4PU7A

Shewanella oneidensis toxin antitoxin system antitoxin protein hipb resolution 1.85
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
LETIMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Toxin
molecule keywords Toxin-antitoxin system antidote transcriptional repressor Xr
total genus 24
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4pu7A00
1HF0A 2L49A 3QWGA 2AUWA 4Z58A 1BDHA 3G7DA 4J1XA 4Z5HA 1X2LA 3O9XA 1RIOA 2ICTA 2LYJA 2PUGA 4YG1A 1S7EA 2IVGA 3SCFA 4Z5DA 1SQ8A 4Z5CA 2GRMA 1ZZCA 2PIJA 3PXPA 3QQ6A 1DW9A 4X4BA 3L1PA 1PERL 3UFDA 1QQBA 2D5VA 3EUSA 5K98B 1BDIA 2LYRA 3GN5A 4Y42A 4X4HA 1JFSA 1ZZ6A 4F8DA 4X4CA 2AXVA 4X4GA 4X4EA 2O4AA 1UXCA 5A7LA 3QF3A 3OMTA 1WH8A 4I8TA 4IWRA 4FBIA 4PU8A 4IA8A 2PUFA 1LQCA 2WIUB 2KEJA 3FMYA 3MLFA 2PUDA 2IV1A 3GBFA 3KJXA 1LCDA 1LCCA 1YSEA 3TRBA 1RZSA 1QPZA 1Y7YA 1Y9QA 3RZZA 1O4XA 3SCGA 3JXBC 3R1FA 2JCGA 2XIUA 1X57A 2ICPA 2IUOA 4GQMA 3CLCA 2PUBA 2LYQA 3ZHMA 4YG7B 4I6TA 1ZS4A 2L8NA 1POUA 3F52A 2CROA 4PU4C 2AWIA 1RZRA 2HINA 4IVZA 2LYKA 1PRAA 2MQKA 1PNRA 3D1NI 1WETA 4JQDA 2BNMA 2PPXA 1NEQA 4X4IA 1E3OC 1VPWA 2MEZA 2XCJA 4I6RA 1LMB3 2GZUA 1QP4A 1R63A 1R69A 1QQAA 2XSDC 1UXDA 1ZZ9A 3OP9A 1WIZA 2HSGA 2CSFA 2EWTA 3FYMA 3SCHA 1JWLA 3H5TA 2B5AA 1NERA 1ZUGA 2PUEA 2A6CA 1XWRA 4O8BA 1IC8A 4X4FA 2PUAA 3BS3A 1OCTC 2XI8A 3FYAA 3QYXA 3BDNA 3KZ3A 2IVBA 2LCVA 1ZVVA 4MCXA 2KEKA 1B0NA 2BNOA 1UTXA 4I6UA 1ZAYA 4GHJA 4OB4A 1CQTA 3ZHIA 1CJGA 2FJRA 4JCYA 1RZRD 3JXDL 1PRUA 2AXUA 3ZKCA 4PU3C 1RPEL 2O38A 3VK0A 4X4DA 2O49A 1ZPQA 2BJCA 3S8QA 1WH6A 4FN3A 1AU7A 3OQMA 2OR1L 1QP7A 4PU7A 2PUCA 3F6WA 2AW6A 3BD1A 3HZIB 3U3WA 4Z59A 2PE5A 1ZZBA 1DWKA 3KXAA 2LYSA 3GN5B 3LISA 3OQNA 3JXCL 3LFPA 1GT0C 1LLIA 1QP0A 3OQOA 1JFTA 2KPJA 3G5GA 4NDWA 4YG4A 4YBAA 1ZZ8A 2AXZA 4YARA 2R1JL 2H8RA 1ZZ7A 2EF8A 1EFAA 3CROL 2R63A 2KEIA 4JCXA 2GRLA 2WUSR 3CECA 4J1WA 1L1MA 2IU7A 2LYPA 2LYLA 2OFYA 2XJ3A 3IVPA 3DNVB 1PRVA 4MCTA 1OSLA 2IVQA 1JH9A 1ADRA 2JVLA 2KZ8A 2EBYA 2BNNA 3B7HA 3F51A
chains in the Genus database with same CATH superfamily
