4PU0A

Crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in fmnh2-bound form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
173
structure length
173
Chain Sequence
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN reductase SsuE
publication title Crystal Structure of Escherichia coli SsuE: Defining a General Catalytic Cycle for FMN Reductases of the Flavodoxin-like Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 57
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.38: FMN reductase (NADPH).
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pu0A00
4PTZA 2QMYA 3OWHA 2D5IA 3U7IA 2XOEA 1QR2A 1YCHA 1FUEA 4H6PA 1I1OA 2W5UA 5NULA 1T5BA 2F1OA 5EA2A 4NLLA 3OJXA 4PU0A 1D03A 4N9QA 3B6KA 3F2VA 3L9XA 3NHRA 5NLLA 2QR2A 3OX3A 2FAXA 5FX2A 1F4PA 4YAWA 3RPEA 3B6JA 4YALA 3W79A 5LBUA 2M6RA 2V5VA 3GFRA 1CZHA 1ZWLA 2XODA 2V5UA 4OXXA 3O73A 5F12A 1FX1A 4ZVMA 1V4BA 3G5MA 3FVWA 1CZRA 5ULLA 1YKGA 1ZWKA 3EDOA 3ES9A 4GI5A 1CZOA 4QOIA 2Z9DA 1CZUA 2QMZA 4ICIA 3UXHA 4U7HA 3FX2A 1AKQA 4FGKA 3P0RA 1JA1A 1FLVA 3KAQA 2MTBA 3SVLA 2Q62A 4ESEA 5EAIA 2N1MA 1XYYA 3OVMA 3B6IA 1RTTA 2FZ5A 4CF6A 1YDGA 1BVYF 2WC1A 4LA4A 3NHFA 4LAFA 1AKWA 1YRHA 5TGZA 3EYWA 4U7FA 4YAFA 3S2YA 1C7FA 1SG0A 2QX4A 2FDXA 5LLDA 3OX1A 3N39C 4C0XA 1CZNA 1RLJA 4M0CA 3FNIA 3TE7A 3NHLA 4H2DA 3NFRA 2FZVA 4N82A 1OBOA 5LJLA 4C0WA 1FLAA 2Q9UA 3ESXA 2OYSA 1AKTA 4U7GA 4LTNA 3L9WA 2HPVA 3N3AC 4LTMA 3ESZA 3GFQA 4QOGA 1J9ZA 3ESYA 3LT5A 2BPOA 1XI2A 1D04A 3N3BC 4QODA 2R96A 1AMOA 4XDGA 1TLLA 1OBVA 4QOEA 4PTYA 4LTDA 4ZVNA 1QHEA 3KEGA 1QRDA 1QBGA 4BMPB 3GFSA 2ARKA 2M6SA 2HNAA 4YAOA 1DX9A 4C14A 1X77A 2RG1A 4ZVKA 5LVAA 2AMJA 2ZKIA 3OWXA 4YAUA 3ZHOA 2OHHA 2BMVA 5F4BA 3KAPA 2X2OA 2R97A 4DIKA 2BF4A 5EMNA 5A4KA 1FVXA 2Z9BA 3QFCA 1WSWA 3QE2A 2QWXA 5FA6A 3LCMA 5B3KA 1FLDA 4XDHA 1AZLA 4Y9RA 4J8PA 5LBTA 1AG9A 3W7AA 3NHUA 1NNI1 2FOXA 2MOKA 1B1CA 2MT9A 4HEQA 3HR4A 3W77A 4DILA 2HNBA 4CETA 2QX6A 5F51A 4HS4A 2Z9CA 4QOFA 3OJWA 1RCFA 1C7EA 1H69A 3D7NA 1DXQA 4D02A 1CZLA 1AKRA 4QOJA 6NULA 1DXOA 1XT6A 3HA2A 1FLNA 2OHJA 2FCRA 3FJOA 3JSXA 3TZBA 3K1YA 4FGJA 3TEMA 4GQIA 4GR9A 1RLIA 4F8YA 3NHKA 1YCGA 4BMOB 4FX2A 1XYVA 1FTGA 4QOHA 3FW1A 1D4AA 3NHPA 1KBOA 3UXEA 5BUCA 4S24A 4NULA 1E5DA 2KQUA 3HLYA 3B6MA 2FLVA 2FVXA 1AHNA 3KLBA 4R81A 3NLLA 1J9GA 4N65A 1WSBA 1YOBA 2QX9A 2V9CA 2MWMA 3OX2A 4FGLA 2FX2A 3NHWA 1J8QA 1OFVA 1J9EA 3F6RA 3F6SA 2KLBA 3NHSA 4ZVLA 1KBQA 2BN4A 2Z98A 5LMCA 3O2NA 1BU5A 1TIKA 3F90A 2GSWA 1AKVA 4DY4A 3NHJA 3W78A 1VMEA 3GAMA 3U7RA 1H66A 5LJIA 2B3DA 1T0IA 1YCFA 2A5LA 3K20A 2OHIA 1GG5A 2X2PA 3R6WA 1JA0A 4Y9UA 2BZSA 1ZX1A 5B3LA 1CZKA 3NHYA 5FUQA 4Y7CA 1SQSA 3QFRA 2QX8A 4YQEA 5JROA 1AKUA 4C76A
chains in the Genus database with same CATH superfamily
4LX0A 3EBOA 3O4FA 2EF1A 2Q3JA 3I3OA 3W8RA 4G4IA 1CG6A 4BECA 3FRIA 2C7BA 1PF7E 3EUFA 4HGOA 3TOSA 4BS9A 4DNFA 5JWOA 3MZ0A 3EUWA 3FBTA 2ZPTX 3HCEA 4E5YA 4QYSA 3C5EA 4ZHSA 2F1JA 3EC1A 5KI6A 3TRDA 4PX5A 3S3TA 3PPXA 2HPAA 4BKPA 3IXQA 3KQTA 1RZRD 3NOQA 3NNNA 1SZCA 2DJ5A 4MVWA 1KO8A 3O4HA 1QIIA 4I08A 1DEAA 2BKUA 1N78A 4N01A 3WLIA 5GM1A 3L9XA 5L3ZA 1GA4A 2VAVA 5EUBA 4OHBA 1E64A 1U3UA 1VPTA 4ROTA 4N1AA 4H4DA 3REQA 4IBOA 2PAAA 3SJUA 4IVQA 2YH2A 3C8HA 1LPAB 2FR1A 2WHEA 3MCAA 4HK4A 1XK7A 4P3YA 2G8NA 4R1LA 3KJZA 3LZ6A 4ND8B 5CA0B 2Q6OA 1X1CA 1NUSA 5H68A 2RHTA 5IVIA 5TV2A 1Z35A 1Q6YA 3WQSB 2XZDA 1G7TA 4IYJA 3DE6X 1UK7A 5MN6A 2WZCA 2C5HA 621PA 2QLLA 3K6JA 3D8BA 4MVJM 2P8SA 4ASUA 3UHPA 1ZWLA 2C82A 2Q3HA 5JSKA 3RF6A 3BD9A 3G82C 2WT4A 2JLCA 1AHHA 1TGYA 5DEIA 5CJ2A 3N8HA 5JSYA 5JZ9A 5JXIA 4OP2A 1AA6A 5KO2A 3FYSA 3A3KA 2Y1KA 4UEJA 4JAVC 1WDTA 3MRTA 1CUGA 4OBXA 3WKDA 1KI8A 3DO5A 1OFIA 1YS9A 2WT8A 5DNUA 4QPJC 1Y6QA 3C16C 4QVIA 1RPNA 3QXJA 4TZTA 5JSZA 3P9CA 4RFLA 4D9EA 2HDHA 2AWNA 4QNMA 4W1RA 3RC7A 4DLKA 1LA2A 5DN6D 2EJUA 2OT3B 3HN7A 3BXHA 3ES9A 1F48A 1W5TA 4U8HA 1WBDA 1YUNA 4TKZA 1EBBA 4UM7A 3REQB 3UWSA 2FZKA 2QL6A 5CM8B 3WLMA 3Q40A 2YHUA 3JYLA 4LZPA 3B1XA 3A4LA 4LI3X 5DNDA 3OH8A 5KMGA 1ZI6A 1SBQA 1XZLA 3PP8A 3SNHA 5HIKA 2Q9CA 3RYIA 4ND1A 4CCSA 1DRWA 3EDCA 4FNGA 3BIWA 4B6OA 2DFPA 5DBHX 5HZMA 1IWBB 3ADPA 1M0TA 3I6ZA 3MF4A 3WB0A 3ML1A 4ZU6X 4R69A 2WSMA 4ER7A 4DUZB 1RAIA 1ZEJA 4AW9A 3O5AA 2DPLA 3CSSA 2PGAA 2Q3DA 1S02A 2WU4A 2IEDA 3HFGA 1Y8CA 1ELOA 4KN5A 3V7FA 5EAIA 1K0UA 1DS6A 3DWIA 1GKIA 1AD2A 2ZJFA 2WW8A 3NAMA 3UT6A 1Y1TA 4G36A 3VISA 2Q27A 1JZTA 5BNZA 3ZHXA 4QD3A 1PWYE 1TAGA 2PXCA 1Y1SA 4FI3C 4V0LA 5JSZB 4JOBA 5EMLA 4JL8A 2IRWA 3OE5A 4BQRA 4JENA 2BGLA 2QMEA 1XTZA 2PU7A 3NYQA 1BEZA 3P19A 4IGAA 2WIFA 2YQ4A 3V33A 4LVUA 2WAMA 4YI3A 5A4AA 3T1HB 1X1DA 3CR3C 4JFAA 1BJKA 2HC9A 5KMGB 5BQ3A 1X94A 2OV2A 4IHKA 5K3EA 1RWKA 2PD6A 3RYIB 2NZUG 5ISMA 2W9XA 2XAUA 1HE3A 3H05A 5EIBC 3RSZA 1JPJA 2ORVA 1UBLS 3C3CA 2HF7A 3TM4A 3W3AH 4W5WA 1XVLA 5I51A 2O2CA 1LVUA 5ES4B 1W49A 5ADHA 3HDQA 4MQBA 3ELYA 3OLXA 1ZNXA 2FV8A 3P4YA 3KRTA 1YGPA 2C4TA 2R8PA 4LXQA 3K70D 5LJLA 3TM5A 3DDUA 4QGSA 3DOFA 1FYWA 2IITA 2PX8A 5EP2A 4DLVA 1PNRA 2NOAA 2F4VB 3PIRA 3PSHA 3PHLA 4R1OA 1QS0A 2P4EA 1OD6A 1V1RB 1FK8A 2Y2VA 1DO8A 2Z2JA 4IRMA 