4PUBH

Crystal structure of fab dx-2930
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
212
Chain Sequence
VQLLESGGGLVQPGGSLRLSCAASGHYIMMWVRQAPGKGLEWVSGIYGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords DX-2930 HEAVY CHAIN
total genus 43
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH01
1C7TA 1Z9LA 2DL9A 1T5WB 4L8CA 5C0FA 1XGYH 1Q94B 3TVMC 1NCCH 2XICA 4XPAL 4HUNB 1KELH 3ET9F 2BC4B 3QI9A 1UGNA 5I8OL 4KRLB 1MVFA 2P24A 5T5NF 4AG4H 2IAMC 1RHHA 5EZIL 2CDEA 2F54B 1AO7E 3SE3C 1I9EA 1XGPA 5KSAC 4IHOA 3GSNL 5ESQB 5F9OH 3K2MC 1WV7T 4DZBB 1X5FA 3CFDA 5IJVA 1I1CA 2H6PA 1RVFL 7FABH 1JNJA 4DAGH 3E6HB 2AJSL 1QBLH 1VGEL 2V7NB 4LSSL 3CXDH 4JLRB 4L8DB 4NZTH 2J1KA 1R3HB 5KVEH 4P23C 4CU7A 5JQ6L 2JJSA 1WFUA 2R69L 3MOBH 2VDNH 3IXAB 5CINH 4XH2A 4CNIA 5B38A 4OLWH 1FBIL 1VPOH 3DVIA 5C2BH 4UDTA 2PXYD 2VL4A 3U0PB 3ARRA 3E1F1 3PNWA 3RKDC 1FFPB 3M8OH 2Y36H 1U8OA 2IC2A 1CGSL 5HGAA 3HA0A 1CDIA 1NKOA 1WZ1H 3FQNA 5HHNB 4P4KC 4Y5VA 5DGRA 4WI6A 3CFEA 1R0AL 4LF3B 3U9UA 2JLLA 4JFYB 1QRND 3K4ZA 1FNEB 2IPKA 4WUKL 3GI8H 2NTFB 1MFCL 4P5KB 4JM2D 4S1SL 1CF8H 4B7IA 3MA7B 3MXVL 4JLRA 3EBAA 2DL2A 5C0GB 1FPTH 1PG7X 3RWCB 4HQQH 3T3PF 1GOFA 3VFNA 3TZVB 3U79A 4MNGB 4W68A 2UY7A 1RPQA 1WZ1L 1MFBL 4YXKL 4XBGA 4JFPA 5J3HC 1BQUA 4CMMB 3GSXA 4I2XE 5FGRA 3HZKB 3QZWA 2AK4E 3PGFH 3CDCA 4JN2B 5TE4H 4J23A 2VZSA 1IC1A 1T1YB 4X98B 4M7KH 4Y16C 4OM1H 3VGDA 3M17A 1LDPL 4S1DD 5T5FL 1G1YA 3F7YB 4ODWB 2OK0L 2HTKC 5DEGB 1P4BH 3C8HA 3QULA 2OSLA 1MFBH 2GFBA 4YXKH 5E8PB 3CXDL 2NY0B 4FQ2L 4LSSH 3GMOA 4DAGL 1T89A 3IU4L 1LQSR 7FABL 3O4OB 4NM8L 2ZNWA 5C0GA 1MRDH 2XTJE 3FT4B 4NO3A 4JO1L 1T80A 3ZKNC 1BHGA 3TWCH 1A2YA 3HNSH 3P2TA 2YN5A 1DSFH 4FG6D 4XCFH 1U95B 1IGCL 1WGOA 3ILQD 4D0BA 3NAAH 3O8XA 1IFHL 1AE6H 2ERJC 5GRUL 1UA6H 1MNUL 2VDPL 1N7ML 3ULVD 3SE9L 5IB2A 1FO0A 1XGUB 3LHPH 5D1QC 1XGYL 3HZKA 4Z78B 1KYOJ 1P4LB 1C08A 3HNTL 3O2DL 5MERA 1FL5A 3MBEB 1PYWB 4Y4KA 3VXOA 1FL3B 3QCTL 2R56L 2EH7L 4LLYB 2FIKA 3IKCA 1BVKA 4K3GA 1I4FA 1HZHL 2F5AL 3HE6A 3VFPB 3RAJH 1JTTA 3RQ3A 3CCHB 1N59B 4TPRH 3TA3C 2I9TB 3UZVB 1FYTB 4KPHL 4LPXA 3Q3GA 1BAFL 3DX8B 1Z5LB 3S35L 5E8NB 1JWUB 5I16A 2FATL 3R06A 5HDBF 4EEEA 1RZGA 4PJBF 4UINL 3REWB 5EU6A 5ICZA 3L7EB 2VR5A 3X3FL 2EKSB 1YECL 3ZLQC 1FN4B 4DVRL 4KHXL 1P5VA 3MYJB 3QXVA 4JFFE 4NHUB 4GRLC 3OKEB 3HNTH 2EYSA 2VDMH 4PJXF 1FVEA 4ELKA 5DUML 4OQ1A 2A9MH 4TUKH 4XPAH 3WBDA 3FJTA 5FO9B 5AEAA 1J8HA 2ITDB 2QEJA 1FG2A 3WXVH 3KXFD 3S3PA 3VFPA 5FYJU 4QGYA 4XCFL 1D9KC 4LHQB 4HFWA 4HJ0D 5BZDB 5E6IA 3ZKXC 5F89A 4S1QL 4D9LL 4MD0A 5J12C 5DJ0A 1MJUH 1T3FB 5EIVA 2NW3B 1QLFB 3QRGH 4M3JA 5D70H 4KZDL 1I8LC 3ROOB 4XNUL 2GJ6D 4RFEA 3SDDB 1A6ZA 2Z93B 3ETBF 4NQED 1BP3B 3GMQB 3OKKB 4TOYL 5D72L 3GSVB 1PY9A 5KW9L 3AFLA 3A6CL 1RUMH 3QWRD 4FZ8H 1FFOB 1NEZG 1P7QA 3EFDH 1H5BA 1XF2B 2OR7A 3I75A 3NCYS 3O4LE 2VDQL 5INDA 2O61B 3WS6C 2IMNA 5TF1H 4QRTB 3STZB 1T21B 4XXCA 3MROA 1MUJB 3VFTB 5FOBB 2WUBL 5HBBA 1JV5B 4CMHB 4V1DE 3RL1A 4ORZC 3ZSSA 4O51A 3E6FA 2QQQA 1BZQK 3T3MF 4JPIB 4F7MB 3T0ED 1OGAD 4DQOH 2BSTA 4WFHD 3TBWA 4OKDA 5BS0D 2F74B 1Q9KA 1MI5A 4N0CD 4OD3H 5CGYD 1I3VA 1OT1A 3SGDI 4CMHC 2F5BH 1TIUA 5KVGH 4X7EC 2ZUUA 1U6AL 3GI8L 3QZWG 4OZGB 4GG6F 2YZ1A 4K3EL 5CIPA 1PLGH 1CD0A 3TV3H 4DGYL 4X4MA 1NGYB 4XVUD 1R0AH 2CIKB 4LLDA 1PAMA 1UXWB 2A6DB 5DURD 4NCC2 4KRPC 4RBPK 4HD9A 1A3LL 5DI8A 3BPLC 3RGVA 4HIXH 1RJZA 3VRLE 1JFQL 3QCVL 3MV9D 3O6ML 5BV7C 3GJFB 1JP5A 2RJMA 4YDIH 5ENWA 4G7YL 4TNWF 4FQHB 3CD4A 1NDGB 3TFKC 4P9ML 4DGYH 5MI0C 3VXUD 5IWLA 2WW8A 3U0WH 4FXGB 3EDEA 2COQA 4KDVA 3MUY1 1VADB 2EDQA 4MDIA 1VFUA 3QO1A 2FGWH 2DQHH 4OD1L 1BECA 1UH4A 4LARH 2XNAB 3F7PC 4Y1AE 1XZ0B 3PWUA 4U1MB 5IFAL 4GKZA 3GSUB 3WIFA 4D94A 4XBEL 1SYSA 1EXUA 1AXSA 3ZE1F 2R8SH 5IEKB 3BZFA 4OFDA 4TTDC 4YDKL 4R3SB 3LIZH 3L5WB 1AGFB 1JVKA 5CSGA 2EE2A 2VDQH 3S35X 3RA7L 4XVTH 3C2SA 2GJ6E 4FFYH 4J6RL 3ZYIA 4NQCD 3FB7B 4KVNL 4LNVA 4FZ8L 2FEEI 4AIZA 2XZAL 3ARBB 1YZZA 1BJMA 3SDXE 2AJYH 3MLUL 3LN4B 3NCJL 5FUZH 1MIML 5KOMC 3LD8C 3G5XA 5EOCL 3VI4E 1Q9LA 5C08E 3O6FB 4UTAL 1IEBB 4JKKA 1G7PA 1RHFA 3U2SB 2YXMA 5DA0B 1AKJD 5E5UB 5IMKB 1RAMA 2Z35A 3PWUB 1X5GA 3HI6H 3VD7A 1FHGA 3BIAX 4X6CA 4BFBD 2RIKA 5IB3A 1BEYH 4V1DD 4XC1L 4GKSA 4JFDD 4RFNC 4AT6A 1U95A 4LHUD 4YPGA 