3QWGA 1BDHA 3O9XA 1S7EA 2IVGA 3PE5A 4Z5DA 2PXLA 3PXPA 1DW9A 4X4BA 4ER3A 5K98B 3GN5A 4Y42A 1ZZ6A 4WVLA 4X4EA 2AXVA 2O4AA 2PXFA 1UXCA 4PU8A 2WIUB 3MLFA 2IV1A 3QOWA 1LCDA 1O4XA 1X57A 2ICPA 3GZDA 1MFQC 5DSXA 4YG7B 3F52A 1RZRA 2CROA 2JQEA 2LYKA 1PNRA 4JQDA 1WETA 1VPWA 4ER6A 1QQAA 2XSDC 1JWLA 1WIZA 3FYMA 2PXTA 2A6CA 4MCXA 4I6UA 1CQTA 3JXDL 1PRUA 2AXUA 2O38A 2O49A 3NXHA 3S8QA 3OQMA 2AW6A 3U3WA 2PE5A 4DE9A 2XXQA 3OQNA 3LFPA 2KPJA 4YARA 2R1JL 2PXQA 2WUSR 2LYPA 2OFYA 2XJ3A 1OSLA 4MCTA 2IVQA 2JVLA 2EBYA 3F51A 4Z58A 1RIOA 1QB2A 1SQ8A 4Z5CA 2PIJA 3KL4A 3UFDA 4EKGA 1BDIA 5DTQA 1JFSA 5A7LA 4IWRA 1QPZA 3KJXA 1RZSA 3SCGA 3ME5A 2IUOA 2FFHA 4I6TA 1ZS4A 1POUA 4PU4C 2V3CC 1NW3A 1PRAA 2MQKA 2BNMA 4EZIA 2XCJA 4I6RA 3NDBB 5DRTA 2LLVA 1NERA 1ZUGA 4O8BA 1IC8A 2XI8A 3GZDC 3BDNA 3KZ3A 2IVBA 2LNMA 5GAHi 2FJRA 2PXPA 3LQXA 1RPEL 2HCSA 2BJCA 1WH6A 4PU7A 1U2ZA 3OKZA 4ER7A 3HZIB 1ZZBA 1DWKA 3KXAA 2LYSA 5DTRA 2PXBA 4ER5A 1JFTA 2HFZA 4HRAA 4NDWA 1ZZ8A 2AXZA 2HCNA 1ZZ7A 1EFAA 2R63A 4JCXA 2GRLA 2IU7A 2ODRD 3R09A 3IVPA 4FBIA 2KZ8A 2PXUA 3G7DA 4J1XA 4Z5HA 1X2LA 2LYJA 1QZXA 2PUGA 4YG1A 3SCFA 2XXPA 2L1PA 3OWQA 2VEOA 1PERL 2LYRA 3QFIA 4F8DA 4X4CA 4X4GA 4I8TA 4IA8A 2PUFA 2KEJA 2PUDA 1YSEA 3TRBA 1Y7YA 1Y9QA 1DULA 3RZZA 3TEPA 4GQMA 3ZHMA 2PUBA 2LYQA 2HINA 1HQ1A 3UWPA 3D1NI 1E3OC 4X4IA 2MEZA 1R63A 1R69A 3OP9A 2HSGA 2CSFA 2EWTA 3SCHA 1XWRA 4X4FA 2PUAA 3M9LA 2YBDA 1B0NA 1ZAYA 4GHJA 4JCYA 1RZRD 4X4DA 4ER0A 3DM5A 4OBMA 4FN3A 3F6WA 3QOXA 2J7UA 1LLIA 1QP0A 3OQOA 2H8RA 2EF8A 3CROL 5DT2A 5DTMA 1PRVA 1JH9A 3LISA 2MXDA 2KEIA 1HF0A 2L49A 2AUWA 2ICTA 5JUWA 2GRMA 3MEJA 1ZZCA 3QQ6A 3L1PA 1QQBA 2D5VA 3EUSA 3A9ZA 4X4HA 3A9XA 3QF3A 3OMTA 1WH8A 1LQCA 3FMYA 3GBFA 1LCCA 3JXBC 3R1FA 2JCGA 2XIUA 3CLCA 3TFLA 3B7HA 2L8NA 2PXDA 2AWIA 2XXAA 4IVZA 3A9YA 4DE8A 2PXKA 2PPXA 1NEQA 4EQZA 1LMB3 1QP4A 2GZUA 1UXDA 1ZZ9A 2J7WA 3H5TA 2B5AA 2PUEA 3BS3A 1OCTC 3FYAA 3QYXA 2LCVA 1ZVVA 2KEKA 2BNOA 5DRYA 1UTXA 3G0TA 4OB4A 3SX0A 3ZHIA 1CJGA 3ZKCA 3SR4A 4PU3C 3VK0A 1ZPQA 1AU7A 2OR1L 1QP7A 2PUCA 3TELA 4Z59A 4EK9A 3GZCA 3GN5B 3GUUA 3JXCL 2PXEA 1GT0C 3G5GA 2LLWA 3NZLA 4YG4A 4YBAA 4Q2JA 3CECA 4EKIA 4J1WA 3NROA 1L1MA 3VWSA 3ZPXA 2LYLA 3DNVB 2PXVA 1ADRA 5GAGi 2M4HA 2BNNA 3BD1A
