4PU8A

Shewanella oneidensis toxin antitoxin system antitoxin protein hipb resolution 2.35
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
LETIMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Toxin
molecule keywords Toxin-antitoxin system antidote transcriptional repressor Xr
total genus 22
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4pu8A00
1LMB3 2AXZA 3SCFA 2KPJA 1LCDA 4GHJA 1BDIA 2KZ8A 2PUDA 4PU4C 4FN3A 1ZZCA 1X2LA 2PPXA 4Z5HA 2R1JL 4Y42A 1ZZBA 1PNRA 1ZZ9A 2A6CA 1WETA 4I6RA 4X4HA 3JXBC 1OSLA 3OQNA 2IVQA 3HZIB 1B0NA 1NERA 2ICTA 1X57A 3G5GA 3GBFA 1CQTA 4I8TA 2AW6A 4IVZA 3JXCL 1UXCA 3F6WA 2GRMA 4YARA 5K98B 3BDNA 3CECA 2O49A 3QQ6A 4Z59A 1SQ8A 3B7HA 4Z5DA 1L1MA 1QP0A 3KJXA 2KEKA 1LLIA 2PUGA 1PRVA 3IVPA 4X4FA 4X4CA 1LQCA 2KEIA 5A7LA 3OP9A 1ZS4A 1JFTA 1OCTC 1RPEL 1XWRA 2L49A 2LYSA 3OQMA 1DWKA 2BJCA 1JWLA 3O9XA 4YBAA 3LFPA 3OMTA 3KZ3A 3FMYA 3LISA 4MCTA 2XIUA 4Z58A 4Z5CA 2O4AA 2KEJA 1GT0C 2LYPA 2LYLA 4JCXA 4J1XA 3SCGA 4X4DA 3GN5B 1RIOA 1EFAA 2HINA 2AWIA 2CSFA 2PIJA 3F52A 4JCYA 3ZHIA 1WH8A 4YG7B 2LYRA 4I6UA 2BNMA 3G7DA 2IUOA 2D5VA 3S8QA 2MEZA 4PU7A 3JXDL 1O4XA 4J1WA 1NEQA 1HF0A 3BS3A 3CLCA 2AXVA 3EUSA 1AU7A 1JH9A 3DNVB 3FYAA 2IU7A 4F8DA 3FYMA 2EBYA 2HSGA 2IVBA 4NDWA 2O38A 1RZRA 4IWRA 2CROA 4O8BA 1CJGA 4GQMA 1ADRA 3GN5A 3L1PA 2LCVA 3OQOA 1WH6A 1ZUGA 2ICPA 2BNOA 3VK0A 1UXDA 4OB4A 2LYKA 3F51A 1Y9QA 2OR1L 1R69A 2AUWA 3R1FA 4I6TA 3ZHMA 4X4GA 1ZPQA 3D1NI 4YG4A 4PU3C 4FBIA 1UTXA 2GZUA 1JFSA 1E3OC 1LCCA 1ZAYA 2IV1A 1WIZA 2WUSR 2LYJA 4PU8A 1S7EA 1QP4A 1ZZ7A 2IVGA 1RZRD 2L8NA 4X4EA 2FJRA 2PUAA 1ZZ8A 1PERL 2LYQA 1YSEA 1RZSA 1VPWA 2WIUB 3BD1A 1PRAA 3H5TA 4X4IA 3SCHA 1QP7A 1QQBA 4YG1A 2MQKA 2PUBA 4JQDA 2JVLA 3QYXA 1DW9A 2H8RA 2B5AA 3KXAA 3UFDA 1POUA 2XJ3A 2GRLA 1BDHA 1R63A 2XSDC 1QPZA 4MCXA 1ZZ6A 2PE5A 1IC8A 4X4BA 2PUEA 1QQAA 2XCJA 2XI8A 1PRUA 3CROL 2OFYA 2R63A 4IA8A 3MLFA 3ZKCA 3QF3A 2EF8A 2JCGA 3PXPA 3RZZA 3U3WA 1ZVVA 2AXUA 2PUCA 2PUFA 2BNNA 3TRBA 2EWTA 1Y7YA 3QWGA
chains in the Genus database with same CATH superfamily