3KPPB 4WEBL 1EJ6A 2P8LB 3DUHA 1IT9H 4EBQL 1PG7W 3SDAB 1YYLH 5ETUB 4RGNE 4OLXL 5GS0D 1J1PL 5E4EB 5HYSG 1KG0B 2CGRH 1WWBX 4KJPD 2BDNH 5FFLA 4ODHH 1A7NH 4KHXH 1HCVA 4PJ7E 2OYPA 3TA3D 4JQXA 2ZCLH 5T33H 4YLQT 1TETH 5KJRH 3VFWA 1NC2D 5KSBE 3WN5C 1PQZA 4K7PL 4YFLF 1WCBA 3X13A 3MLSH 1U8PA 1Q0YH 4HJ0C 3EOTL 4HIJA 3H7BA 3WNMA 4JGMA 3KJ6L 5GRVK 4PJEE 4NN5C 1QSED 1FZKB 4YPGB 4P2RE 1PJ9A 4WDIA 2I9LA 3K8LA 3NBNA 2WBWB 1IGJA 3RIAK 1BZ9A 2X7LA 5HI5C 1KJVB 2R1YA 1OAUH 3DUUB 3D39E 1MQKL 4RMSA 4ETQB 1F00I 2HLAA 4WW2A 4XTRD 2EECA 3L1OL 3Q48A 1A7RH 5KSBB 1N8ZB 1MCBA 4UIKL 1RUAL 2Z0BA 3ZDZE 1T22B 3BZ4B 3UDWC 4PJBB 1N7MH 5SX4I 4JAMA 5D7SH 4BUGA 1U3HC 1OAYH 5I1JH 1PKOA 3O3UN 5DWUL 3VFOB 2IALB 4HIHB 3FB5A 4LQ1A 3MGOA 5FF6A 5KSUB 3VFGH 3RBGA 3HNSL 2FD6L 3QWRA 2VE6A 4FQQA 4LHUG 5HY9B 1LMKA 3EOBA 5D7LB 5IKCA 3FFDB 5GZNC 1HYSD 3VG9C 2OI9C 3FQUA 4TSAH 4KK9C 4LASH 3O9WB 4M7JH 1I9RH 2I5YH 3TFKD 3RVWC 4FHBD 4WWKA 1KJ2L 1CE6A 4U33A 1NFDF 4O2FA 1RUQH 3EOYG 3H3BC 4M7KL 2YRPA 3VD9A 1X5IA 3C8DA 4UIMB 3EYOA 4PGEB 4Y5VB 5CD5C 4XHJD 5DT1L 4Y4HD 2O61A 1CL7I 2LAGB 2AQ1A 4M93B 1KACB 2Z31C 2G5RA 3QIWB 4GRWE 1S7SA 1MIEH 3FFCE 3F65A 4I0PD 4F2MA 4HKJA 1F4HA 4PRAA 5H8DA 4Z7WB 1NC4B 3KVQA 1E27A 5D9SB 4X9GA 3MBXH 4MNQA 3NIFE 5F97E 2IEPA 3DVNB 4HPOL 2P47B 3FN0L 1JPFB 2APBA 5D8JH 3RGVD 4DTGH 3C8KB 3QISA 4UQ3B 3OXRA 4KUZH 5FGCE 3VW3H 3RWIA 2Z4QA 3HC3H 3MRHA 4LEXL 4JRXE 4XMPH 4ZSOA 4QO1A 3TVMB 4GG6A 4DKFL 3QXAB 4KTEH 4G6AC 5FYJL 4DEPC 3AUVA 1QA9B 1PGRB 1KCRL 1ZK9A 2H32H 1MCSA 1JGDB 3JV4A 2R29L 4OUOA 4OQTH 4KK5C 4BJLA 4MJIE 3F7YA 1EEUA 3SGEH 3ARFD 3OR6A 5JNYB 5JR1L 1HIMH 5KAQF 3EJYD 1S7SB 1LEIB 4UT9H 3BP5A 1XR9A 4F37F 4OLWL 4NKOA 1W72A 4EOWL 1DQJA 1NSNH 3ARYA 2E7HA 4P5TB 5I76A 4HWEH 3O9WD 4PLJC 5JQ6H 2CRYA 3FN9A 3HG1D 5EO0A 1YMMA 1KCVH 3VI3E 5IGXH 1X5XA 4P2OB 2UYLA 2KQNA 3GKZA 2LFGA 1GZPA 4X7SL 2V2WB 3MRMB 1CFQA 4YHPA 3DI2B 4TUOB 3IFPA 2H2PC 4RSVA 3WEXB 1RURL 5ISZA 2M1KA 3P77B 4V2CB 5FYLD 5HDBE 1LO5A 1FL3A 1Q1JH 5INCB 1ZS8A 1R3KA 3CH1B 3OKDB 5HI5D 2MKWA 4DN4H 4KQ3L 4BH7A 1SJHA 3V0VB 4OZGF 3SO3B 5CBEB 1IC7L 3MR9B 1A1MB 4XVSH 1J1OH 3TF7C 4K8RH 3PDOB 4XB7A 3I6GA 3BFOA 4X4XA 1ODAA 1OAXL 3W39B 4NNPL 1M7IA 3BQUA 4O58L 4NNYA 4DKEL 5C7XH 5GS0H 1D9KA 1SYVB 2HN7B 3O3BB 2YPVL 4HUKB 3BKML 4V1DA 3MV7D 4HT1H 2YPKB 2EDXA 4KUCD 4H20H 1ADQH 4XNQB 4ZOCA 3GO1H 4YE4H 3L7FA 4JRXD 4OIBA 5JOPE 1U8KB 2P7TA 1B4JL 3BVNB 4ODSL 1FNLA 3DV4A 2PKDA 2X1PA 1Q38A 3MGAA 5DLMH 1HH6A 3BMWA 2XQYK 4YQXH 1IAIL 5J4MA 2JB5L 4JFDE 3TIEA 4NWTH 1EIBA 5HJ3A 5MEQB 4WTZG 4KKCD 5I74B 3UJTH 5MHSE 1A21A 2VZVA 4K3DL 1QLFA 1F90H 2VAAA 4NWTL 4R4NC 2FWOB 3VFRA 1BBJB 3QUYB 3BDXA 2AJZB 4YHML 1II4E 1GH7A 3G6JA 1RK0A 3S36X 3G5YB 1PSKL 2PO6D 1RV6X 4X4YB 1YYML 2AJUH 3I6LD 3FO1B 4LP5A 1F5WA 2YPLE 5F9JA 1AGBB 3VWJB 4EKXA 1FCCA 3HG1E 1NGPH 2NYYC 3V5DA 2DBLL 2H45A 3EYSL 3IDNA 1HILB 1DVFA 4I3RL 4HS6B 4YDLB 1QPXA 5F6HJ 3SGJA 3MV11 3T0XA 1F4WL 3MV8A 2EXYD 1AQKH 1I8IA 4NC1C 4ELMB 2YD7A 5FYKU 4G80B 5F1IB 1HXMA 4MLIA 2OZ4H 4HWZB 4JQVA 1DL7L 4JRYA 2KUTA 2LTQC 4QGTA 3TBYB 1F58L 3HKFA 1GPOL 1VESA 5L8KB 1EPFA 4AEEA 5F7EH 5C0CA 5DHYA 1ZAGA 1QVOA 3QA3A 1UH3A 3FAXA 5E2JA 1PZ5B 4PJGB 1VB9A 3QUXD 1QEWB 2AABL 5LWYL 3VGHA 5C0BB 1UZ6F 4JREC 3HUJA 1HWHB 5D2LA 1NGYA 5J1AA 4MCYB 4DVBA 1N3NB 2X4SB 4LSUH 1YEGH 5I1CL 2FECL 1QO3A 3NFNA 3PWVA 1MHCB 5KZCB 2W0FB 4PLKC 3DTXB 4LDLB 4NQEB 4LU5H 3QIBA 3S37L 2DICA 5D1XB 4UV4H 2Y5TB 4XT1C 1XGTB 4XNMB 4XPGH 3VXNA 1EMTH 3VXRA 5GZOC 4JKLA 1RIHL 3RKDD 1R5VA 1G7JB 3WLWC 3UROR 3RDTD 3DGGA 1AD9A 3DMMB 2UZIL 3VDAA 1JPGA 2GCYB 1XIWA 3IU3B 2DM4A 2NXYC 3IDIB 1P9MA 1E27B 2X9WA 4U1GC 1D6VH 3L95A 3DVGA 3HAEA 5H37G 1OSPH 1YJDC 4OZIA 1XF4B 3VWKD 4CNIB 2DQEL 1KFAL 3LSOB 5SWZA 3RVTD 3SO5A 4PJCA 2Z31D 3MRCB 5MHSD 1MCPL 2AXGA 3SCMB 4MXWL 2GFBB 1G7HA 2VL5A 3MJ6A 5FIEA 3GMNB 3B5GA 5DD6B 5LVEA 1CQYA 1IGTB 4PGZA 3IB4A 3VFSA 4D9QE 3LN4A 2AGJH 3TNNA 3ARVA 3FO9A 1WF5A 4KUZL 2EDHA 3NH7L 4U1HB 3FN0H 3IDIA 4HCRL 3KYMB 3WKMH 4LSRH 1FNGA 1BOGA 4WUUB 5IG7A 1I7ZA 3ZDXF 1YEFL 3HMXA 1C12A 2FJFB 2UUDH 4H26B 4OGAD 2EEDA 2KPNA 5FYLE 5CEZL 1CLYH 2EXWC 3KPSA 2F19L 4MXVE 5IF0B 2VISB 2FO4B 3RU8H 5I8CA 1WQVT 5EOQH 3ZKQD 4F9PC 4POYA 4NP4L 4JFOB 3P0YL 2YBRB 5J89A 7CGTA 4OSUH 3H3PH 3CJJA 