chains in the Genus database with same CATH topology
1HF0A 2L49A 3QWGA 2AUWA 4Z58A 1BDHA 3G7DA 4J1XA 4Z5HA 1X2LA 3O9XA 1RIOA 2ICTA 2LYJA 2PUGA 4YG1A 1S7EA 2IVGA 3SCFA 4Z5DA 1SQ8A 4Z5CA 2GRMA 1ZZCA 2PIJA 3PXPA 3QQ6A 1DW9A 4X4BA 3L1PA 1PERL 3UFDA 1QQBA 2D5VA 3EUSA 5K98B 1BDIA 2LYRA 3GN5A 4Y42A 4X4HA 1JFSA 1ZZ6A 4F8DA 4X4CA 2AXVA 4X4GA 4X4EA 2O4AA 1UXCA 5A7LA 3QF3A 3OMTA 1WH8A 4I8TA 4IWRA 4FBIA 4PU8A 4IA8A 2PUFA 1LQCA 2WIUB 2KEJA 3FMYA 3MLFA 2PUDA 2IV1A 3GBFA 3KJXA 1LCDA 1LCCA 1YSEA 3TRBA 1RZSA 1QPZA 1Y7YA 1Y9QA 3RZZA 1O4XA 3SCGA 3JXBC 3R1FA 2JCGA 2XIUA 1X57A 2ICPA 2IUOA 4GQMA 3CLCA 2PUBA 2LYQA 3ZHMA 4YG7B 4I6TA 1ZS4A 2L8NA 1POUA 3F52A 2CROA 4PU4C 2AWIA 1RZRA 2HINA 4IVZA 2LYKA 1PRAA 2MQKA 1PNRA 3D1NI 1WETA 4JQDA 2BNMA 2PPXA 1NEQA 4X4IA 1E3OC 1VPWA 2MEZA 2XCJA 4I6RA 1LMB3 2GZUA 1QP4A 1R63A 1R69A 1QQAA 2XSDC 1UXDA 1ZZ9A 3OP9A 1WIZA 2HSGA 2CSFA 2EWTA 3FYMA 3SCHA 1JWLA 3H5TA 2B5AA 1NERA 1ZUGA 2PUEA 2A6CA 1XWRA 4O8BA 1IC8A 4X4FA 2PUAA 3BS3A 1OCTC 2XI8A 3FYAA 3QYXA 3BDNA 3KZ3A 2IVBA 2LCVA 1ZVVA 4MCXA 2KEKA 1B0NA 2BNOA 1UTXA 4I6UA 1ZAYA 4GHJA 4OB4A 1CQTA 3ZHIA 1CJGA 2FJRA 4JCYA 1RZRD 3JXDL 1PRUA 2AXUA 3ZKCA 4PU3C 1RPEL 2O38A 3VK0A 4X4DA 2O49A 1ZPQA 2BJCA 3S8QA 1WH6A 4FN3A 1AU7A 3OQMA 2OR1L 1QP7A 4PU7A 2PUCA 3F6WA 2AW6A 3BD1A 3HZIB 3U3WA 4Z59A 2PE5A 1ZZBA 1DWKA 3KXAA 2LYSA 3GN5B 3LISA 3OQNA 3JXCL 3LFPA 1GT0C 1LLIA 1QP0A 3OQOA 1JFTA 2KPJA 3G5GA 4NDWA 4YG4A 4YBAA 1ZZ8A 2AXZA 4YARA 2R1JL 2H8RA 1ZZ7A 2EF8A 1EFAA 3CROL 2R63A 2KEIA 4JCXA 2GRLA 2WUSR 3CECA 4J1WA 1L1MA 2IU7A 2LYPA 2LYLA 2OFYA 2XJ3A 3IVPA 3DNVB 1PRVA 4MCTA 1OSLA 2IVQA 1JH9A 1ADRA 2JVLA 2KZ8A 2EBYA 2BNNA 3B7HA 3F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF0 A;  2L49 A;  3QWG A;  2AUW A;  4Z58 A;  1BDH A;  3G7D A;  4J1X A;  4Z5H A;  1X2L A;  3O9X A;  1RIO A;  2ICT A;  2LYJ A;  2PUG A;  4YG1 