4PU8A

Shewanella oneidensis toxin antitoxin system antitoxin protein hipb resolution 2.35
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LETIMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Toxin
molecule keywords Toxin-antitoxin system antidote transcriptional repressor Xr
total genus 22
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4pu8A00
4X4FA 1RZSA 4PU3C 3BD1A 1UXDA 2AUWA 2L49A 3QF3A 1WH6A 1Y9QA 2HSGA 1XWRA 3OQNA 3TRBA 5K98B 3QYXA 4MCTA 3CLCA 3SCGA 1PNRA 3LFPA 1VPWA 3EUSA 1R69A 1Y7YA 3GN5A 1DW9A 4I6UA 4Y42A 2B5AA 3ZHIA 1WETA 1PRUA 2EF8A 2BNMA 3KJXA 2PUEA 3S8QA 1JFTA 1ZZBA 2PUBA 2PUCA 4O8BA 1PERL 3IVPA 3QQ6A 3R1FA 1RPEL 3G5GA 1QP7A 3ZHMA 3DNVB 1RZRD 3L1PA 1QQAA 2EWTA 1ZVVA 3FMYA 3F51A 2LYKA 2LYQA 2OFYA 2PUFA 1POUA 3UFDA 3G7DA 3QWGA 1JWLA 4JQDA 1IC8A 4IA8A 1RZRA 1E3OC 2AXVA 2XJ3A 4X4BA 4JCYA 3CECA 3ZKCA 2D5VA 5A7LA 1DWKA 4X4CA 2IU7A 1LCDA 4X4DA 2GZUA 3LISA 1ZAYA 1UTXA 2PE5A 2GRMA 3BS3A 4YARA 1RIOA 1O4XA 2ICPA 4Z5CA 4Z5HA 2R63A 1UXCA 1LCCA 3OP9A 2PIJA 1QP4A 1LQCA 2LCVA 3JXBC 3U3WA 4I6RA 2KEIA 2R1JL 4YG1A 3SCFA 2XSDC 1L1MA 1EFAA 3F52A 3VK0A 2PUGA 4J1WA 1LLIA 2OR1L 1CJGA 1ZS4A 2IVGA 4GQMA 1WH8A 4FBIA 2XCJA 2KPJA 2ICTA 1CQTA 1ZUGA 1B0NA 1X57A 3FYAA 3JXDL 4Z59A 3JXCL 2BNOA 4I6TA 4Z58A 1OSLA 1QPZA 3KZ3A 1SQ8A 1JH9A 1ZZ8A 1HF0A 2IVBA 4FN3A 2AWIA 2WIUB 2CROA 2O38A 4F8DA 4MCXA 1ZZCA 1BDHA 1QP0A 1ZPQA 3H5TA 3SCHA 4YBAA 2A6CA 4OB4A 4Z5DA 4YG4A 1GT0C 2CSFA 2LYLA 1NERA 1ZZ7A 1PRVA 4X4HA 1ZZ6A 1X2LA 3PXPA 2AXUA 1ADRA 3OQMA 1NEQA 1S7EA 2JCGA 2IVQA 2AW6A 3KXAA 2BJCA 4NDWA 3MLFA 2LYJA 2LYSA 2KEKA 2MEZA 2LYRA 4I8TA 2O49A 2IV1A 3F6WA 2BNNA 4PU7A 4PU8A 2PUAA 3OMTA 3B7HA 2WUSR 3O9XA 2XIUA 2MQKA 3D1NI 3CROL 2O4AA 4J1XA 2HINA 4YG7B 4X4GA 2EBYA 1LMB3 4IWRA 2FJRA 4X4IA 1JFSA 2JVLA 1R63A 4PU4C 1AU7A 1QQBA 3GBFA 1YSEA 2AXZA 2IUOA 4GHJA 2H8RA 2LYPA 1BDIA 1PRAA 2GRLA 3FYMA 2KEJA 2L8NA 1OCTC 3GN5B 2PUDA 2PPXA 2KZ8A 1WIZA 3BDNA 4IVZA 4X4EA 3OQOA 3HZIB 3RZZA 1ZZ9A 4JCXA 2XI8A
chains in the Genus database with same CATH superfamily
