IX3A 2RGEA 5DI9A 2VHQA 4L4UA 1ZU5A 4DCSA 3AVQA 2JJ1D 1LTQA 2FH5B 1ZAKA 4EPVA 2O0KA 4ZKEA 3TW8B 3K70D 4M8NE 4NE2A 4FMBB 3LBNA 3EARA 4NYIR 3QKTA 1JR6A 2BBSA 1E32A 3AF2A 3CBQA 3RABA 4LC1A 4M2LA 4QBGB 2YJTD 2ZEJA 4TMTA 1G1MA 1XF9A 4KLNA 2RHDA 2IXFA 2XX3A 1J7KA 3RS7A 3B6EA 3W3ZB 1OH6A 4MRSA 2Z83A 4E09A 5L3RA 1AJEA 3F5FA 3BB1A 5FTLA 2G88A 2C99A 4KYIB 1XRJA 1F2UA 5TY0A 4DC9A 2X1VA 4IFBA 2HXYA 2GZDA 2FEMA 4DSNA 1E0AA 2H7VA 2PZGA 4DB2A 5DH9A 1VYTA 1JR3D 1HY3A 3QE0A 4CW7A 1ZNWA 2IEYA 1AA9A 1W2HA 2QPTA 4HUTA 2O8CA 5JS7A 3FYHA 4G01B 4US2R 1IQPA 2WAYA 3V9PA 2C98A 3EIQA 3FOZA 2P65A 3IUYA 3RHFA 3A4NA 2D2EA 4JBWA 5SZJA 5JEEA 4FN5A 4Q02A 3RC3A 2ZR7A 1GKYA 1W0JA 2XZLA 3M4YA 4ZDJA 3AVPA 1O3YA 2CJWB 2C9CA 2O8EA 3PIRA 3AVXA 2QY9A 3SHWA 4MA4A 3BXZA 2H18A 2ODBA 1GKIA 5ANRB 2BKUA 5HZHA 3T1TA 4HSEA 3VHXA 4N0EA 4HB3A 2B92A 1OYYA 2AKAB 1DS6A 4NL4H 5TARA 3SE0A 1UPTA 1J90A 3ZLJA 3L0SA 4MRVA 4MGZR 1DE0A 1XMVA 2IHYA 3M0EA 3Q85A 4LBVA 4LJ5A 2QA5A 3GLIE 1BO6A 1W49A 1ZNXA 2H1LA 4QBHA 3SBDA 4B2IA 1R8SA 1ZM2A 3PEYA 4GMXA 1SVWA 3QF4B 1NIJA 2Z43A 2OXRA 1YU9A 3THXB 3IPYA 3B60A 5AR1A 2IF0A 1Q21A 4A0HA 3BIFA 4ARZB 1E2MA 2R8RA 1E1QA 1H8ED 3FWYA 3SJCA 4ASUA 3AM1A 2RKOA 4I1OA 3TNFA 1FTSA 4NCNA 1RJ9B 1E2IA 3TVTA 4YDHB 1E6CA 4F4JA 3KUDA 1KYIA 3LFUA 5IK2D 3B1WA 1T5LA 3VKHA 1YJ5A 4JL5A 4UQOA 3GP8A 4KFTA 2HCJB 4QFMA 3B2EA 4V0LA 2CE2X 1YHNA 4TSFD 1G7TA 3L8YA 4UKDA 1P6XA 2EFDB 3ONWA 3BORA 4KHZA 1QG2A 3A1TA 3KFXA 2GJ9A 1SHZA 3NC0C 4ON9A 2F3RA 2GXAA 1F2UB 3ZJYA 1KMHA 2VHJA 5C4MA 4CEHB 4D4LA 4L5BA 1S2MA 5EE5B 2RGDA 1S4QA 3PENA 3DM5A 3TQFA 3A4LA 1FUKA 2H5EA 3DVLA 2CCJA 2R6FA 5JSZB 1E9BA 1KHTA 4UNNA 5KU1A 5AJVB 5DI3A 5EE3A 3E5HA 4MDFA 3EPHA 3LH5A 4C0SA 4P31A 2OILA 3GLGB 4PZYA 2ZRAA 2JLRA 2XTZA 2C95A 4QHSA 4BFUA 3QI2A 5BW8A 1RE0A 3CF6R 1SVSA 2ZJYA 2VSXA 5LD2C 2QAJA 5TB5A 1U99A 2PZEA 5SZHB 3RRYA 5HE8A 4DDUA 4Q1AA 1DADA 2R65A 2WJJA 2HLDD 3UMSA 1QBKC 2WJHA 2Z0MA 2G9NA 3NG1A 3C8UA 2R6DA 4KXFB 5L8VA 3ZVNA 1X1RA 1XXHE 2KJQA 4YMTA 1AGRA 2XB4A 4LUCA 4H9GA 3U6KA 3Q72A 1W2GA 4LJ9A 5FL7D 3TMKA 1P2TA 1WP9A 1OSNA 4M1TA 4MGYR 4PQFA 4ZKDA 1RYFA 1DBSA 2J3EA 4ZDKA 1OIXA 2ZI9A 4TQUS 2IWRA 2ZRCA 1JAHA 1GTVA 4BLTA 3EX7C 2QQ0A 1D2MA 1EFTA 2YYZA 1Z2AA 3X1XA 3FPAA 3R7WB 2V6IA 1XD2A 1RRGA 3K1JA 4A2PA 2KBEA 1XPRA 2AR7A 4C0KA 4P4TA 3OZXA 4JL8A 1Z63A 1Q1BA 3T5DA 5EP4A 2W6JA 1N6KA 3MJRA 4ZCIA 4AI6A 3L8ZA 2A5JA 2GEVA 2RHMA 2GKSA 4LHWA 1NG9A 2GF9A 1EGAA 1XEXB 2I4IA 2WBLC 2ZI6A 4MRPA 3U44A 2Q9BA 3QEJA 1K5GA 1XP8A 3B8HA 4JLNA 2HYDA 4F4CA 2ZI4A 4MUBA 3LLUA 1KKMA 1G5TA 1SHKA 3PUXA 1KDPA 2B8TA 3NBXX 3WRXC 1XPOA 4LJAA 3SJBA 4G5RA 3CR8A 3WXMA 5FPTA 2RCNA 4QKQA 3CUEF 2J7PD 2OAQ1 3W34A 4QGFA 5CIWA 2FU5C 2RGNA 2QZ4A 3LXXA 3PG5A 4S35A 5CDFE 5D3MB 1WE2A 2IA5A 2WTUA 4HAZA 4MH0R 1P60A 2F43B 5LD2B 2CL7X 2VP5A 2ZIAA 1COWA 5FOVA 5JSZA 4QNMA 1G7CA 3P1JA 4ZDWA 1WXQA 2ZS8A 5A0FA 2D7DA 1GL6A 5FTKA 1D6JA 1S8FA 1RRPA 3W3AA 4OQFA 4II7A 1I4LD 3OFND 3QBTA 4B3BA 3MAAC 1W36C 1HH4A 1WBBA 4B34A 4B3DA 4PSKA 4F92B 1M8PA 4KLZA 3AVUA 1H8HA 2JDID 4KJZA 4EPRA 2X77A 2XGJA 4HLCA 2XB2A 1BYIA 4V02A 2AK2A 2RGBA 4Q4JB 3AUXA 1E9SA 1NN0A 4RFSB 4PAQA 3UPUA 1N0VC 1HE8B 2P67A 2QG6A 2ZJAA 3TSWA 3IHLA 2BVNA 4IW3B 4WAUA 2C9OA 2JJ1A 3BH7A 2OZEA 4PSAA 4LSGA 2EW1A 2DYKA 5L3VA 4TQ9A 1G20E 2JJ8A 2FSFA 1Z29A 5FTJA 2WAXA 4LBZA 3CRMA 3PVSA 4N0DA 2QGNA 1TPZA 2NZ8A 1S9HA 2BMDA 3H1TA 3U3KA 4C2TA 4BLOA 2G0TA 1UDXA 4TMWA 3BJIC 3U7FB 1JNYA 3GLGA 1KI7A 621PA 4LJ8A 4ZI3A 5F98A 4TLBA 4DSOA 2ONKA 2CK3A 3UIEA 2FSGA 3Q3JB 1OT3A 1JPNA 3EA5A 3MLEA 3UG7A 3C41J 1KKLA 2QMEA 1M7BA 4Q9HA 1N0UA 2ZE5A 3G82C 1PLLA 1XTRA 3GFPA 4LY6A 1GOTA 4W5WA 4XD7A 4WZAE 2BMEA 3QBVA 1ELOA 1DAKA 3QF4A 5KUTA 1XD9A 2PBRA 2C03A 2QE7D 1RPZA 3ETLA 5KPJA 4JVSB 3BB3A 1MABA 2QROA 5L3QA 1Z22A 3O8DA 2BBWA 2V7QD 3GLFB 4N3NA 4TWZA 5CIQA 3FKQA 2FDCA 3RC8A 3QXXA 1YZLA 2VP4A 2BOVA 3QVUA 4JKIA 1GIAA 3V4FA 1WMSA 4DLUA 2ZYVX 2PJRA 4BZQA 2WWWA 4L16A 1W4BA 3KXKA 4OHVA 1U0HC 1NSFA 2J1LA 3GLHB 1D2EA 3TSZA 1NKTA 2YZ2A 3G5UA 4C9BA 2J9RA 4CIDA 4X8HA 2ZAOA 2Z6VA 3BH0A 1NMYA 3LXRA 5JFGA 1Q57A 5BN3A 2KB0A 4AWXA 1A2KC 3GEEA 5FPKA 1VG1A 2GAOA 2D74A 1GILA 3TUZC 1JALA 2FGKA 1KSGA 3A1VA 4KI0A 2WZQA 1E2EA 3CB4A 1C4OA 1E9CA 4NH0A 4PPNA 4MGKR 3X1ZA 4ZCMA 2VTKA 4Q1BA 3AGPA 3MSXA 3QNUA 2JLUA 3CIOA 1W4AA 3PUZA 1US8B 3QEOA 1EESA 4Q48A 3U3JA 2P5TB 5DN6A 1UEIA 1SVIA 4HZIA 2QT1A 4B75A 3THWA 4ZCLA 4DCNA 4CVNA 4Z1MA 1R0XA 1G21E 3FTQA 1F2TA 5JZVA 3VTKA 2IYWA 4LYFA 3MGCA 4A0FA 2IC5A 3A36A 4DLSA 2ZVPX 4GOXA 1IBRA 2X2FA 5C46F 2IYYA 3EA0A 3AVOA 1MRSA 1MO3A 4M1WA 3NBYC 1RRCA 3U7HB 3ZS9A 5HKKD 1A1VA 3SJZA 3C4JA 4B33A 3O8CA 2PH1A 2ZPTX 2QSYA 1NLZA 3U4QB 4XVUA 5JCPA 2GZAA 