4YHOH 3FB6A 5DMIH 2NY5L 5IUSA 2BRRH 5C0DB 2YC1A 2GHWB 3RVVC 1S78C 1F45A 1U91B 2H32B 1JYVA 4X7FC 5K9KA 4K71B 2DJSA 5IHLB 4X98A 5E6YA 4LK4A 1S7RB 3PL6A 3UAJC 4UB0H 3QUKA 1Q0XH 4QRUA 4NJ9H 1T5XB 5E8PA 4LQFL 1OP9A 3DURB 2J8HA 4XP4H 4X5WB 5DWUH 5JPMA 3JVGC 1EUUA 2VDKL 4NO5B 5IESL 5C09E 1SY6L 5I1AB 1GC1H 3MFGB 4YX2H 4JHWL 4U1SB 5I1KH 3CFKB 2ADIB 1OQXA 4OLVH 3CPLA 1KEML 4MYWB 3ROLB 4GKNB 5DQDH 3WN5B 1U8QB 4F15B 4Y2DB 1E6JL 5ERWA 3VJ6B 2KZ1B 5IMLA 3GJEB 1FGVH 1EH9A 4OIIL 4PY7B 2IFFH 3WO3B 4Y4KB 3VXOB 5IW1B 3BZ4A 4P46C 2OTWB 4PJ7F 4HGWA 1KENL 1FGVL 4OIIH 1JF1B 4JY6B 4NRYA 2IQ9L 4DFIA 3P9MB 5JW4R 1KBGH 4W4OA 3ALPA 5IVXB 1S7TB 4MA8L 1T1XA 3MLSL 1F4XH 4HH8A 2WQ8A 4LOUC 2GTWA 4H5SB 4F58L 2XWBA 1QQDB 3RNKA 2X4QA 4FQPA 1CLZH 2ARWA 1Y6MR 2A6IB 3MRKA 3MRJA 4ODHL 3B9EA 4OZHE 2ZZUT 3RDTC 5F7FA 3IFNL 3LD8B 2DQFA 2X4TA 4Y16D 5F3BB 3VXSB 5GZOD 3S34H 5E2TL 3O6KL 3B3IA 1CFNA 1J7VR 2X70A 1OSZA 2YD5A 3MJ9H 1ZHNB 1WZKA 4F33A 4FABL 3VXTB 3IVKA 3KDMB 1QHPA 2G9HB 2PN5A 2CKBA 5C0CD 3GMMA 5HHPB 4ZNEA 4OSUL 2YD4A 1CICB 1MY7A 4ZQKB 5EC2B 4KK5D 2DI9A 2EZ0D 5EO9A 2YD2A 3CX2A 3QEGH 4OI7A 5I1DA 1WIOA 4RFOL 1IGYA 4F15C 3PJSA 1OB1B 2EDEA 4MCZA 4JO4L 3QHZH 1HXYA 1MJ7L 2DWDA 1X4ZA 3GJFH 1TZIB 4RFEB 1V05A 1MAKA 1DFBL 2VDOL 5DUBB 4LSRL 4WHYH 1N6UA 5ANMA 1AY1H 5DJ8A 2WINA 4WU5A 3NCCB 1K5NA 2FGZA 4R7NA 3MNVA 1MI5D 4R6UA 5BS0E 1W8OA 1A6VL 1XIWD 4FQIH 1JHLH 2IANA 5BVPL 4YDKH 3JWDC 4UOJA 5D5MB 3CUPB 1E4WH 1FAKT 4NKDA 1HSBB 3LEYH 1U3HB 4NBZB 4Z7UF 4P0DA 4TNVK 3C5SB 3MJ7B 2B1HL 1NBZB 1WBXB 1G1CA 3NFSH 4R0LB 1MCPH 1CD8A 1CDCA 4JVWA 3W0WA 3SDXB 4YEEA 4LVHC 5B39G 4I4WB 4MGXA 3HZVA 4LLAA 2FNBA 1YEEL 4OF3A 3LVEA 1R5WA 4L8BB 5HDOA 4MMXC 4BM7A 4GG8A 1O0VA 1Q9KB 1SHMA 3FRUA 4YHIA 5HYSB 4E0RA 3BGMB 2AK1H 2WINB 4WU5B 1J5OL 2OJEB 3JZ7A 5ESVB 2BK8A 2Q76B 4JY4A 1DBML 1S7XA 4JRWA 4PJDB 2A6KB 4XVJL 1P4IH 1YC7A 1A3RL 2Z8WC 1DBBH 1RZKL 3RWFB 1IAOA 2QQLL 3O81A 2R1WA 4Y1AB 2VC2H 3B83A 1LK3H 5GGVH 4AK1A 1T7ZA 2BC4A 1PLGL 3QI9B 1FZMB 2ZP0T 3PGDB 1U93B 2X4RA 1DDHB 1WTLA 2F5BL 1UVQA 3WIHH 5I17B 3LY6A 1G7IA 3LQMA 1WZMA 4IM8A 5FA4B 4K2UL 4XMKH 1YNLL 5DSCA 3VRJA 1LO3H 2YUXA 3GSRB 4GBXB 5JXEA 4NUJB 3FONA 4LLWB 3OF6D 4OCYL 3V8CA 3T77B 2J8UB 1A6WH 4I0KA 2AABH 4H1LB 2XWJA 2ICWI 2G5BB 2QV2A 2OP4H 3GBMH 2GQHA 1IQWH 4YXHL 4Y5XC 1X44A 4U6YA 4GRLA 1U8NA 1GJIA 3PWPD 1AXSB 4G42B 4KK6C 1T0NA 32C2A 5DJ6B 2DI8A 3FQTB 1G7LA 4C56D 2P7TB 3CNKA 3BVNA 3BE1H 3C6SB 4OZGE 1AQKL 3SKNA 3VD5A 2DYPB 3WNLA 1TVBB 5GIRA 3RZCC 5JZ7D 5TQ0H 3GHEH 3KGRA 1IARB 2GAZB 5FYKL 1QKZH 3QFDB 5I8KH 1WIUA 3RDTA 2GJZA 3SGEI 2EYRB 1IEBA 4XNXH 2X44D 1DQMH 3AM8A 4GBXD 3NZHL 4S1QH 3FO0L 2ARJA 3NN8B 2C1PA 2X7LB 3MPCA 1M71A 4N0YL 2D31A 5CJOL 4Z76A 4ZAKD 3IFOA 1N8ZA 4K3DH 4LLVA 4OQTA 1HQ4B 2E7MA 1KLGB 3U48A 1FNSL 4J3TA 4Q2ZB 3U36A 1MCIA 4LGRB 5JHDA 3P73B 4UDUA 3ESVF 3PWLB 4M1CC 1NMAH 3AXLB 4M6MH 3JWDH 2CDFB 2E27H 4KQ4H 1TVHA 2F53D 1V7MH 3NTCL 1VEMA 4DVRH 4LLQA 3MRDA 2RFXB 4J4PD 2VLMD 1BFVH 2FBJL 3T09A 3QEHB 5DJYA 3D48R 3QUYD 1KG0A 3T2NL 3VD4A 3QUMA 1I1YB 1KJMB 2GEEA 2ZCKH 2X9YA 4HT1L 4HC1H 4U1JA 3OKNA 1I3GH 2DN7A 1TFHA 4TULL 5CWSA 1CQKA 1JCKA 2ERJB 3QFJB 4K7PY 5DS8B 25C8L 3DHJA 4HX1B 5TH2A 4MJ4A 4UNTA 4Z8FL 2BNQA 3HS0B 1HDMA 3QEUA 2Q6WB 3JTSA 4LDOB 1LVEA 1ZVSB 4NQDA 4OLUH 1CLOH 3TO2B 4JFFB 4HK0B 4FFVC 2HH0H 4P46A 2YKLH 5C0RH 5D71L 2BOBA 2LABA 1OD7A 3VXRB 3KHOA 5B21A 4M9PA 3MRDB 5E6IB 5FCUL 3OHXA 4LAJH 3IXAA 2CLRA 3OJDB 5HPOA 4WV1A 5MERB 1N2RB 5IHUL 5DK0A 4K9EC 4XGZA 4F7PB 3IRPX 4FZEL 3MUJA 4JQIH 1VFOA 2FH8A 3SPVB 4KTDL 4MA3A 2C3HA 1NCNA 3LQZA 1OPGL 1YPZA 4XAWH 2VDLL 2DQDL 4NQDE 3RWDB 1DUYB 1TZIA 1NCDL 4MXVF 1G0DA 1BVZA 5KVMC 4WFED 5DHVB 4Y7MA 3PDGA 3WKNA 1HQRA 1ORSA 5EUOF 5HYJA 4XTRC 4M6OL 3VXSD 4ELME 1J8HD 2B8OT 5L7XL 2DM2A 3QJFB 1NMBH 3AB0B 3CAFA 4KRMB 5ALBL 4O2EB 4XHJC 3VGBA 1NBYA 4HBCH 2J4WL 4HWNA 5CP7A 2R29H 3ZE0E 1KB5B 35C8H 4X4ME 1GC1C 5FYJH 1DUZA 2VQUA 1SQ2N 5I0DA 2X41A 5J9PB 2PTUA 4NHCL 4CMMA 1E6OL 4JG1H 4HS3A 3D0LA 5T3XE 3E6HA 2H8PA 4YFEA 4Y4FB 1AXTL 5CMAB 4ODVH 3ULSA 1N5YL 1QBMH 1IZKA 4JFEE 2B5IB 4OZFA 5C07E 2BSRA 1Z3GL 4I18A 1KN4H 1WBZA 2IAMA 3MBXL 2EZ0C 3KLAB 5EWIH 1IGIH 1UWEH 4D0CA 3SDDC 3QDJB 3WL9B 1OM3H 1EUTA 5SWQB 1IM9B 2VXQL 3DXAA 3NIGE 4Z95H 5HHNA 