3NROA 4PU3C 1UXDA 3A9YA 4DE9A 3QF3A 1Y9QA 3CLCA 2B5AA 2PXDA 3ZHIA 1WETA 1PRUA 3KJXA 2BNMA 3QOXA 1JFTA 4O8BA 3L1PA 3PE5A 2LYKA 2PXQA 1IC8A 1E3OC 4JCYA 4X4CA 2IU7A 1LCDA 4X4DA 2V3CC 1RIOA 3SR4A 4ER6A 2PUGA 1LLIA 2OR1L 4GQMA 1B0NA 4ER5A 4Z59A 2PXPA 3KZ3A 1JH9A 4EK9A 2AWIA 3ZPXA 2WIUB 2O38A 4MCXA 1BDHA 4YBAA 4Z5DA 2CSFA 1NERA 4OBMA 1ZZ7A 5DTQA 2KEKA 4I8TA 2MEZA 2LYRA 2BNNA 4PU7A 4PU8A 3OMTA 3B7HA 4YG7B 5DTMA 3KL4A 1AU7A 1JFSA 5DRTA 2AXZA 4GHJA 1BDIA 3A9XA 3QFIA 2PUDA 3BDNA 4X4EA 5JUWA 1RZSA 3TEPA 1XWRA 2J7WA 3TRBA 3QYXA 1QB2A 4MCTA 1PNRA 3EUSA 4Y42A 1RPEL 3G5GA 3ZHMA 3DNVB 1RZRD 2EWTA 1ZVVA 3FMYA 3UFDA 3G7DA 4JQDA 1JWLA 5GAHi 4IA8A 2XJ3A 4X4BA 2PXVA 3QOWA 3NXHA 3OWQA 2GZUA 3LISA 2PE5A 1O4XA 2ICPA 1UXCA 1LCCA 2PIJA 1DULA 3OKZA 3JXBC 3U3WA 3GZCA 3F52A 3VK0A 1CJGA 2KPJA 1ZUGA 2BNOA 3G0TA 2ODRD 1SQ8A 4FN3A 4EKGA 4F8DA 4Q2JA 2XXQA 1ZZCA 1QP0A 1GT0C 1ZZ6A 1X2LA 1NEQA 1S7EA 4NDWA 3MLFA 2O49A 2PUAA 5DRYA 4J1XA 2HINA 4X4GA 2EBYA 1LMB3 4EKIA 2JVLA 1R63A 2H8RA 3NZLA 2VEOA 2KEJA 2L8NA 1OCTC 2KZ8A 1WIZA 4IVZA 3VWSA 3OQOA 2XXPA 4JCXA 2XI8A 4ER7A 3LQXA 2L49A 1WH6A 2HSGA 5K98B 3LFPA 3GN5A 4I6UA 2LNMA 2EF8A 2PUEA 1ZZBA 2PUBA 2PUCA 1QQAA 2OFYA 2PUFA 3TELA 3QWGA 3GZDC 2LLVA 2PXUA 2D5VA 5A7LA 4YARA 3DM5A 2YBDA 2R63A 4WVLA 5DSXA 3TFLA 1QP4A 2R1JL 4YG1A 2XSDC 1EFAA 4J1WA 1ZS4A 1MFQC 3A9ZA 5DTRA 2ICTA 2PXEA 4HRAA 3FYAA 5GAGi 4I6TA 4Z58A 1QPZA 3R09A 1ZZ8A 4EQZA 4DE8A 2HCNA 1ZPQA 3SCHA 2A6CA 4OB4A 4YG4A 1PRVA 1ADRA 3OQMA 2PXBA 2AW6A 2LYSA 2IV1A 3F6WA 3SX0A 2JQEA 2XIUA 2LLWA 3CROL 3ME5A 2FJRA 4X4IA 2MXDA 4PU4C 3GBFA 1YSEA 2IUOA 1PRAA 2GRLA 2L1PA 3FYMA 3GN5B 2PPXA 3HZIB 2FFHA 3RZZA 2HCSA 4X4FA 3MEJA 3BD1A 2AUWA 2HFZA 4ER0A 3OQNA 2PXKA 3GUUA 3SCGA 1VPWA 1R69A 1Y7YA 1DW9A 3S8QA 1HQ1A 1PERL 3IVPA 3QQ6A 3R1FA 1U2ZA 1QP7A 3F51A 2LYQA 1POUA 2PXFA 2PXTA 1RZRA 2AXVA 3CECA 3ZKCA 1DWKA 3GZDA 4EZIA 3UWPA 1ZAYA 1UTXA 1QZXA 2GRMA 3BS3A 4Z5CA 4Z5HA 3OP9A 1LQCA 2LCVA 4I6RA 2KEIA 3SCFA 1L1MA 2PXLA 1NW3A 2IVGA 1WH8A 4FBIA 2XCJA 1CQTA 1X57A 3JXDL 2XXAA 3JXCL 1OSLA 5DT2A 1HF0A 2IVBA 2CROA 3H5TA 4ER3A 2LYLA 4X4HA 2J7UA 3PXPA 2AXUA 2JCGA 2IVQA 3KXAA 2BJCA 2LYJA 2WUSR 3M9LA 3NDBB 3O9XA 3D1NI 2MQKA 2O4AA 4IWRA 1QQBA 2M4HA 2LYPA 1ZZ9A