5HGJA 4R3NA 2FDXA 1EI9A 2XUQA 1RAHA 3CPJB 5JAPA 1TTTA 1E2HA 2WD8A 3H5OA 1J7JA 4ZPXA 4CN9A 2PSJA 4M2LA 4B80A 1PYDA 4C30A 1R4NA 1JJ7A 4O2AF 2FKNA 3QUSA 5KVAA 4YRMA 3ER8A 4KODA 4XVUA 2OGSA 3I2JA 5C9ZA 4KIGA 2PEYA 2A58A 1EBUA 2EOAA 3I8XA 3G5UA 3PR1A 5CUQA 1OXSC 4XWWA 1QNFA 1JDNA 1VMKA 4WLFA 4ZEWA 5BNTA 2O6HA 1XQWA 3BSFA 4TMYA 2RGYA 3UC9A 4KRYA 3H9GA 3WDSA 3PGLA 3L93A 3UMFA 1P18A 3DONA 5K3SA 3AEQA 1G1AA 1M1ZA 1Z34A 1PW5A 4A2CA 5CEEA 1YE8A 2Z09A 2NO6A 3K9FC 2DUMA 3A4YA 3K8QA 1EGMB 4ZK2A 3AOEC 4Z4IA 4YP7A 4RZ3A 4NIMA 2QM8A 1XLTC 1EFLA 3KAJA 1Q83A 3A1CA 3EVDA 1REQB 1B42A 1QS0B 1QSGA 1ZGJA 3G0OA 4FCVA 3HXKA 5F7XA 3TDNA 2E4WA 1RFGE 2VRWA 1C30B 1KO1A 1L1QA 3KUXA 5KDLA 1NP6A 2X7JA 4DCSA 2ETXA 2J45A 3MD9A 4DZRA 2E49A 2FZCA 4OHZA 2BBSA 1XI2A 4O8ZA 5IT9A 3LP5A 2P68A 2XGGA 5ESRA 1YGYA 4N0MA 3MTAA 1R4NB 4RENA 1PVVA 4KXMA 5BN4A 1SKYE 1V4VA 1VLQA 3PIIA 5K3CA 3CV3A 5AXDA 3WGVA 1NP3A 2L19A 4BWVA 4ZVQA 3Q8MA 2IXTA 2DHDA 1U3FA 5FI5A 1L1FA 2HSGA 3SDZA 1TLLA 2BWJA 3EEFA 3JALA 2DBYA 1ZIDA 2AQKA 1K8RA 2CHFA 2A4KA 4FS8A 3P2OA 4L51A 4NS4A 4X5OA 3WYEA 4JMPA 1B1AA 2NTEA 3MIZA 2HIMA 2V3WA 3M1AA 3FZNA 1TZCA 1XCBA 4TXHA 1EIZA 4JT4A 4JJ8A 3SS7X 5LQAA 1GN8A 1JXMA 3KQYA 1ZEMA 3Q6MA 4OHKA 2IXEA 3AEQB 4KC0A 3U40A 1Q1NA 2I2DA 4NMLA 4OKIA 5E95A 4LMBA 1M5TA 1A7AA 2ARKA 1VE9A 2KI5A 2AMFA 2EHDA 2GTPA 2VIIA 3G2PA 3OE4A 4OMFG 1RHUA 1QNLA 2JIOA 2P9YA 3B6EA 3TTYA 2HMAA 3A1SA 1E2LA 3LIPA 3OUTA 4PLCA 4RADA 5CXQA 5L4NA 1SXHA 1RXEA 3S2IA 4OSEA 1PJTA 2GETA 4XJSA 2FUCA 1W6UA 4FINA 4JUFA 3V4PB 4FFVA 4KZKA 5TSDA 4HMQA 1YJAA 4FFMA 3N0WA 2AMJA 5A4DA 4TT3D 3KE8A 4Q6BA 2XWPA 5AESA 2OXEA 1RWXA 3G8BA 5BN4B 5H9WA 1Z73A 2QTFA 2XTNA 2G17A 4DQVA 4KNYA 1R6VA 2ZR9A 1L5MA 2PBLA 3PGXA 4QUAA 2V5AA 2V54A 5ENZA 2BEWA 3CF4G 4PXYA 4AVYA 4J0EA 2V7WA 3OHPA 4OYLA 2C5GA 2PRYA 1DU4A 3E8XA 4HF7A 5T3YA 1WXHA 3UMMA 3VFDA 3T3OA 1XGKA 1FVXA 2B37A 3B70A 2ZR8A 4QBGB 2PV7A 4WKBA 5LQDA 4D5GA 1RKBA 5BSWA 1U80A 2IUSA 2OY0A 2HQBA 2ZYAA 1W75A 1P4RA 5A0TA 3EC2A 4H15A 3ZCUA 3GCDA 4U6QA 4KTTE 5DTJA 3GRRA 3DT9A 2A5FA 4PY2A 4FHCA 4LE1A 3C3AA 4NDNE 4QU9A 3E3NA 3FFAA 3GRAA 4I9HA 3EG5A 1KP2A 4PO3X 4LJRA 1XO1A 1CP3A 2P3SA 5DN6A 1P5FA 1XDSA 2EJTA 3REOA 2Q8NA 3PKJA 1NBAA 1RIFA 2DHQA 1IBCA 2I7DA 1EWRA 2O2SA 3ASUA 3LQRA 3NHUA 4GM0A 5AKIA 1PS9A 3CZQA 5A3JA 4RZSA 3VYSB 5HX7A 4OHYA 3EVNA 1VG9B 1UJBA 4ZCIA 4UTNA 1VL2A 2DSNA 4D97A 1OMOA 1RAEA 2OFFA 1QC5A 1Z6YA 4RMJA 4TTTS 4HEQA 3FCYA 4S1TA 5GV8A 3LK7A 3W5DA 2BEWB 5E4JA 3JATA 4ILKA 3ROZA 3UA3A 1SKQA 2R6GA 1H1DA 4M9UA 5FBQB 4X84A 5BUSA 2X7XA 2HK8A 2PX0A 3RJZA 3V4LA 3VR4H 3NGLA 4NCBA 4NYMR 3PG5A 5ALFA 1KY2A 1E2MA 1XDBA 3KLOA 4J3JA 1UFRA 1CUYA 1KVQA 3F46A 4Q9NA 1J06A 2IH2A 1XQYA 3CRRA 2XRYA 4BHTA 5JJCA 2D54A 2QZ9A 2WP0A 1WV1A 2H3EA 4RM3A 5B5SA 3EVEA 3JYNA 3T7DA 3P4XA 4S2UA 3A9SA 4FFOA 3BA1A 1GR1A 3IIKA 5DFAA 5BN1A 3IILA 4JELA 5AIAA 1ZL2A 4JWKA 3G2QA 1YB4A 1HDYA 1WDLA 6REQA 3CEJA 1ADGA 4WOPA 4QWMA 3UOAB 3WQQA 1P3DA 2FGJA 2XEXA 2ADOA 4MKFA 4GKVA 2JAHA 2RK4A 1V45E 1Q15A 1NYRA 2B7BA 2BBTA 1O54A 2WE8A 3RV4A 3WJ7A 2IXDA 2V6FA 3ND5A 4EZEA 2EFGA 3FPEA 1NE7A 4MV8A 2WINI 4OJKA 4L6CA 2OHJA 3JATB 2GZ1A 1VPEA 1O1YA 2B78A 2V7PA 3ECSA 3H1FA 4LGVA 4S1NA 4CI0B 4ZJYA 1DJMA 4EKNB 3LOPA 1U4SA 4MUXA 4PYOA 5JS6A 4I0WB 1QYVA 4H6XA 1X38A 4OSOA 5CR9A 1P6XA 3T4XA 3U1VA 3GUHA 1C0KA 3PXEA 2GXUA 2XIJA 1GZ7A 4GAEA 4F8YA 3JU3A 1GFWA 1VFNA 3CB2A 4AJIA 1FIUA 3C3KA 1NY6A 5JS1A 4WA8A 1OROA 5E9JA 4BDTA 4R40A 5DVZA 3PX2A 4PW0A 2HZ7A 3IODA 4I46A 2LCQA 4G0WA 3FNQA 4BRSA 3TB4A 1CS0A 3U61B 3L6DA 4HVTA 1PD0A 1TF7A 2AT1A 2PO7A 3CH6A 1Y1QA 3GHHA 4M8IA 3OCVA 4EYSA 1ANKA 4KREA 2HQ1A 4K1LA 1JKMA 1FDWA 2OGZA 4TUYF 3S1LA 3ICOA 3UXEA 1BCRA 3ZWKA 3VKUA 1E3WB 3L02A 1XZNA 1Z8NA 2BFNA 4INZA 5CFLA 3PNMA 2V74B 1FQWA 2O7RA 1NXVA 1WMAA 3N8GA 3HLYA 3JZFA 2VJQA 2Q6TA 3I8OA 3R0ZA 4JWTA 3R3UA 5HA5A 2P6MA 4BO5A 4FUQA 4P53A 2O2IA 3N2KA 3LIIA 1MBZA 1N0IA 1JTEA 1PL0A 3DWEX 3NGXA 3OLCX 4WE3A 3COPA 3EOBI 5JD4A 3BH6A 5EERA 3UO8B 4IDAA 3ZHYA 1ZIYA 4YJ2F 4MUNA 3WMWA 3ABQB 2RGWA 2ZXFA 4BZXA 2WU0A 1ZM7A 2H9YA 2JEOA 2O7NA 3M82A 3S27A 4F5WA 4HVLA 3C2QA 6Q21A 4NWIA 2FDCA 2Z3WA 1NRIA 3SD7A 3SIRA 3T41A 1QTRA 1W46A 4D3SA 1EG2A 4B4OA 4C20A 3N5KA 5CM2Z 2B20A 1CS0B 3FYUC 4EZBA 2YNMD 1JIJA 4AIIA 3MNFA 3QJGA 2O0JA 2ZYHA 1A8QA 2C4WA 1RYMA 2FX2A 1LLQA 3WYFA 4EJSC 4JC4A 1G6KA 2DBRA 1BCRB 1K3FA 1FMJA 1UJMA 1TZKA 2I4LA 3H5RA 3WOVA 1LV7A 1AUQA 4GX0A 1YVPA 1I6WA 5A5VA 3ID6C 4ZOLA 4BLWA 4XEUA 5I9SA 5HJEA 4FOSA 4BUCA 1EQAA 4GI2A 2H7CA 1Z47A 1EX1A 5DP1A 5LMCA 3CJTA 4L8GA 2Q5HA 1NM5A 1P1FA 2D5LA 3N2KB 5IKMA 4OP1A 4IIVA 2RAFA 3R7NA 4QLBA 1T0JB 3ELDA 3UB2A 3L49A 1NQWA 3IXMA 4Z4GA 4PFQA 2CWWA 1FFCA 1T2DA 2QI9C 1E1MA 3IVXA 4GC9A 3AUYA 4M8SA 3V48A 1N2EA 2VEOA 2XTAA 3F98A 3Q2OA 4IXWA 3UXMA 1W87A 3QVMA 1QAOA 2XNDD 2YYZA 3WLKX 5C81A 4PPYA 1HYBA 2O05A 3OO1A 4P22A 1PFQA 1M2GA 2C96A 4UXHA 4A1FA 4TZ0A 3FTNA 3ROFA 1FX0A 1WJGA 2C07A 2G7ZA 2J5BA 2PBRA 2QORA 4PONA 3M9LA 1TXGA 1ADCA 4JR2A 2E5WA 4E31A 3STXA 4CYMA 4WJLA 4O4HF 1E7SA 2PWBA 1WXXA 4EJMA 5CB0A 3TFOA 5AKLA 2G36A 2JARA 2V03A 4PNPA 2ON6A 3KETA 5JD3A 