2ZSWA 1IAOB 1A7OH 5KTEL 1OP5K 1I8MB 1KCUH 4NJAL 3DO7B 2QSCL 4P3DB 1UQSA 4GS7C 1A1OA 2VLRA 3T0EB 5DO2C 1D5XA 4ISVB 1V3JA 4LASL 1JV5A 5C0EA 1LHZA 1Z9SA 3CVHA 2ADGA 2DIBA 5L2JA 4PBVC 2BCKB 1MSPA 3GSXB 5F9OL 4H1LA 4IMKA 4XBGB 1FLRL 5B38G 4DGIH 1X4XA 3I6KA 5EZIH 2E9JA 3ARBA 1QUNA 1VERA 2WWMD 5L8JB 4DKDC 3BIBX 5FYLL 1QYGH 5HI3D 3DX6A 3L3DB 2P44B 3C60B 1S3KH 4N90D 2FEDD 4MB3A 3WHE1 2CLZB 3NPSB 2YK1H 3VGAB 2GT9A 1CS6A 5HHVH 3INUL 4X4YA 1Z9MA 5CEXA 4HZLB 2FEEL 2QR0A 2AQ2A 3H6JA 1F3JA 5D7JB 3FT4A 4G6MH 1FZKA 2E7LA 3AU1B 4HAGA 4XXDA 3RTQB 2UWEE 1FP5A 5GSRB 4RWYL 5GGRY 3VE0A 2JK5A 2NW2A 1Q9OB 2VUOA 1H3TA 4JM4L 5FO7B 5FYKD 3NCBB 5EU5A 4PV9B 3LS5H 3V6ZA 2CKBB 1S8DA 1U8PB 1KJ3L 4OM0H 4IOIB 5E5MB 1UT9A 3B2UC 4LIQL 3SE4A 3VDCA 3BJ91 5EZJB 1YYLL 1TTUA 5J1TC 3UBXB 3BAEL 3D18B 1L0XA 3SDYH 2XRAH 4EBQH 5FA3B 3CVHL 4DWHA 1ORQA 4PUBH 3EO1B 4AQOA 3BP7A 2FO1A 1EHNA 4QY8A 5CILL 4EN3D 3IDUA 2EC8A 3MRGB 5DMJB 3VRIA 5F7MC 2EH8H 5D7JC 1A9EB 1CXLA 1YN7A 3RVUC 1K4CA 4MS8D 2ORBL 3ILPA 3STBA 3MZGB 2HTKD 5DRNA 1EX0A 2JK5B 5E99H 5AYUH 4WO4C 3A67L 4IRSD 2MQ3A 4A6YB 1XGPB 3GIVB 1BQLH 1MHHA 2I60H 4JM2A 1WEJL 5DUPL 3TH4T 3C60C 1UJ3A 1DCLA 4WUUD 1XIWB 4UTBL 4PLKD 1GGBH 3VXUE 4MWFA 1ROWA 3KJ4C 2LVCA 3MRLA 4J6RH 1EHAA 1WITA 5DQ9B 2W9DL 2VB5A 2IQAA 2Q3AA 3EO0B 4KK8C 4OLYH 2F8OA 4JVPA 1RU9H 3MV8B 3VH8A 3G6DH 3SOBL 3LZFL 4EUPA 1ZT7B 2MSPA 4Q6IC 1XF3A 4F7PA 1YY8A 3O45A 4AENA 3UJIH 1JRHH 4M7ZB 1IEAB 4HAFA 1YC8A 2B7DT 3AY4A 4XMLL 4LSTH 4WFEE 5IFAH 3D3VE 5HHOD 3OJVC 2OX5A 5BRZD 3RNQA 3BUTA 2PETA 4FXKB 4F9PA 4KAQH 3L3JA 3Q1SL 2MOVA 4NZUL 1VDGA 1ETZB 2UUDK 4X80L 5F1KC 1T21A 3T0VA 1FAIH 3AREB 1RFDL 3MRBB 5FGBC 5L6YH 2DQIL 5T1MB 2IBZY 4U3HA 4HIIA 5I71B 3VWJD 3WFDL 3B9VA 1A3QA 5ADPH 2KZWA 4B0MM 3J7HA 2NX5A 4N1CA 4KRNA 1A3LH 2FHBA 2DWEB 1VACB 1ZHBB 2HTLD 4JN1L 3WUWB 1CTNA 5T3XL 3WUZA 2VISA 3HRPA 1ED3A 2UYLB 3TT3H 2GSGB 5DK2A 4PJEB 4I1NB 4ZPTA 4P3CH 4QXGL 3DYMA 2HFGH 1T20A 3NABH 4BQ8A 1KJ2B 1LNUA 4F9LC 4XP6H 3ALXA 2BSRB 1XH3A 4W4NA 1KEGH 4NNXA 3BHBB 4RGOH 5I1IL 4LLUA 4NQVB 1GIGL 1EJOH 1G9ML 3G5XB 3KS0H 3FQUB 2PR4H 3VXPA 1YNKL 5DJDA 4NO2A 3T4AA 2EXYC 3VCLA 2XT1B 3L5IA 1T0MB 2APFA 3GMNA 3UPRB 5B8CB 3JXAA 2EYRA 4EUPH 3ULVL 4C58B 3V6BR 3HRZA 5D2LE 1IKNA 3U4BH 5DRXA 5KW9H 1YEKH 4FQXD 1JGLH 2AV1B 3BYYA 4OZ4A 2VABB 3CLEH 2WWKO 5FHAH 1ZGLA 3UTQB 4JRXA 2BOCB 3E8UL 3AMKA 4BYHA 3P4NA 2VRAA 1HEZA 3HPJB 2SEBB 5JHLL 1J12A 2FIKB 3WHE0 3LRSB 1OWWA 3NA9H 1QACA 2AAVA 4L3EE 3DUSB 4X8JB 2ZPKL 4TVPL 3N1PC 2Z8SA 3WIIL 1KCSH 4LPUA 3KLSA 3OAUL 1GOHA 5J6HA 2J12B 5I19H 4RAVA 3FRPA 3L3DA 1BQSA 2JIXA 1N6VA 1LEGB 3B8SA 3V79C 2QQNL 4MNHB 4XHQA 3ZHLA 4MXQD 3FOLA 4X6CF 3CMOL 5LCVH 3IYLW 1OT2A 5AUMB 3S3SA 3CDFA 3RVTC 4YWGH 3WLBA 3GSWA 1JI1A 3SDCB 3BX7C 4EVNA 4QRPE 4XCCL 4NWUH 4OLEA 2DOCA 2J8OA 1H3PL 2VR4A 3RVUD 5D1QA 4CVZB 3PHOB 4PV8A 4NO5A 3PHQB 4TPRL 4NSKA 2VLJB 2RR3A 1W8NA 1UWXH 1DQTA 4RIRA 1DN2A 4QKXB 2AV7A 2AXJA 4FFWD 1GGCL 1I8IB 1RUKH 4J1UA 2ZUYA 4HPYH 1RZJC 2CR3A 5I1EH 4PJXA 3EZJB 3BEWA 5DJ2B 2CDGA 2P5WD 1BF2A 5CBAB 4C55A 4UAOB 5HGBB 1NDMB 1H15A 2WBJA 4KK8D 4DGVL 1BLNA 2W9EH 3GMPB 3MRNB 3HI1B 1IFHH 4U6TA 3BKCL 5LXGL 1JPST 1NCUA 1D5MB 5CJ8A 4HIJB 4RGNB 1V3KA 3TJHC 2XQBL 3WMSA 2PUQT 5E2WL 3TT1H 3I02A 2DQTH 1LO4H 4MAYD 2CXGA 2RAMA 3QPXL 2F8XC 1MRDL 4WO4D 5IJKC 3O8XB 1OCWH 4QTHB 2EE9A 3OAZK 5J57B 5A2FA 2DQFB 1EEQA 3QDAA 5F3BA 3NCYP 3JWOH 1NCAL 5CS7A 2I07A 3BUYB 4XCYA 3V95A 1I75A 1LILA 1P4BL 3NIDE 3RL1B 1A4JB 1AGEA 1NLDL 3MOAL 3CC5A 4ZXBB 5HHXL 2WAHA 1C1EH 2A74A 4EXKA 3HTLX 4UT6L 1U8MB 2B39A 1BFSA 1UM5H 4M6AA 4R9HA 5IV2A 5C08B 1AXIB 3L7FB 1N64H 3TCLB 2R39A 4M03A 2MPAH 1MI5E 1M05B 4WI2A 1MF2L 4XCEA 3GKWH 1XF5B 2V5RA 4EI6A 4GAFB 4JPKH 1WJ3A 4MS8C 4P2QD 4QOKA 5IOPB 1BD2E 4WI9A 5L2KE 4KROB 4PY8J 4UUJA 4Z7VB 1ZWIA 2CK0H 4EN3C 5I16B 1N5AB 2NR6D 3HHRB 5KBNC 2XY1A 4NDMB 4PJGF 5J8OA 4I3GA 1BBDH 3WS3B 1DBAH 1FH5L 2ZCHH 5J11C 2QQKL 5FCSH 3BOVA 3DPBA 4IHOB 4JO3H 3MODL 4CRPA 3B9KC 5J6GA 3H9HA 1NC4D 2Q8BL 4AEHL 5ALCH 4ZFGH 3QNYA 1B0RB 3BN9D 4JKWA 2Q3ZA 4XP1H 3W11D 2BVOB 4EDWL 3BYTA 5EDXA 1RMFL 1VACA 4Y5XB 3LMJH 1FQ9C 4WUUE 1NFIA 2FJGA 3I3EA 1JIBA 2EDBA 5EOTB 1R5IB 3DIFA 3UTSB 4U05A 2YMXH 4LVHB 4XNZC 1YEJL 3LKSA 5EA0H 1RULH 3DBXA 5GHWH 3R1GH 