chains in the Genus database with same CATH topology
4X4FA 1RZSA 4PU3C 3BD1A 1UXDA 2AUWA 2L49A 3QF3A 1WH6A 1Y9QA 2HSGA 1XWRA 3OQNA 3TRBA 5K98B 3QYXA 4MCTA 3CLCA 3SCGA 1PNRA 3LFPA 1VPWA 3EUSA 1R69A 1Y7YA 3GN5A 1DW9A 4I6UA 4Y42A 2B5AA 3ZHIA 1WETA 1PRUA 2EF8A 2BNMA 3KJXA 2PUEA 3S8QA 1JFTA 1ZZBA 2PUBA 2PUCA 4O8BA 1PERL 3IVPA 3QQ6A 3R1FA 1RPEL 3G5GA 1QP7A 3ZHMA 3DNVB 1RZRD 3L1PA 1QQAA 2EWTA 1ZVVA 3FMYA 3F51A 2LYKA 2LYQA 2OFYA 2PUFA 1POUA 3UFDA 3G7DA 3QWGA 1JWLA 4JQDA 1IC8A 4IA8A 1RZRA 1E3OC 2AXVA 2XJ3A 4X4BA 4JCYA 3CECA 3ZKCA 2D5VA 5A7LA 1DWKA 4X4CA 2IU7A 1LCDA 4X4DA 2GZUA 3LISA 1ZAYA 1UTXA 2PE5A 2GRMA 3BS3A 4YARA 1RIOA 1O4XA 2ICPA 4Z5CA 4Z5HA 2R63A 1UXCA 1LCCA 3OP9A 2PIJA 1QP4A 1LQCA 2LCVA 3JXBC 3U3WA 4I6RA 2KEIA 2R1JL 4YG1A 3SCFA 2XSDC 1L1MA 1EFAA 3F52A 3VK0A 2PUGA 4J1WA 1LLIA 2OR1L 1CJGA 1ZS4A 2IVGA 4GQMA 1WH8A 4FBIA 2XCJA 2KPJA 2ICTA 1CQTA 1ZUGA 1B0NA 1X57A 3FYAA 3JXDL 4Z59A 3JXCL 2BNOA 4I6TA 4Z58A 1OSLA 1QPZA 3KZ3A 1SQ8A 1JH9A 1ZZ8A 1HF0A 2IVBA 4FN3A 2AWIA 2WIUB 2CROA 2O38A 4F8DA 4MCXA 1ZZCA 1BDHA 1QP0A 1ZPQA 3H5TA 3SCHA 4YBAA 2A6CA 4OB4A 4Z5DA 4YG4A 1GT0C 2CSFA 2LYLA 1NERA 1ZZ7A 1PRVA 4X4HA 1ZZ6A 1X2LA 3PXPA 2AXUA 1ADRA 3OQMA 1NEQA 1S7EA 2JCGA 2IVQA 2AW6A 3KXAA 2BJCA 4NDWA 3MLFA 2LYJA 2LYSA 2KEKA 2MEZA 2LYRA 4I8TA 2O49A 2IV1A 3F6WA 2BNNA 4PU7A 4PU8A 2PUAA 3OMTA 3B7HA 2WUSR 3O9XA 2XIUA 2MQKA 3D1NI 3CROL 2O4AA 4J1XA 2HINA 4YG7B 4X4GA 2EBYA 1LMB3 4IWRA 2FJRA 4X4IA 1JFSA 2JVLA 1R63A 4PU4C 1AU7A 1QQBA 3GBFA 1YSEA 2AXZA 2IUOA 4GHJA 2H8RA 2LYPA 1BDIA 1PRAA 2GRLA 3FYMA 2KEJA 2L8NA 1OCTC 3GN5B 2PUDA 2PPXA 2KZ8A 1WIZA 3BDNA 4IVZA 4X4EA 3OQOA 3HZIB 3RZZA 1ZZ9A 4JCXA 2XI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4F A;  1RZS A;  4PU3 C;  3BD1 A;  1UXD A;  2AUW A;  2L49 A;  3QF3 A;  1WH6 A;  1Y9Q A;  2HSG A;  1XWR A;  3OQN A;  3TRB A;  5K98 B;  3QYX A;  