4FMDB 4ZOLB 4XGKA 5HJ7A 5KTPA 1DMSA 1JQJC 2OCPA 1Z2NX 3V34A 3Q3VA 2HDWA 3GJTA 3NEYA 1WB9A 2RB5A 3RVJA 4FR5A 4EG3A 4PIPA 5FTKA 2YXDA 1L8LA 3AZQA 2Z30A 1C7IA 5LYYA 2W6ID 3Q5DA 4P3OA 5C53B 3AKEA 2XLBA 1I5RA 1LBQA 1HKHA 5B3LA 2Z3ZA 1Z3IX 5H3LA 1ZN9A 3JQBA 1WMFA 4G1UC 5LZ7A 4F04A 4RK6A 3KV1A 2XDWA 4IQ0A 4X97A 3B9BA 3AIIA 1IONA 1WO8A 3TUZC 2E82A 2X7HA 1MORA 3F96A 4L50A 4W5RA 1EXNA 2YV1A 4L1KA 1FX0B 2JD2A 4NCKA 3EHDA 4UNNA 1D3AA 4J1TC 3U7EB 5EHIA 3RD5A 1S2LA 5B3JC 2H2HA 1FMLA 4AMVA 1PTJA 3ZV6A 3SSAA 1YU6A 2LIVA 3A3OA 1YBHA 4IHQA 3I9NA 4EPRA 3KZVA 1KK3A 4TMZA 5JEEA 2VCYA 1OLOA 1HPLA 4K9NA 1KYXA 4OU5A 3V97A 3HBAA 4ER5A 4Y2VA 3D3WB 3UTCA 2C9CA 4QXMA 4BZZA 1KZGB 5J5CA 2H00A 2VF7A 3ISVA 1VRWA 1WSAA 1S9DA 5SY4A 3Q0TA 4OAQA 4L8FA 1CTQA 3EGDA 2NO1A 2VBCA 2XD4A 3HFSA 3HHPA 5E7MA 3NM4A 4H3HB 5AVYA 3PU6A 1N4DA 4TWBA 1OZGA 1UP7A 4L8LA 4ZTZB 2VUHB 1T4GA 1RRVA 2GBLC 1EJ2A 3PQ4A 1BKSB 1RYZA 2MINB 2FY8A 3I6BA 1DJPA 1CQXA 2D1QA 3GEGA 2Y8EA 3GOHA 1BEEA 2BBOA 1QDLB 2W2TA 3LVQE 4EF5A 2ACWA 3F5SA 5LNK6 2ZI6A 3LHKA 3PCTA 1Y3CE 1ODKA 2A0WA 2CL0X 3D5QA 4HAVA 2GYVA 4JI5B 2FPIA 4DNQA 4FOOA 4Y6OA 3PWSA 5E3JA 3IOEA 1ECJA 2BFWA 1A9XA 1QV9A 4AYWA 2J07A 5CPBA 2JGJA 5A4JA 2YV4A 1FEZA 2D0DA 4Q7EA 4Q1AA 4G0UA 5BWOA 3Q1KA 1B43A 1NSYA 3O8BA 4N5HX 1ULAA 2V7VA 2AFHE 2VTEA 1SQ6A 3DV9A 2HU8A 3IOBA 3M0EA 1FA9A 5A3SA 4P7KA 3NNSA 4WK6A 3UOWA 3EGDB 2HO5A 3HXLA 3TAHA 1I4DD 5JMWA 3EF0A 4AURA 4RTKA 3A26A 3Q12A 5KSPA 4E2XA 3FVWA 1SCNE 3B5IA 3DSRA 1OWMA 5D3KA 2GJAA 5C1BA 1IBKB 4Z7JA 3WK7A 4Z4EA 5AK3A 4Q7MB 4BN4A 4DDUA 2CXNA 2GWHA 3E22A 4U2GA 3L7YA 3BE6A 3PD0A 1E79A 3UICA 3WWCA 4PTLA 5HMLA 3HV0A 3VPDA 3HVRA 1JQEA 3IKJA 3N7UA 3EZXA 1G5RA 2PL9A 1USWA 3GP3A 3KALA 2IIBA 2FPIB 3EVFA 3RC2A 3EB9A 1A9XB 1V5EA 2BRUA 2DSTA 4Q4CA 4AJJA 1FFGA 3N2NA 1S2NA 2FFRA 1YBAA 4JYCA 1GZVA 3DJFA 4C7KA 2YWXA 3P0RA 1RWBA 1L0BA 4CNQA 3H11A 4TTVA 1YZTA 2XMZA 2FPPB 4GYJA 4JJ6A 4R0NA 1I0ZA 1GT6A 2BGWA 4OQNA 5GZ6A 3IUMA 5I8WA 4IXTA 4YFYA 5ITZA 4ETWA 1FMTA 4DUPA 4OQ4A 4TV8F 4QGGA 4IZHA 2OXRA 2OLKA 2BFOA 4M9XA 4C89A 5M04A 2XB9A 3CRQA 5FWAA 2PQ6A 3H1PA 1WDWB 2VNKA 2V7EA 3VVBA 1ZNYA 3NJ8A 3VSEA 3FR7A 1TB4A 2LW7A 1UDRA 2GMWA 5FEMA 4AY3A 4N0EA 4KVAA 1K5PA 3E22B 4EFLA 3K53A 1K5DA 2F64A 2IF2A 3A6LA 4ZEVA 2YNMA 3GZNA 3H13A 4PF1A 4UVGA 3RWOA 1DARA 1I6LA 2Y1XA 5DHSA 4R1SA 4D9NA 4XYMA 1GIAA 3EIOA 3RJMA 2JLUA 5CCBA 4DLSA 5CVCA 3NATA 1E60A 1E0KA 2JH9A 3N7TA 1B00A 1F6BA 2IYVA 2PLWA 3EA4A 3PLNA 4HLQB 4OBBA 5FO1A 5BW5A 4YIHA 5JFTA 1V71A 5DSXA 2AYZA 3H11B 4LX8A 1BDBA 4UHJA 3CGGA 3NVMB 4AJ1A 1PLLA 3BMNA 1XLWA 1K08A 2IEAA 4OHRA 4F72A 4RV9A 5JYCA 1FZQA 3U3MA 1XPUA 1DAFA 2I67A 2FW0A 1SUSA 3EFBA 3KUUA 5I8ZA 4PE5B 1RWQA 3OQPA 3PEEA 1KSGA 1Z5GA 3K72B 3ZX5A 3OQOA 1KRWA 4V3BA 1PEDA 3SEFA 5TGTA 2C7QA 3OJEA 2HNKA 1QZUA 4OBEA 3ZD6A 1NHWA 2JCBA 4PRYA 4QE3A 2UDPA 1V25A 3SU8A 3GZNB 3AKCA 3R09A 2JHCA 3RDPA 1GGEA 2G6TA 1Z4KA 4RE6A 3G6KA 2AOUA 3DEHA 3L1VA 3TL3A 5CBKA 3D64A 2XYPA 4X71A 4DBLC 1KMMA 2QDXA 1AV7A 2ZTUA 3AF1A 3W0LB 5KJFA 2Q5OA 3CVOA 4DSOA 4FCCA 3OKPA 3RR2A 1J8VA 5EP1A 3IKVA 2ZIZA 4TLEA 1TU3A 2GB4A 4RPCA 1QGOA 4MV4A 2DTEA 2P62A 4QASA 5DX8A 2UZ1A 5CIQA 3PWKA 5C5IA 2HCRA 3TRHA 1VG1A 1NVGA 2QIPA 2CHQA 4I50F 5ECWA 2GXSA 1YAJA 5JXHA 2IW1A 4YBRA 3RVMA 3DS8A 4E0BA 1ZJYA 5DRTA 4A5SA 1GNLA 4TWJA 3CXUA 4YJ3F 3IMCA 1AOXA 3CEMA 4Q19A 5EMKA 3WGLA 2ISQA 5K4HA 4ID9A 3NRBA 2B30A 2HADA 2PT9A 3L0BA 1SVKA 1COWD 1DZIA 4OHPA 3DB1A 1SK9A 3ESZA 4O6VA 3MHPA 1BH2A 3PA8A 1G8MA 5TMDA 3V3TA 2BPOA 2EV9A 4FYJA 2A3RA 5IHPA 2C2YA 2V0GA 1RU3A 4JI0B 1D04A 3E2IA 3L8DA 1HV8A 1EVJA 2AOUB 4E5VA 1Q2XA 1ATZA 2J09A 2FP3A 1FVHA 3ED5A 4WJKB 5TRTA 2VC2B 2ONCA 3OPQA 3GLUA 4UM8B 3RIMA 4DLZA 1ESCA 3LHSA 4PCLA 5DNAA 3DDZX 4LRSB 3L4SO 1U7UA 2J08A 4JLJA 5C1DA 3K5PA 4ZVNA 4Q3EA 4Z7NB 4MV5A 1NVEA 2HREA 2UZ1B 2ZVPX 1PE0A 1TVKA 5JS8A 1QRDA 1QQ7A 3PQCA 4MA5A 2CNWA 2WU1A 3DLPX 1ZVMA 3P52A 1QOZA 4MUEA 1SXJE 2YC4C 5ES3A 5C46F 1C29B 1QG6A 1J56A 4O63O 2F00A 2EFCB 4ECEA 1PDWA 1OX5A 4Q7KA 1UBSB 5JUWA 2WJYA 2JI8A 2IYEA 3QUQA 2RD2A 4A6DA 4C0HA 3DLAA 1GEEA 1VJRA 3VZBA 1D9XA 2QF7A 3WGKA 1ARZA 2X13A 3ANMA 3UK7A 4ETMA 5JDIA 1GCOA 1Y82A 1W85A 4FI3F 4DKJA 3PNKA 3H2IA 2D5BA 4HO1X 5F4BA 1NASA 2PFSA 4BPRA 4IHJF 1TLTA 2YIDA 3I45A 3ASYA 3EMKA 4QPDA 5L40A 3FHTA 2GH1A 1CJTC 4N5LA 2XTJA 2XQFA 4R2KA 4D44A 5KSWB 4OGKA 1ZCZA 3D0RA 3F1KA 4X45A 3WJ2A 2UUAB 4HH0A 3EOAI 3UTDA 3EK2A 1WSWA 3AR6A 1TVKB 1FTNA 3EGWA 3WGOA 2HHLA 3DZGA 3WMEA 5GJWC 1S1MA 2G4VA 3CZ5A 2G4LA 2WKSA 5J2UB 5IABA 4MCIA 1JR3A 4LY0A 4HJXA 2YUTA 3FPFA 2C59A 4KQXA 5KNBA 4MHTA 1QH9A 4KSBA 4DANA 5FPKA 2AVNA 1EVEA 3N0TA 4FC7A 2YX1A 1E3LA 1GDDA 1WD7A 1Y9AA 4RDCA 3ZCVA 4W5TA 4X65B 2W48A 1VYVA 4CT5A 1W8IA 1KPHA 3RS4A 1V9SA 1E1YA 4I1RA 2REQB 4MQLA 3HPRA 5TQVA 3GPBA 1X0VA 3P45A 4QGAA 3BE8A 1D2EA 3S7TA 4BZPA 4C2TA 3D6TB 1B1CA 4ALIA 3H1GA 4OYYA 3K1AA 1W85B 2XB4A 3IR5A 4RWEA 4B83A 1IBLB 4X20B 2AEEA 2FZ4A 2I4RA 1RI4A 1Z2AA 1UJ2A 3AR9A 1DAKA 1HTWA 1QG0A 3PYXA 3OZRA 4HNRA 1AHIA 1CY6A 4U1RA 2VCHA 1FF9A 2JIQA 1NL3A 4D9BA 4LRUA 5F51A 3F4LA 3AIMA 4HS4A 2VJOA 1RP1A 2NW6A 3OKAA 