3MLZH 4JG0L 4N68A 4KTYA 4OV6F 2DMBA 3LKNB 5D7LD 3H9SE 4MZ2A 1U3HD 1E28B 3GSVA 1SJEA 1BQHB 2P4AB 4APQD 5DZLA 4PJAF 3RWGA 1LP9A 4ALAL 4KY1H 2YEZB 2P1YA 5CIPH 5E6ZA 3QDGA 5GJTL 2ZKHL 4KKLC 1T03H 4KV5E 1NJ9A 1PEWA 5JUEL 2PTTA 5I8OH 3DYOA 1RUPH 3MRFA 2E6PA 3SKJH 3S88H 1ZLUK 1HHKA 2NY6B 4ZG1A 3QI9D 4ZTOH 2EIZA 1VFMA 2ATKB 1EFXB 2H2PD 2P5WB 4PGCA 4BZ2L 1NH6A 5J06A 4DCQB 3T77A 4ERSL 2J5LC 1XMWA 4RBPH 4FQJL 2DQTL 3SE8H 3VRJB 5DSCB 1A22B 3CVIH 3QDJD 1A6AA 1MAML 2DTSA 4OZIE 3BKCH 3BEVA 5LXGH 4LL9A 3U7WL 3C2AL 3KPLB 1WICA 3UTQA 1A02N 1MFEL 3HCVA 3FQNB 5H35B 5E6ID 3DX9B 5MEQA 5ITBL 2I26N 4YUEH 3PQYD 4HG4J 1NGQH 3PUCA 3ZDXE 2NLJB 1BZ7B 5DF0A 3RX8A 3HI5L 2XZCH 2GJ6A 4HF5H 2CRMA 5IFHH 3KLHD 2OL3B 3OBAA 1G6RL 3LKOB 4CN1A 1Y0LB 5BOZG 4FNLL 3LN9A 4YZFF 1BQHG 1KYOK 3H0TA 4IDJL 5T1LA 1Q72L 4BSJA 1FSKB 4D3CL 4JB9L 2AXHA 3K3QA 3GUTB 5FB8A 4X4XB 4NKMB 2WLYA 4LVNC 3DRTA 5E9DE 5AAWA 4RZCB 2CLVA 3BN3B 2D4FA 2E8ZA 3KWWA 2HLFD 1UXSA 1SJXA 3Q6GL 4FFZH 1MWAH 2HN7A 3V7AG 1S7QA 3BSZL 4UT7L 3V0WH 3GZKA 3BXNB 4UILL 2QTEA 4LFHD 3C6LD 4N5UA 2ZUWA 3O2VL 4TTGA 4K8RC 5MEOB 3QDGE 3CXHJ 2KH2B 2AERT 3W9EB 4L5FH 1AGCB 3MRLB 1O7SA 3MRIB 4Y2DD 5GPRA 1TLKA 5EPMA 4GMSL 3ARGC 5C0IA 4F7EA 5EC1B 5TPWH 4Q0XL 4J4PC 4OFYD 2X5PA 3QHFL 3VXME 4N0RA 2VYRE 4M4PA 3CSBA 1ZHKB 2DTMH 2JIXD 2OL3H 3KPRE 5CGYC 3K0WA 3TIDA 3KYKH 1P1ZB 1CXEA 4UQ2B 1EK3A 5INDB 5H94A 2DWDB 3DETC 4G9FA 2Z92A 2DLIA 4JM2F 1H3WM 5GSVB 1QNZH 4HX1A 5TE7L 4FQXA 5GJSL 3LV3A 3IDMA 3OKYA 3ULUH 1TXKA 2VKWA 4FQ1H 1JGLL 5GGTL 1CI5A 1JWSB 3EYOB 4PGEA 1HINH 3V5DB 5J0BA 3OJ2C 2EDFA 1IQDB 4NN6C 1HHIA 3NPZB 3GMMB 4K71C 1SBSH 4OT1L 3OKLA 4PD4K 4HUUB 4GW4B 3TYFB 3QDJE 4JJ5B 4U1LA 2VIRB 5E0QA 3MUHL 4C56B 1HKLH 2RB8A 4I5BB 1CN4A 5BO1H 5C0AA 4F57H 1JN6A 2FECI 5I1LB 5IEHB 3EOBB 4M48H 4Y5VC 1J0JA 4HULB 1RJLA 1FGNH 3IF1B 3QG6B 4KI5F 2J5LB 1YNKH 4PJCB 4I77L 4ZFZA 4U6HA 4HWZA 3NCMA 1PBYA 4X4ZA 4Z77B 3KPOA 2R2EA 4OTXL 3L5XH 5C0NC 1JTOA 4KI5E 5C0FB 5ANMB 1TNMA 4O5LH 3P40A 1NLBH 4NQEE 2IWGA 2MCPH 5JPNA 3NFPB 3VA2C 1INDL 1L9NA 1WSST 3WV0A 3VU2A 4IOFD 4DUXA 5ILTH 3QIWA 4XPFL 3TO4A 1P7QD 2OM5A 4S0SD 2HYMA 3MJ8A 4ZAKB 4WFGE 3UJJL 5IMMB 5GGUA 3KJ4B 2XIDA 5BVJB 3RGHA 1BOGB 3QO0A 2H26B 1YQVH 3EDKA 4R4FH 4UZGA 1W72B 4HHAA 1CK0L 4JFED 4OTXH 4E41A 2DS4A 2EC9T 2HVJA 3CXHK 5C0AB 1VGKB 3W2DH 1FFNB 4GBXC 2QL1A 2HRPL 1OQOA 3HZVB 3QG6A 2Z31B 3QIWC 1JNLH 5L6YL 3OAYK 3ARSA 1FGNL 1X7QA 4ZUWB 4MAUH 5B38B 4WW2F 4PLOB 2X1QA 4P57B 5KAQG 1MREL 3ARQA 3QEQB 4EN3A 1KLUA 3LKPA 4RISH 3B9KD 5JW4N 4OT1H 3TO4C 3MRCA 1ZANL 2WUCL 3QIBD 5EFIB 2XI9A 5SV4A 1JRHI 3NA4A 2X09A 3SJVE 1ZS8B 5DJXB 1H5BB 4QWWD 2DJ4A 3CGTA 4MNQE 2JB6B 2X4OB 5KSVB 4QXUH 5IMMA 1OTTD 4U2YA 4QYOA 4WY7L 2DYPA 2IPTL 3ARDC 1SM3L 5FV2A 4OLYL 1T04B 1RHHB 3DXAB 1A4KA 2Y1VA 1QSVA 2W9DH 4HZLA 1JHTB 2W1NA 3IGAA 5JLZA 2ZG1A 2OL3L 5IK3B 1D5IL 2PTTB 4TRPL 4NKIH 4ZS6C 1ES0A 1QBBA 3WFEL 4LVEA 5C0JB 2BNRA 3EOAB 2EIBA 4Q0XH 5CZXC 3CLFL 5TPWL 3LPFA 4GKNA 1DQLH 1EFXA 4H26A 3CMGA 4UU9B 4XWOC 5AD0B 3LKPB 2CUMA 4RX4A 2DQJH 2OMBA 5F7UA 3ZL4H 4QRSB 4RMQA 3W5NA 4JFEB 5F96H 3W0WB 4ZO7A 4QOKD 3O4LA 4OBSA 1P84K 4IIQC 4OZFG 5C6TH 5CILH 5GRZA 2CRZA 4XBPA 3E3QE 4M5YH 1MWAL 3U9PL 2IH3B 4X6EB 1JHKH 4DN3H 2WM0A 4AQ1B 4YO0A 1AO7D 1RZFL 3MLXH 4M8QB 2VH5H 1EAJA 2ARJQ 3VI3F 4GAJL 3KPQB 5D7JD 4JB9H 4PJDA 2VZ1A 4JFXA 2H32A 3EYQD 4KGLA 3BH9A 3QDHA 1WIPA 1ZSDA 2P48B 5IFJB 4G43A 3MRKB 4XAKE 2R0KL 2R4SL 4W70A 1RZIB 2M2DA 3EYUH 5D7LE 3CFIC 2R9HD 3TZVD 5JOFB 5D1ZD 4M1GL 3G5ZA 4F3FA 4LHJB 3F58H 3RX5A 5IB3B 4MQ7B 4NKOB 3LEVH 3EDDA 4LMQI 1RIUH 2Y06L 1BM3L 1FL5B 1MHHB 2J88H 3HNVL 3MBEA 5I30L 2P8LA 5I18L 1QFUL 1X5LA 4OGYH 2OQJA 1MWAB 3GHBL 5LQBH 2GITA 3O2WL 5SV3A 3B6SB 5FDWA 2BVQB 1FO0L 4LOUD 1GGIL 4HDIA 4ZFOA 5M95B 3MV9B 1OAZH 3FB7A 2BJMH 2B4CL 1G7QB 3G04B 2OBGA 1EEYB 4FQJH 5GS1B 2YN3A 1KV3A 1PQZB 3FFDA 1DBJH 3GRWL 3TIEB 5FO8A 5CD5D 3GIZH 5HJ3B 5BRZA 5DD0L 5TGBB 5EZJA 1A0QL 1T83C 3ARBC 4ZTOL 5T3ZD 4I0PA 5SWSD 4LCIL 4XP5L 5EORL 5LGHH 3BPLB 1EVTC 3SKUD 3GMOB 5H37H 1EHLL 4ZUTB 1P53A 3MYJA 3UYPA 1F11A 2GI7A 4KMQA 2EKSA 3G6JF 3HE7C 2FLBT 2HG5A 3RWDA 1T6VN 1IKFH 5EO1A 1EAPB 2H1PH 3KPPA 2R15A 1ZGLP 3QDMD 1OP3H 5HHMD 1CXIA 2EKJA 4JDVA 1AQDB 1HQRB 1ORSB 4PB0L 3T4YB 2XQYG 1CXFA 