4MCT A;  3CLC A;  3SCG A;  1PNR A;  3LFP A;  1VPW A;  3EUS A;  1R69 A;  1Y7Y A;  3GN5 A;  1DW9 A;  4I6U A;  4Y42 A;  2B5A A;  3ZHI A;  1WET A;  1PRU A;  2EF8 A;  2BNM A;  3KJX A;  2PUE A;  3S8Q A;  1JFT A;  1ZZB A;  2PUB A;  2PUC A;  4O8B A;  1PER L;  3IVP A;  3QQ6 A;  3R1F A;  1RPE L;  3G5G A;  1QP7 A;  3ZHM A;  3DNV B;  1RZR D;  3L1P A;  1QQA A;  2EWT A;  1ZVV A;  3FMY A;  3F51 A;  2LYK A;  2LYQ A;  2OFY A;  2PUF A;  1POU A;  3UFD A;  3G7D A;  3QWG A;  1JWL A;  4JQD A;  1IC8 A;  4IA8 A;  1RZR A;  1E3O C;  2AXV A;  2XJ3 A;  4X4B A;  4JCY A;  3CEC A;  3ZKC A;  2D5V A;  5A7L A;  1DWK A;  4X4C A;  2IU7 A;  1LCD A;  4X4D A;  2GZU A;  3LIS A;  1ZAY A;  1UTX A;  2PE5 A;  2GRM A;  3BS3 A;  4YAR A;  1RIO A;  1O4X A;  2ICP A;  4Z5C A;  4Z5H A;  2R63 A;  1UXC A;  1LCC A;  3OP9 A;  2PIJ A;  1QP4 A;  1LQC A;  2LCV A;  3JXB C;  3U3W A;  4I6R A;  2KEI A;  2R1J L;  4YG1 A;  3SCF A;  2XSD C;  1L1M A;  1EFA A;  3F52 A;  3VK0 A;  2PUG A;  4J1W A;  1LLI A;  2OR1 L;  1CJG A;  1ZS4 A;  2IVG A;  4GQM A;  1WH8 A;  4FBI A;  2XCJ A;  2KPJ A;  2ICT A;  1CQT A;  1ZUG A;  1B0N A;  1X57 A;  3FYA A;  3JXD L;  4Z59 A;  3JXC L;  2BNO A;  4I6T A;  4Z58 A;  1OSL A;  1QPZ A;  3KZ3 A;  1SQ8 A;  1JH9 A;  1ZZ8 A;  1HF0 A;  2IVB A;  4FN3 A;  2AWI A;  2WIU B;  2CRO A;  2O38 A;  4F8D A;  4MCX A;  1ZZC A;  1BDH A;  1QP0 A;  1ZPQ A;  3H5T A;  3SCH A;  4YBA A;  2A6C A;  4OB4 A;  4Z5D A;  4YG4 A;  1GT0 C;  2CSF A;  2LYL A;  1NER A;  1ZZ7 A;  1PRV A;  4X4H A;  1ZZ6 A;  1X2L A;  3PXP A;  2AXU A;  1ADR A;  3OQM A;  1NEQ A;  1S7E A;  2JCG A;  2IVQ A;  2AW6 A;  3KXA A;  2BJC A;  4NDW A;  3MLF A;  2LYJ A;  2LYS A;  2KEK A;  2MEZ A;  2LYR A;  4I8T A;  2O49 A;  2IV1 A;  3F6W A;  2BNN A;  4PU7 A;  4PU8 A;  2PUA A;  3OMT A;  3B7H A;  2WUS R;  3O9X A;  2XIU A;  2MQK A;  3D1N I;  3CRO L;  2O4A A;  4J1X A;  2HIN A;  4YG7 B;  4X4G A;  2EBY A;  1LMB 3;  4IWR A;  2FJR A;  4X4I A;  1JFS A;  2JVL A;  1R63 A;  4PU4 C;  1AU7 A;  1QQB A;  3GBF A;  1YSE A;  2AXZ A;  2IUO A;  4GHJ A;  2H8R A;  2LYP A;  1BDI A;  1PRA A;  2GRL A;  3FYM A;  2KEJ A;  2L8N A;  1OCT C;  3GN5 B;  2PUD A;  2PPX A;  2KZ8 A;  1WIZ A;  3BDN A;  4IVZ A;  4X4E A;  3OQO A;  3HZI B;  3RZZ A;  1ZZ9 A;  4JCX A;  2XI8 A; 