A;  1S7E A;  2IVG A;  3SCF A;  4Z5D A;  1SQ8 A;  4Z5C A;  2GRM A;  1ZZC A;  2PIJ A;  3PXP A;  3QQ6 A;  1DW9 A;  4X4B A;  3L1P A;  1PER L;  3UFD A;  1QQB A;  2D5V A;  3EUS A;  5K98 B;  1BDI A;  2LYR A;  3GN5 A;  4Y42 A;  4X4H A;  1JFS A;  1ZZ6 A;  4F8D A;  4X4C A;  2AXV A;  4X4G A;  4X4E A;  2O4A A;  1UXC A;  5A7L A;  3QF3 A;  3OMT A;  1WH8 A;  4I8T A;  4IWR A;  4FBI A;  4PU8 A;  4IA8 A;  2PUF A;  1LQC A;  2WIU B;  2KEJ A;  3FMY A;  3MLF A;  2PUD A;  2IV1 A;  3GBF A;  3KJX A;  1LCD A;  1LCC A;  1YSE A;  3TRB A;  1RZS A;  1QPZ A;  1Y7Y A;  1Y9Q A;  3RZZ A;  1O4X A;  3SCG A;  3JXB C;  3R1F A;  2JCG A;  2XIU A;  1X57 A;  2ICP A;  2IUO A;  4GQM A;  3CLC A;  2PUB A;  2LYQ A;  3ZHM A;  4YG7 B;  4I6T A;  1ZS4 A;  2L8N A;  1POU A;  3F52 A;  2CRO A;  4PU4 C;  2AWI A;  1RZR A;  2HIN A;  4IVZ A;  2LYK A;  1PRA A;  2MQK A;  1PNR A;  3D1N I;  1WET A;  4JQD A;  2BNM A;  2PPX A;  1NEQ A;  4X4I A;  1E3O C;  1VPW A;  2MEZ A;  2XCJ A;  4I6R A;  1LMB 3;  2GZU A;  1QP4 A;  1R63 A;  1R69 A;  1QQA A;  2XSD C;  1UXD A;  1ZZ9 A;  3OP9 A;  1WIZ A;  2HSG A;  2CSF A;  2EWT A;  3FYM A;  3SCH A;  1JWL A;  3H5T A;  2B5A A;  1NER A;  1ZUG A;  2PUE A;  2A6C A;  1XWR A;  4O8B A;  1IC8 A;  4X4F A;  2PUA A;  3BS3 A;  1OCT C;  2XI8 A;  3FYA A;  3QYX A;  3BDN A;  3KZ3 A;  2IVB A;  2LCV A;  1ZVV A;  4MCX A;  2KEK A;  1B0N A;  2BNO A;  1UTX A;  4I6U A;  1ZAY A;  4GHJ A;  4OB4 A;  1CQT A;  3ZHI A;  1CJG A;  2FJR A;  4JCY A;  1RZR D;  3JXD L;  1PRU A;  2AXU A;  3ZKC A;  4PU3 C;  1RPE L;  2O38 A;  3VK0 A;  4X4D A;  2O49 A;  1ZPQ A;  2BJC A;  3S8Q A;  1WH6 A;  4FN3 A;  1AU7 A;  3OQM A;  2OR1 L;  1QP7 A;  4PU7 A;  2PUC A;  3F6W A;  2AW6 A;  3BD1 A;  3HZI B;  3U3W A;  4Z59 A;  2PE5 A;  1ZZB A;  1DWK A;  3KXA A;  2LYS A;  3GN5 B;  3LIS A;  3OQN A;  3JXC L;  3LFP A;  1GT0 C;  1LLI A;  1QP0 A;  3OQO A;  1JFT A;  2KPJ A;  3G5G A;  4NDW A;  4YG4 A;  4YBA A;  1ZZ8 A;  2AXZ A;  4YAR A;  2R1J L;  2H8R A;  1ZZ7 A;  2EF8 A;  1EFA A;  3CRO L;  2R63 A;  2KEI A;  4JCX A;  2GRL A;  2WUS R;  3CEC A;  4J1W A;  1L1M A;  2IU7 A;  2LYP A;  2LYL A;  2OFY A;  2XJ3 A;  3IVP A;  3DNV B;  1PRV A;  4MCT A;  1OSL A;  2IVQ A;  1JH9 A;  1ADR A;  2JVL A;  2KZ8 A;  2EBY A;  2BNN A;  3B7H A;  3F51 A; 