3O3BA 4MA7L 1P7KB 4PYHA 2BX5A 2JJUA 4XP9H 5F1IA 5I8EB 4XPTL 1N2RA 5EA0L 1UZ6E 3EO9L 5ICYB 2XPGA 2Q8AH 2VNCA 5EZLB 4E5XB 4YHLL 3N9GH 1X5JA 4AEIL 3OKLB 4JM2B 2HFEA 4N0UE 2BP3A 4KWUA 1F3DJ 5HD8C 4JE4B 4Z7NE 4X7TB 4V2BA 1UB6B 1T3FA 3BH8B 3S5LB 3RWEB 1MRCH 2PYEA 5CJXA 4EUPB 4HKBB 1OM3L 4CAGA 4LCWE 1G6VK 3KYAA 4J3XA 5GRVL 4I0CC 4PGBA 3KPOB 3FTGB 4XAKD 4WHTB 3PXHA 2APXA 5B8CC 1T5WA 4L8CB 4ODTL 2QQKH 3L7EA 1FVCA 3NIDF 1DEDA 3ZKXB 1IGTA 3I9GL 2IF7A 1S9YB 1HHGB 1J8KA 2AEPH 2JE8A 3QEUB 1YMMB 35C8L 4POUB 4HIIB 2VJXA 4JPKL 3T2OA 4OGXL 4R96A 5DRZA 3W0WD 3N85H 5FUCE 1NC2A 2X42A 1H0DB 2QADB 3SCMD 3OF6A 1CD1A 2DF3A 1I8LA 1XAUA 5CSZA 4JN2A 2PYEB 5F93C 2HWZL 3TVMD 3LRGA 4P4RA 4KJYA 3VH8G 4K07A 4M62L 2UY6A 3F6IA 3RGVB 3RWJB 4OGZA 1S9WB 2GY5A 5DJ0B 4U0QB 5D4QA 4C59B 2LE9A 2EYTA 2D0FA 4G6FB 5TDPA 4U7SA 3MA9L 1YUHB 3IDXL 5CBEA 6CGTA 4Z5RB 4TN9A 2OTUA 3UC0L 1W0YT 3IDGB 1JZ5A 3NZ8B 4U3CA 4HZAA 1T20B 5D2NB 4NQVA 1I8KB 3DX6B 4PREA 1XH3B 2A77L 1UEYA 4RNRA 4KI5D 2QSVA 4GRWH 5C0ND 1I3RB 1KCLA 1UQSB 2VZUA 3KS0J 5F71A 5HHME 4IRJC 4P5TD 5HGDB 2J6EL 4U1MA 2X4RB 1VFBA 4U1GB 1NCBH 2W9EL 3SQOL 3MBEC 1QZ1A 2NY5C 4S2SB 5F7YC 3KPSB 4RGMB 2APVA 5DDHB 1QTYT 1BIIB 1KIRB 5DRXB 2N56A 1CLOL 4YNYB 5IW3A 2DIJA 1DP0A 2D03H 5KG9A 2KL6A 5BXFA 1PG7H 4U6YB 2W07A 3PV7A 3QUXC 3OZ9L 1AI1L 3NCEB 2X1XR 1MJ8H 1H3PH 4I3SL 3Q3GB 1FLTX 1NAMB 2BHUA 4S1RH 4UBDD 2MNUA 3HE7A 4QTIL 2OCFD 2XV6B 3X3GL 2NY0C 1T5XA 1EEZB 3PL6B 1A5FL 3PWPA 5DMYA 4M43H 1BFVL 3V7AE 5DEFB 2AEQH 4NUGH 4ZYKB 3CK0H 5B3NA 4XX1E 1V7ML 4Q58C 5A2KH 3PP4H 1JZ8A 5KSAA 4ZDHB 4XPHH 4AT6B 1CU4L 2FIRT 3L3KA 4N0UB 3ZZ1A 2VXVL 4P99A 4DJMA 2AXFB 4OJFL 2LU7A 1S9XB 4Q7DA 1KCSL 4C57C 2OI9B 4BFGA 2HJLA 3HC0A 4LSQH 4O9HH 4ZPVA 4HW6A 5DQJB 4Q9QL 5HTSA 1EBPA 4HUWA 2WBJD 4Z7QE 3GJEA 3MFFB 1U8KA 1DQML 3DV6A 4ODWA 1T89C 3TNMA 2ENYA 1LO0L 5C9KA 2FRGP 2EO1A 1L0YA 2CPCA 1AC6A 5BW7C 1QKZL 3G08B 1WCBB 4OCWL 6FABH 5I1LA 4JPWL 1YEKL 3K81A 4R97C 5EU4B 5ID0A 1OARL 3V6FA 3V4VL 5J1SC 1IE5A 1ZT4A 3ZYJA 1BX2B 4AIXA 5L0QC 4U2ZA 5CP3H 2AJXL 4H8WL 2V2XB 3W39A 2VLKA 3P11L 4PJ5A 5HGGS 1RJCA 3BRDA 1MCWM 4LCCA 1FDLL 1M7DA 1GSMA 43CAB 1MLCB 2V2TA 5HVHC 1FO0B 3TPKA 1UM6L 3K4AA 2ICWA 3O6FC 5I1HH 3DX7B 3L5HA 3QUZA 3PABA 1D5MA 5FAAA 4RGOL 4HXBH 5I1IH 2BNRE 3MFFA 3VFMB 1TJIH 1U58B 1KTLA 4PJHA 3QNYB 1IILE 1KTDA 1ZLSH 5GGUB 2V9QA 3C6LB 1OY3B 4NQCB 1KIQB 4LCYA 4WI4A 2B2XL 2XZQH 2XACC 3BWAB 1S7WA 1MFDH 5GRJL 2A0LD 1IGYB 1J88A 1NUNB 1KIPA 1LK3L 4YAQB 1FRGL 3D3VB 1ZLVK 4WI3A 5T1KB 5BMFH 5SX5K 1QRNB 4KJWD 4MQXD 3ULUF 2V6HA 3IJSA 5EU6D 1TNNA 3BO8A 1WBYB 1M7DB 2FBOJ 1VHPA 3LH2L 3VXMA 1IC4L 3PXJA 3HLAB 4RFNB 4QRQB 1XF5A 1ORQB 4U0RB 3A6BH 5IJVB 4DZ8B 4TSCH 1I7TA 1VSCA 5SWSE 4Y5YC 4OUUB 2EYSB 2CIIB 1JPTL 3SE3A 1ERNA 4DZBA 3MRJB 3WNNA 1V3MA 3TH2T 3S36L 4BSWB 3C5SA 1PKQA 3MJ7A 3ECBB 4R8WL 3ARPA 5ICXB 2F53B 4YZFE 3CVHB 2L4OA 3DGGB 2B0SL 4JDZB 1I1RA 3I50L 4GAGL 3BN9C 3DVGB 1U8IA 3RIFK 1P5UA 2CKBH 2OS7A 1ZV5A 2GK0B 5JORA 3GJFK 4OZ4B 3KPLA 2V7HA 3IETA 5EBMB 1G0XA 4JY4B 3I84A 1R5IA 4TVPD 3MRPB 1N4XL 2B2XH 1ZGLB 1CR9L 4Y5XA 4PJFF 2Y23A 4NQXB 5C3TA 1H3XA 1ZLSL 5DJDB 1UXWA 2A6DA 2ZOKA 1W0WA 4TSBL 1JK8B 3UBXI 3QDMA 3ULVF 2PYFA 2W0LA 4HXBL 5GGQH 5DA4A 3OL2A 2APTA 1ZA6A 1LD9A 1CE6B 1LEIA 3B2VH 1YJDL 3V6OA 2GYSA 4HJJH 1HHHB 3VFSB 2VAJA 5JPMB 1IGML 3ZDZF 1WFTA 2H2SC 4GAYB 1KB5L 2D7PA 3QFJD 1M7XA 1CLCA 3QDGB 5T1KD 1HSBA 4JZJA 3ZO0A 4M1DH 1T6WA 1A0QH 1U3HA 5FKPA 1ZLWK 3ZTNL 5JW3H 4JR9L 3GIZL 1F4YL 2JTDA 4D8PB 2YA1A 3AAZA 4LIQH 1I7RB 4KJQD 4JPWH 2D4DA 5EZOH 4WO4B 3V4PH 4R2GC 3ORJA 4F9LA 3KYOB 4TQEH 4UV7H 1A6TA 3WE6B 2UVFA 4NSKB 5DJAA 4YGVB 4UBDC 4BQ9A 3O2WH 1ZA6B 4MA1C 4KVCH 4YR6A 5FYJE 1QFUH 5I18H 2P5EB 3U46B 4XC3H 5IMOA 4M8VA 3PDOA 1BM3H 3EYVB 1FZOB 2YD3A 1NPUA 1I1FA 3JTTB 1YN7B 3GDBA 3IAQA 4YHZH 4TQEL 5AWNH 2YA0A 3RZCA 1Y0LA 3V4PL 1E6JH 4OF7A 3TBVB 2HT2D 2ZUVA 2A1WH 4OCSH 3P4OB 1AHWA 2VH5L 4PG9B 4Z76B 3EKCA 5FB8B 1IQDA 5FYLH 2G2RA 3DRTB 1H8NA 4S1RL 3D39D 4Y8DC 1OP3K 2P5EE 4BFIB 3SDCD 2VDKH 1MJ8L 4I3SH 1N6QL 2IALA 2O5YH 4I2XB 2VMFA 4OCXL 3FB5B 5DC9B 5KSUA 1P2CB 3MLTB 1R3JA 2FCBA 1JPTH 2AKRA 4LQFH 1ZHLA 1X5YA 1QSFB 3B2VL 3S5LG 1CE1H 3GSOA 5JXEC 1E4XH 1KPVB 4ZFZB 2FZ3B 3M17B 3H8NA 3RY6C 3ZYOA 4JZOA 5ADOH 1UYWL 