#chains in the Genus database with same CATH topology
 3NRO A;  4PU3 C;  1UXD A;  3A9Y A;  4DE9 A;  3QF3 A;  1Y9Q A;  3CLC A;  2B5A A;  2PXD A;  3ZHI A;  1WET A;  1PRU A;  3KJX A;  2BNM A;  3QOX A;  1JFT A;  4O8B A;  3L1P A;  3PE5 A;  2LYK A;  2PXQ A;  1IC8 A;  1E3O C;  4JCY A;  4X4C A;  2IU7 A;  1LCD A;  4X4D A;  2V3C C;  1RIO A;  3SR4 A;  4ER6 A;  2PUG A;  1LLI A;  2OR1 L;  4GQM A;  1B0N A;  4ER5 A;  4Z59 A;  2PXP A;  3KZ3 A;  1JH9 A;  4EK9 A;  2AWI A;  3ZPX A;  2WIU B;  2O38 A;  4MCX A;  1BDH A;  4YBA A;  4Z5D A;  2CSF A;  1NER A;  4OBM A;  1ZZ7 A;  5DTQ A;  2KEK A;  4I8T A;  2MEZ A;  2LYR A;  2BNN A;  4PU7 A;  4PU8 A;  3OMT A;  3B7H A;  4YG7 B;  5DTM A;  3KL4 A;  1AU7 A;  1JFS A;  5DRT A;  2AXZ A;  4GHJ A;  1BDI A;  3A9X A;  3QFI A;  2PUD A;  3BDN A;  4X4E A;  5JUW A;  1RZS A;  3TEP A;  1XWR A;  2J7W A;  3TRB A;  3QYX A;  1QB2 A;  4MCT A;  1PNR A;  3EUS A;  4Y42 A;  1RPE L;  3G5G A;  3ZHM A;  3DNV B;  1RZR D;  2EWT A;  1ZVV A;  3FMY A;  3UFD A;  3G7D A;  4JQD A;  1JWL A;  5GAH i;  4IA8 A;  2XJ3 A;  4X4B A;  2PXV A;  3QOW A;  3NXH A;  3OWQ A;  2GZU A;  3LIS A;  2PE5 A;  1O4X A;  2ICP A;  1UXC A;  1LCC A;  2PIJ A;  1DUL A;  3OKZ A;  3JXB C;  3U3W A;  3GZC A;  3F52 A;  3VK0 A;  1CJG A;  2KPJ A;  1ZUG A;  2BNO A;  3G0T A;  2ODR D;  1SQ8 A;  4FN3 A;  4EKG A;  4F8D A;  4Q2J A;  2XXQ A;  1ZZC A;  1QP0 A;  1GT0 C;  1ZZ6 A;  1X2L A;  1NEQ A;  1S7E A;  4NDW A;  3MLF A;  2O49 A;  2PUA A;  5DRY A;  4J1X A;  2HIN A;  4X4G A;  2EBY A;  1LMB 3;  4EKI A;  2JVL A;  1R63 A;  2H8R A;  3NZL A;  2VEO A;  2KEJ A;  2L8N A;  1OCT C;  2KZ8 A;  1WIZ A;  4IVZ A;  3VWS A;  3OQO A;  2XXP A;  4JCX A;  2XI8 A;  4ER7 A;  3LQX A;  2L49 A;  1WH6 A;  2HSG A;  5K98 B;  3LFP A;  3GN5 A;  4I6U A;  2LNM A;  2EF8 A;  2PUE A;  1ZZB A;  2PUB A;  