1GP2A 2G77B 1BMFA 4M4SA 3FMFA 4Y0AA 1N3BA 4PZLA 4TT3D 4OK3A 3K0AB 4NKRA 5G41A 1OKKD 2IS4A 3NVAA 1HT1E 2H16A 3GLGE 2WSSA 1MH1A 2OO7A 3B7GA 3D6TB 3BERA 2ZYUX 2QMUA 2V1UA 1FL9A 2B7BA 1Z0DA 2KE5A 5FBVB 4HB4A 2CLSA 1P9WA 2AXNA 1U2RA 3ZS8A 4DSUA 3U7GA 3QPVA 1U94A 4WZBE 2IS2A 2Q0HA 2GCNA 1U9IA 4JLDA 1G9XA 2CCKA 2FA9A 3PCRB 2GVZC 1KO8A 2ZROA 1N2CE 3S1AA 4PAMA 2NO1A 2O8DA 1T9HA 1EK0A 2KSQA 4LHXA 4Q1CA 4XWKA 3NH6A 4M0LA 3PUWA 2LKDA 2UVQA 2VH5R 2IEZA 2L0XA 1KZGB 4CYMA 1W36D 4A1FA 2G1JA 3TGPA 4NMMA 5FUVA 2IUSA 1GSIA 2NZJA 1L4YA 1DO2A 1TQ4A 1W0KD 1ZUIA 2WWHA 3CH5A 1US8A 4EQ6B 2DWPA 2IK8A 3IDQA 1W36B 4HAUA 4TMXA 1NNEA 4J0QA 1OYWA 5B57C 5HZKA 1KK0A 1ZW6A 4NHOA 2QP9X 2XOKD 4TZ6A 2RGAA 4IOLA 3AH8A 4KODA 3ND8A 2QTVB 2RGNC 3FDIA 1ZNZA 1E99A 1Z0KA 3CWZA 3LDAA 4KYUA 3B85A 5DHAA 3I5XA 4HUQA 3THYB 1KI1A 5DGXA 3MWYW 3JVVA 3D7MA 3CRW1 3LQQA 4JMPA 1DAMA 2D2FA 4JLMA 3IEVA 2DR3A 1E2LA 1RZ3A 2CL0X 2H57A 3WBJA 2O8BA 3LX5A 1EFRD 1SGWA 1CJVC 2DFLA 1I4TD 4RKFA 1LF0A 4C2UA 4MYCA 2ZYTX 4V0MA 4D80A 1T6NA 2OFWA 3U44B 5B64A 5DSZA 5DIFA 5JJLA 4A8JA 4LPSA 1BS1A 721PA 3BC1A 3THOA 3V4RA 1TADA 4HDQB 1QHHA 4TMVA 4XD7D 4Q9JA 1GKUB 5BN5A 1T91A 1ZIOA 3R20A 3T61A 1XD2B 3RSLA 1KO4A 3T1QA 3KUCA 1ZM9A 1BMFD 2P6UA 4IFEA 2DBYA 4DDWA 4I1VA 3K0EA 2F55A 3GMTA 1XXHA 2WJIA 1KI8A 1DAIA 4QM6A 5AK0A 3NBFA 4I4LA 4M9ZA 821PA 2QSZA 3MUFA 5HR5A 3I8SA 3QG1A 5EP1A 2W83A 1YRBA 2O8CB 2FPLA 2YINC 2WJVA 4EFLA 3LBHA 1E0JA 1CR2A 3BGWA 3EXAA 4QBFA 5FL3A 2R6GA 4K46A 3U4QA 4Q00A 2G0NA 1AIPA 1ZD9A 3N70A 2B8WA 2ZSAA 4DLXA 1OE0A 4JJZA 1ZNYA 2BM0A 3T1OA 2D06A 4PPQA 2F1JA 1D2NA 4DCVA 1F60A 2CVFA 2XTNA 4IDOA 3SC3A 2EFEB 5EXTA 1SVMA 3SQWA 3RRNA 3OIWA 1ANKA 3I3SR 1KOFA 1P7CA 3KJGA 1P9RA 2FFAA 2O0HA 4CT5A 1DARA 2C78A 3KKMA 5DNYB 1N6NA 1VPLA 3WNBA 3CNOA 3H4MA 3K0CA 5E7IA 4BFSA 1UBGA 2HT1A 3LA6A 1JJ7A 4P4UA 4HAYA 1A7JA 1YR9A 3AP1A 4QGHA 2IUUA 3FFAA 3I62A 2FEOA 2NGRA 1PLJA 3KJHA 4MYUA 2BBTA 4YMWA 3TBKA 2OT3B 1BH2A 1AK2A 3KQHA 3MD0A 4G5QA 4EIWA 4D2IA 1QVRA 4G3XA 4URYR 2A5YB 1SKQA 4M22A 4WXRA 5DISB 4ZPXA 3VAAA 1N6OA 2FFBA 5CJPA 2N1BA 5EZ5A 1FZQA 3MRSA 4BLPA 4AIIA 3CPHA 2VYFA 2ZUBA 3OIUA 2SHKA 3GLFE 4QXAA 4LK2A 2J0UA 4DIEA 2BBOA 3UWOA 4YXWA 2CVHA 3TKLA 1YR8A 2BHRA 1TTTA 2IT1A 2G6BA 2GRJA 2Q6TA 3UMRA 5JRJA 1QDEA 1IJEA 2ATXA 3QKSA 3VU9A 3CX8A 3ZIAD 4WZ6A 2ERYA 1ZVQA 2AKYA 4CEHA 1KI6B 3DMNA 2NIPA 4KFSA 5EXPA 4F4IA 4C0AC 3EPKA 1HA3A 3MMPA 4BRUA 4DRZA 1P5ZB 2CXXA 1JB1A 4Q19A 1VECA 1OHHA 3RDPA 4A92A 4EUNA 4Q01A 2IXGA 4DWJA 3K9HA 4LBYA 3KQLA 3NKVA 5G40A 3HPRA 2KWIA 1GM5A 1MRNA 4Q7KA 1U0LA 2HF8A 2QP3A 1KAGA 4Q7JB 3MCAA 1NLYA 1U8YA 2R9VA 4GOJA 3TAHA 5KYKA 3CH4B 3OAAD 3UWKA 4RVCA 5FUXA 2VP2A 3AEZA 2IUTA 4H1UA 4D4JA 1YKSA 4MKGA 1IXRC 4GI7A 1U81A 2XSZD 1TF2A 2B21A 2OXCA 2ZRMA 1Z06A 1XTKA 5KTYA 1SQ5A 1FP6A 4DLWA 3ECCA 2CE7A 2BCJQ 2C8VA 3E70C 5JHHB 1OLOA 4Q7MB 1OFTA 1CEEA 2J7KA 2FJUA 3BFVA 2GJ8A 1UFQA 4AG5A 2H8KA 2OBLA 4EDHA 2QN6A 3AF4A 4DEXA 1XTSA 1QHSA 1Q3TA 3FVQA 1XEXA 1II8A 4AKEA 3Q7QA 3DPUA 3EAQA 3QKUA 2MSDB 2CHVA 2W6IA 4R71A 3B9QA 3BH6A 4N1AA 1VIYA 4IVRA 1YR6A 2ORIA 4XVRA 2OSBA 1GFIA 3AGQA 5KO2A 2Q3HA 4IHQA 3AKEA 3RS0A 1JR3E 1ZUNB 3L0OA 4KV9A 4RZUA 1SKYE 3SR0A 4D0NA 2XOKA 5AUQA 4DHEA 3L82B 4BZPA 1J70A 1DELA 1NN5A 2XJ9A 1TF7A 1ESMA 2FFQA 4B76A 4HUQB 1Z0JA 3TUIC 4B74A 1W0JD 1OPXA 2GCPA 1LB1B 2QTFA 3LAWA 4B43A 5A5GA 2EYUA 1AA3A 4RD1A 4DT1B 3QKSB 2QEQA 3VU9B 2NG1A 3X1WA 4OQMA 4U7DA 5GJVC 4M1KA 4YXWD 4QGGA 2QE7A 2ZE8A 5JECA 3LD9A 1NVUQ 5JRZA 1KK1A 2FG5A 4XSHA 3N2EA 1G6OA 2IYVA 4ZIRA 4KFUA 421PA 5FTMA 1RIFA 3X2SA 2ZQ5A 1EWRA 1W4CA 2V55B 4DDVA 2OCYC 4BFTA 1G291 2ORVA 3ASZA 1VTKA 4AYWA 1Z6YA 1GRNA 1CF4A 5G3YA 1FFHA 5DO9A 5AUOB 4TLCA 1XB2A 1JXMA 2VSFA 5C18A 1JEEA 4FXPA 3DHWC 2OCAA 5J5CA 4JSYA 2WICA 1TX4B 3WYAA 2CK3D 1W46A 2F9MA 4XVQA 1X8JA 2QORA 2ZU0C 4DUGD 3LLMA 4Q4JA 2QU8A 5J4YA 3D8BA 2V1XA 2Q3MA 1SULA 1T8UA 3ICEA 3DO6A 4M53A 1N6LA 2XTMA 2NMVA 5CJ2A 2DCUA 4RFVA 2AN9A 3VR1A 3CLVA 2AL7A 2AFHE 4LHYA 2QBYA 1KDRA 5JI2E 2RGCA 1LVGA 3DKPA 5BYJA 1PUJA 2LWIA 2NPFA 4XJXA 5JWRA 2A30A 2V6JA 2JLXA 3EIHA 1BIFA 4V0OA 1S3GA 3C15C 4LC0A 5P21A 5BN4A 1KTVA 1ZCAA 3GJ4A 2BIFA 3KX2A 2Q3FA 4D82A 5EUQB 5CM9C 4URVR 5KSYA 2ATVA 2V4ZA 4W9MC 1GL9B 4DLTA 3ND9A 1E0KA 1U98A 2C5LA 1T0HB 1M1YE 3K9GA 2P5SA 2ONJA 5FUWA 1Q3HA 5IT5A 1MV5A 5FOWA 4E5UA 4EFMA 5IK2A 4CEJB 1GRQA 1WBDA 3VNVA 1MT0A 5DLQC 3QKRB 1YZNA 3ZDQA 1GNRA 4TZ0A 2HV8A 1EFUA 5J4VA 5KDOA 1N6HA 5F9FA 2WWIA 4DKXA 3PEWA 3RRMA 4DT1A 3A37A 3OF5A 4PXAA 2HDNB 2QBYB 3EZ2A 1CRQA 4Q47A 5HTKA 2IWHA 2KI5A 2DPXA 1X1SA 1DG3A 2NO7A 2Q9CA 4MUAA 4UNRA 1E9AA 5GJWC 1E0SA 2WM9B 1G8HA 2XNSA 2GA8A 1FMLA 2V9PA 1CULC 2HEIA 1KI3A 4G0NA 5FI0B 