4NZZA 1DOZA 2Q28A 4V2UA 4YMSA 3SXUA 3VR5H 8MHTA 5K3FA 1FJGB 1B0AA 1E9VA 1E9SA 2JFUA 3TOVA 3DT6A 3IDSA 4B3IA 3O95A 1RCFA 2PWPA 2BF7A 1K88A 1NBWB 4TVSA 1F7UA 1FNBA 2FOIA 3LTNC 1LK0A 4P3KA 3ORFA 1JTVA 2ZYUX 3EHEA 2CMDA 3IOCA 1T4CA 4R0VA 5GIOE 2EERA 4G5RA 1G3RA 3F0TA 2PZAA 3FF4A 5EQJB 2G1UA 3D7NA 4HLCA 4NPCA 1VKNA 2JJYA 3K5HA 1N32B 3TLGA 4B4WA 4QZVA 4F11A 1AKRA 1XZJA 2A59A 1L5SA 1TPYA 2OK8A 4A5OA 5FKJA 3EDRA 3K1AB 3O8DA 3BMCA 1VE3A 4WUTA 2Z2ZA 2B2NA 2Z5VA 4NPAA 1L4HA 1JNYA 5I45A 1JH9A 1JG2A 4KQ1A 4UZFA 3R7WB 5MF6A 3SNKA 2HB6A 3PHJA 5GVRA 1IN7A 1KDZA 1F1JA 5FRDA 3TZBA 5BYJA 4D92A 5LM3A 5LQCA 1Q16A 3KEMA 1JVBA 4UM9D 3HB1A 4Y9TA 1B93A 1QKKA 1GL9B 2OOSA 2ZCUA 3SXUB 4BLUA 5K3FB 1NA5A 4G3XA 1A5TA 2YCLA 1NN3A 2FKAA 3EWNA 4Q21A 4UFOA 2GS9A 3S55A 1JHMA 3C70A 4DCPA 1H5NA 5A9RA 2XQVA 4JT8A 4K9LA 5EIEA 2QMHA 2B9EA 2TMGA 1G1MA 4NFLA 4FB5A 3O4RA 1MN6A 1T4CB 4XR9A 2ZDGA 3RF7A 4X44A 3C48A 4KQ2A 1NWCA 2BFCB 1DAHA 3LKZA 3IEVA 3MQ2A 4QOHA 1NFFA 1TNDA 4AMBA 2I4OA 2QYSA 5HQTA 3T3HA 3ZWNA 1XTSA 2WIGA 1V7ZA 2QSJA 4OY3A 3CTMA 3Q88A 5GTDA 5LQMA 3B1VA 4TMKA 2Z2XA 3Q11A 1CJVC 1JN0A 3EGCA 4GPZA 5CLIA 1ZOOA 2NYRA 2V8OA 2P65A 3KL4A 5DX1A 5HIAA 4GKJB 2DFLA 4GDFA 1OZ0A 1CY2A 5A71A 2OORA 1TUGA 1NVWQ 1IOZA 1GKYA 3ZHBA 4L7QA 2C29D 4WH0A 5BWMA 1KFBB 3OF2A 4AP6A 1RBQA 4LVCA 4A6PA 2LNDA 1GTL1 4NBSA 3RAEC 2H63A 4PVCA 2CJFA 3EPRA 3KOWA 2OG1A 4HH4A 4NZ9A 1A9TA 4J0IA 4POAA 4TS3A 4Y2HA 5TF0A 4RPKA 1DBSA 1MXFA 2XTZA 2FPMA 4U7DA 1M2WA 2LCIA 3B78A 3CO5A 5AVSA 1BGVA 1SULA 3I05A 4FD2A 3H87A 5IMBA 4BAZA 1OFTA 2FSSA 3RVNA 1SRQA 3ENKA 3BG5A 3SLKA 3WRWA 4F5YA 1JIXA 5LZ8A 5IAKA 3TSOA 3HHEA 4WGGA 2NU9B 5FL7A 4OA8A 3C6YA 5AJTA 1QUEA 3JQCA 2QN6A 5CDSA 5AVRA 2C42A 1JFSA 2YZNA 3B9PA 4R7TA 4G81A 4D9HA 2ZQYA 5LR6A 4F12A 5DJ5A 2FWNA 4X1YA 2J9GA 4LWZA 3N8DA 2C83A 3SLGA 3SYLA 4DJ5X 1YR3A 3IEMA 1O77A 1INLA 3EIEA 4JLDA 2ALJA 1V5GA 2WOOA 4IUDS 1LH0A 1WEHA 4WOJA 2VPTA 2FR8C 2JKVA 4K3VA 3PT9A 1JEQA 5T8KC 3LFHA 4DG5A 2YWEA 3WBKA 3WA7A 4N54A 5ILOA 1JSXA 2ECKA 1UDBA 4F46A 1A3CA 1U8EA 1CU1A 1ZCBA 1PV2A 2REOA 1OIXA 4N40A 3VZDA 3OFND 5IUNC 1P4HA 3F78A 4ZQBA 3DE1X 1XDDA 2FMKA 4W7SA 2DQKA 2OZLA 3F9RA 4TTSA 3VVCA 4W7HA 4PZZA 5F2NA 4OKNA 3UBMA 3LF1A 1Z2EA 3LPAA 4U0KA 5GPBA 1VLMA 4DQDA 1IBMB 3HYNA 1U8ZA 3G17A 4OQMA 4ALNA 2Y9MB 3VYWA 1Z4NA 3COYA 5H4GA 5IRCD 3GC6A 3SKVA 1Z7YA 5ENVA 5FWNA 4PQEA 3BIJA 1NAIA 4OA5A 3OIGA 3SC4A 2OYRA 4JJ7A 4P31A 3HGQA 4MYRA 5CFNA 4OCZA 1U3DA 2CMKA 3R5JA 3RAPR 4WOCA 4ZD6A 4X92A 2B3DA 5EKSA 1EYZA 1VBFA 1CNMA 4J4HA 4MQEA 4OHUA 1LUAA 4WCFA 3THOA 2I4MA 2FSPA 4IMJB 4XUCA 1G8PA 2QJOA 3CUKA 5T7BA 3L7MA 4TKLA 2K2WA 1HOTA 2J30A 1WU7A 4R2IA 1KJQA 5AI9A 3CF0A 4D0LB 2RGDA 5FYDA 4AK9A 1BXZA 3FRHA 1QTQA 3EPHA 3HXTA 4BPBA 1CYDA 1E8NA 3CLSC 4BO8A 4N5IX 4Y7CA 1EINA 4JLNA 3TIVA 2Y71A 3ZIUA 4JYAB 1OFUA 1R0YA 3LC2O 3M5PA 4CMCA 4JUDX 1B41A 3FZEA 4YDRA 3RTCA 1GQ2A 1FTQA 2KYRA 1E2IA 4OGWA 4PLZA 4AG5A 5BWCA 3JZDA 1R0ZA 1WLSA 1DT5A 2JEZA 3L4BA 2L17A 3C5VA 2PGIA 3VSBA 3ZLJA 1QXSA 3THRA 2Y6UA 5L9AA 1NLYA 4BV2A 3H8WA 2P6UA 1G4HA 1UXGA 1ZOSA 1CVRA 2XOEA 2JZOA 3VZSA 2FW7A 9GPBA 1SCJA 2ATVA 4WCFB 4QUEA 4K6HA 3M6IA 5HZKA 3CNBA 3GJ3A 5D84A 3CKMA 4UTPA 4HEJA 4N7BA 1R6UA 3KOZA 3H1EA 4Z3DA 1MOZA 3F74A 4ZKDA 1CERA 4ROSA 2WT9A 1KMNA 2DX7A 3WP1B 6ADHA 1IJKA 4FSXA 2I2AA 4PEVA 4MI1A 1K7SN 1A4IA 2GM3A 2VKTA 3IOMA 3AG6A 4R8SA 4JBNA 1MDFA 1VCOA 3KVVA 4RFVA 5JXJA 2QTHA 3ZWMA 5K0TA 4QUBA 3WXMA 1SN7A 3IP7A 2FN4A 1UPUA 3DZ8A 4EI8A 4KLAA 1NZFA 5D8DA 3ROTA 4H6VA 4ZHQA 2B2CA 2QTVA 3RPEA 5LZ5A 1MW9X 4Q18A 4TXNA 4F9FA 3JQ6A 4D0RA 3VYVA 4FR0A 4KLNA 3BL6A 1L5HA 1DIHA 4BX9A 3TZHA 1Q11A 4NL4H 4B1FA 1K4YA 2SICE 3DOIA 3VJLA 3TVYA 3BX1A 5FUVA 1LPBB 4J03A 2V5UA 1GGMA 3HEBA 1ODTC 5GMOA 4AMYA 1KJIA 1MJHA 1TZBA 3BIFA 3UW1A 1EQ2A 4UPDA 5FH9A 5F64A 3VQTA 3SOPA 4EPYA 4YV0A 2PKYX 4Q93A 4TVKA 2V96A 4Z0HO 5J2TA 3T38A 1RR6A 5E1MA 4CJXA 1L8QA 2Q0HA 4DTIA 1CZRA 1DI0A 5BV7A 4C21A 4MZDA 1ZWKA 4JB0A 4FS3A 1UBMS 4N6NA 5C2JB 2IS4A 3H5TA 3OT5A 1G8KA 2V1XA 2IUTA 3JQ7A 3TZQA 3D2AA 1MB4A 2C0QA 1JU3A 2PKXA 3CLKA 1KU6A 3ZHSA 8OHMA 3P4UA 1N6LA 2WNHA 2HJVA 2DFVA 3QXCA 4ZHQB 2WWRA 2QTVB 1AXRA 4RF2A 4K03A 4ZRDA 4BMSA 3L7KA 4QBTA 4ZO6A 4EMTA 3FX2A 5JMPA 4TKMA 1EXVA 5T4HA 2XWSA 4EG7A 2Z8XA 3Q6NA 4J16A 1L5HB 4BBPA 4ZYLA 4YV2A 4BQQA 3RT7A 1FLVA 2KM1A 2GZMA 1TQ6A 4MUIA 2E5LB 4JBIA 1Y7IA 5AJZA 1A71A 3CIOA 4H7PA 3RC3A 3PFIA 4UM9B 1B2RA 2AE1A 2O0HA 1IWPB 1KC3A 3IJ5A 4RVDA 3DAYA 5F9HA 1U7ZA 3LW8A 4M98A 4G89A 4WESA 4WNIA 5J2TB 4NS1A 4N39A 1WZUA 3FKQA 1G3QA 4PVDA 3WV4A 3SQLA 3B3QA 1HT0A 2X0NA 3O0TA 4HQRA 4GLOA 2QLBA 5G4LA 3CWQA 3IAM6 4KB5A 1PGJA 3JQ7B 4DC1A 4M55A 2V6GA 4AZTA 2CXXA 1DIBA 4GP9A 5EE5B 1P2TA 3RSOA 3IKMB 3SC2B 3ZNPA 2HA5A 3Q85A 2NZWA 5ELLA 2P2NA 3HWSA 3FYTA 4Y9SA 1SCBA 4EY4A 5B2EA 4FDLA 2OC9A 3DXYA 1GPJA 3HXMA 4G1CA 1BKDR 1RAFA 1TM4E 2Y0CA 3H18A 1F0PA 3WLHA 3SYKA 3D59A 1Z74A 2IK8A 3RUCA 1G19A 4YWJA 2D59A 2XBUA 5TGZA 3MGCA 4B82A 3PYLA 2ISSD 5SY6A 1NTRA 2ZSDA 5C7LO 1U4OA 4P34A 1QYXA 1E1QD 3L8EA 3FLEA 2D74A 3OTHA 1WETA 3DCJA 4U3JA 3DWFA 2DQSA 3NANA 4GSLA 4QUKA 4UBJA 1B3RA 3U7JA 