1BDIA 2KZ8A 4Z5HA 1PNRA 1ZZ9A 3JXBC 1OSLA 2IVQA 1B0NA 3GBFA 3ME5A 3JXCL 4OBMA 4EQZA 2O49A 4Z5DA 3KL4A 3KJXA 4EKGA 2XXQA 3IVPA 4X4FA 1LQCA 3MEJA 1XWRA 2BJCA 3O9XA 3DM5A 3GN5B 2HINA 2AWIA 4JCYA 3ZHIA 2LYRA 4I6UA 2BNMA 3G7DA 2LLWA 3S8QA 3A9YA 3JXDL 1AU7A 1JH9A 2HSGA 3A9ZA 2O38A 5DTMA 3GN5A 1QZXA 1ZUGA 2BNOA 3R09A 1R69A 4I6TA 1DULA 2M4HA 2IV1A 2WUSR 2LYJA 1RZRD 1YSEA 1QQBA 2MQKA 3PE5A 3QFIA 3QYXA 2B5AA 3KXAA 2GRLA 1R63A 2XSDC 2PUEA 2XCJA 3SX0A 2R63A 2J7WA 3MLFA 3QF3A 5DSXA 1LMB3 3ZPXA 2KPJA 4GHJA 2PUDA 2PXLA 2R1JL 4Y42A 1QB2A 4X4HA 2YBDA 3G5GA 2ODRD 3QQ6A 1L1MA 2MXDA 4X4CA 3OP9A 2L49A 3OQMA 3LFPA 3KZ3A 3FMYA 4MCTA 2XIUA 4Z5CA 2O4AA 2LYLA 4JCXA 4J1XA 3SCGA 2L1PA 1RIOA 1EFAA 3QOXA 2CSFA 2MEZA 2LNMA 4PU7A 5DTQA 1O4XA 4J1WA 1HF0A 3BS3A 2AXVA 3EUSA 2XXAA 2EBYA 2IVBA 3QOWA 1RZRA 4IWRA 4O8BA 1ADRA 3L1PA 4EKIA 4X4GA 3D1NI 4PU3C 1UTXA 2GZUA 1ZAYA 1WIZA 1S7EA 1ZZ7A 2IVGA 4X4EA 1ZZ8A 2LYQA 3G0TA 4JQDA 3SCHA 4YG1A 3TEPA 2JVLA 1DW9A 1IC8A 1QQAA 2XI8A 2HCSA 4IA8A 4EZIA 3U3WA 1ZVVA 2PUFA 2VEOA 2HCNA 5GAGi 3TRBA 2PUGA 4PU4C 4FN3A 1ZZCA 3NZLA 2FFHA 2A6CA 3SR4A 4I6RA 3TELA 2ICTA 1CQTA 2AW6A 1UXCA 2GRMA 5K98B 1U2ZA 4HRAA 3BDNA 3GZDC 2LLVA 4Z59A 1LLIA 1PRVA 2KEIA 1ZS4A 5A7LA 1JFTA 1OCTC 1RPEL 4ER7A 2LYSA 1JWLA 4YBAA 3LQXA 3LISA 4DE8A 4Z58A 1GT0C 2LYPA 4DE9A 4X4DA 2HFZA 2PIJA 3F52A 2PXEA 2IUOA 2D5VA 2PXKA 1NEQA 2PXTA 3CLCA 3GZDA 5DTRA 2PXVA 3DNVB 3FYAA 2IU7A 3FYMA 4NDWA 2CROA 4GQMA 5DT2A 2LCVA 1WH6A 2ICPA 3VK0A 1UXDA 4OB4A 2LYKA 4ER3A 3A9XA 3R1FA 1ZPQA 4YG4A 1E3OC 1LCCA 2J7UA 2L8NA 2PUAA 2FJRA 2PXBA 3H5TA 4X4IA 4ER0A 3UFDA 1POUA 1QPZA 3OKZA 4MCXA 1ZZ6A 2JQEA 1PRUA 3CROL 2OFYA 5GAHi 3RZZA 2PUCA 2AXUA 1Y7YA 3QWGA 2AXZA 3SCFA 1LCDA 4Q2JA 2PPXA 1X2LA 1ZZBA 1WETA 3OQNA 3HZIB 1NERA 1X57A 4I8TA 4IVZA 3F6WA 4YARA 2PXPA 3CECA 3NROA 1SQ8A 3B7HA 1QP0A 2KEKA 2OR1L 3VWSA 1DWKA 2XXPA 3OMTA 2KEJA 3OWQA 2PXFA 1WH8A 4YG7B 2PXQA 4F8DA 3NXHA 5DRYA 1CJGA 3OQOA 2PXDA 1MFQC 3F51A 1Y9QA 2AUWA 3ZHMA 3GUUA 2PXUA 1JFSA 5DRTA 4FBIA 1HQ1A 3UWPA 4EK9A 4PU8A 3GZCA 1QP4A 1PERL 1VPWA 1RZSA 2WIUB 3BD1A 1PRAA 3M9LA 1NW3A 1QP7A 2PUBA 2H8RA 2XJ3A 4ER5A 1BDHA 3TFLA 2PE5A 4X4BA 4ER6A 5JUWA 3NDBB 3ZKCA 2V3CC 2EF8A 2JCGA 3PXPA 2BNNA 2EWTA 4WVLA