3TCLA 5TE6H 3WFCH 5CFHA 3SPVA 5EIQA 4ZUVA 2GY7B 5A2LH 3CU1A 4WWKB 4NRYB 2BXYA 3MACH 2P8MB 1M1SA 2Z35B 1IBGL 3UAJD 4LLMA 3D9AL 5BMFL 1ZGLM 3ZE1E 1ZOXA 2IADA 4PG9A 2FL5A 3CDGB 3AS0A 3BD4A 4PP2B 4AL8H 1XGRB 1FIGH 2WWMC 3JBG7 2A77H 3MLVH 1FG2B 3FOMA 5K9OA 1T7YA 4X99B 3L3GA 3UC0H 1KF9B 2A0LC 1BOYA 3PQYE 4JPVL 2PXYA 2J8UF 4WWID 4MWFB 2LVEA 3VGGA 5E8DH 3ARWA 3VWKB 5HGHA 2B4CC 4AM0A 1AC0A 3Q6FB 3P4MA 3QYCA 1KLUB 2AJVH 2JELH 1K3IA 3SY0B 5CSZB 5F8RC 1JNLL 3NPSC 2A38A 4G6KL 1JE6A 3BPOC 2HRPH 4PJ9C 2WANA 3N85L 1CK0H 4OGXH 1L7IL 1S7VB 1A1NB 4R4FL 1YQVL 4JFZL 5C6WH 1DUYA 2W60A 1H9VA 1LDSA 3BP5B 2B5IC 4KZEL 1LO0H 1TJGH 2JELL 2AJVL 3SDAD 4HFUH 3NZ8A 2FYYA 4U6XA 5F70A 4MJID 1BJ1H 3MV7E 1QD0A 1YNTB 3K80A 4O00A 1CDUA 1NBVL 1AGBA 3VWJA 1DE4A 1IKNC 3HFML 1DQQB 2CO6B 3I02B 4PPTA 1NAML 4GH7B 4HIEA 1KB5A 3KNBB 1RIVH 1UZ8A 4HLJA 2HTLC 4ISVA 3V9FA 2ATKA 4H25A 4OZGA 4UV4L 3WEXA 3AY4C 3S37H 1MCOH 1QRNE 3OJDA 3PP4L 2CLRB 1BIIA 2EEAA 1CL7H 1FDLH 4NCDA 4XNYL 1S7VA 1QSEA 3MZTA 1YA5A 4M43L 2BFVH 3M1BA 4KJWC 4MQXC 1GOGA 5C0CB 5IP4A 2AXGB 2WNGA 2H3NB 3ILQC 2IH3A 3BEVB 4FMFA 5ESVA 5IVZB 3QEQA 3K7UA 4NQUA 1AGDB 2MHAB 3G9AB 3TN0A 1ONQA 4X6FB 2DKSA 5HXMA 2Q76A 5GJSH 3CFDB 5D1ZA 1BVLA 1CE1L 4KC3B 5D7IF 4YHKL 5DC4B 1NMCC 4OCRL 3QB7C 5ABDE 3SGJC 3UPRA 1IL1A 4TVPE 1N6QH 3V5KA 4Y4HC 2VTFA 3BT2H 3FFCA 5IEKA 3LOWA 4MJIB 3MUGA 3SDXA 4NQDD 1WISA 3T2NH 5D5MF 2AS5M 3EOAA 4F7CB 2HJFB 5E7BA 3D85A 1NEUA 1RZKC 1HSAB 3WO4B 2A9NL 2FLRT 4KJQC 4J2XA 3GSRA 4GBXA 4NFCA 1DN0A 1U8JA 3MRQB 2CDFA 4GRMB 4IRSB 4QRPB 5D93B 2R0WL 5D7IE 4PJAE 2FB4H 4G7VL 2CD0A 4L8SB 5H2BB 3BP4B 4IRZL 1Q9OA 4JRXB 1FC2D 1G7MB 4QXWA 5B39A 2VABA 1FO0H 1B3JA 4MAYC 1RIVL 2Q7YB 3Q6GH 5HGBA 1C8PA 2CLZA 1IRAY 3MCG1 2BVTA 1NDMA 4Z7VE 4OGYL 3RWFA 3UMTA 1MHPL 2R1WB 4Y1AA 3HNVH 3O6FA 3WSQL 3LS4L 4L4VA 5I30H 1NL0H 3CSYA 5ID1A 1A9BB 1MPAL 1KGCD 1XCTB 5SWSB 1B4JH 1A7QL 3EYFB 1WCQA 3DROA 4ZS6D 4K3HA 3U0TB 3BDYH 2D2OA 5L2KD 1AH1A 5JXAL 4LPTA 1AO7A 1LGVA 2HKHL 3LRHA 1BMGA 3K2UL 3MV8D 2VN4A 4EVNB 1WC7B 5DFWH 2NY6D 5JW4Q 5HYFA 3U9PH 2AEPL 3RVWD 3D39A 4NM4H 4IJ3C 3I9GH 3AXLA 2X4PB 4WIQA 1XF1A 4K8RL 2OP4L 2XN9A 3C87A 2E6JA 3FO2A 1LE5A 4EUPG 2PO6A 3HZMA 3MLYL 1NEZA 1UG9A 1OWRM 4NRXA 5IB1A 4EI6B 3GSOB 1K2DA 1B0GB 4IJ3B 3VH8B 3TH3T 1KIPB 2DMCA 3ZTJG 5D93C 3O6LH 1AJ7L 4UQ2A 4K2UH 4XMKL 4D9QD 3WFEH 3SKJL 2UWEF 4TRPH 1C5CH 3WYRA 1P6AB 3CX5J 1RURH 4WDIB 1F97A 2P45B 3TN0D 1CIDA 3GIVA 3NFPA 3P9LA 2QQLH 2FL5B 2W0KA 1UCBL 3CDGA 5JA8B 2KDGA 3MV01 1G84A 4YHLH 2IPTH 3I50H 2ICES 1R3LA 2VLKE 3FO1A 4PJ5E 4ZFOL 2GKIA 2BNQB 1ETZA 2A2QT 2VLJE 5DFVC 4BZ1L 5D2NE 3BGFB 3RPIB 1K4DB 5F9AC 1JZ6A 4MB5A 2N4IA 3EDJA 4QHKI 4ZQKA 5TE6L 3WFCL 3QIUA 4I5BA 2V5MA 3R1GL 4YPJA 5ADOL 3WFHA 3S36H 1UXSB 4APQC 1QR1B 1XF3B 1IKFL 4QF1B 2VSCA 5D7LA 2IH1B 5KN5B 5IKCB 4OAWB 4KFZC 1FYTD 3QI9C 4FA8A 1S9WA 2ADFL 1ZTXL 4YBLB 1ED3B 4QNPE 1TJHL 5K9JL 4GRLD 1T1ZB 4X6DA 4ZFGL 4RDQF 3GBNH 3MNVB 1U2HA 5T3XD 3W2DL 3UXFA 1NFDA 1PW3A 3P9LB 5DJZA 1KGCE 1OLZA 4Y4HB 2VITB 4ZAKA 3QXWA 5T1MA 4XMPL 5DHVA 3HC3L 2A83B 5H94B 2IANE 4I48B 5I6XB 3IDNB 3P30L 1NMCB 3ZKMC 1AR1C 1YEHL 2NX5B 4WNQB 5CEYA 5I73B 5ITFB 4Y89A 3VXSE 4P49A 1FVCB 3PWJA 1DE4B 3OG6B 3U7YL 2LU4A 4XC3L 4X6DF 2CUIA 5JW4M 4HFWB 3B43A 5DEZA 5CP3A 3OJMB 4PB0H 1R5WB 1Q9WB 4QXTA 3ULUC 2NR6C 3KDMA 1MLBA 1T1ZA 4PJ9B 3ABZA 5E8OA 5C70A 5F44A 2D9CA 3HR5B 4Y19A 4HS3B 1CGYA 1RUQL 5F3HA 4DW2L 1JYNA 5GQBA 1QA9A 1NAMA 4JR9H 5I1GH 5AG8A 3VWKC 1NCAH 3DIFB 3UTSA 1JNHB 5FKAB 3FCTB 2D0GA 4I48A 4M5YL 1F2QA 2K7QA 3QPXH 4HWUA 4X6EA 4N1HB 1SJEB 3MTRA 1FNEA 4U6VH 1DLHB 2NTFA 2Z8RA 4EIGB 4FQCL 3LKOA 1F4AA 3WDIA 1YQ2A 2BHYA 3LKNA 3I3BA 3D2UD 4HV8A 2X9XA 4YBLC 4JY5L 1U41A 2VLJD 1FIEA 1CD9B 4P3DA 4ZO8A 2ZSWB 4APQA 5JDSB 2DTML 2BNUB 1I3RA 1CFQB 4YHPB 2NY2D 4JREB 4NT6B 5BRZE 3C5ZB 4N0FA 5LGJB 1RIUL 5ERWB 2EDRA 1H3GA 4Z7VF 3BGAA 3F58L 1C12B 2DM3A 2VXVH 3ZDYF 2D7TL 1FYTE 2YHGA 2Z31A 1DBKH 4L29B 3OSKA 4RQQB 2NXZD 3U6RB 1S8DB 4BH7B 2R4SH 4PRPE 5MP6L 4G8FB 2AK4A 4X6BA 3UO1H 2VWEC 1UWGH 2XXCB 2JJWA 4GAJH 4X7DC 3CFJB 3SGKC 5FA3A 4ZS7H 1TZHB 4XCCH 3O8XC 4FFZL 4YX2L 5GIRB 5BQ7B 1YMME 3L9RB 5CEZD 1JNNL 1IZJA 4QCIA 3O0RH 4G9FB 1H15B 4L4JA 4F3FB 5T33L 4WV1C 3QO1B 2DLEA 3PIQA 1X5ZA 4PP1C 3UTOA 