1DOAA 2CBZA 3CM0A 3A1SA 2R6CA 1XXHB 4OQLA 2CCGA 5CYPA 4OBEA 2NO6A 3GPLA 2J5XA 2YNMA 1P75A 3GLIB 1VCOA 2XXAB 4OHXA 1R0ZA 2OE2A 1XZPA 3CRRA 5EP2A 3OEED 2GTPA 3T12A 5KSOA 2QAGB 1W0KA 5JWOA 2WKRA 1PLKA 3HR7A 3NEJA 4QC2A 2HUPA 1C1YA 1G6HA 4LV5B 3RNLA 4KFRA 2BWJA 3D3QA 4MYHA 2QP4A 2H17A 2ZE6A 3A4MA 3MWKA 3P4YA 3OEHA 1B23P 1XCGB 4LI0A 3CZPA 3EC2A 1MKYA 4QOSA 2BEJA 1OXTA 4TTQA 5L3SB 3SQXA 4TYYA 4FWTA 4G5SA 2YWHA 4ZDIA 2OUKA 4M9QA 2ZRFA 2JCSA 3ADBA 2GXUA 1KK2A 2CNWD 3NEYA 1XFAA 2CHGA 4LZZA 4NPHA 5K8UA 2AWNA 3L0PA 4BEBA 4O25A 4A82A 1U0JA 3AQ4A 3JZMA 3I8XA 2FMXA 4NCKA 4ABYA 4OK5A 2P6RA 1NN3A 3GFOA 5C4GB 3FE2A 1KO1A 2XXAA 5HE9A 1ZCBA 4Z51A 1Q20A 4RD2A 5D3QA 3DM9B 3RVBA 2ZRNA 3ZQ6A 5ELXA 3SBEA 1ZM7A 4TL8A 1JEDA 4KVAA 2VF7A 2C04A 3U5ZB 3GFTA 3QXHA 1OJLA 2WIBA 1OH5A 2WMOB 4LYAA 2ZRBA 3V00A 4O3MA 1ZD8A 4JVLA 2FPMA 3K53A 4TL7A 4Q66C 2CLDX 4X8MA 4RY2A 1UEJA 4U5XA 5JCZA 3A58B 4C7OB 3SDZA 1LFDB 2HJGA 4LX0A 3B78A 4YMSA 5FPYA 3ZVRA 1W7AA 3I92A 1S9DA 4TTRA 1CBUA 3CONA 2BKEA 2FPKA 3EG5A 4RJLA 3WNCA 5JLJA 1XPUA 4IRUB 4LPKA 1A2BA 2PT7A 1FNNA 1SXJB 4GT1A 3KQNA 4JJKA 1AGPA 4GFDA 1FX0A 2VSOA 2WOJA 3IPXA 1TL7C 1S0UA 1FQKA 1KMHB 1Y63A 1CJUC 3OE7A 4KAXA 3U3OA 1YQTA 1D5CA 1VYUA 1E96A 2W2TA 3WYGA 4PQYA 1M34E 2XNDA 3HWSA 1D8TA 4KBGA 4TTPA 1P62B 1T4GA 4IDHA 1CR1A 5FPSA 4TQAA 6Q21A 1Q1ZA 2HF9A 2ZETA 2ZJOA 2WV9A 4TL9A 2ZRIA 1XTQA 1ONBA 3CX6A 4JLKA 1KJYA 1Z08A 2BV3A 2QMOA 3GJ3A 2DFTA 1R10A 4DJTA 4JLOA 2GDJA 4JKYA 1Z3IX 3MFYA 4FMDB 4FWIB 1RJ9A 4BZXA 1K5DA 3QJYA 1Z0IA 1UKEA 2PMDA 3K09C 4LGMA 4PC7A 3KL4A 4V0NA 3CR7A 2A7QA 2VP9A 5JWHA 3W6NA 3NH9A 1XBTA 4PHHA 2QM8A 2O52A 4EPTA 3A6PC 2B6HA 2ZRKA 2YHSA 3NDPA 3TW4A 4H1VA 3GQBA 4PHGA 4AK9A 1BOFA 2FX3A 1DG1G 4NONA 1Z47A 3THXA 4HZUA 1QZXA 4AC9A 4B47A 2Z5FA 4IEEA 2CLCX 4B35A 5LDDC 3VR5A 3FHTA 2REBA 2E1RA 5CYOA 5JJIA 4PPGA 1P73A 1Z6AA 3AP2A 1P9NA 2J7PA 3U7EB 2ZJBA 4DLRA 2H92A 1PZNA 5K8LA 1XMSA 4IVPA 4A0GA 2OV2A 4YMUA 5B58C 2ZRDA 1RFLA 3THWB 3I32A 4POAA 4BRWA 1K8RA 1IN8A 1OB5A 4LOAA 1LNZA 1E4VA 2Z4RA 3FHOA 3KTAB 3KXIA 3WHLA 3TVDA 2PCLA 5CDFA 4BWYA 4KU4A 5G3ZA 4IKEA 1XCPA 1II9A 4CZ2A 4DUGA 1YRAA 2FOLA 3FMOB 2IBMA 4LWZA 4IEIA 1FP7A 3QQ5A 4OHZA 1E9RA 4W7SA 4Z1MD 3B82A 1MO4A 1R2QA 2YOGA 1G8YA 1VG8A 1DAEA 4DLZA 3K9NA 1KSFX 1S96A 1YE8A 1SVOA 4JLAA 4HAWA 4DCUA 4PO1A 1G17A 3AKYA 2AXPA 4HLUA 2F1HA 3OIVA 4D26A 1GWNA 1TUEA 4LJ7A 2EFCB 1E1RA 3ASYA 1MABB 1JBKA 1FTNA 3R8CA 1F6BA 4BLRA 1NL3A 4BQSA 1DAFA 4I1SA 1Z2CA 1YZQA 4D25A 1E2DA 3JZAA 3TE6A 4KO8A 5BQ5A 3CPEA 4YC7A 3ICQB 2DHRA 1P3JA 5F9HA 2BCGY 1R5BA 3KKQA 3QOFA 2D62A 1P2UA 3LX8A 3SYKA 4QM7A 4S2EA 1UJ2A 5FOSA 3C14C 2JAQA 4URUR 3ZIAA 3EIEA 4A8JC 3VFDA 2PJZA 2VL7A 3EZ6A 5CM8B 4RKEA 5JS8A 3I72A 4QRHA 2BMJA 3FGNA 3T06B 4QJ3A 2IL1A 3NC1C 4LYHA 4NCIA 1P72A 3U60B 2GK7A 4RZ2A 2ZS7A 2RAPA 1E98A 3B1YA 1Q12A 4FCTA 3B5JA 1BYUA 3MJHA 5EZ6B 2VP0A 1R5NA 2C77A 1TF5A 4TN1A 2PX0A 3CRQA 3T15A 1UKZA 1KI6A 2ODWA 3DDCA 4OK6A 4HB0A 2ZJZA 2QT0A 2WJYA 2ZUDA 2OEPA 3BD9A 4PC1A 3RWOA 2DWOA 4C0LA 5M04A 3IIJA 3PUYA 5BYKA 2GJKA 3EPJA 1T5IA 1ZRHA 4HEJA 1QHXA 3D31A 2OLJA 2WOOA 2QL6A 3DZDA 5UKDA 4D81A 3Q5EA 3HU3A 1S1CA 221PA 2G1KA 1GDDA 4JLBA 4K8OA 3TQCA 1JJVA 1RRFA 1IOZA 3P26A 2WPDD 5F2EA 1ZD1A 1QHYA 1J8YF 2VO1A 4RCZA 1H65A 3QXJA 4G5GA 4GOKA 1N5JA 4P4SA 2WSSD 1GZSA 3HYRA 2PZFA 3QPWA 5DHFA 1R5OA 2WWXA 3P32A 1W1WA 2ERXA 2REOA 3CWQA 3QXSA 1E69A 3KKNA 3FKSD 1LW7A 2ANCA 2WWYA 2A78A 2RGXA 3QKRA 4FIDA 4Q7LA 1D9XA 1IAQA 4OHYA 3PEUA 1X3SA 4DSTA 4MKIA 3TR5A 4PHFA 3SEAA 5H70A 4ESHA 3MWLA 1IY2A 3GD7A 4R2IA 2OCBA 2ODEA 5LB4A 2QMHA 4AYTA 3H84A 1SVLA 2YWGA 1NVVQ 3KKOA 1VG9B 4LYJA 2WIAA 3NBZC 2JGNA 4JVNA 1OIWA 3WRYC 5K8IA 1ZU4A 4PQRA 1DTSA 1E2HA 4GP6A 1WCV1 1JI0A 1G3RA 1NSTA 1CTQA 2GXSA 5FBQB 2UZ3A 4ITRC 1CXZA 2QM7A 1T3SA 4NBSA 3MWJA 4IOKA 3T1VA 2PX3A 1CLUA 3C16C 3TLXA 5HPYB 2DB3A 3FFBA 2QENA 1TQ2A 4OI2A 4M1SA 3W8RA 4C3ZA 2IYLD 3HU2A 3HYTA 5AUNB 4YDSA 2GBLC 1JAIA 2IYUA 1IN6A 3AF3A 2ZJ2A 4LJYA 4U02A 3EZ9A 1UBEA 2ZS9A 3VX3A 1Q22A 3DZ8A 2WMNB 2VHCA 4M1YA 5GJCA 3SYLA 2VBCA 4AKHA 1VCNA 1NN1A 3WY9A 2ZVQX 5FBWB 2MMGA 1EG7A 2OLKA 4HDCA 2D3WA 5L3QB 3AV0B 1A4RA 3TRFA 1TEVA 2XNDD 1R6BX 1IHUA 2J46A 3P4XA 4B3XA 2W6ID 2WKPA 2AWOA 2GEDA 3ADKA 3F8TA 5FI1B 1KO7A 3VR2A 3LY5A 1SXJE 4ERNA 4DBLC 4ARZA 1QHNA 5FUYA 4WIAA 2YWFA 2VHTA 3H86A 4KCGA 1DAHA 4HDOB 1RKBA 4P4SB 1E94E 1HYQA 1W5SA 1T3HA 1M2OB 2OFXA 4Q4AA 1E2NA 4YQFA 1KSHA 3WP0A 3RYTC 1RYHA 4W5HA 3RANA 4URXR 3AF0A 4EFNA 3AVVA 3NWJA 4TYQA 2VP6A 1CP2A 1NKSA 5AJXA 4BLQA 1ZINA 3QSYA 1SXJC 2WWGA 1XDBA 3RS3A 1I2DA 4NTZA 5EXSA 1IXZA 5JHGB 3G0HA 1GNPA 1NBMA 2UKDA 4EJSC 2CDNA 1R0YA 4B73A 4NYMR 3R9XA 1E9EA 1T0JB 2YC2C 1AZSC 