1RVDA 4R51A 4A3SA 4WESB 3OFNA 1ECBA 5CTJA 1ZU5A 2E4UA 2ZVQX 5J4HA 3ACCA 6AT1A 5C4MA 2NUAA 2QG6A 2O7SA 3OZWA 2QYHA 2P35A 3MM4A 4PBSA 1X19A 4WK0B 3AH8A 1PWZA 1T2VA 2DGDA 4J07A 4P35A 4A7PA 4LF4B 1QHFA 1XRRA 3JARA 1SJ9A 4YRZA 2IIVA 3R3WA 2IYPA 3KZ1E 2P3LA 4CFSA 2NAPA 1E7RA 3FWNA 1UBRS 3UJ9A 3GA7A 1UC5B 1UPFA 2IYUA 4LSMA 4EW1A 1YA8A 4EY3A 3CE6A 2IHNA 1I7LA 5IX8A 3VKHA 3PE3A 4KXWA 3DE5X 5JQGB 2WUWE 2P2DA 2QU8A 2AQHA 1OOEA 1TM5E 2QPLA 1Y3DE 3G23A 3MWYW 7GPBA 4P93A 4NC9A 3CXRA 4CV1A 1E3TA 4GOMD 1SZJG 3G0DA 4U3JB 2DULA 1DDIA 2N75A 3ILHA 3QVJA 2LCFA 2OVBA 1PT6A 2CC2A 2ZT8A 4MPPA 1MJGA 5IVDA 3AHFA 4HNTA 2AEFA 3INYA 3HXQA 1YQTA 3A2NA 3HU1A 1RLOA 1QAMA 1Y3HA 1BWQA 1T6NA 2UYQA 3WZLA 2NUAB 1G7RA 1FNMA 1KY5A 1KSJA 1N3BA 1NW3A 3GLHB 1K6MA 5CLHA 3W9YA 1ODJA 1BOFA 4QRIA 4BGVA 4EHJA 2WHYA 2M2IA 1EP2B 2RJOA 2PZKA 3E5HA 3ADKA 3QOYA 5EZ5A 3T0IA 1FE8A 3TX2A 1A9SA 2G70A 1DAIA 1FSFA 1O9HA 3JARB 1KQFA 3B2EA 5IDQA 2IEIA 1SU6A 3O8OA 5IPFA 4Q3CA 2P9BA 4J1SA 3KB1A 4IL5A 1EAYA 4PGAA 2NU8B 4B5KA 2QK4A 1RMTA 4J0FA 1UM9B 3SZMA 1VL8A 2ZBGA 1J22A 3AXSA 3UANA 2G72A 3F71A 3BILA 3LHFA 1QHEA 3BWCA 3G1TA 3KUKA 3DD5A 1BMTA 3VR6A 3AYZB 2UVPA 2P9JA 4PQFA 4DVGA 5JISA 3IKLA 4WXRA 1J0EA 4OAOA 4FUTA 1ONNA 1U7OA 3UJPA 3WKCA 4D82A 2RFLA 1HRKA 2QM0A 3SZGA 5A1JA 2BMEA 1TEVA 2D1TA 4Y1RA 2VP0A 3RJ5A 5CT5A 1U28A 4KN6A 1DKMA 4YR7A 2QRVA 2Y0EA 3DE2X 2FPLA 4W9RA 2VPXA 1YZFA 4HDSA 2VP9A 4C14A 1H22A 4JZKA 2IYAA 3EULA 3FCUB 4RMHA 4CMGA 2FX5A 3E3AA 5LVAA 4FU0A 4R8KA 3VI3B 5ICMA 3DFKA 2P1RA 1VB3A 1U02A 4XB6B 1J8MF 2AKAB 2HGSA 4LZZA 1T1IA 1UMDA 1F4LA 2A67A 4J90A 3UFBA 3MS4A 2P78A 1PLKA 4YDSA 1NMQA 3S2ZA 4MMXB 4GXQA 4HJRA 2AC4A 4UNSA 2Z56A 4R8LA 1HKUA 1YQQA 4MJXA 1KZ1A 1D0VA 4FZ3A 4FN5A 4QHSA 3PZRA 2BF4A 4PC6A 3MJSA 4RXUA 1B16A 2B8EA 3LYHA 4GOXA 3ZCRA 2NSYA 3FTCA 4UBOA 1R4MA 5DHTA 1KI3A 1XD2A 2UVPB 4RW0A 5L7TA 5KU7A 1Z2OX 3QE9Y 4P9NA 1ETHA 3LL7A 3KZKA 1XMQB 4YEDA 5FA6A 1VJ5A 2P4QA 3SMVA 2ENWA 2OGTA 1T0UA 4Y1RB 5EHGA 2Y0PA 2PKQO 4MR8A 4MKXA 5M2QA 1P39A 2G40A 2D06A 1C8BA 4HDSB 5HKBA 4ZAGA 2X40A 4R8RA 3MQFA 4DLYA 3QMPA 5K5EA 1L5WA 4IFBA 1XEWY 1WOMA 1IUPA 3W7AA 5I01A 1G16A 1JW9B 3HB0A 2QVGA 3OT1A 2BELA 2C9BA 2H57A 3QNUA 4MW1A 4BMNA 5JAIA 2ZUCA 1UMDB 4GYWA 4N41A 3MRVA 3B12A 3MB5A 1IJFA 3N75A 4JN6B 3GEEA 2XUPA 5HCIA 1UMCA 4N0PA 4B7AA 5HBRA 3H1AA 4CV0A 2HUPA 1GCAA 4CKXA 2JIMA 3HADA 3DKIA 1LLUA 1T2UA 1TJNA 1WB5A 4K6FA 1DC6A 3RIYA 5A03A 1BE8A 3CEPB 1KYVA 1JVNA 3ZZ0A 2I71A 1XRPA 3ACBA 4MAFA 1A4RA 4DMLA 2QAJA 3CMCO 1XD2B 3GUUA 1W4CA 4Q1FA 1MC1A 5ALXA 5H0IA 1II9A 5F2KA 3EBPA 3HO1A 2E55A 2X76A 2KMLA 3RT9A 1ZYUA 4OB7A 1V3QE 4D74A 2AG1A 1KDRA 1EFDN 1XP8A 2YY6A 1N5JA 3MINA 1L9KA 3ME5A 1UJ6A 3OAAA 4JEMA 1HDEA 1ZM4A 3RHSA 4DMMA 3FZQA 2CLIB 2X2FA 5CYFA 4K40A 3V32A 2VF8A 2R84A 3RVBA 1T13A 4TL9A 1N2XA 5I7SA 1XZHA 4BFUA 2R5WA 4JBXA 3BDAA 1CZLA 1JU9A 5TXGA 4JBYA 4Z99A 3OT1B 5DCLA 1HDXA 3BDVA 4YLYA 4KHPB 3ZJTA 2B1QA 4YYZA 2JCVA 1Z56C 3MGBA 4G25A 1DXOA 1X7HA 1UMCB 3LUJA 2PGOA 2PDAA 5CIYA 2PBFA 4QXOA 1L7XA 1QYRA 3AVQA 2D62A 2ZATA 4CKCB 1D7AA 1XVTA 2VT7A 5KYNA 2QRMA 3DMFA 3GVIA 3IDOA 3KKOA 4AF6A 1U2RA 5AXCA 4FGJA 2EZ4A 2I7XA 4DSUA 4EI2A 3LOUA 5EUCA 3PUVA 2Y77A 4W5NA 1XZKA 3ODPA 4LJAA 3VH2A 4N9WA 4L8YA 2GEFA 4HXGA 2HU5A 2JI4A 3ICWA 4F71A 2WKQA 3HN6A 5HM8A 1YZVA 1CX9B 1JDSA 4KUHA 2ONKA 5IWAB 3X0DA 4Q1CA 3HKEA 1RBZA 2AWOA 3HJRA 3MINB 5JOQA 2A6PA 3E58A 3ILVA 4A91A 3IMEA 2HJHA 2EW2A 2VAXA 3C3YA 2G5PA 3O3CA 3TW8A 3QY0A 5BQXA 1JSRA 1F14A 4BASA 2D5AA 3OPVA 3FAKA 3TFWA 3WSTA 4MRVA 5ESDA 2CVFA 1J49A 3Q7QA 4PSAA 2C94A 1OILA 1JF8A 2R1TA 1PGQA 3KJEA 2I78A 3EFHA 1E5DA 1D1QA 1Y5LA 4FYWA 4TRRA 4B79A 1G98A 1I9CA 2KQUA 1UQTA 3IPAA 1F6DA 4YV1A 2CV2A 3HR8A 2P6OA 5EJ2A 1KF0A 2FMIA 1IHUA 5TMEA 3LUKA 4LHZA 2E4AA 4FEGA 1KQ3A 3RTAA 2H1CA 2I6FA 3HTXA 1P3Y1 3PNBA 1DLJA 1LY1A 4L02A 4B3SB 2AD5A 1K8YB 9MHTA 4HR7A 3U31A 1J9GA 5EWLB 5I3CA 3CGWA 1GAEO 1X7GA 4DC0A 2XMCA 4WZ6A 1YOBA 2LD4A 3PEWA 1SXPA 2QX9A 4ZKEA 1Q0HA 2OG2A 5AK5A 1EP1B 3ZDDA 4LBWA 2V9CA 2MWMA 1E1LA 4EA7A 3TW8B 4C9BA 1R9JA 1SUFA 2IDKA 2HQOA 5E6RA 5JFGA 2YN2A 3R6GA 5K8UA 1JAZA 2HGZA 2R1TB 3HSKA 1H6CA 3NHWA 1H2HA 4KXNA 4MHSA 4EVIA 1MX3A 1GADO 1P80A 4KBYA 2QBYA 4CMAA 1GPMA 3BWMA 1Q7GA 1R8QA 4NE7A 1A8IA 3WLNA 1RW4A 4YGXB 2Q7OE 5DU2A 3KKQA 2WJJA 1GPWB 3W3AA 4QXAA 1NUQA 1E2FA 2XDQA 3NIFB 4HH3C 5EWJA 4BFSA 1A8PA 2OHOA 3L06A 1T36A 4KH1A 1BXKA 2J9XB 2Z4RA 5AVUA 2WILA 1XEAA 1T2NA 2PL1A 3D7KA 3QBDA 1T8PA 3BMQA 3GLGE 3FGOA 3TYXA 3SFTA 3OIWA 4PC2A 1QU2A 1E99A 5JARA 3AI3A 5H82A 2A3NA 4C5BA 3NHJA 3PEVA 1VMEA 3B2NA 3TGWA 4RULA 2VL7A 4NOLA 2DH6A 1XTBA 4D26A 3COSA 5K0NA 2WUFA 3NOXA 4X7PA 1AC5A 5E6RB 5IULC 1Z75A 3X1DA 5EYPA 1RYNA 2DT5A 4F56A 1MGOA 3T94A 1SCDA 2AI3A 2GFQA 2QBYB 2X1HA 3KD2A 4LFBB 1VSTA 2Y1GA 1XSEA 2D2VA 4B73A 4BNKA 5BYKA 1YCFA 5IAOA 3OU6A 5L6LB 1DGQA 4WAUA 1EFKA 4WFKA 3W1WA 4LN1A 2GCEA 3IUBA 2H1SA 5HG0A 1GUYA 5EWJB 4RKYA 2WHPA 2YJNA 5CITA 2ZBRA 1T36B 5EJ7A 3E9YA 3DTVD 1MGPA 3K92A 4G9GA 4C3ZA 4E51A 4HX9A 2IX3A 1AZTA 1UWKA 3BB1A 4J0KA 2YFYA 3BMQB 3L7BA 4I6JA 4MPTA 4I1IA 4CDNA 4MKRA 1SU8A 2X3FA 