chains in the Genus database with same CATH topology
1LMB3 2AXZA 3SCFA 2KPJA 1LCDA 4GHJA 1BDIA 2KZ8A 2PUDA 4PU4C 4FN3A 1ZZCA 1X2LA 2PPXA 4Z5HA 2R1JL 4Y42A 1ZZBA 1PNRA 1ZZ9A 2A6CA 1WETA 4I6RA 4X4HA 3JXBC 1OSLA 3OQNA 2IVQA 3HZIB 1B0NA 1NERA 2ICTA 1X57A 3G5GA 3GBFA 1CQTA 4I8TA 2AW6A 4IVZA 3JXCL 1UXCA 3F6WA 2GRMA 4YARA 5K98B 3BDNA 3CECA 2O49A 3QQ6A 4Z59A 1SQ8A 3B7HA 4Z5DA 1L1MA 1QP0A 3KJXA 2KEKA 1LLIA 2PUGA 1PRVA 3IVPA 4X4FA 4X4CA 1LQCA 2KEIA 5A7LA 3OP9A 1ZS4A 1JFTA 1OCTC 1RPEL 1XWRA 2L49A 2LYSA 3OQMA 1DWKA 2BJCA 1JWLA 3O9XA 4YBAA 3LFPA 3OMTA 3KZ3A 3FMYA 3LISA 4MCTA 2XIUA 4Z58A 4Z5CA 2O4AA 2KEJA 1GT0C 2LYPA 2LYLA 4JCXA 4J1XA 3SCGA 4X4DA 3GN5B 1RIOA 1EFAA 2HINA 2AWIA 2CSFA 2PIJA 3F52A 4JCYA 3ZHIA 1WH8A 4YG7B 2LYRA 4I6UA 2BNMA 3G7DA 2IUOA 2D5VA 3S8QA 2MEZA 4PU7A 3JXDL 1O4XA 4J1WA 1NEQA 1HF0A 3BS3A 3CLCA 2AXVA 3EUSA 1AU7A 1JH9A 3DNVB 3FYAA 2IU7A 4F8DA 3FYMA 2EBYA 2HSGA 2IVBA 4NDWA 2O38A 1RZRA 4IWRA 2CROA 4O8BA 1CJGA 4GQMA 1ADRA 3GN5A 3L1PA 2LCVA 3OQOA 1WH6A 1ZUGA 2ICPA 2BNOA 3VK0A 1UXDA 4OB4A 2LYKA 3F51A 1Y9QA 2OR1L 1R69A 2AUWA 3R1FA 4I6TA 3ZHMA 4X4GA 1ZPQA 3D1NI 4YG4A 4PU3C 4FBIA 1UTXA 2GZUA 1JFSA 1E3OC 1LCCA 1ZAYA 2IV1A 1WIZA 2WUSR 2LYJA 4PU8A 1S7EA 1QP4A 1ZZ7A 2IVGA 1RZRD 2L8NA 4X4EA 2FJRA 2PUAA 1ZZ8A 1PERL 2LYQA 1YSEA 1RZSA 1VPWA 2WIUB 3BD1A 1PRAA 3H5TA 4X4IA 3SCHA 1QP7A 1QQBA 4YG1A 2MQKA 2PUBA 4JQDA 2JVLA 3QYXA 1DW9A 2H8RA 2B5AA 3KXAA 3UFDA 1POUA 2XJ3A 2GRLA 1BDHA 1R63A 2XSDC 1QPZA 4MCXA 1ZZ6A 2PE5A 1IC8A 4X4BA 2PUEA 1QQAA 2XCJA 2XI8A 1PRUA 3CROL 2OFYA 2R63A 4IA8A 3MLFA 3ZKCA 3QF3A 2EF8A 2JCGA 3PXPA 3RZZA 3U3WA 1ZVVA 2AXUA 2PUCA 2PUFA 2BNNA 3TRBA 2EWTA 1Y7YA 3QWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LMB 3;  2AXZ A;  3SCF A;  2KPJ A;  1LCD A;  4GHJ A;  1BDI A;  2KZ8 A;  2PUD A;  4PU4 C;  4FN3 A;  1ZZC A;  1X2L A;  2PPX A;  4Z5H A;  2R1J