3CX7A 4HB2A 2ZRLA 2C96A 1G7RA 4JSTA 4AG6A 4B44A 2X2EA 3SYNA 4RCYA 1WF3A 4LCBA 3IHWA 4P3YA 3SOPA 2QRZA 3I4LA 3X1DA 2VPPA 3AF1A 3WMGA 4R7ZA 1E2FA 2ZM5A 3AVTA 2FV8A 3R9WA 3JVUA 4CEIB 5FBLB 3B1VA 4RD6A 1UM8A 3SZRA 3RRZA 1BKDR 3F0TA 4Q4AB 5J47A 2NQ2C 3QVVA 2Q21A 1IY1A 3TJZA 5DN6D 3CRVA 3P27A 1UAAA 1FQJA 3WYFA 1E79D 4JYCA 2JIZA 2ZU6A 3FHCB 5JJKA 4QJ5A 2IYRA 3BFKA 3T5GA 2HYIC 1KY3A 1YZTA 2IYQA 2JLZA 3ADDA 5E7MA 5D3MA 3OHMA 3KQKA 2QQEA 1HT2E 3QENA 4NYJQ 3WP1B 4MYTA 5H68A 4ZI2A 3K0AA 1T3LA 1A5TA 2I1VB 1KNXA 3CNLA 2XZPA 1NMXA 2KBFA 5HCIA 1OFUX 2FSHA 4PC2A 4URWR 1DEKA 2FZLA 4UXHA 4A2WA 3HDTA 4X8OA 1GNQA 2ZRGA 5E4FA 3KJEA 521PA 4M1OA 1H8HD 2AK3A 4LHZA 3ZD7A 1F5NA 2D4HA 2NTYC 2O0JA 4XSGA 4B2LA 1OF1A 2DFNA 4BECA 121PA 2IS1A 3LBIA 2LKCA 1TEXA 1XWIA 1A82A 5FTNA 1ZIPA 3WHKA 3LV8A 4IXMA 4CF7A 2FGJA 3SHFA 4DB4A 1M7GA 2N46A 3ZVLA 2ODNA 1XD8A 3PITA 4RFSA 2YKGA 3B9PA 2JLVA 4ESVA 2XZOA 5EP3A 2ZE7A 3IQWA 2MSEB 1XMIA 1B0UA 2RGGA 2VIIA 2AHOA 4A4DA 1LV7A 2JA1A 2QRNA 3GJ8A 1Q1EA 1XEWX 2BDTA 2OBMA 1U90A 3FMIA 4AURA 2P3SA 2JJ2D 2AD1A 3U3MA 1NI3A 5JBQA 1E9DA 2UZIR 2WKQA 4U00A 2RB4A 4EQ6A 4XTCS 4DXAA 1E2JA 3ZD6A 5EE0A 3VMFA 4D0LB 1NG1A 1W44A 5J4KA 1VCMA 3ZZTA 2ZXUA 4PO9A 1VHTA 1XEWY 3SS8A 3WMFA 2QAGC 3W90A 2GVDC 1HEIA 5AJZA 4AKGA 3N5CA 4RD3A 2JLSA 2PLRA 3EWSA 4B48A 4V0ME 1UF9A 4AKIA 1OXSC 3THYA 1SVKA 2HLDA 4Q21A 4D6PA 3K09A 4GZLA 3CF0A 3TK1A 1OXVA 3W5IA 2EYQA 5E7JA 2F1IA 4RD0A 2MMCA 1QG4A 2IYSA 2GBLA 4QHYA 5EE9A 5GADl 3W9YA 4PANA 5F3WB 3BK7A 4JT2A 2OBNA 1ZJ6A 1Z8FA 4NYMQ 5KSPA 3OAAA 2RMKA 4MITA 3R8FA 1NP6A 3K0FA 5CITA 2J0VA 3IILA 4JL6A 4CRWB 4TYNA 3AKCA 2ZYWX 4NYIQ 2NPIA 4L9WA 5TV2A 4KBFA 3OEHD 4UNQA 2LCFA 2W58A 4MDEA 4HI0E 3TSOA 1N6RA 4TMKA 5CK4A 4UJ5A 4ZO4A 1RW4A 3KKPA 1L8QA 1YR7A 4W5JA 3AVWA 1PVOA 1AS3A 2WJGA 3ZZ0A 2V8OA 4RSGA 3VKWA 5GJBA 1I4DD 2ZJ8A 1EFHA 2YVUA 4BASA 2A5FA 4BFZA 4A8JB 2GK6A 3LVRE 4FW9A 4R2HA 3U2QA 4GZMA 1QRAA 1IN4A 2YV5A 4BPBA 4JT4A 3BAFA 4BGDA 1NY6A 3N2IA 4AYXA 5AJYA 1LS1A 3VHLB 4EAQA 1Y3AA 4B3GA 1G4AE 3DOEA 3I61A 1GVNB 2RH5A 2N42A 5IRCD 4Q9LA 2R2AA 3GLHE 4L15A 4XWAA 2EVWX 1SXJD 5TDHA 5KNBA 2W2VA 1KZ7B 1XJCA 4R98A 2ZTSA 4NCJA 4MKFA 5JI3E 2CMKA 1EXMA 1FNMA 3HR8A 4V0KA 1NBME 1G64A 1NJGA 5KHOC 3W8NA 1M6NA 3L43A 1KIMA 4I1UA 3H2YA 4D4KA 5K8TA 4Q1EA 3EZ7A 4US1R 4RZXA 2OHFA 4IOJA 4JLPA 4A6PA 3SJAA 3SI7A 3P20A 2GEUA 1TU3A 1S3SA 1CR4A 2X19A 2NO9A 2FN4A 3GLFA 4JIMA 4FMCB 2YOFA 1SKYB 4GMDA 5FFMA 1SXJA 2XJ4A 4E07A 4A6XA 2C9YA 4QL3A 4B71A 3L2OB 4GNKA 1HTWA 2VF8A 5E3HA 1OIVA 5J4HA 3BB4A 1NRJB 2EFGA 4FINA 2ZJ5A 4MQBA 1G3QA 4CEJA 3KDSE 2JEOA 5GVRA 1NLFA 4I99A 1KDTA 2O8FA 1AS2A 4M9SA 4WW0A 4B3CA 3Q8XB 1KDOA 3DKVA 3SFZA 1N6IA 1CJMA 1VKJA 2YC4C 3GEHA 4QBIA 5SZIA 2R44A 2JLWA 1XTIA 2W0SA 5TXGA 4LHVA 1G8FA 4TLDA 4F7WA 4Q1FA 3VR4A 1JPJA 3IO5A 2GILA 2HCBA 3Q9LA 2ZSEA 1E9FA 4OQXA 3UXMA 3ZYCA 2F1RA 1CJTC 2JDIA 1GG2A 5LBIA 4A2QA 5DE3A 1P61B 3GJXC 3NDBB 3A1UA 1W5TA 2JLQA 4FMDF 4E22A 1SZPA 1R8QA 1OB2A 1E79A 4B6FA 1TNDA 3PJRA 1VCIA 3QXCA 3REGA 1LF5A 2F43A 2MSCB 3PEVA 2QTHA 1AKYA 4JLVA 1PV4A 1P2VA 3EASA 3RS2A 1DPFA 4FI3C 1G41A 4B2PA 1N5KA 2DY1A 2O8FB 4WVFA 1EFCA 4EPWA 3BE4A 1G5RA 4JZKA 1WA5A 1TU4A 1AN0A 2FSIA 2C2HA 4M21A 1NY5A 3TR0A 2GCOA 1CU1A 3ZZUA 2A3RA 4O2LA 3RLFA 3BFXA 1M7HA 3CF2A 4PPFA 1CS4C 3EZFA 3HP1A 3ZQJA 2F7SA 2EU8A 1IJFA 1E2KA 1PJRA 2XAUA 1NMZA 1N6PA 2CJWA 2O8EB 1DAGA 3O8BA 1QF9A 1TAGA 2ORWA 1I2MA 1NVXQ 4OI4A 1N0WA 5FOTA 1LY1A 4BLSA 3AKDA 4TMZA 2OESA 2BJVA 4GPTA 3CO5A 5HKKA 1R4AA 1LS6A 3BBPA 4Z8XA 3VNUA 5TVKA 4QHTA 4MRNA 1F3OA 2W6JD 4NZYA 5FBRB 1AKEA 2PT5A 4M9XA 3CW2A 2V54A 3RS4A 5E95A 4OL0A 1Q44A 1E3MA 1ZM4A 2DFKB 4HATA 4C0QC 1IM2A 1VHLA 3IIMA 4RZ3A 4EPXA 3FB4A 5KDLA 1UKVY 1MOZA 3B13B 5IDVA 1CJKC 3QPUA 2OM2A 3SN6A 5BXQC 1RVDA 4BE7B 3NHBA 2CL6X 4D0GA 3C5CA 2D7CA 3BS4A 1OKKA 5BWMA 3PXGA 1E1RD 2GHIA 2V7QA 2ZI3A 3K9LA 3C5HA 4DEYA 2IS6A 4Q9KA 2GESA 3LW7A 4DVGA 2BM1A 2F6RA 2JASA 4Q4HA 3RAPR 4DCTA 3TAUA 5IHPA 1ZUHA 2NO0A 1OHHD 4Q18A 1OW3B 1O87A 4DLVA 2HT6A 1JR3A 1ODFA 3PQCA 3NHAA 4OQNA 5C1BA 3T34A 1XTJA 4PC6A 1ZP6A 3TUJC 3LNCA 1G8GA 3UG6A 4NP6A 3U6BA 1EWQA 1OXXK 2X8AA 1F2TB 3KB2A 4G1UC 3VQTA 2VLIA 1JQJC 1GRRA 1HE1C 2IHBA 3OFNA 4TLAA 2PCJA 2XITA 4LDJA 2GJSA 4ACAA 2A2ZA 3E1SA 3PV0A 2F9LA 5LPNA 1C9KA 4GBMA 4NDZA 3EWAA 3BRWD 3GLIA 5H8WA 2ZI5A 5CLLA 1L2TA 4OYHA 3I5YA 2OG2A 1VDZA 1XU4A 3M1IA 3DMDA 1ZBDA 1XMJA 2R62A 5AWFC 4AY2A 2ASEA 2IYTA 1KAOA 3RS5A 2ZR0A 1VYVA 5DYIA 4ZIRB 5KSZA 2ZRJA 2VA8A 2EQBA 1Z6XA 3CZQA 1Z0AA 5EQTA 4JBYA 1XX6A 4QGAA 4ZV4A 5CB6A 1E1QD 1H8EA 1OV4A 4Q1DA 5EE1A 1QVAA 1X8KA 1VIAA 2ZSFA 2ANBA 4C4PA 5EUMA 3KB1A 5TMPA 4Q4HB 4V03A 2TMKA 1ZM3A 5AJWA 5IF9A 1K6MA 2REXB 