1UCFA 3AOGA 5JRZA 4IDQA 2VAPA 3NUZA 5ALGA 1Q12A 4M1EA 4A0FA 3C45A 3KD3A 2CUTA 5K51A 4BFWA 1DJOA 2WYUA 3E7XA 3VO1A 3C6ZA 521PA 4UCFA 1GP2A 2GHTA 3FCCA 1CY1A 3FI9A 4PZAA 5E1BA 3L41A 2XYQA 3RBZA 3KQUA 4BB0A 2ZVDA 3AHEA 2WMYA 4PTZA 3E9NA 3UAVA 5JECA 1DB3A 1NKSA 4RQAA 2B83A 1ENZA 1ZKMA 1EEXB 3AX6A 4R3UC 3T1QA 3CR7A 5IZCC 1QZTA 4M88A 3HCPA 4C0KA 1AV6A 2ZUEA 4BJ1A 2BHTA 2HBRA 3K15A 1JDBB 2QXYA 1XCMA 2XUZA 2Y68A 2ZYTX 3F2IA 3OCZA 2WMNB 4K6KA 4PIVA 4R9VA 1U7DA 5FWXA 3U5TA 1MT3A 1TOAA 4IXDA 1CV2A 4EW6A 2QM3A 1JH8A 2IOFK 3OLQA 4DV3B 1E9AA 3I72A 1LPSA 4BQSA 4I66A 2C0CA 1IY0A 1SCQA 2WWTA 3C5CA 3F2VA 3MOSA 4BQEA 1BHO1 1R66A 4NKRA 1LC0A 2NTVA 9LDTA 4IH9A 2VN8A 5EPEA 2FFJA 5BNFA 4K87A 3SFZA 2K5UA 1GCGA 2FUNB 3L1JA 4KQGA 2IUUA 3RU3A 3C3BA 3GNTA 3ZHQA 3T1YB 1GYPA 2MSEB 1E1RD 2ODBA 4IM7A 3V9PA 4Z7OB 2GWRA 1QLHA 3FPCA 4MCAA 2ET6A 5F9MA 3QEAZ 1W7AA 2XZTA 4CQNA 1EA7A 3AVOA 1PJ8A 3CG0A 3QV2A 4RK7A 3UJ3X 3BVPA 3I12A 1M3SA 2KPOA 3GZJA 1NM5C 1A5SB 4OJQA 7ABPA 4RY0A 4POOA 1OH7A 1EPUA 3V6MA 4J43A 4B4UA 1XKXA 4JVSB 4P98A 1Q3TA 1GQQA 4A8PA 5G41A 5K4AA 3LZCA 4MWSA 5G02A 2IYWA 1XA3A 3LQ4A 5K0EA 4CM5A 5G53C 1TIBA 5D51S 2H9IA 4XSVA 3EZYA 1V1MB 5LOVF 3DJYA 3X2FA 2JIPA 5LKAA 2ZJ2A 4DE5A 5HJ5A 3HZRA 1JBKA 4DHEA 4YIKA 4KMSA 3EXIA 4WVFA 2Z0MA 4IDDA 3STWA 1PFGA 1X87A 1VBNA 1P1JA 4W5QA 1U1EA 1VJDA 1CEEA 2FYTA 1SEVA 2ZJ7A 5G0TA 1XJ0A 4I81A 3KSUA 1MP0A 3FRJA 3G8DA 1V43A 3I83A 3RLFA 4XGQA 2C4NA 3HO8A 3WBBA 4EPTA 4JC0A 3BXZA 3B3FA 3U1BA 1XG5A 2HQSA 1R4AA 3GJ8A 1RWWA 3C5WP 1W88A 3MT7A 3ZTYA 4EKGA 3TF5A 4I9FA 3KO8A 4DEYA 4ENPA 4BO9A 5AM2A 2ZI9A 1E77A 2C7VA 4OLJA 5C7OO 1H1LB 1YL6A 2GKOA 4ND3A 1P17A 2GK3A 3KZMA 5ALKA 4WBNF 1K6XA 3I6YA 2ZRHA 5T5QA 2YZMA 5CB8A 2WB2A 1SBHA 4TMFA 2DG2A 4C2AA 3KFLA 3DE3X 3D4LA 1KIAA 4C4OA 2ZIFA 3L4KA 1H2XA 3WNQA 4MQ5A 2AMYA 4AQ7A 5C8XA 2DUWA 2FPKA 2MIIA 2FPSA 5KNCD 3UPUA 3E2MA 4JFRA 5D3ZA 1PTJC 1I13A 2IXBA 2QRPA 3EXIB 3JR3A 4FEYA 4O4LF 1WVIA 2DU8A 3AR8A 721PA 1RXIA 1LPOA 1A82A 2DKOA 3IUEA 1Z26A 2PKEA 3SICE 5FBHA 1V7PC 1I4WA 1AKWA 1HWYA 2QVBA 3TZEA 1G5QA 3JWPA 3BORA 1PR3A 3ZU4A 4LFCB 3PBKA 4DLLA 3EFEA 2GJSA 1JIUA 3ET4A 3HEAA 2G9ZA 4FD3A 3JD1A 3KU4A 3L2OB 1JKXA 2PX6A 3CZPA 4ZVUA 5T6MA 3HU5A 3V8BA 1EESA 4LDRA 2N1BA 4KXFB 4TYQA 2JJMA 2MR5A 2AZTA 4DQXA 2X0EA 3ZD7A 3ZXSA 4L4XA 3J7AC 1P7WA 1FTSA 4A6EA 1P1BA 3SIPA 1E8MA 1Z08A 4GIBA 1T3ZA 2BI7A 3VO8A 2JG3A 3DEYX 3QG5A 2Y66A 1A98A 1H2AS 2WD7A 2X86A 4IDEA 2WWIA 3OETA 3P2MA 4L07A 3GZ4A 3M81A 5T4BA 3MOGA 4WSOA 2CCJA 1U1DA 2PLNA 8GPBA 4HH1A 2H5EA 1L7BA 5FBLB 3UUFA 2YHIA 4TXJA 2DQYA 2OV1A 4Y8VA 4P3XA 1ZC4A 3HB5X 4IJWA 1Z0IA 2OILA 2R6DA 5KYGA 1T9KA 1YRYE 3ZVLA 5I48A 4EAAA 2MSKA 1NG9A 2IYNA 3DC7A 2O07A 4MNTA 2OB1A 2XHZA 5SYNA 3ITNA 3LFUA 3E84A 5AOCA 2JDID 2ZGVA 3NV7A 3VBCA 3EVGA 4BNJA 1DIRA 1M1YE 4HQOA 2EGHA 1EVLA 1MOSA 1PZGA 1SUAA 1W4RA 3DZKA 3JWHA 3ZV3A 4CT4B 2D00A 3R41A 5F76A 1KY3A 2WJ3A 4H1WA 2OYSA 3HDHA 3BMOB 5IMSA 2BTOA 2RKBA 3GPDG 3T5MA 1L4BA 3BEOA 3K8OE 3W2EA 1NNEA 4XIYA 2ZREA 3QKRA 1GL6A 4JGGA 5D5HA 2Z1DA 1W2WB 4FBGA 1K5GA 2WD7B 1Q5PA 5ECGC 1MEJA 5JZOA 2JIRA 1I3KA 2J5QA 3B1KA 4MRMA 1IPFA 4PBRA 1JHQA 2PNFA 4DPKA 4PWZA 2C84A 2O59A 2XNSA 4MV3A 4JU8A 1RYHA 3II6X 5D3MA 2YHIB 2BRUC 3TRFA 4C5CA 1C80A 5E6UA 1B73A 2GAAA 4KBFA 4G24A 4O1HA 5L3RA 4B85A 1G38A 1L5GB 2ZTSA 5A9TA 4MW6A 3R7AA 4C4SA 3F7MA 1TADA 5D7NA 1PZXA 4LFAB 2C8KA 2X8WA 4IDNA 5ALMA 1KO4A 3AFHA 3EY9A 3H9BA 3HJHA 4IW3B 4H35A 3B2QA 5E3IA 5C8YA 4F6CA 4F7DA 2CLSA 3HM9A 1U81A 1W2HA 1GLNA 2NT3A 3WQHA 2MU1A 2H1FA 4MS3A 4XYEA 1CUZA 1XZDA 3TKLA 4YAOA 1VPWA 1EDDA 1XB2A 4MYHA 1J25A 2XRZA 2C92A 2M6SA 1XL0A 1Q0ZA 2CFIA 2YWJA 5IJ0B 4NK5A 3MQ4A 3QKRB 1EDBA 3TQCA 3AYXB 1E6WA 5D6OA 3VUFA 1DIAA 1VI2A 2EEZA 2Y4NA 1CC1S 1W0JD 2ZLBA 2YNMC 3DFMA 3H5NA 1Z45A 3VA7A 3QTBA 5GJCA 3Q9UA 4MRMB 3VAAA 5KYUA 3AHJA 2ZRPA 4JA2A 5ALPA 3N0RA 3S0JA 2NYUA 2CBGA 1WG8A 1ECLA 1WUIS 1XTVA 4LXGA 5D3MB 5HQJA 4DMUB 1YZLA 3GCZA 1TE2A 4UUOA 1M1XB 4RC9A 5ALEA 5E6UB 1PP4A 1E1RA 3K2BA 5AHOA 1XDUA 5B55A 3FMVA 4ZFNA 1HFKA 3HDVA 5KYTA 3QPCA 3H97A 3VOAA 3UJCA 5CTAA 5ERYA 3ZNNA 2W6QA 1UK6A 2D4HA 4D8TA 1QORA 1QIKA 2O2XA 3PB3A 4MW5A 5KOJA 1E7WA 4UHFA 1LPMA 3TLXA 4LIPD 3PNVA 5LUBA 3EWSA 1WKBA 3KZXA 3LVRE 1X8JA 3GLFA 1VSUA 4M1SA 1IXZA 2P2LA 1FLDA 3ESBA 4HYTA 5M7EA 3GN2A 4XDHA 1G8GA 1ZN7A 1K1EA 1RE0A 1V2HE 1YQ9A 3C8DA 3D5EA 3I1FA 3NU1A 2FQYA 2WJ6A 4IRUB 4ONEA 4WK4B 5AVZA 1YE3A 4U4AA 5KYUB 2XXAA 1QR6A 2C2XA 3QBTA 2H8GA 2EHJA 3HE3A 3IESA 4J6FA 2A0XA 1MJ5A 4JEHA 1UBCA 4GGOA 4E33A 2GERA 3MTBA 4BMZA 4URZR 4EFMA 2ZJ8A 1K2WA 4NV1A 3RRFA 4BLSA 1R6TA 2JD1A 1ZGBA 4IILA 2J7PD 2FG6C 3HCCA 3D3QA 3IVRA 3VX4A 1DELA 2Q1XA 3CY6A 2QN7A 3JZAA 3M1LA 4WZZA 4DILA 4DRXA 3N05A 1SBZA 2VHQA 1NYQA 3C6XA 4EJ6A 1MVLA 4RSRA 1E9RA 2EDCA 4UE3S 1NSTA 3DE4X 4EO9A 1NONA 5KOJB 3GFOA 3PNYA 4P8RA 3D8NA 3WDKA 4UQLA 4PO9A 2QAGA 2NO0A 1TO2E 1HQDA 5JZSA 2H5LA 1KZ9A 4LJKA 1NXOA 2KLHA 3A6FA 3BERA 4BKQA 3GLFB 3ZNQA 4G97A 4PN7A 1GAXA 1C7EA 3RKSA 4U2KA 5CFPA 2BM9A 2CJPA 4IUCS 5JALA 1KYWA 4I4TF 1PDOA 4FMCB 2FEOA 2JGFA 3FNHA 3NKLA 4LEIA 5CNKA 3E4DA 5K3DA 3SBEA 3UH1A 