L;  4Y42 A;  1ZZB A;  1PNR A;  1ZZ9 A;  2A6C A;  1WET A;  4I6R A;  4X4H A;  3JXB C;  1OSL A;  3OQN A;  2IVQ A;  3HZI B;  1B0N A;  1NER A;  2ICT A;  1X57 A;  3G5G A;  3GBF A;  1CQT A;  4I8T A;  2AW6 A;  4IVZ A;  3JXC L;  1UXC A;  3F6W A;  2GRM A;  4YAR A;  5K98 B;  3BDN A;  3CEC A;  2O49 A;  3QQ6 A;  4Z59 A;  1SQ8 A;  3B7H A;  4Z5D A;  1L1M A;  1QP0 A;  3KJX A;  2KEK A;  1LLI A;  2PUG A;  1PRV A;  3IVP A;  4X4F A;  4X4C A;  1LQC A;  2KEI A;  5A7L A;  3OP9 A;  1ZS4 A;  1JFT A;  1OCT C;  1RPE L;  1XWR A;  2L49 A;  2LYS A;  3OQM A;  1DWK A;  2BJC A;  1JWL A;  3O9X A;  4YBA A;  3LFP A;  3OMT A;  3KZ3 A;  3FMY A;  3LIS A;  4MCT A;  2XIU A;  4Z58 A;  4Z5C A;  2O4A A;  2KEJ A;  1GT0 C;  2LYP A;  2LYL A;  4JCX A;  4J1X A;  3SCG A;  4X4D A;  3GN5 B;  1RIO A;  1EFA A;  2HIN A;  2AWI A;  2CSF A;  2PIJ A;  3F52 A;  4JCY A;  3ZHI A;  1WH8 A;  4YG7 B;  2LYR A;  4I6U A;  2BNM A;  3G7D A;  2IUO A;  2D5V A;  3S8Q A;  2MEZ A;  4PU7 A;  3JXD L;  1O4X A;  4J1W A;  1NEQ A;  1HF0 A;  3BS3 A;  3CLC A;  2AXV A;  3EUS A;  1AU7 A;  1JH9 A;  3DNV B;  3FYA A;  2IU7 A;  4F8D A;  3FYM A;  2EBY A;  2HSG A;  2IVB A;  4NDW A;  2O38 A;  1RZR A;  4IWR A;  2CRO A;  4O8B A;  1CJG A;  4GQM A;  1ADR A;  3GN5 A;  3L1P A;  2LCV A;  3OQO A;  1WH6 A;  1ZUG A;  2ICP A;  2BNO A;  3VK0 A;  1UXD A;  4OB4 A;  2LYK A;  3F51 A;  1Y9Q A;  2OR1 L;  1R69 A;  2AUW A;  3R1F A;  4I6T A;  3ZHM A;  4X4G A;  1ZPQ A;  3D1N I;  4YG4 A;  4PU3 C;  4FBI A;  1UTX A;  2GZU A;  1JFS A;  1E3O C;  1LCC A;  1ZAY A;  2IV1 A;  1WIZ A;  2WUS R;  2LYJ A;  4PU8 A;  1S7E A;  1QP4 A;  1ZZ7 A;  2IVG A;  1RZR D;  2L8N A;  4X4E A;  2FJR A;  2PUA A;  1ZZ8 A;  1PER L;  2LYQ A;  1YSE A;  1RZS A;  1VPW A;  2WIU B;  3BD1 A;  1PRA A;  3H5T A;  4X4I A;  3SCH A;  1QP7 A;  1QQB A;  4YG1 A;  2MQK A;  2PUB A;  4JQD A;  2JVL A;  3QYX A;  1DW9 A;  2H8R A;  2B5A A;  3KXA A;  3UFD A;  1POU A;  2XJ3 A;  2GRL A;  1BDH A;  1R63 A;  2XSD C;  1QPZ A;  4MCX A;  1ZZ6 A;  2PE5 A;  1IC8 A;  4X4B A;  2PUE A;  1QQA A;  2XCJ A;  2XI8 A;  1PRU A;  3CRO L;  2OFY A;  2R63 A;  4IA8 A;  3MLF A;  3ZKC A;  3QF3 A;  2EF8 A;  2JCG A;  3PXP A;  3RZZ A;  3U3W A;  1ZVV A;  2AXU A;  2PUC A;  2PUF A;  2BNN A;  3TRB A;  2EWT A;  1Y7Y A;  3QWG A; 