2IXEA 1X86B 2W0MA 4BEJA 4EPYA 5J4LA 1VG0B 1IN5A 1Z6GA 3SFVA 4GP7A 4DLYA 1ESNA 2AFIE 2I1QA 1AS0A 1UADA 4IXNA 5JEDA 1NBMD 3TH5A 3AUYA 4B3FX 3J81k 4PC3A 4JBXA 1GL7A 2A5DA 2I3BA 2WWFA 3EPLA 2WHXA 1G5PA 4FMCF 3AP3A 2Z4SA 4CGZA 3K70C 1NVVR 2HXSA 1HURA 4GRAA 2XSZA 5LB2A 4F38A 4Z8YA 3QUSA 1JECA 3FMPB 1ZC3A 1DVRA 1G16A 3CKLA 4DZZA 1KI2A 8OHMA 1IN7A 2CHQA 4UXJA 4WXPA 4PR0A 2VEDA 3KJIA 4OHWA 1YVDA 1NJFA 4OJQA 3R7WA 1MR3F 2JJ2A 4PHTA 4URZR 2A9KA 4YONB 2BC9A 3RWMB 2OCPA 1E2QA 1FOEB 1WB9A 4Q03A 3OE7D 4JVMA 1G18A 1F48A 2IYXA 4F93B 5H1YA 3QF7A 3K0FB 3GJ0A 4Q9IA 4TYPA 5FH9A 1W48A 1AQUA 4XH9B 2FFHA 1Z6TA 3KTAA 1MO5A 2GETA 4G5OA 1GUAA 4C0JA 2JLYA 1JQLB 3MG9A 3BWDD 2G83A 3NXSA 4MRRA 4PFSA 4LRWA 1G8PA 4QNRA 1COWD 4PX9A 1XCMA 5AUPB 2GWHA 2JIZD 1V43A 1S1MA 1E2GA 2CNWA 1KI9A 3U61B 2QAGA 4IOMA
chains in the Genus database with same CATH superfamily
1H05A 3G5AA 5HDQA 2X7JA 1VJ5A 4C0HA 5K6RA 1XT6A 2I6GA 3L0BA 3SLGA 2NSYA 3D8RA 5IC4A 2HJHA 1DI0A 4BP8A 4H18A 4KRFA 3RASA 2ZLBA 1PK7A 2ZBFA 3A05A 1N1MA 3DOFA 3QWAA 1GQFA 3E18A 1KJWA 1TQ6A 1XSEA 2JATA 2HY7A 2OYRA 1KK3A 3FOCA 2QT9A 4IIYA 2C7BA 4AD8A 3PICA 4EATA 1HRKA 3REFA 1CF9A 1RNLA 1QHIA 3IOEA 3LRPA 4QD3A 2FF7A 1Q6ZA 1V16A 2G40A 3RAGA 4V1CB 3IMGA 1Z0FA 4ND4A 3TM5A 1J7JA 1GNVA 4P1ZA 3Q5DA 2RSLA 2BEKA 3OIYA 1DRVA 1LSJA 1N3YA 4IL5A 2BSAA 3CXRA 3ZVMA 1F8GA 4X8LA 2J0UB 2O3UA 2OHIA 3GIDA 4R83A 2IDKA 5KDDA 3PNBA 3QLUC 4KO2S 1G19A 4OXNA 3V97A 4AKTA 2VRWA 4OMUA 1KJ9A 3I73A 1ZZEA 4J0FA 3A8TA 4E4TA 1DO0A 1GGJA 2WG0A 3UA3A 2WKSA 1L3IA 2QR5A 2XGSA 1TRHA 3NWBA 1SC4A 5FOUA 3EWIA 2BM9A 2UYQA 4F3CA 2AHRA 1XU7A 2LVBA 3I1FA 4YCMA 2BGIA 2PWAA 3JQQA 1HUQA 2HU2A 3L93A 3O8QB 4IF6A 1SBYA 4HZUB 3HZRA 4OL9A 1WEHA 4MP6A 2P69A 2GCOB 1SCNE 1NIPA 1WQ3A 3F8WA 1MH9A 3LL7A 4D9EA 2ZR9A 1U9IC 5MHTA 1JSZA 5B30A 5CR9A 5IYZA 3UANA 4F7DA 2I8LA 3A1WA 2P9FA 5EPEA 1X7DA 4C6RA 3U7QB 4M7RA 1N25A 2FE4A 2ZITA 4RABA 4BX8A 1YVEI 3WLIA 2XT6A 1E4YA 1I3NA 3QLVA 4G8BA 4R54A 3SNHA 2WJZB 3ROQA 1S2DA 3WIDA 3L8EA 2FWRA 1CKEA 2VJCA 3IPLA 3LPDA 4XVHA 5CG1A 4HLDA 1WHTB 3GEIA 3FD8A 1F0KA 1ZC4A 3M4JA 1Q0UA 1WRBA 3ZCVA 3LVFO 5DX8A 4LVNA 4WACA 2IPLA 4AJNA 1TT5B 2CUNA 3GJZA 2PL3A 1V35A 3VPAA 3BMQB 4AJHA 3KL2A 3KZ1E 3CLUD 4LDAA 3IGFA 2AG1A 1DFGA 3OP1A 3GLHA 4KXYA 5AW9A 4FCVA 4GO1A 3DUFB 4UM9D 4GLFA 4AFNA 1NAIA 1X8LA 4JT9A 2Q1TA 3DVRX 3AZOA 3H0KA 3KWFA 2J48A 2OVFA 4ND6A 1RPJA 4MR7A 4OY3A 1LK7A 2KM1A 2QZZA 1Z07A 1VIVA 1L5NA 2DWQA 2AFVA 3U4IA 5DX1A 5DMHA 2J0SA 1Y4SA 1KHHA 2WC1A 2ZI7A 3JPWA 4HFNA 4G86A 4MKXA 2LZ0A 1ZWKA 2SCUA 4M0EA 2Q5LA 4NU0A 5JH7B 1CRPA 5J40A 3VZPA 1X7YA 1H4QA 1OXUA 4FS3A 1JEJA 2GZ1A 1QHHB 2R87A 3IEUA 5J3JA 3CVYA 4K2HA 1JFSA 2QNIA 3DFZA 1R7RA 2O2CA 1BDIA 3GK3A 4DLLA 1V16B 5CH8A 5FLKA 2AX4A 3INNA 4BFYA 3UKDA 1THTA 4RFLA 4FEAA 4J7CA 3WAKA 3IQXA 3UZUA 3EW9A 3R9IA 4UM8B 2BHNA 2D3TA 1YDHA 3MAGA 4GDMA 2GXQA 3B3AA 1QV9A 4NJEA 5EESA 5K3DA 1RWBA 2EGUA 2IHJA 3UTCA 1W30A 5HK8A 1FFXA 4AUEA 1WXWA 5EXDA 1U11A 1ZH4A 1CUZA 4ZVQA 2AFHB 2IEDA 4NQZA 4UNSA 2P2LA 3VYTB 5EMNA 4B0OA 5AW1A 3U4MA 3BOSA 2HRCA 1P2SA 2X14A 4A0RA 1MRZA 2VHZA 5FO1A 3BFPA 1TTQB 4BDTA 4Y18A 5HIMA 2K5UA 1T34A 1U0TA 2JGIA 2QTNA 5CFZA 1OQAA 3ON5A 4UCXA 2P0EA 2PUFA 2I65A 1G7SA 2V3VA 3TTYA 1UKYA 1Q1AA 4TZTA 2BGTA 2HMTA 4EJSB 4D9MA 2UYGA 3NAMA 2EDCA 1K8XB 1I3MA 2OAP1 1TK9A 3LO5A 3OOEA 4DY6A 2YWXA 4J90A 5DTJA 4AS2A 3C8MA 4L8GA 4LY9A 5DI3B 2DUWA 2QW8A 4RH3A 4D4MA 3ZJUA 1RADA 1TYEB 3EEBA 2IIQA 3LIIA 3MTIA 1N4AA 3CF4A 1K88A 1BXRA 4R8KA 4A03A 1MW8X 4YMVA 5K0TA 4ISBA 4PGHA 1CY0A 5H3CA 3TZ6A 1NW5A 2Q8PA 3ENVA 2I4OA 4TYWA 5EOVA 4ZT6A 1GTMA 1YB2A 4QXPA 4WASA 1PJTA 4ZVMA 4PSCA 3RU9A 2R6AA 4D9KA 3TLYA 1F17A 3DWEX 4DDTA 4HBGA 1UQUA 2QD3A 3RSFA 2ECKA 2Y99A 4IBOA 3STUA 2YXLA 5EKXA 1L4GA 4KR7A 2QTCA 4IJUA 1K98A 3BJRA 3PNLA 3ENQA 3KJQA 5T5QA 4F0JA 4DOMA 5BWLA 3L7YA 1HSOA 1L6RA 1E3DA 3FH0A 2I4NA 5EIFA 1M74A 4GPEA 4F3TA 4HFMA 1XMQB 4BBAA 3FPLA 4B0PA 2PM8A 4WDQA 3IUPA 4BYGA 3HB1A 4R9UC 2G1PA 4GM4A 1K3FA 2V98A 5E4TA 3SYRA 2GZHA 2ASVA 5FR1A 5C80A 5FR2A 3OLCX 3HJFA 3WJ1A 5B2ZA 2AI1A 1G42A 3WKDA 3ZWCA 4D8WA 3BHNA 3NOQA 1HQCA 1N3LA 5JXJA 2J59A 3Q9NA 1TRKA 1W4RA 4I6JA 3ESXA 1O6FA 5EUBA 1C3XA 1BHJA 2D8AA 4Q4LA 1EDDA 2CL5A 5TS2A 4BFVA 5IN5A 3GC6A 5GONB 1HNXB 1UXOA 4PSVA 2G9QA 4KPYA 2OC9A 1K63A 4KQ9A 3KQUA 4KQMA 3LPMA 3GJ7A 5GVSA 2PH5A 2B1QA 2QI9C 4PYIA 4PZZA 1F7VA 2IZ0A 3PR3A 4OQYA 4R40A 3S8YA 3DC7A 4ZZIA 5K4GA 4R16A 3AW9A 5JNUA 4DQDA 5KKNB 3ROFA 1B6RA 1E2PA 4LTNA 3WA6A 2B7CA 4PAOA 4XIGS 1Y6QA 4GUDA 1W47A 1AM4D 2GF0A 4J29A 3HO8A 4BVBA 1B41A 3EVNA 3H5VA 4EJSA 2INGX 5C7OO 2IX3A 4A6DA 5CAEB 2DEUA 4OOFA 4KUHA 2O7QA 4U0KA 2NUAB 3KXDA 1SCQA 2CXPA 4K6HA 2JJ1D 