#chains in the Genus database with same CATH topology
 3QWG A;  1BDH A;  3O9X A;  1S7E A;  2IVG A;  3PE5 A;  4Z5D A;  2PXL A;  3PXP A;  1DW9 A;  4X4B A;  4ER3 A;  5K98 B;  3GN5 A;  4Y42 A;  1ZZ6 A;  4WVL A;  4X4E A;  2AXV A;  2O4A A;  2PXF A;  1UXC A;  4PU8 A;  2WIU B;  3MLF A;  2IV1 A;  3QOW A;  1LCD A;  1O4X A;  1X57 A;  2ICP A;  3GZD A;  1MFQ C;  5DSX A;  4YG7 B;  3F52 A;  1RZR A;  2CRO A;  2JQE A;  2LYK A;  1PNR A;  4JQD A;  1WET A;  1VPW A;  4ER6 A;  1QQA A;  2XSD C;  1JWL A;  1WIZ A;  3FYM A;  2PXT A;  2A6C A;  4MCX A;  4I6U A;  1CQT A;  3JXD L;  1PRU A;  2AXU A;  2O38 A;  2O49 A;  3NXH A;  3S8Q A;  3OQM A;  2AW6 A;  3U3W A;  2PE5 A;  4DE9 A;  2XXQ A;  3OQN A;  3LFP A;  2KPJ A;  4YAR A;  2R1J L;  2PXQ A;  2WUS R;  2LYP A;  2OFY A;  2XJ3 A;  1OSL A;  4MCT A;  2IVQ A;  2JVL A;  2EBY A;  3F51 A;  4Z58 A;  1RIO A;  1QB2 A;  1SQ8 A;  4Z5C A;  2PIJ A;  3KL4 A;  3UFD A;  4EKG A;  1BDI A;  5DTQ A;  1JFS A;  5A7L A;  4IWR A;  1QPZ A;  3KJX A;  1RZS A;  3SCG A;  3ME5 A;  2IUO A;  2FFH A;  4I6T A;  1ZS4 A;  1POU A;  4PU4 C;  2V3C C;  1NW3 A;  1PRA A;  2MQK A;  2BNM A;  4EZI A;  2XCJ A;  4I6R A;  3NDB B;  5DRT A;  2LLV A;  1NER A;  1ZUG A;  4O8B A;  1IC8 A;  2XI8 A;  3GZD C;  3BDN A;  3KZ3 A;  2IVB A;  2LNM A;  5GAH i;  2FJR A;  2PXP A;  3LQX A;  1RPE L;  2HCS A;  2BJC A;  1WH6 A;  4PU7 A;  1U2Z A;  3OKZ A;  4ER7 A;  3HZI B;  1ZZB A;  1DWK A;  3KXA A;  2LYS A;  5DTR A;  2PXB A;  4ER5 A;  1JFT A;  2HFZ A;  4HRA A;  4NDW A;  1ZZ8 A;  2AXZ A;  2HCN A;  1ZZ7 A;  1EFA A;  2R63 A;  4JCX A;  2GRL A;  2IU7 A;  2ODR D;  3R09 A;  3IVP A;  4FBI A;  2KZ8 A;  2PXU A;  3G7D A;  4J1X A;  4Z5H A;  1X2L A;  2LYJ A;  1QZX A;  2PUG A;  4YG1 A;  3SCF A;  2XXP A;  2L1P A;  3OWQ A;  2VEO A;  1PER L;  2LYR A;  3QFI A;  4F8D A;  4X4C A;  