#chains in the Genus database with same CATH topology
 1BDI A;  2KZ8 A;  4Z5H A;  1PNR A;  1ZZ9 A;  3JXB C;  1OSL A;  2IVQ A;  1B0N A;  3GBF A;  3ME5 A;  3JXC L;  4OBM A;  4EQZ A;  2O49 A;  4Z5D A;  3KL4 A;  3KJX A;  4EKG A;  2XXQ A;  3IVP A;  4X4F A;  1LQC A;  3MEJ A;  1XWR A;  2BJC A;  3O9X A;  3DM5 A;  3GN5 B;  2HIN A;  2AWI A;  4JCY A;  3ZHI A;  2LYR A;  4I6U A;  2BNM A;  3G7D A;  2LLW A;  3S8Q A;  3A9Y A;  3JXD L;  1AU7 A;  1JH9 A;  2HSG A;  3A9Z A;  2O38 A;  5DTM A;  3GN5 A;  1QZX A;  1ZUG A;  2BNO A;  3R09 A;  1R69 A;  4I6T A;  1DUL A;  2M4H A;  2IV1 A;  2WUS R;  2LYJ A;  1RZR D;  1YSE A;  1QQB A;  2MQK A;  3PE5 A;  3QFI A;  3QYX A;  2B5A A;  3KXA A;  2GRL A;  1R63 A;  2XSD C;  2PUE A;  2XCJ A;  3SX0 A;  2R63 A;  2J7W A;  3MLF A;  3QF3 A;  5DSX A;  1LMB 3;  3ZPX A;  2KPJ A;  4GHJ A;  2PUD A;  2PXL A;  2R1J L;  4Y42 A;  1QB2 A;  4X4H A;  2YBD A;  3G5G A;  2ODR D;  3QQ6 A;  1L1M A;  2MXD A;  4X4C A;  3OP9 A;  2L49 A;  3OQM A;  3LFP A;  3KZ3 A;  3FMY A;  4MCT A;  2XIU A;  4Z5C A;  2O4A A;  2LYL A;  4JCX A;  4J1X A;  3SCG A;  2L1P A;  1RIO A;  1EFA A;  3QOX A;  2CSF A;  2MEZ A;  2LNM A;  4PU7 A;  5DTQ A;  1O4X A;  4J1W A;  1HF0 A;  3BS3 A;  2AXV A;  3EUS A;  2XXA A;  2EBY A;  2IVB A;  3QOW A;  1RZR A;  4IWR A;  4O8B A;  1ADR A;  3L1P A;  4EKI A;  4X4G A;  3D1N I;  4PU3 C;  1UTX A;  2GZU A;  1ZAY A;  1WIZ A;  1S7E A;  1ZZ7 A;  2IVG A;  4X4E A;  1ZZ8 A;  2LYQ A;  3G0T A;  4JQD A;  3SCH A;  4YG1 A;  3TEP A;  2JVL A;  1DW9 A;  1IC8 A;  1QQA A;  2XI8 A;  2HCS A;  4IA8 A;  4EZI A;  3U3W A;  1ZVV A;  2PUF A;  2VEO A;  2HCN A;  5GAG i;  3TRB A;  2PUG A;  4PU4 C;  4FN3 A;  1ZZC A;  3NZL A;  2FFH A;  2A6C A;  3SR4 A;  4I6R A;  3TEL A;  2ICT A;  1CQT A;  2AW6 A;  1UXC A;  2GRM A;  5K98 B;  1U2Z A;  4HRA A;  3BDN A;  