3X2SA 4BYGA 1JYSA 1ZOIA 3ESDA 1O6GA 2AQIA 1UJNA 1I2BA 5AWFC 5KNCA 1JP7A 1MCZA 1ZIXA 2JFPA 2NM0A 3T3MB 4DB4A 4B35A 4X7MA 4JJ4A 3A06A 1E66A 1NUTA 4RHFA 5JXWA 1SCKA 5L95A 1QH0A 4ZAYA 2FHPA 2IVFA 1PNOA 5I4IA 5FPYA 2IPMA 1XT6A 3I2HA 4ZN6A 1UF9A 1KSHA 1B7GO 3M34A 5B1HA 4KXQA 4E08A 3MT8A 5HPYB 2PXXA 4YY3B 5KNDH 4DWJA 3QVGA 1U0RA 1OH6A 2J1LA 2ZROA 5MGNA 1U2TA 2LUOA 2J46A 2OHVA 3PFCA 3HRHA 2VOJA 4I1UA 4UFNA 4XOUA 5FTMA 4C78A 5FUMA 2WWYA 3MERA 3F3YA 4V2IA 4ENRA 5C5CA 1E3SA 3A2KA 7MHTA 4L9AA 1EAMA 1OI3A 2ZR0A 3FCEA 4TSRA 5IF9A 2QAGB 3ICCA 3ORQA 2CXPA 4M0PA 1C50A 2P2YA 2Q3EA 3FD8A 2AZMA 1N5IA 5BWLA 4CTNA 3ONDA 3DG9A 1S2IA 1Z4QA 3EXEB 3W6UA 4Q03A 3BMXA 3I28A 1PIWA 4JMLA 5DMHA 3TR0A 3H9QA 1AKYA 4F93B 4QQRA 2Z95A 1E6KA 1LLFA 4CCYA 4CUJA 4LK2A 5JDIC 1HSOA 4N5MA 1ZK4A 3P5SA 4YMUA 3ZVMA 3DBRB 1ORHA 3SJCA 5TJHA 3KXLA 3PQ7A 4E4TA 1XAIA 5AJVB 3CC8A 4ZO4A 3WGMA 4GKAA 1ZINA 4QGFA 1KJYA 3W7VA 1VBMA 4JUCA 3S1AA 1Q17A 2WTXA 2PBZA 2BMDA 2ZIEA 1OA0A 2FLVA 3QVGB 1JB9A 4MVJD 5DK6A 1X2EA 3H9CA 3RRYA 4RKEA 3RO7A 5EIAA 2OCGA 1N1EA 1VCNA 3FDFA 2P75A 3X44A 5JMTA 5D7BA 3HBLA 1GOTA 5L4SA 1UQRA 2AI1A 1LQUA 2FWPA 4AIRA 3Q41A 4QJBA 4XI9A 2INGX 3DZHA 5BOSB 3ZH9B 1TRKA 3FOWA 4MK4A 3WWZA 4JA0A 3AF4A 3EOZA 4LRTB 5TMBA 3V1MA 3NKVA 3R7DA 1G3UA 1TCCA 1YWGO 3FVQA 2UU9B 1ZGCA 2Q4EA 3CUYA 3UHJA 3FSJX 3RSHA 5CFZA 1G8YA 3DHYA 5BSKA 4OOFA 3SX0A 2X1MA 3VH3A 3ZQUA 4CMEA 3O8QA 4ZJPA 4TYPA 3VUEA 4S05A 4O4JF 4TSKA 2A8YA 5GOTA 2GCNA 2QRJA 2SKDA 1E4OA 1FNSA 4NG4A 3DR5A 1EE1A 1OI4A 1RC1A 1WD5A 4KQEA 4KNVA 4MYDA 1MQSA 3S1AB 2EWMA 2Z98A 3PJEA 5CK4A 3K2QA 4GNKA 1KVTA 4EQ6A 3O2NA 1T0BA 2I9KA 1KVSA 2DKNA 3GH1A 1GPUA 4NYIR 4TLCA 5L8VA 2WQ6A 2BV3A 3BCHA 4BMYA 2DH5A 2RARA 2AXNA 2WPNA 4EBBA 2OWDA 2BEUA 2E6KA 2Q4OA 4L22A 1M8JA 4AYXA 4QJ4A 1YB2A 1ZH2A 4EDFA 3UQZA 2K2QB 5KINB 2H51A 3DNMA 1KQGA 3G1UA 3TS1A 5CXUA 3H04A 2WU3A 3FNGA 1W0JA 1YNSA 4NK4A 2AJLI 5EHNA 1XJQA 3UMGA 4DM3A 1P5ZB 4EYGA 3CUEF 1S3GA 1TKAA 1OHHD 3LWNA 3O8QB 1SG6A 3ZE8A 2JLRA 3HYRA 2IHKA 4BNVA 3V2IA 4LJYA 4NJOA 3KSZO 5ALDA 1IDN1 2R1UA 5CJJA 3PL5A 3DPSA 3GRCA 1F06A 1P74A 4J9UE 4M0MA 3G88A 4WWHA 4AZ3A 2SECE 1LSJA 1O89A 2AJ8A 2QIOA 3HKDA 3HMQA 3NCHA 2Y67A 4K1XA 4MKIA 5DHUA 3SAJA 4FGSA 1C8LA 3EQ6A 4G5FA 4AJ9A 3B8HA 1MA0A 1VG8A 4MGEA 1NV8A 1QE3A 2HOQA 2X3YA 4EQ6B 4RPLA 3ZJUA 1FYDA 4GICA 2BFFB 1AX9A 1PZFA 5BMVA 2GZRA 3SOZA 4JI7B 1RI5A 1MX5A 3IT0A 2AJBA 3QHQA 4KQCA 2ZUWA 4QL3A 5K0ZA 3NDIA 2OV4A 3EWIA 4IAOA 5GONF 3S4YA 4C2BA 5E2IA 5CT6A 2D13A 4REQB 1VSBA 1VKHA 3UEOA 3L1HA 4BRWA 2LPMA 5LA6F 1GZUA 3OC6A 2OAP1 2BR5A 1TQ4A 1U2QA 2Q4TA 3WTCA 2YMPA 5LNK1 1TZMA 2QA5A 2ZTHA 2ZIGA 2QX8A 3BIXA 5JHGB 1L4EA 3IO3A 2W70A 3H0CA 1S0UA 4MI9A 3D4BA 2EXXA 5CB4A 1U2ZA 5J1TB 3OBIA 5HKLA 3H6GA 3L8ZA 2QMYA 1I9GA 2OORC 1O95D 3KKMA 5CHEA 2D5IA 3W6NA 1QR2A 3CH5A 4AZ3B 4D9IA 2CL5A 2J7PA 2V6BA 3HKDB 3MMXA 4CIYA 1PL7A 5CVVA 3OT4A 5K99A 2XZLA 1SOMA 2EWWA 3M9XA 3V42A 4JC8A 3VRHA 4DKXA 4C4TA 1XQ1A 1O97D 2XQIA 4D9FA 4Y6RA 3LWBA 4U0JA 3P1JA 3RRNA 1V26A 5EA2A 3UJ7A 3GQBA 3S28A 3VPCA 4CG3A 5BMVB 5KX5F 3OQBA 3CW8X 3ZDEA 2J5KA 2B9VA 5HKKA 3H83A 1PG2A 2VF4X 2Y1LA 4BCDA 4ZIRA 2MSWA 1P60A 4L95C 1ENPA 3L8CA 4PC3A 4YREA 3GF4A 4MUBA 1F8YA 5EE9A 4CLRB 3GAZA 1FSPA 1W581 5YASA 4TX1A 1IATA 2QZ4A 4BKMA 1L2TA 4TM8A 3FHJA 3I8SA 4OLHA 4G07A 3ZVRA 2YV3A 3F6BX 1U0OC 2Z1MA 1P72A 4QUHA 2CLCX 4ZOQI 2Q4RA 3C15C 3PNSA 4OHWA 4KR7A 1T2AA 4BIMA 1GO2A 4EEKA 1SUWA 3QX7A 3S5UA 1BAPA 3KSMA 2YZ7A 4HRYA 3ULKA 1Q3KA 3RS9A 2OR3A 5DASA 1WDMA 2DRIA 1O9GA 5HK9A 1EJ6A 2VZLA 2EL7A 5FFFA 3FETA 1MABB 2VI5A 4CTKA 1YMQA 1BVHA 2P0YA 4IUBS 1KJZA 1RQLA 3MXOA 4WNCA 3F4BA 5B1IA 2G5TA 3GQBB 4BJ3A 3FMFA 1S6YA 5JY1A 4CUKA 2BJWA 3DDCA 3KNZA 3L1UA 4KFRA 5EIXA 2LKCA 2NTYC 1U0HC 2BE9A 4FFLA 5ARCA 4ZDWA 4TQGA 4ZIRB 3NHAA 2B0CA 3G5MA 4KLRA 1G5IA 1WNTA 5CRIA 1R5NA 1FP4A 4FFWA 2AZXA 3ZU2A 2VAMA 3S8MA 1PW7A 3EDOA 5KREA 3VU9A 4QVKA 1EWYA 2FH5B 2ID8A 3TCXB 2QU7A 4C22A 5C7YA 4RTQA 1WXQA 5DHPA 1J0AA 2Z9DA 4LBYA 3ND6A 5DO9A 3IVAA 1OBCA 2C5FA 2YWHA 3R3VA 3CN7A 4AO7A 3KPYA 4XE5A 1BVRA 1ZA2A 2A0YA 2GF9A 3TD6A 1SEPA 3B36A 5I4KA 5CIWA 5L51A 4KE8A 4U7HA 4WCFC 3GO4A 3JVVA 4Q24A 3RQIA 1PX0A 2R4UA 4MYSA 2IOQA 1SCAA 3QYFA 4JIGA 1N0UA 4G4JA 1T2FA 1QV6A 4YCAA 4CNBA 1FW6A 4MVJA 4YRLA 3GRZA 3EZLA 3U19A 4LJLA 3GARA 2EARA 5HOEA 2OB2A 1MKYA 5JNRA 2AN1A 4RXTA 3GUZA 2DXIA 1J2RA 1NBEA 4WKGA 2VRNA 1Q20A 3KYJB 5CNIA 4I7EA 1XZPA 1ZD9A 3WP0A 1Y4UA 5KAMA 3DLTA 3KX2A 2PZMA 4RSGA 1E2UA 1Y5NA 1R2QA 5EJGA 1FP4B 5EXXA 3ZJYA 4DQKA 5LU9A 3CVUA 3PFBA 4GPAA 3JWGA 5P8WA 3HVUA 3T9CA 4IKEA 3F47A 3V9AA 4LA4A 2VQEB 1TU4A 3AU9A 2WZBA 2DY1A 4A03A 4M9ZA 1EWTA 1RXCA 4UBIA 2IWRA 4OXNA 3MJEA 4JVMA 1D2HA 2ZYRA 1C0LA 4CIXA 3EC7A 1XNRB 3QA9A 1R18A 1DUVG 3RBVA 4BVAA 4NEGA 1R0KA 1X1RA 2WTMA 5FTJA 3VVMA 3ZLVA 1KFJB 1XKQA 2AOWA 3CINA 5D00A 2EZTA 3CRW1 2WICA 2FI1A 1SQFA 2ZB7A 4S35A 1LLDA 1KDVA 2J0UA 4MH0R 1W0CA 2YYYA 2GFHA 1NQAO 2O20A 3RVPA 4HX2A 3I37X 3QPUA 5EIBD 4DIFA 4MGKR 4KXLA 1W5FA 1KOJA 3SJZA 4R71A 1SG0A 5FWYA 1FL9A 3G3EA 5ECDA 4TZ6A 2JFHA 2VDQB 1H3FA 3G79A 4FMBB 4WERA 1MAAA 3QEBZ 1DFHA 