4X4G A;  4I8T A;  4IA8 A;  2PUF A;  2KEJ A;  2PUD A;  1YSE A;  3TRB A;  1Y7Y A;  1Y9Q A;  1DUL A;  3RZZ A;  3TEP A;  4GQM A;  3ZHM A;  2PUB A;  2LYQ A;  2HIN A;  1HQ1 A;  3UWP A;  3D1N I;  1E3O C;  4X4I A;  2MEZ A;  1R63 A;  1R69 A;  3OP9 A;  2HSG A;  2CSF A;  2EWT A;  3SCH A;  1XWR A;  4X4F A;  2PUA A;  3M9L A;  2YBD A;  1B0N A;  1ZAY A;  4GHJ A;  4JCY A;  1RZR D;  4X4D A;  4ER0 A;  3DM5 A;  4OBM A;  4FN3 A;  3F6W A;  3QOX A;  2J7U A;  1LLI A;  1QP0 A;  3OQO A;  2H8R A;  2EF8 A;  3CRO L;  5DT2 A;  5DTM A;  1PRV A;  1JH9 A;  3LIS A;  2MXD A;  2KEI A;  1HF0 A;  2L49 A;  2AUW A;  2ICT A;  5JUW A;  2GRM A;  3MEJ A;  1ZZC A;  3QQ6 A;  3L1P A;  1QQB A;  2D5V A;  3EUS A;  3A9Z A;  4X4H A;  3A9X A;  3QF3 A;  3OMT A;  1WH8 A;  1LQC A;  3FMY A;  3GBF A;  1LCC A;  3JXB C;  3R1F A;  2JCG A;  2XIU A;  3CLC A;  3TFL A;  3B7H A;  2L8N A;  2PXD A;  2AWI A;  2XXA A;  4IVZ A;  3A9Y A;  4DE8 A;  2PXK A;  2PPX A;  1NEQ A;  4EQZ A;  1LMB 3;  1QP4 A;  2GZU A;  1UXD A;  1ZZ9 A;  2J7W A;  3H5T A;  2B5A A;  2PUE A;  3BS3 A;  1OCT C;  3FYA A;  3QYX A;  2LCV A;  1ZVV A;  2KEK A;  2BNO A;  5DRY A;  1UTX A;  3G0T A;  4OB4 A;  3SX0 A;  3ZHI A;  1CJG A;  3ZKC A;  3SR4 A;  4PU3 C;  3VK0 A;  1ZPQ A;  1AU7 A;  2OR1 L;  1QP7 A;  2PUC A;  3TEL A;  4Z59 A;  4EK9 A;  3GZC A;  3GN5 B;  3GUU A;  3JXC L;  2PXE A;  1GT0 C;  3G5G A;  2LLW A;  3NZL A;  4YG4 A;  4YBA A;  4Q2J A;  3CEC A;  4EKI A;  4J1W A;  3NRO A;  1L1M A;  3VWS A;  3ZPX A;  2LYL A;  3DNV B;  2PXV A;  1ADR A;  5GAG i;  2M4H A;  2BNN A;  3BD1 A; 
#chains in the Genus database with same CATH homology
 1HF0 A;  2L49 A;  3QWG A;  2AUW A;  4Z58 A;  1BDH A;  3G7D A;  4J1X A;  4Z5H A;  1X2L A;  3O9X A;  1RIO A;  2ICT A;  2LYJ A;  2PUG A;  4YG1 A;  1S7E A;  2IVG A;  3SCF A;  4Z5D A;  1SQ8 A;  4Z5C A;  2GRM A;  1ZZC A;  2PIJ A;  3PXP A;  3QQ6 A;  1DW9 A;  4X4B A;  3L1P A;  1PER L;  3UFD A;  1QQB A;  2D5V A;  3EUS A;  5K98 B;  1BDI A;  2LYR A;  3GN5 A;  4Y42 A;  4X4H A;  1JFS A;  1ZZ6 A;  4F8D A;  4X4C