2PUC A;  1QQA A;  2OFY A;  2PUF A;  3TEL A;  3QWG A;  3GZD C;  2LLV A;  2PXU A;  2D5V A;  5A7L A;  4YAR A;  3DM5 A;  2YBD A;  2R63 A;  4WVL A;  5DSX A;  3TFL A;  1QP4 A;  2R1J L;  4YG1 A;  2XSD C;  1EFA A;  4J1W A;  1ZS4 A;  1MFQ C;  3A9Z A;  5DTR A;  2ICT A;  2PXE A;  4HRA A;  3FYA A;  5GAG i;  4I6T A;  4Z58 A;  1QPZ A;  3R09 A;  1ZZ8 A;  4EQZ A;  4DE8 A;  2HCN A;  1ZPQ A;  3SCH A;  2A6C A;  4OB4 A;  4YG4 A;  1PRV A;  1ADR A;  3OQM A;  2PXB A;  2AW6 A;  2LYS A;  2IV1 A;  3F6W A;  3SX0 A;  2JQE A;  2XIU A;  2LLW A;  3CRO L;  3ME5 A;  2FJR A;  4X4I A;  2MXD A;  4PU4 C;  3GBF A;  1YSE A;  2IUO A;  1PRA A;  2GRL A;  2L1P A;  3FYM A;  3GN5 B;  2PPX A;  3HZI B;  2FFH A;  3RZZ A;  2HCS A;  4X4F A;  3MEJ A;  3BD1 A;  2AUW A;  2HFZ A;  4ER0 A;  3OQN A;  2PXK A;  3GUU A;  3SCG A;  1VPW A;  1R69 A;  1Y7Y A;  1DW9 A;  3S8Q A;  1HQ1 A;  1PER L;  3IVP A;  3QQ6 A;  3R1F A;  1U2Z A;  1QP7 A;  3F51 A;  2LYQ A;  1POU A;  2PXF A;  2PXT A;  1RZR A;  2AXV A;  3CEC A;  3ZKC A;  1DWK A;  3GZD A;  4EZI A;  3UWP A;  1ZAY A;  1UTX A;  1QZX A;  2GRM A;  3BS3 A;  4Z5C A;  4Z5H A;  3OP9 A;  1LQC A;  2LCV A;  4I6R A;  2KEI A;  3SCF A;  1L1M A;  2PXL A;  1NW3 A;  2IVG A;  1WH8 A;  4FBI A;  2XCJ A;  1CQT A;  1X57 A;  3JXD L;  2XXA A;  3JXC L;  1OSL A;  5DT2 A;  1HF0 A;  2IVB A;  2CRO A;  3H5T A;  4ER3 A;  2LYL A;  4X4H A;  2J7U A;  3PXP A;  2AXU A;  2JCG A;  2IVQ A;  3KXA A;  2BJC A;  2LYJ A;  2WUS R;  3M9L A;  3NDB B;  3O9X A;  3D1N I;  2MQK A;  2O4A A;  4IWR A;  1QQB A;  2M4H A;  2LYP A;  1ZZ9 A; 
#chains in the Genus database with same CATH homology
 4X4F A;  1RZS A;  4PU3 C;  3BD1 A;  1UXD A;  2AUW A;  2L49 A;  3QF3 A;  1WH6 A;  1Y9Q A;  2HSG A;  1XWR A;  3OQN A;  3TRB A;  5K98 B;  3QYX A;  4MCT A;  3CLC A;  3SCG A;  1PNR A;  3LFP A;  1VPW A;  3EUS A;  1R69 A;  1Y7Y A;  3GN5 A;  1DW9 A;  4I6U A;  4Y42 A;  2B5A A;  3ZHI A;  1WET A;  1PRU A;  2EF8 A;  2BNM A;  3KJX A;  2PUE A;  3S8Q A;  1JFT A;  1ZZB A;  2PUB A;  2PUC A;  4O8B A;  1PER L;  3IVP A;  