3O4GA 3PR2B 1LTQA 4RDCA 4WVLA 4FZRA 4EOGA 1QP4A 2R6HA 3LBNA 1ULTA 1F6DA 4NYIR 5FV4A 4RTOA 1DBWA 2HF7A 4GI3A 3SSNA 4WQMA 1TK3A 3I58A 3O8NA 1R15A 2AZXA 1WKVA 4LC1A 1Z5OA 2VK8A 3VR3D 4CKYA 5HQJA 2YJTD 1Q0TA 4ZMSA 5G1NA 1XF9A 2X5XA 2Y4OA 4J0GA 1N33B 2G25A 1EU1A 2XX3A 2O0LA 2QDKA 3QHQA 5HJEA 3OH8A 4LXGA 1V8PA 4J94A 2GX6A 2JF0A 3G6KA 3KR0A 1UPXA 1U7ZA 2PAFA 2FWNA 5LA6A 3H17A 4MR8B 1XRJA 1PFVA 4DC9A 1JKIA 4AJPA 3VJRA 3WLKX 2PFGA 5FFFA 3PXBA 1USWA 2FEMA 1KERA 2Y0CA 4RH1A 3EGDA 2GK3A 1Q7TA 1XN4A 1E0AA 2H7VA 4RE6A 4DYHA 1O1YA 1L5LA 5DH9A 1JR3D 4NJMB 1YL5A 1IPFA 4IYRA 3UV3A 4QODA 1ZNWA 2IEYA 1JPVA 2V74B 3T6KA 1G0OA 2JH9A 3IMCA 1EEXB 4G01B 1NT2A 2PX8A 4US2R 3T1NA 3AT1A 5EGSA 4Q6BA 2RFLA 3V9PA 2RHRA 3EIQA 3FOZA 1XKTA 2P65A 2Q1WA 3RHFA 2TRSB 3AEKB 2A58A 3ZY2A 1H3EA 2PGXA 4FDLA 4L6CA 3E7FA 1GKYA 1YRQA 3B1JA 5SICE 3S2FA 1ZGCA 2J6CA 4ZDJA 1J49A 2YXEA 3IP6A 4ER0A 2WNHA 3PXCX 3DDHA 2O8EA 2C9CA 3AVXA 2QY9A 4RF5A 5DGCA 5IKOA 3UJ6A 4MA4A 4BU1A 3G0IA 2H18A 3A6JA 2ODBA 2GTHA 4A23A 4FLFA 3U7RA 4HB3A 1UXJA 3TR6A 1EJBA 4XM2A 4M83A 4MUEA 1C81A 1J90A 1LJ8A 2VH1A 1M83A 3IBTA 5AM5A 5HJ2A 1DE0A 1UJ5A 3OTQA 1EVKA 4GXNA 2FWIA 4IQ4A 5D85A 1XN1A 1ZNXA 2H1LA 3QYAA 4V39A 4AQ7A 1PR1A 5ARCA 4XM0A 1PV1A 5MDHA 3AUAA 10MHA 1X1CA 3V6MA 2J3MA 1FXWF 2G9RA 4YN3A 2BFAA 1A2OA 4L5YA 2BFOA 3KYDB 1RDFA 4F9FA 4A0HA 2IZZA 3OX2A 3H16A 1E2MA 1JEQA 1H8ED 2IVZA 2H1VA 5E8RA 3PIIA 4O08A 4NC9A 2BFWA 1KAEA 2WT8A 4U7GA 1I7SB 2DC1A 3KB6A 1YHZA 2RKOA 3AHCA 4JEHA 1V8DA 1L5MA 3R3UA 4UE6A 1DINA 3VTFA 5CEEA 2QM0A 1RJ9B 2K87A 3A1NA 3TVTA 4AECA 1V4NA 4ZVUA 4B8WA 1E6CA 4F4JA 4FC6A 3FOEC 3IMFA 3IE2A 3H2ZA 3BMCA 3ANNA 3OCYA 4M87A 4B31A 1DTWA 5EHGA 4ZI7A 3FLMA 3UXYA 1YJ5A 2DPGA 4NR0A 1HR0B 4LRQA 2YVLA 3FPSA 3T99A 2HCJB 4HOYA 4IZ6A 1FDIA 1HG0A 2A14A 2VDWA 2EJUA 2CE2X 4P2BA 4X6LA 3MSCA 3RYCB 4KYVA 1PR0A 1YHNA 1ZGAA 4TSFD 1N9GA 3RTGA 1WY7A 2PT6A 1UEXC 4C76A 4CBVA 1U3VA 3OA0A 2I34A 4KHZA 4RXMA 2GXAA 4ND1A 4ON9A 3JQ8A 3DAYA 3HSYA 1U2EA 2ZIEA 2HMWA 1YAJA 1KEVA 2XBLA 3NDRA 3OZSA 4P6VF 4ZI5A 5JAIA 4TTJA 5C4MA 1KYYA 5L3SB 3FLEA 4M3NA 1ZVKA 4L5BA 3CHYA 3U4GA 5HK9A 1S2MA 4EYOA 2RGDA 4R7GA 1S4QA 1PNTA 5LC1A 3PENA 5EKUA 1A9OA 4ZVTA 3N0RA 1G21A 1C4WA 2FPGB 1FUKA 2YZMA 2R7NA 3ISJA 5TQVA 4PCLA 2DTDA 2NUTA 5L7TA 1BD3A 3KT0A 5FB3A 5JSZB 2D1QA 3ZH2A 1KHTA 7ABPA 1OOEA 1XG5A 2FB9A 4GOLD 2ZB4A 3E5HA 1V39A 5REQB 1SXGA 2C4UA 3DZKA 3WWOA 4EO7A 2P1ZA 5CVUA 3GLGB 4D96A 4CETA 3AR7A 3O4JA 4QHSA 2ZRAA 1GTL1 2XTZA 4HN2A 1U3DA 2VT3A 4IMIB 3T7AA 4ZYUA 5B6PA 3V4VB 1A97A 5DNWA 2ZJYA 1ZITA 2GZMA 2W6MA 4QUAA 5D00A 3JZFA 2QRHA 5TB5A 1TC1A 3AG5A 2HFJA 4ZCRA 2ILVA 5CFNA 1FTQA 2AEFA 3EMDA 3L8MA 3RRYA 5FNVA 4KQCA 3VV3A 4DDUA 4UD6A 3UMSA 1NWHA 2WU3A 1E1KA 3RK0A 1V8ZA 1ZN8A 1ILWA 4FILA 4CGYA 1VM6A 4NJEB 3NTLA 2PNJA 1BXKA 3GLQA 2KJQA 3ETHA 4YMTA 3ZVNA 2Q2WA 2XB4A 3JQEA 2CNDA 1RYYA 3U6KA 1DFHA 1W2GA 1YIAA 2E4UA 1WP9A 3JY6A 5J9FA 5A3RA 3F3KA 1ETHA 4ZKDA 1E8MA 1FSSA 1DBSA 2J3EA 5A4AA 4L02A 1C8KA 5ICMA 1OIXA 1SXIA 2AB0A 2X6RA 2ZRCA 1YS7A 4P0QB 2YCLA 5T3UA 2C2OA 1D2MA 1P74A 2XMRA 4N7JA 3E53A 2X13A 4MVXA 4Q3LA 3R7WB 3UHPA 1XD2A 1RRGA 3K1JA 1SC6A 3OIFA 5DXFA 3S4YA 2B36A 2Y1GA 1KFCB 2R751 4UVIA 3CE9A 4PN3A 4MW6A 5JO0A 1Q1BA 1R5JA 3I5AA 4N18A 1W93A 2R5NA 3WDLA 1N6KA 1LBQA 1PJ3A 1G6KA 4QICA 1Q92A 4EB6B 3A9VA 3VZQA 3GY0A 4K9LA 3SBOA 1E4EA 2GKSA 5HGXA 2IP1A 2ZJ3A 1QXSA 1V26A 2VWQA 4HQRA 1ZJYA 1ID1A 2C2GA 3WC4A 1K92A 4JLNA 1C3OB 1XP8A 1K5GA 2FMFA 2ZDQA 4HVAA 2NVBA 3UMVA 4F4CA 3EK2A 2ZI4A 5BYBA 3LLUA 1KKMA 3PUXA 1SHKA 4IPTA 1KDPA 3B3QA 2YR0A 3D2CA 3NBXX 2IE0A 3WLPA 3WRXC 5KI6A 3SJBA 1NZDA 4J0CA 4CI0B 4YP7A 1SUIA 1NASA 2I78A 3DTVD 3R3VA 4IUDS 5DNCA 4CTJA 2R79A 2YV2A 3JQ8B 3W34A 3C3YA 3ZE0B 4B6OA 1LQUA 2RGNA 3LXXA 2Y0BA 2YXPX 4S35A 4Y1FA 3O74A 2QE6A 4E94A 3PFBA 3PK0A 1H0SA 4RKRA 2QYTA 3URMA 3A3OA 4MH0R 2WYVA 1YMUA 2QUBA 3H2KA 4L9RA 4AAYA 3VYWA 13PKA 2CL7X 2VP5A 3KSUA 4I36A 3TEJA 2X4GA 2Q4EA 4L9AA 1UWVA 4IJWA 2EQAA 3DZHA 5FNZA 3RJZA 5FOVA 4EUKA 2I6QA 3NCTA 2COEA 2ZS8A 3K1YA 4HVLA 3SF0A 5JD5A 4YJ2A 5FTKA 3W3AA 3MHTA 4KREA 3HUEA 4DQVA 3OZRA 3G2NA 1W36C 4EKEA 5IC6A 3KQYA 2DY0A 1QTNA 3CRNA 2IH4A 3FSGD 1ZR2A 4QU8A 1M8PA 2BR4A 1XLTC 5C1IA 4LJSA 1H8HA 3EVDA 2DRIA 2WHPA 3PQ8A 1AKWA 4KJZA 6CHYA 4RHUA 2X77A 4HNTA 4W9RA 5HP4A 2XB2A 1BYIA 4V02A 4K0KB 1TZKA 5AHWA 3ZE6A 1HNWB 1QGAA 4P5DA 2WTNA 1NN0A 2W8ZA 5G1OA 1N0VC 4G4SO 4F12A 1HE8B 2QG6A 2ZJAA 3AY7A 1IRIA 3O2QB 4WAUA 4IW3B 2C9OA 1OZGA 1IB0A 2P9YA 2Y0EA 4LSGA 1UDCA 4FK8A 1BJRE 2VXOA 3P2MA 4UHEA 1HSZA 1TAQA 3WG9A 1B16A 2QN2A 3L4SO 2YY6A 1MIHA 2FZEA 2WPNA 3NYIA 4LBZA 1I6LA 2J5RA 4GKJB 2DQYA 3CC8A 1T2UA 2VPIA 2QGNA 3JALB 4NFYA 1BMQA 