4NCHA 1EJBA 4BXOB 1XF1A 1LTKA 3SM3A 3PWZA 3RC1A 3SN6A 3WRYA 3D3KA 3O1HB 1B8OA 1CJUC 1LNSA 1Z88A 2DMRA 1CZNA 2ZS9A 3NONA 3RSCA 2AN9A 2J0SA 3RKRA 4KYUA 5DEOA 3I6MA 4FSHA 2XX3A 1OXBB 3UA4A 2ZAIA 2YZ2A 3L43A 3P9NA 3D31A 4FT2A 4HPWA 2PQMA 3QPDA 5FCDA 2BI8A 3CVVA 5B7NA 1ACJA 1WCIA 1P77A 4BQIA 1N34B 5I6DA 3KKZA 4CVNA 4ALLA 2GZHA 5F33A 1MENA 3HFRA 2PNJA 5C32A 4ZOAA 1GU7A 4MVJI 1RQNA 4QAJA 1G5HA 3C39A 1PUIA 3LNTA 4L27A 1IPEA 5EZYA 5CD1A 2QL5A 5H59A 3PEYA 2J0UB 3I42A 1AQ6A 2O8FA 5F2OA 2UZIR 3IURA 2HO4A 3NT4A 4YA6A 4C0WA 2JH8A 4YBZA 1F9EA 5FWYB 4KO8A 4L5JA 1X7YA 3VZPA 3FLMA 1N2CE 1Z37A 5TJ9A 1VA4A 3NHZA 1XNQB 1RM3A 3RYTC 1Z5WA 1G7CA 1Z4JA 3JASA 4PQRA 2Q2QA 3TLMA 4MV0A 2IQIA 2R6CA 3QKWA 2PX2A 2F43A 4E1VA 4EQZA 3L0CA 5E8JA 4NYJR 2PMEA 3RTBA 1CJCA 3GDWA 1EM8A 1TT7A 2HBZA 3BGVA 5DM0A 2HIHA 1BSVA 1LDGA 1OTYA 1UQUA 2CXRA 4J16C 4CDGA 2ZI5A 3KDPA 4HYEA 2XADA 5AKKA 4UTXA 3WE7A 1AMOA 1C3LA 1WCIB 4FT4A 5AW0A 5IJ9B 1O95A 1LTHR 2PGNA 4OXQA 3U9SA 1Q44A 3USCS 2AMVA 4TKVA 4MWOA 2QQGA 4QXRA 5EZYB 3PUIA 4GNRA 5CLJA 5LYJA 3NNDA 3C5HA 5CG1A 1SOAA 1Z4LA 5TS3A 2O8FB 1YZKA 2QP9X 4KWIA 1GPDG 2UV8A 5FHQA 4HQKA 3ROPA 3QENA 1U1CA 3GFSA 2M6KA 2VJAA 4J7AA 1KYQA 1JXOA 2AXPA 4K05A 1X7YB 4BNUA 2B36A 1O94C 2WSIA 2XT9A 5HUQA 5JJKA 3OZ7A 4DMHA 1MH1A 2ZWPA 4LGCA 3RG8A 6PFKA 4H3VA 1X86B 1DO2A 3GJ5A 4PX9A 1XN1A 1ZHFA 4ZYTA 5JAUA 2IZ1A 3JASB 3EXFA 4WN3A 3Q7PA 2WTAA 1ZD2P 3UYLA 1OVGA 2YV2A 3VJMA 2I54A 3WG9A 2FMTA 2F43B 3T3GA 4IZOA 3UWOA 2XSZD 2ODAA 3AY0A 4IXMA 4MWTA 1EM8B 2R1ZA 4ZVOA 3ZHOA 1R0WA 1UDWA 4Q3NA 2B4KA 1M0EA 1NF3A 1L7EA 3C0KA 3C3PA 3QU9A 4G23A 4TL6A 3HJTA 3DTTA 3QNMA 4L73A 1EDZA 4DJAA 4BC0A 1XU7A 4BO4A 4IYRA 4E94A 1KS2A 2OHFA 4MGIR 4TKVB 4LJ4A 4EL5A 4YO7A 4NNPA 3P9KA 3HLTA 4WLUA 1YA6A 5F1PA 4BE9A 1FS5A 3DPUA 1RWVA 1SC1A 4Y2UA 1F7VA 4AKSA 4I8IA 4LHXA 2RHOA 3W5UA 2BCJQ 1RT9A 4GI1A 4OXYA 5KS2A 2UYCA 2ODNA 1J5EB 3KM0A 4YJGA 5FQNA 4K46A 4BEWA 3KK0A 5JVDA 1TTPB 2Y1EA 2ZAYA 4LI0A 1SU7A 1XLVA 4G1EB 1XNJA 2XF2A 2WYWA 3EXFB 3ONWA 2QR5A 3ZQKA 3C6MA 4CRWB 5JCJD 4D5EA 2JBAA 1HYQA 1DBRA 1WRBA 1D1PA 2OAEA 4MJ7A 4W6QA 4O3MA 4BP9A 2WTUA 4G4SP 2J3QA 5I9LA 2VPWA 1H0KA 3HB9A 3USZA 5C7IO 1UBEA 1M2NA 2H1VA 1OBHA 3L6BA 1OWLA 1KNQA 2PHZA 2R6AA 1PL8A 2ZSAA 3PFNA 3RG2A 1YK0A 4NVRA 3RFVA 4FYHA 1Z0FA 1W4AA 3DL0A 1NLUA 4X8HA 4BBZA 4YCLA 1AUOA 4JXZA 3M7IA 4KOEC 1T1JA 5A04A 4DGQA 4HNQA 4CETA 3I0MA 4MP6A 1K75A 4UUPA 4RJIA 3T7KA 3HB4X 4BMDA 2ZJ5A 4I55A 4KK4A 1YJCA 2PSSA 1MPXA 4QOFA 4EI9A 2H7YA 2IKSA 3P27A 1HEUA 3ENVA 4QO8A 3U48A 2H6EA 2XVYA 1Z0SA 4YJGB 2BM0A 2IWHA 1IXSB 2R6FA 4PGHA 3H5LA 5DSTA 4DJDC 2XV1A 4R9SA 5JVDB 1Y3IA 2V65A 4QDXA 4ZQCB 3G8AA 1LJUA 2VDJA 1PT8A 1DEHA 1SHUX 4V0NA 4EAQA 4H4EA 4JLVA 4HAYA 3SSMA 1Y1KE 2BFDA 4Q1DA 1TUBA 2FK7A 4L6AA 1XMJA 2JBAB 3N6VA 4FP9A 4JX8A 1KAGA 2Q49A 4KW7A 1TMOA 3D1VA 2OCLA 4PAOA 3TEJA 4H1VA 3U4DA 4Z54A 3PT5A 1K8XB 4EF4A 1G291 1OYYA 1KK0A 2GM9A 3CLUC 1QB7A 4LYYA 4XPZA 4CU2A 1U7WA 2NPFA 2HLDD 3HA2A 4CV3A 4KRGA 3ZEAA 1L5RA 2WUVA 3O90A 3LWDA 4YK7A 1T8TA 3ZJ4A 3TIIA 2G1JA 1UT6A 4RK4A 1JKFA 1U28C 1KMIY 4I55B 2SKEA 1VSVA 5E4YA 2GBCA 1TD1A 3A6GA 5HIMA 4GWKA 1XTKA 3AFNA 3JRXA 3PCXA 1SBNE 4V0QA 4AWBA 5LQUA 2A2ZA 3IPRA 4ENWA 5SZHB 3KHUA 1M34B 3OPYA 2R8OA 4YTEA 4R98A 4FX2A 1XYVA 4N5NA 1RKXA 4JBWA 1DQZA 2BFDB 1TUBB 1ZRHA 3O4JA 4X90A 2H1LA 1FPMA 3WAGA 3NYRA 1U3TA 2RGBA 3CX8A 1DHRA 1LRLA 2JF0A 3DZBA 1YV9A 3NRJA 3AW8A 2EKQA 1VSQA 4JLBA 5DXJA 2ZM6B 2ZYGA 3FM9A 4AKEA 3BXPA 5FXMA 2F1HA 4FHGA 2K6GA 4S1VA 3OZGA 1Q84A 4DEVA 3DEJA 2PZJA 1SVSA 1KEWA 2CK3D 3PC7A 2XE8A 5JNWA 2VDUE 2ZRQA 3ADOA 1V39A 4PBTA 3TD2A 3ZW7A 5IEJA 4YN3A 2IIQA 1YAHA 1YZGA 2G09A 2VLBA 3CBQA 1FDRA 4AY5A 4P4LA 4E7PA 3LKVA 4CMIA 5EHXA 3OPYB 2N9UA 4QLOA 4BC1A 3DF7A 3K0EA 3RNOA 3E2PA 4KK3A 4WNAB 2XA9A 3NO4A 3HU3A 4FQ7A 3TNLA 3O8CA 5F98A 3MEQA 1R6DA 3EIUA 4D56A 4FTWA 1QFJA 2E5FA 3OURA 4JT9A 1XLTA 2RONA 4E1AA 2BH9A 1QM5A 3C3DA 3GLHE 1UBHS 2QUBA 5L3QB 3NG1A 3L5OA 1PR5A 5JV5A 4O2BA 1QIMA 1N3IA 3AF5A 2J6IA 1ZJWA 1Z6QA 4GUAA 4ZEMA 1Y37A 2H2AA 2PMKA 4NBLA 4N6OA 3UKDA 4ESOA 2BFAA 3ORRA 1A2OA 3C3MA 4WV3A 5I8PA 1U0TA 1IOWA 2RGGA 3R0IA 1SVNA 4UEOA 3PJDA 3COZA 2CDBA 3BJMA 3D6UA 2BGKA 2Z5GA 5BYAA 5H7XA 4YHBA 1QRAA 4GPD1 2KS6A 2BAGA 2XRMA 3TQIA 4CPDA 2I1QA 4YHHB 4YXFA 3ENNA 1AO0A 4QPCA 2JAWA 4DY4A 4GDMA 2CUKA 3QSGA 4XAQA 1T3TA 5F3WB 4EA8A 1L5LA 3SHWA 4LKRA 3KCQA 1YIOA 1X0XA 2CLKB 3ZE2B 5JU6A 3IVCA 3ANNA 4FDTA 5F2EA 1KH2A 4QTZA 5SZKB 1SY7A 2J3MA 1XZGA 3RWBA 4GLFA 5L6MB 4E2FA 1QQAA 1QRTA 1UKYA 3D3EA 2NVOA 4TLAA 4B3GA 2JGDA 2XUFA 3VSDA 2XSZA 1PWHA 3AI7A 1XX6A 4N5DA 2PPVA 3WL3A 1JX6A 2IGBA 2LWIA 4O2BB 3CPEA 2CN1A 3V8MA 3AL3A 2GHIA 3PPWA 3QA3E 2F3QA 1M0WA 4P92A 2ZYWX 3JYPA 4UAVA 4R1PA 2PV0A 1I32A 2GPYA 4B43A 1JLKA 2HJGA 2NNLD 2QQEA 2R8EA 1LD3A 2XDAA 2B6HA 4RPGA 4TPKA 4D8VA 2PE5A 1ZHHA 3VTFA 5LUAA 4AJOA 1XMVA 3OOHA 4YDHB 2QHXA 3OZAA 4LG1A 3BPSA 4FFSA 1DC7A 3NHYA 4DYHA 3RUEA 3A3PA 4NE2A 1RKVA 2FA9A 2B25A 3LLMA 5TGDA 2FFBA 3WNDA 3ZZUA 3BRQA 4L0DA 1UBTS 2EJWA 4H18A 4O1MA 2KE5A 2ISCA 5JDCA 2XQKA 1W44A 2QGNA 2FZLA 5FUXA 1TEXA 3AO0B 2X5NA 5JCJA 2AOVA