3QQ6 A;  3R1F A;  1RPE L;  3G5G A;  1QP7 A;  3ZHM A;  3DNV B;  1RZR D;  3L1P A;  1QQA A;  2EWT A;  1ZVV A;  3FMY A;  3F51 A;  2LYK A;  2LYQ A;  2OFY A;  2PUF A;  1POU A;  3UFD A;  3G7D A;  3QWG A;  1JWL A;  4JQD A;  1IC8 A;  4IA8 A;  1RZR A;  1E3O C;  2AXV A;  2XJ3 A;  4X4B A;  4JCY A;  3CEC A;  3ZKC A;  2D5V A;  5A7L A;  1DWK A;  4X4C A;  2IU7 A;  1LCD A;  4X4D A;  2GZU A;  3LIS A;  1ZAY A;  1UTX A;  2PE5 A;  2GRM A;  3BS3 A;  4YAR A;  1RIO A;  1O4X A;  2ICP A;  4Z5C A;  4Z5H A;  2R63 A;  1UXC A;  1LCC A;  3OP9 A;  2PIJ A;  1QP4 A;  1LQC A;  2LCV A;  3JXB C;  3U3W A;  4I6R A;  2KEI A;  2R1J L;  4YG1 A;  3SCF A;  2XSD C;  1L1M A;  1EFA A;  3F52 A;  3VK0 A;  2PUG A;  4J1W A;  1LLI A;  2OR1 L;  1CJG A;  1ZS4 A;  2IVG A;  4GQM A;  1WH8 A;  4FBI A;  2XCJ A;  2KPJ A;  2ICT A;  1CQT A;  1ZUG A;  1B0N A;  1X57 A;  3FYA A;  3JXD L;  4Z59 A;  3JXC L;  2BNO A;  4I6T A;  4Z58 A;  1OSL A;  1QPZ A;  3KZ3 A;  1SQ8 A;  1JH9 A;  1ZZ8 A;  1HF0 A;  2IVB A;  4FN3 A;  2AWI A;  2WIU B;  2CRO A;  2O38 A;  4F8D A;  4MCX A;  1ZZC A;  1BDH A;  1QP0 A;  1ZPQ A;  3H5T A;  3SCH A;  4YBA A;  2A6C A;  4OB4 A;  4Z5D A;  4YG4 A;  1GT0 C;  2CSF A;  2LYL A;  1NER A;  1ZZ7 A;  1PRV A;  4X4H A;  1ZZ6 A;  1X2L A;  3PXP A;  2AXU A;  1ADR A;  3OQM A;  1NEQ A;  1S7E A;  2JCG A;  2IVQ A;  2AW6 A;  3KXA A;  2BJC A;  4NDW A;  3MLF A;  2LYJ A;  2LYS A;  2KEK A;  2MEZ A;  2LYR A;  4I8T A;  2O49 A;  2IV1 A;  3F6W A;  2BNN A;  4PU7 A;  4PU8 A;  2PUA A;  3OMT A;  3B7H A;  2WUS R;  3O9X A;  2XIU A;  2MQK A;  3D1N I;  3CRO L;  2O4A A;  4J1X A;  2HIN A;  4YG7 B;  4X4G A;  2EBY A;  1LMB 3;  4IWR A;  2FJR A;  4X4I A;  1JFS A;  2JVL A;  1R63 A;  4PU4 C;  1AU7 A;  1QQB A;  3GBF A;  1YSE A;  2AXZ A;  2IUO A;  4GHJ A;  2H8R A;  2LYP A;  1BDI A;  1PRA A;  2GRL A;  3FYM A;  2KEJ A;  2L8N A;  1OCT C;  3GN5 B;  2PUD A;  2PPX A;  2KZ8 A;  1WIZ A;  3BDN A;  4IVZ A;  4X4E A;  3OQO A;  3HZI B;  3RZZ A;  1ZZ9 A;  4JCX A;  2XI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...