3D6JA 2X0EA 2BMDA 2CZGA 2VBIA 1T9KA 4XX0B 3U3KA 4DFDA 2FR0A 2GT1A 1QC5B 5GONA 2NSDA 1M8FA 4K6OA 1UDXA 4JGGA 1UMDA 3BJIC 4OHKA 3U7FB 3LUHA 2D8MA 3I9OA 1LI5A 3GVIA 4DJ5X 3JQ9A 4I1IA 5LQUA 3LCCA 4TLBA 2ONKA 5DCLA 3G23A 1OD6A 4G81A 1OT3A 2JZCA 3R0IA 4R9RA 5HJ5A 3MLEA 3UG7A 4J1TA 3NUQA 3JWPA 1XTRA 3DT8A 4MVJF 4XD7A 4DRXB 4W5WA 1OZ0A 1MJNA 4K88A 4KE7A 5EMHA 5F2NA 4IRXA 3CUWA 2A9OA 3IKMB 5CW2A 5KUTA 1UOOA 2PBRA 1RPZA 3G0GA 3ETLA 3UFXB 4UDXX 3LKZA 3ISVA 3AL3A 3IR7A 2XCUA 3O8DA 4QTYA 4HNAA 5LUBA 1Y8QA 2C2BA 4XGQA 1BWRA 4M36A 4TWZA 4AJLA 1EE1A 2A9FA 1WNTA 1Z25A 2YXNA 3ZBPA 1EWYA 3RC8A 3QXXA 4IWNA 3M1AA 1YS6A 1M6VB 2HJWA 4O1HA 5FHRA 4JKIA 1FVFA 2HMYB 1RM3A 3L79A 3OF2A 2ZYVX 1Y1TA 1V2HE 2BP7B 3BDAA 1XZLA 5DZSA 3TTXA 3W3AH 4QLOA 3ZV7A 4BY9E 1K4KA 1W4BA 4GR4A 4JXZA 1R8XA 1KFKB 3UC9A 3HXQA 2EDAA 3AJAA 1BMDA 3TSZA 2YZ2A 1GSOA 4BNNA 4CIDA 1GPMA 3P71T 3D6HA 1UDBA 2ZAOA 4FJ0A 4AS1A 2NU6A 1AB6A 1GKKA 1H93A 2BLLA 1G8KA 2JIQA 3LXRA 2KB0A 3OHSX 4AWXA 5CFQA 1SU6A 3KDPA 4HZGA 3WDMA 3L6UA 2CGEA 4FNMA 3AFMA 3Q1KA 3TUZC 1N7GA 1TIPA 1QVWA 2FW7A 4YHBA 1KSGA 2O0MA 3GU3A 2WT9A 4KYTA 2WZQA 3W4IA 3HFSA 3CB4A 1QF6A 4UVHA 4LZPA 4U7WA 1JFTA 2YKPA 4MGKR 4NH0A 3WGZA 3X1ZA 5KQGA 1YVRA 2I87A 1X1QA 4KGDA 1CRLA 3AGPA 3QNUA 3AW8A 4GNRA 4L0MA 3CIOA 1W4AA 4CV0A 2VS1A 3KELA 5TS3A 3ONVA 3SLRA 1XMPA 1US8B 1DXHA 2AYXA 4PLTA 5IPFA 1GTRA 2P5TB 4UAGA 4LWQA 2C7VA 1JQBA 3TTWA 1UR5A 4HZIA 1M9NA 5ERXA 2HW8A 4ME6A 3THWA 2Z2IA 3LHFA 4YT2A 1X7GA 1RHQA 5IVHA 4NNPA 4Z1MA 5I3ZA 3TLAA 4HQNA 3JATA 5K8CA 4H3SA 1DL5A 1EWTA 1VRVA 4WCFB 5BNWA 2B2XA 4LYFA 3QFRA 5E8JA 2XMDA 3MGCA 3K1AB 4DLSA 1X38A 4RANA 3RKRA 4IS2A 4JQCA 2ROQA 5C46F 1AMUA 3A6KA 2A86A 3AVOA 1MRSA 1GU0A 1YCHA 2AOXA 1JH9A 4XFDA 1PZMA 4W1PA 2R1TA 3KQWA 1DSSG 1P39A 1Z45A 3FKJA 4NI5A 2PH1A 2ZPTX 3FI9A 4Y2UA 3FX2A 4OUDB 4CIVA 1MXHA 4R84A 2C82A 3CWCA 4XVUA 3L0DA 2GZAA 1QCZA 3KZXA 1BMFA 2O4CA 4UUBA 5CVCA 4M4SA 1ENYA 1FJHA 5C52B 4GE0A 1THGA 4G9BA 1NJ6A 1XR3A 3I9FA 2WAOA 1QR2A 3M34A 2FKAA 4PZLA 3EW7A 3K0AB 2WYHA 3E9YA 4LOJA 5DLEA 2ECFA 2IS4A 3WJ7A 1C30A 3GLGE 4B81A 1AX9A 2WSSA 2FWMX 3KD3A 1NDQA 1M75A 1TB4A 3VVMA 5A4FS 4YAUA 3QEBZ 4N48A 3ERCA 2WYUA 3E5RA 2W22A 1QYVA 1JJFA 2E21A 5HF9A 3DE4X 4CKWB 3ROPA 1LDNA 1E6EA 4OD0A 1M34B 2GHRA 4JUDX 4PWZA 3ZS8A 4XDGA 3EGXA 4DSUA 1U94A 4WZBE 3IKVA 2Q0HA 2Z56A 5EMKA 4JUBA 4GAEA 3V8MA 2CCKA 2GVNA 2YNMD 2GVZC 1KO8A 2ZROA 1N2CE 1U8CB 4FC7A 4RGYA 5FJJA 3NRBA 2I0FA 4QPZA 3D4IA 4LE2A 1IE3A 3VRHA 3NHFA 1T9HA 3Q0EA 4DA9A 3RTCA 3NH6A 4K1LA 4YASA 1D09A 1OGYA 4N8SA 1IWOA 3D4BA 1NUHA 2JHPA 2LKDA 1P3DA 2HMAA 3NKFA 3MTJA 3D1VA 1JL3A 1KZGB 3PBKA 4CYMA 2JAPA 3EXHB 3KOUA 3FGZA 1DKNA 1X42A 3LLCA 4BNXA 1NQTA 4NMMA 3TGPA 2XUKA 3FBTA 1Y0BA 4QJIA 3E3MA 2DLNA 5FUVA 1P1RA 1U2ZA 1RXUA 4RY0A 3N58A 1A8QA 3AHEA 4RYLA 2NZJA 3FPHA 1L4YA 4WADA 1ULSA 4WZBA 1L5YA 3G2HA 3MB5A 4UDYX 1ZUIA 2WWHA 3WGVA 2I33A 4MS1B 1NUUA 3IDQA 2Z3WA 3WMXA 3K71B 4P4NA 4QVGA 4HAUA 4TMXA 1H94A 1Z35A 4HJXA 2X6TA 5B57C 3MS7A 4NHOA 4NPAA 2QP9X 2FDXA 4TZ6A 4GRDA 2RGAA 1DJOA 3AH8A 4KWEA 3ND8A 3QU5A 2BZSA 3O83A 2QTVB 1ULAA 2W6OA 1ZNZA 3QU7A 4I55F 3LDAA 4WCVA 1O6CA 3ABIA 1N0IA 2GD1O 4R41A 3ZDXB 5DGXA 4X95A 4UU8A 3D7MA 1BDHA 3LQQA 3OMWA 1TOAA 4NG4A 5T8KC 2DR3A 1RZ3A 3ONNA 1EFRD 3I6YA 5FA6A 4JUFA 2ZSHA 1H3FA 4UUPA 1VP9A 3DEYX 1C7IA 2VT2A 3MINB 4YP5A 2N1MA 4JOCA 4PBTA 4MR8A 2XD9A 5LMZA 2ZYTX 2RJOA 3N2ZB 4WPGA 3MUOA 5DIFA 3UMMA 4PRLA 5IJ9B 4MYRA 1X7HA 4K2AA 5IVDA 4A8JA 1TYBE 1BS1A 1EZZA 5BW4A 721PA 5KTRA 1DBRA 1CG6A 3GYGA 4PNHA 3TF5A 1XVTA 4OTZA 2BR3A 3K5WA 5H4GA 5IAEA 1OXMA 3RU3A 5GQSA 5BN5A 3R20A 4EG5A 2BYTA 1EFKA 2H7XA 1J0EA 1XD2B 2WTEA 2LGJA 2W2KA 1ZM9A 4YBRA 2P6UA 4IFEA 2DBYA 5JATA 1ECCA 4FW8A 3WLAA 3GMTA 4G0OA 1U3CA 2WJIA 1JHUA 3R5SA 1L4BA 2B61A 5GWXA 3VAYA 1ONOA 3C8ZA 4YCNA 1VA4A 1ST3A 3JQFA 1YV9A 5IG2A 4DMUB 1XQ6A 2WUWE 3I1JA 5FFNA 1OLSA 3WQQA 3C5EA 4CCYB 1TYZA 1Y8RA 3CG4A 4QULA 5BXYA 4Q6WA 2W83A 3G8AA 4QOJA 2ZWMA 4CHTA 5IFLA 2O8CB 2CF6A 2FPLA 2EL9A 3BGWA 1CR2A 3LBHA 1MFZA 1KQPA 3OFSA 5T4FA 4DLAA 4Z7NB 4F6LA 3HBMA 3W5CA 3PXXA 4X6UA 5HBGA 4D97A 4KR0A 3GAAA 1DXYA 3LT5A 1ENOA 2HI0A 4ZEOA 2B30A 2H07A 4C7XA 1RXYA 3HB5X 3GRZA 2WWRA 1UAGA 3B9BA 3GVXA 3PJGA 1P0FA 3GEDA 3QUAA 3T1OA 3ZGLA 4ER7A 2F1JA 4DCVA 2HJRA 4IMRA 4M0PA 2CVFA 4RK7A 1FJXA 3SC3A 2EFEB 2PO7A 5K0BA 5EXTA 3U19A 4C6TA 5GZ3A 3UJHA 1SD2A 1MB0A 1U0FA 2O5RA 4WMLA 5M2QA 2FFAA 3BGIA 2EZ8A 1SNYA 5DM2A 3A4TA 3GP5A 5C3MA 1C1DA 1IVYA 1VPLA 2Z09A 4HL6A 2PD3A 3K0CA 1BZYA 4P4UA 4TV8B 4BWVA 1YR9A 3AP1A 5EMMA 1B14A 3B6KA 4E33A 4EELA 3FFAA 2VUSA 4MYUA 1P7PA 1ZVJA 1FS6A 2OT3B 1AK2A 1TVEA 4L51A 4RSRA 4UBKA 3TBKA 1QVRA 4D2IA 4EIWA 2WINI 4URYR 