3GZD C;  2LLV A;  4Z59 A;  1LLI A;  1PRV A;  2KEI A;  1ZS4 A;  5A7L A;  1JFT A;  1OCT C;  1RPE L;  4ER7 A;  2LYS A;  1JWL A;  4YBA A;  3LQX A;  3LIS A;  4DE8 A;  4Z58 A;  1GT0 C;  2LYP A;  4DE9 A;  4X4D A;  2HFZ A;  2PIJ A;  3F52 A;  2PXE A;  2IUO A;  2D5V A;  2PXK A;  1NEQ A;  2PXT A;  3CLC A;  3GZD A;  5DTR A;  2PXV A;  3DNV B;  3FYA A;  2IU7 A;  3FYM A;  4NDW A;  2CRO A;  4GQM A;  5DT2 A;  2LCV A;  1WH6 A;  2ICP A;  3VK0 A;  1UXD A;  4OB4 A;  2LYK A;  4ER3 A;  3A9X A;  3R1F A;  1ZPQ A;  4YG4 A;  1E3O C;  1LCC A;  2J7U A;  2L8N A;  2PUA A;  2FJR A;  2PXB A;  3H5T A;  4X4I A;  4ER0 A;  3UFD A;  1POU A;  1QPZ A;  3OKZ A;  4MCX A;  1ZZ6 A;  2JQE A;  1PRU A;  3CRO L;  2OFY A;  5GAH i;  3RZZ A;  2PUC A;  2AXU A;  1Y7Y A;  3QWG A;  2AXZ A;  3SCF A;  1LCD A;  4Q2J A;  2PPX A;  1X2L A;  1ZZB A;  1WET A;  3OQN A;  3HZI B;  1NER A;  1X57 A;  4I8T A;  4IVZ A;  3F6W A;  4YAR A;  2PXP A;  3CEC A;  3NRO A;  1SQ8 A;  3B7H A;  1QP0 A;  2KEK A;  2OR1 L;  3VWS A;  1DWK A;  2XXP A;  3OMT A;  2KEJ A;  3OWQ A;  2PXF A;  1WH8 A;  4YG7 B;  2PXQ A;  4F8D A;  3NXH A;  5DRY A;  1CJG A;  3OQO A;  2PXD A;  1MFQ C;  3F51 A;  1Y9Q A;  2AUW A;  3ZHM A;  3GUU A;  2PXU A;  1JFS A;  5DRT A;  4FBI A;  1HQ1 A;  3UWP A;  4EK9 A;  4PU8 A;  3GZC A;  1QP4 A;  1PER L;  1VPW A;  1RZS A;  2WIU B;  3BD1 A;  1PRA A;  3M9L A;  1NW3 A;  1QP7 A;  2PUB A;  2H8R A;  2XJ3 A;  4ER5 A;  1BDH A;  3TFL A;  2PE5 A;  4X4B A;  4ER6 A;  5JUW A;  3NDB B;  3ZKC A;  2V3C C;  2EF8 A;  2JCG A;  3PXP A;  2BNN A;  2EWT A;  4WVL A; 
#chains in the Genus database with same CATH homology
 1LMB 3;  2AXZ A;  3SCF A;  2KPJ A;  1LCD A;  4GHJ A;  1BDI A;  2KZ8 A;  2PUD A;  4PU4 C;  4FN3 A;  1ZZC A;  1X2L A;  2PPX A;  4Z5H A;  2R1J L;  4Y42 A;  1ZZB A;  1PNR A;  1ZZ9 A;  2A6C A;  1WET A;  4I6R A;  4X4H A;  3JXB C;  1OSL A;  3OQN A;  2IVQ A;  3HZI B;  1B0N A;  1NER A;  2ICT A;  1X57 A;  3G5G A;  3GBF A;  1CQT A;  4I8T A;  2AW6 A;  4IVZ A;  3JXC L;  1UXC A;  3F6W A;  2GRM A;  4YAR A;  5K98 