A;  2AXV A;  4X4G A;  4X4E A;  2O4A A;  1UXC A;  5A7L A;  3QF3 A;  3OMT A;  1WH8 A;  4I8T A;  4IWR A;  4FBI A;  4PU8 A;  4IA8 A;  2PUF A;  1LQC A;  2WIU B;  2KEJ A;  3FMY A;  3MLF A;  2PUD A;  2IV1 A;  3GBF A;  3KJX A;  1LCD A;  1LCC A;  1YSE A;  3TRB A;  1RZS A;  1QPZ A;  1Y7Y A;  1Y9Q A;  3RZZ A;  1O4X A;  3SCG A;  3JXB C;  3R1F A;  2JCG A;  2XIU A;  1X57 A;  2ICP A;  2IUO A;  4GQM A;  3CLC A;  2PUB A;  2LYQ A;  3ZHM A;  4YG7 B;  4I6T A;  1ZS4 A;  2L8N A;  1POU A;  3F52 A;  2CRO A;  4PU4 C;  2AWI A;  1RZR A;  2HIN A;  4IVZ A;  2LYK A;  1PRA A;  2MQK A;  1PNR A;  3D1N I;  1WET A;  4JQD A;  2BNM A;  2PPX A;  1NEQ A;  4X4I A;  1E3O C;  1VPW A;  2MEZ A;  2XCJ A;  4I6R A;  1LMB 3;  2GZU A;  1QP4 A;  1R63 A;  1R69 A;  1QQA A;  2XSD C;  1UXD A;  1ZZ9 A;  3OP9 A;  1WIZ A;  2HSG A;  2CSF A;  2EWT A;  3FYM A;  3SCH A;  1JWL A;  3H5T A;  2B5A A;  1NER A;  1ZUG A;  2PUE A;  2A6C A;  1XWR A;  4O8B A;  1IC8 A;  4X4F A;  2PUA A;  3BS3 A;  1OCT C;  2XI8 A;  3FYA A;  3QYX A;  3BDN A;  3KZ3 A;  2IVB A;  2LCV A;  1ZVV A;  4MCX A;  2KEK A;  1B0N A;  2BNO A;  1UTX A;  4I6U A;  1ZAY A;  4GHJ A;  4OB4 A;  1CQT A;  3ZHI A;  1CJG A;  2FJR A;  4JCY A;  1RZR D;  3JXD L;  1PRU A;  2AXU A;  3ZKC A;  4PU3 C;  1RPE L;  2O38 A;  3VK0 A;  4X4D A;  2O49 A;  1ZPQ A;  2BJC A;  3S8Q A;  1WH6 A;  4FN3 A;  1AU7 A;  3OQM A;  2OR1 L;  1QP7 A;  4PU7 A;  2PUC A;  3F6W A;  2AW6 A;  3BD1 A;  3HZI B;  3U3W A;  4Z59 A;  2PE5 A;  1ZZB A;  1DWK A;  3KXA A;  2LYS A;  3GN5 B;  3LIS A;  3OQN A;  3JXC L;  3LFP A;  1GT0 C;  1LLI A;  1QP0 A;  3OQO A;  1JFT A;  2KPJ A;  3G5G A;  4NDW A;  4YG4 A;  4YBA A;  1ZZ8 A;  2AXZ A;  4YAR A;  2R1J L;  2H8R A;  1ZZ7 A;  2EF8 A;  1EFA A;  3CRO L;  2R63 A;  2KEI A;  4JCX A;  2GRL A;  2WUS R;  3CEC A;  4J1W A;  1L1M A;  2IU7 A;  2LYP A;  2LYL A;  2OFY A;  2XJ3 A;  3IVP A;  3DNV B;  1PRV A;  4MCT A;  1OSL A;  2IVQ A;  1JH9 A;  1ADR A;  2JVL A;  2KZ8 A;  2EBY A;  2BNN A;  3B7H A;  3F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...