4M22A 1C7JA 5EIEA 1YS9A 3ZHXA 4M49A 1W581 3OM0A 3LKDA 1Q50A 2UYYA 2AH5A 1FZQA 3QLTA 5EMLA 5CT8A 3WE7A 5BR1A 2XUHA 4C4SA 2IH2A 3V7UA 1JYEA 5FWXA 3CPHA 2WFZA 2DQZA 4UFOA 4CCSA 1WCYA 4JI6B 1DZIA 1GCUA 1TXGA 4LK2A 1OX4B 1IDOA 2J0UA 2BBOA 3DL2A 2HC9A 1DV1A 4HNAB 4WESA 2GASA 3I6QA 2BHRA 3KD2A 2CD9A 2V7UA 4IHJB 4XEUA 1E18A 4HTFA 3UMRA 1QDEA 3H2HA 3KPWA 2YJ3A 1LWNA 3QKSA 1JIIA 1UZUA 1LBIA 4BP3A 1G60A 2ERYA 3QBJA 3PTZA 2AKYA 5LZ7A 3P9IA 4GGPA 3U39A 4F4IA 3EPKA 2PFKA 4BRUA 1EK5A 4V3CA 4HEQA 4FFPA 5C5IA 4Q19A 5HHTA 3L92A 1OREA 4Q01A 2G06A 3LY9A 3M8KA 4RZQA 4I9FA 4LJKA 5JRDS 2IHKA 2PQ6A 3D4OA 5A4IS 1B0AA 2I4RA 3KQQA 3F6YA 2G4LA 2R9VA 1KVSA 4GOJA 1O4VA 3VC7A 4O4LF 4CKCB 3TAHA 5KYKA 2XIJA 3CH4B 3TFOA 5CA1B 2G4CA 3WXBA 3SYMA 4EGFA 3L7NA 5FUXA 2P9HA 2VP2A 3LLSA 1YKSA 3FN4A 4BE9A 4FQ8A 1VSQA 2O57A 3P9YA 1U81A 2VG8A 1DJPA 4U3JA 5EPUA 3SM9A 1QQAA 3CH7A 5KOIA 2CE7A 1P5HA 1RJWA 3G2JA 4ZHSA 2Q1YA 2FPPB 2PBLA 2PX5A 1QAOA 1BX3A 1OLOA 2P4UA 3U1BA 1H85A 1TO1E 2J7KA 2PY6A 5FQNA 2R4QA 2E4YA 1A96A 2FW9A 5F9MA 2M6LA 1T1EA 2B3DA 3M3DA 5LM3A 2EC5A 1VJCA 3AF4A 4DEXA 4EB6A 1D0IA 1XTSA 3W04A 2AQKA 5I8WA 2ZCJA 2QUIA 2C7QA 1IBLB 3OZAA 1FIUA 4PN7A 4LCJA 2VDVE 3FF1A 3QKUA 3HXOA 4D9HA 4QTUB 3CUKA 3AFNA 4IIDA 1EVLA 3RROA 1XNRB 4M46A 4HGRA 2OSBA 1AK1A 3L7BA 1JU9A 2O20A 4IHQA 3AKEA 1JR3E 4WOCA 4LOLA 2DE0X 2F3QA 2VYNA 4RZUA 1H9AA 1L8XA 3PC2A 3JATB 3TLZA 3TQTA 1NOJA 2FPUA 3T7TA 4D0NA 5BXQC 1EHYA 1CQJA 1WZEA 4DHEA 2Q3DA 3HEMA 4FR2A 3EC7A 1B73A 5B6JA 3JRNA 1OR8A 4M76B 3HRHA 1JAZA 1PT8A 2NLOA 1Z0JA 1H5QA 1V6SA 2P4QA 3BFJA 1OPXA 2VPYA 4B43A 2A8YA 3F6CA 1A4IA 5AICA 4UM5A 3QKSB 2QEQA 2Z98A 1GZ4A 1LI4A 3VDXA 2NYAA 2R7MA 1MD9A 2PGIA 4U7DA 3EXIA 3T0GA 3IT0A 4UUNA 4M1KA 5BSGA 1X7ZA 4WE3A 5LIPA 1IMJA 1E3TA 3A9WA 1SK8A 4QGGA 1AC5A 2ZE8A 4HFJA 3WTBA 3D8HA 1YIDA 4FB4A 1NVUQ 2CNBA 2C2KA 2CHEA 3F46A 2FG5A 2VKQA 1VFNA 5DNEA 3RRFA 4ZIRA 1Y6FA 3MCTA 3KAKA 4KFUA 1XZKA 4BMVA 2DSTA 1RIFA 4G1CA 2YIMA 2ZQ5A 3ZXIA 1KL7A 2V55B 1SXQA 4B6QA 2PJUA 3AZPA 5A1JA 4CMHA 1EK6A 2B94A 2CXTA 1XLTA 4TQGA 4NQRA 1WDLA 2UVPA 3DMGA 4FFBB 2X0DA 2LDBA 3QZUA 1FFHA 1FDSA 4QX6A 1JXMA 4MEBA 4FXPA 3S2YA 2C1ZA 3A10A 3CLHA 3FROA 5I9TA 1UT6A 1TX4B 1Z37A 1W46A 2GQ0A 3FA2A 4XVQA 5DRYA 1X8JA 2ZU0C 5JXWA 2LPMA 3OCXA 4Q4JA 5BWNA 2IHVA 3PC4A 4AMBA 3VYVA 3DFUA 5IEBA 3WFIA 1BVHA 1JTFA 1RS0A 2EARA 2QU8A 3WHPA 2V1XA 1UT8A 2I1LA 3ORYA 5K6AA 1O0CA 2V5UA 4M53A 2YIJA 4IDBA 1M2VA 2DCUA 3VR1A 5LN1A 4DILA 3BX1A 2GARA 1SUBA 1F3LA 1K9VF 2A1UB 3EZGA 1DDGA 2J33A 3Q6NA 4PFJA 5BYJA 3RFCA 1PUJA 4GKBA 4C5CA 5AQ1A 4B9EA 1ML3A 2A30A 2JLXA 1KH3A 2BI8A 2Y1DA 3EQ7A 3P9XA 3WRYA 3HEBA 1BIFA 1V41E 1AGNA 1H6CA 1KZYC 1OT5A 1RJEA 1BA3A 4LC0A 4TTTS 3BMNA 2Z1MA 5DBFA 5P21A 1KRHA 5KSYA 4RTJA 2V0CA 3ELBA 3BRWA 3C3PA 2V4ZA 1BQ4A 2I6XA 3KQMA 2B25A 3TPFA 2ZATA 3GRYA 1PJQA 4UVGA 1W8IA 3CN9A 4KFCA 3G9QA 1FVXA 3S7TA 4GSKA 4D9BA 4XYEA 3FF4A 3UC5A 1T0HB 3C6XA 3K9GA 2P5SA 2RDMA 1U2QA 3KU4A 1Q3HA 3H5TA 5IT5A 3HGTA 1WIWA 4KXQA 3P2OA 4BB5A 3LT0A 3RV4A 2JZOA 2QTBA 2J85A 2Q2VA 4OU5A 4WN3A 5EWLB 2XOEA 3UUEA 1YZNA 1L7AA 2Y0PA 4L95C 5J4VA 4TZ0A 4M9CA 4L6AA 1RJGA 1ZH0A 3COSA 4HGNA 5F9FA 3RRMA 5TC4A 2E55A 1PEKE 3WYEA 3DYBA 4IUBS 4C4XA 1E5VA 3HZHA 4YAFA 1T9BA 4XB2A 3QRWA 1LKZA 3GCDA 4TTAA 1WMDA 4BTEA 1W87A 4F5WA 1CS0B 2A0KA 1QVVA 4GQAA 2IWHA 1X1SA 2AOTA 4HRVA 2CXUA 2OR3A 2Q9CA 3R5KA 1TM7E 2GKOA 1E9AA 1ZIDA 2GN2A 2WM9B 4AP5A 4LG1A 1G8HA 3KB8A 3ZHOA 5K3EA 4ZOBA 3GUZA 3KYBA 4FR5A 5L4LA 1TVCA 4E5SA 5IS2A 4ND8B 3OCVA 4G0NA 2VZLA 1TYDE 3VU0A 3OA2A 1E6KA 3QELA 4Z9YA 2QHXA 4X41A 3CM0A 4DG8A 2HMSA 4X1KB 1XXHB 5CEFA 4JMLA 3OU6A 3K0BA 4JUIA 4N3BA 4F2HA 2ZSUA 4G0QA 4PO3X 2YRFA 4Q15A 2G0AA 4YP1A 1IULA 2MYUA 1VCOA 4HMOA 5BURA 4GZ3A 3AIMA 4L85A 1DEXA 5CB4F 1TJ4A 1XZPA 2OE2A 5EP2A 1Y7IA 3K1AA 3JD1A 1CB0A 2A1IA 2CWWA 2X2PA 4UEOA 1GO2A 1R16A 3H75A 3DQZA 4AJKA 5CYGA 1TM1E 3D7KA 3DUFA 4ZRNA 2VHXA 1ECFA 1N9KA 3JPYA 5EWMA 3HR7A 4RV4A 1QR6A 5DTRA 3KM0A 3LCMA 2ZBUA 4ZAGA 3KR2A 3DJYA 3K6JA 1C1YA 4GM1A 4BJHB 3QXGA 2Z9CA 3SJ7A 2AFIB 3C5WP 3V2UA 2A1UA 7REQB 5KEIA 2I7DA 1OYOA 3ZWQA 3UM9A 4CMAA 1XRQA 4UM9B 4UEJA 3A4MA 4FGKA 5KNBH 4BNJA 3NYRA 4LI0A 3K4QA 3KEMA 1WDKA 2OZVA 1MKYA 4QUKA 4WJZA 5FOQA 5JQGF 1PNOA 1SHTX 3VOTA 3ZXYA 4FZ5A 5HOQA 2P41A 3K73O 4Y2XA 4FWTA 1KP2A 4TYYA 4HDRA 3QYPA 2JCSA 3PHHA 1J0XO 1KK2A 1M67A 3WHIA 3DONA 2XWSA 4NPHA 1C9YA 2ARKA 2WWVD 1KXJA 4O25A 3AQ4A 4CLRB 5JR3A 4FT4A 4OK5A 3GNTA 4KXUA 4PGAA 4QT4A 3QWFA 2G80A 3EGXB 4QGBA 1FX1A 3KYCB 3FDZB 4AVYA 3LUFA 3V32A 5D3QA 5ELXA 4KNYA 3ROXA 2XAAA 4L5AA 1XCBA 4P5EA 1H42A 2AQIA 3USCS 1X70A 1OJLA 1RHMA 1WD5A 1A5SB 5HS4A 3K2BA 1E5TA 3DGEC 4XX1A 3RTAA 2FPMA 1KZ9A 3O4FA