B;  3BDN A;  3CEC A;  2O49 A;  3QQ6 A;  4Z59 A;  1SQ8 A;  3B7H A;  4Z5D A;  1L1M A;  1QP0 A;  3KJX A;  2KEK A;  1LLI A;  2PUG A;  1PRV A;  3IVP A;  4X4F A;  4X4C A;  1LQC A;  2KEI A;  5A7L A;  3OP9 A;  1ZS4 A;  1JFT A;  1OCT C;  1RPE L;  1XWR A;  2L49 A;  2LYS A;  3OQM A;  1DWK A;  2BJC A;  1JWL A;  3O9X A;  4YBA A;  3LFP A;  3OMT A;  3KZ3 A;  3FMY A;  3LIS A;  4MCT A;  2XIU A;  4Z58 A;  4Z5C A;  2O4A A;  2KEJ A;  1GT0 C;  2LYP A;  2LYL A;  4JCX A;  4J1X A;  3SCG A;  4X4D A;  3GN5 B;  1RIO A;  1EFA A;  2HIN A;  2AWI A;  2CSF A;  2PIJ A;  3F52 A;  4JCY A;  3ZHI A;  1WH8 A;  4YG7 B;  2LYR A;  4I6U A;  2BNM A;  3G7D A;  2IUO A;  2D5V A;  3S8Q A;  2MEZ A;  4PU7 A;  3JXD L;  1O4X A;  4J1W A;  1NEQ A;  1HF0 A;  3BS3 A;  3CLC A;  2AXV A;  3EUS A;  1AU7 A;  1JH9 A;  3DNV B;  3FYA A;  2IU7 A;  4F8D A;  3FYM A;  2EBY A;  2HSG A;  2IVB A;  4NDW A;  2O38 A;  1RZR A;  4IWR A;  2CRO A;  4O8B A;  1CJG A;  4GQM A;  1ADR A;  3GN5 A;  3L1P A;  2LCV A;  3OQO A;  1WH6 A;  1ZUG A;  2ICP A;  2BNO A;  3VK0 A;  1UXD A;  4OB4 A;  2LYK A;  3F51 A;  1Y9Q A;  2OR1 L;  1R69 A;  2AUW A;  3R1F A;  4I6T A;  3ZHM A;  4X4G A;  1ZPQ A;  3D1N I;  4YG4 A;  4PU3 C;  4FBI A;  1UTX A;  2GZU A;  1JFS A;  1E3O C;  1LCC A;  1ZAY A;  2IV1 A;  1WIZ A;  2WUS R;  2LYJ A;  4PU8 A;  1S7E A;  1QP4 A;  1ZZ7 A;  2IVG A;  1RZR D;  2L8N A;  4X4E A;  2FJR A;  2PUA A;  1ZZ8 A;  1PER L;  2LYQ A;  1YSE A;  1RZS A;  1VPW A;  2WIU B;  3BD1 A;  1PRA A;  3H5T A;  4X4I A;  3SCH A;  1QP7 A;  1QQB A;  4YG1 A;  2MQK A;  2PUB A;  4JQD A;  2JVL A;  3QYX A;  1DW9 A;  2H8R A;  2B5A A;  3KXA A;  3UFD A;  1POU A;  2XJ3 A;  2GRL A;  1BDH A;  1R63 A;  2XSD C;  1QPZ A;  4MCX A;  1ZZ6 A;  2PE5 A;  1IC8 A;  4X4B A;  2PUE A;  1QQA A;  2XCJ A;  2XI8 A;  1PRU A;  3CRO L;  2OFY A;  2R63 A;  4IA8 A;  3MLF A;  3ZKC A;  3QF3 A;  2EF8 A;  2JCG A;  3PXP A;  3RZZ A;  3U3W A;  1ZVV A;  2AXU A;  2PUC A;  2PUF A;  2BNN A;  3TRB A;  2EWT A;  1Y7Y A;  3QWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...