1M7IB 2BDNL 1QOKA 5MP6H 3MV8E 2DIAA 3WCYA 4Y4KC 4NJ9L 5E4IA 5BZWA 3C08L 2XTLA 1DBKL 4CL7A 4PR5A 1RQ5A 4Y2DC 3PHOA 2XKNB 3IFOB 4UAOC 1NGQL 3OAZH 4JJHA 5JQHC 2AEIT 5I15L 4HH9B 1T83A 4WWKC 3FKUS 4ZFOB 4XI5C 1ITBB 1KIQA 4LCYB 1F3RB 5BJTB 3SQOH 3IKCB 2R1XA 5GS0C 3G6JE 1KIUA 3UJJH 1QFWL 3BRGC 2J6EH 5EUKB 1U8QA 5ICYA 4Y2DA 4AIZB 5FO8B 1INEH 5BQ7A 1INDH 1CLYL 4DOHB 4AENB 5FYKE 1A7PH 2MCPL 4QXUL 1F6FB 3BEWB 1VEOA 1AR1D 4U1KB 4CJ0A 5CUSH 4OFVA 3ZT7A 8CGTA 4AMKL 5DYOA 5DJ8B 4N1EA 2ZUXA 3EO1A 3KPTA 5C3LD 5F7LB 2XWTB 2JJTA 3LKRB 4NGHL 4DW2H 5TDOA 4L8SC 3KPQA 4NQTA 2FX7H 3T0DA 1ZT4B 4R4BA 4JGJA 4P46B 4PRPA 1RZ8A 3T4YA 4HS6A 43CAA 1ZVSA 3TO2A 2HWZH 2KBGA 3GMLB 1G0YR 3HC4H 1EJOL 4XBEH 4QTHA 4HHAB 4G80A 1QG3A 4R0LA 5DRNB 3JV6B 4AZ8A 1K3ZA 1OARH 4J7RA 1Y18B 2UWEB 1WFNA 2HFGL 3CC5B 4ZXBA 1S7UA 5IR1A 3QUZB 3ARTA 1KFAH 1YEJH 4KMTH 1INEL 4RAHA 4PRIE 4P57A 2D7MA 1FFRA 5T1DH 3RZWA 4OF6A 4P9MH 4G8EA 4PRDA 4NQCA 3S96B 4FTVB 3CZFB 4X5XA 1SJVA 5E03A 1R6VA 4KJYB 1OGAB 4KROD 2OXHA 3UTTD 5IQ9A 3TN0C 5SX4H 5ALCL 1G9NH 1JGEA 3UX9B 4G5ZH 4K94L 2DB8A 2X89D 4GMSH 1LE9A 4I77H 1BLNB 3QIWD 2AI0H 2N7AA 2BY2A 5DJZB 1OW0C 3L3IB 3AM8C 5BO1L 4K55A 1ZKAA 3HS0A 1HKLL 1AFVL 1WWCA 3CIQA 1LP9E 1UJ3B 1V5JA 4AEIH 1ACZA 1DUZB 5CCKL 1PEZA 4O51B 4ONGL 5DRZB 3EO9H 1NBYB 2ICCA 3QH3B 43C9A 4XWGH 5ACLA 4QT5A 4FG6C 1KT2B 4LSTL 2Y6SD 2FR4B 4NKDB 4CN4A 1HINL 2YPLB 3GBLA 4Y0GA 5IVNA 1JMZA 4ODXB 1I7RA 2VLME 3OX8B 3HAEB 3ULUL 1WZLA 4GW5A 2IG2H 4P4KD 1I3UA 1UCBH 4PG2A 1LWRA 1U8MA 5E1AA 4EZMA 1YY8B 3O45B 3DBXB 2CO7B 5D1XC 1G6RH 1U9KA 5IV2B 1GXEA 1GGTA 4QHUA 2Y07L 4K23H 1JGEB 2DQUL 4EN3B 1K8IA 5DI8B 1KB9J 3VRLF 4POZD 5EU3B 1QSZA 2OR9L 5J1AB 3JWOL 3QFJE 2IJ0C 2NXZC 1FZOA 2MCG1 3PGCA 1TQCC 1MRFL 2DQCL 4U1HA 4NNXB 3ULUD 1LEGA 3U7WH 4HMEA 3K46A 3BISA 1FNGB 4WUUA 1V7NH 1MAMH 4KK9D 4HWBA 1JZ4A 4GLRH 3W5MA 2APWA 3SE8L 1D5XB 1J05B 4ZXBC 4NM4L 3KYNA 5GGRA 4MNQB 5DRWB 3PGDA 4DCQA 2IAND 3VG9B 3NIGF 3BAEH 5D1QB 2FO4A 1ZHBA 4YDLC 2P5WA 4YHYC 4J3WA 1YY9D 3WUWA 2W92A 5FKPB 4OF5A 4DK3A 4R90L 4QHUB 4MDJB 5LKNA 3MX0A 1NC2B 2GIYA 5FECB 4IDJH 3LEVL 4PRHE 1T03L 2DQUH 1U8OB 2ZKHH 4M1GH 3DNKA 1BFOA 5CZXD 3SKMA 1KXQE 4KHTL 3BXNA 5JTWA 4WHCA 5SWZB 4FP8H 1M4KA 4QRPD 4UINH 3X12A 3BHBA 1I1YA 2X2YA 3O4OC 3DX9A 3UTPD 4PJFE 3UDWA 3FO2B 1LE5B 2Q86A 2R2CA 3U7YH 4NWUL 4M93C 5IROC 1YEDB 3WJJA 3RAJL 3DUSA 4X8JA 5ISZD 1YEHH 2YMXL 4FTVE 5FHBL 3GB7A 3MREB 4FQXC 2I27N 5F9WC 3CDYA 3AU1A 5C6TL 1C5DB 1FJ1A 5JOPD 1I8KA 1ACYL 4PREB 4PRIB 3O2DA 4EDWH 3MNWA 4B50A 2FB4L 4G7VH 1WTGT 2F54E 3ZL4L 2DLFH 3QPQD 4LCUB 3BJLA 1ZT1A 4FQXB 3CFKA 5DVMA 5F9WB 4M7ZC 3VJ6A 2JJVA 2VLRB 5I19L 5IMLB 3T0EA 3F8UB 1HHKB 2OR9H 2ICWB 4TUOA 3MLPA 3ROLA 3PL6C 3SKMB 1NGWB 1MNUH 3ARDD 2ZPKH 5MEOA 4NKIL 4M1CD 1MRCL 1AD0B 2IBBA 4PJCE 2BOCA 3LQAC 1U3ZA 4G8GD 4JO3L 3P4NB 4L3CA 5D96C 2L7UA 4ZFFB 4WFFD 3BD3A 1DSFL 1T0PB 5I2IB 3QUXA 3P9MA 2BCKA 4PJAA 4PV8B 3TWCL 2OSLB 4YHKH 4HUMB 4F7EB 1KPUB 4MJ5A 4ZUSB 3D18A 4ALAH 4XCEB 4BKLB 4FMKA 5GS1A 3THML 3JSSA 2EDOA 3MV9A 2C1OB 3UPAA 1EZVX 1U91A 5I74C 2DKUA 5IB5B 2XFXA 4BZ1H 2P5WE 1CVRA 3U4BL 3ZKND 3MRGA 4NO0A 1F6AB 1IAKA 1ZVYA 3K8MA 4ONGH 4EOWH 4N9GB 1B4RA 2ITCA 4MNHA 1IAMA 1HOCB 1N64L 5IVXF 4R2GB 1VENA 5DR5L 4K7FA 4Z7WF 1RZJL 4NYLB 1CL7L 5CEZE 5D6DA 2P8MA 3T3ME 4UT6H 4Z7WE 1C1EL 1C08B 5A1AA 1OHQA 3QAZB 4HKXA 4X9BA 3IJYB 1BJ1J 1G9MH 4HIEB 2UZYB 4X83A 2I07B 2H26A 3GRWH 4H8WC 3RRQA 2W59A 3U83A 5MEND 2DLFL 4N9OB 2PW1A 1NQBA 4E42A 3NABL 4X99A 4Z0BH 1CBVL 5F7DA 1DTUA 4JANA 2EEBA 4EIZC 5HGHB 2BVPB 2XPGB 2NZIA 1KJMA 4NCC1 2C4XA 4G8GB 1QFWH 5TDPB 5BS0B 1HXYB 3GMPA 1I9JL 4P2CG 4GLRI 5E9DB 5BOPA 3G5YA 2HKHH 4WRLA 4K7FB 3TEUA 1MIEL 1BX2A 4G6KH 3BP7B 4PBXA 3ARXA 2W60B 4X6DE 4KHTH 1LE9B 3FCTA 1RUKL 5BVJA 3T2PA 5MI0B 4IBLT 5TQ2L 2DKMA 2QHRH 2DLHA 2ICEA 2KQMA 4ZMAT 1OL0A 5HHXH 3VMPA 3BUYA 1Z9OA 3FHAA 4XCYB 3WS3A 4YK4C 4M7JL 2DQDH 2RHEA 1U92A 5FEBA 2FJHB 5E94B 2CK2A 4PJHE 3DXAD 4JANB 4YWGL 3VXQB 3MRRA 3OXRB 5DHXB 5GGTH 4JQIL 1M6OA 1UWGL 5IW6B 2L7JA 1LNUB 3ARZA 3BWAA 4AL8L 3PP3K 4AG4L 4G6JH 1CCZA 4LPCA 1FNHA 1N3NA 2X4SA 1T1WB 2P43B 5FM5O 3UTTA 1JUFA 1U3JA 2XKUA 4U6HB 1HK6A 3PWVB 4O2CA 4LNRB 2I25N 1A7RL 1WFOA 5C0RL 5I15H 4OZHA 5D6DC 2HH0L 4BQ6A 1MQKH 3QXDA 1BQLL 2V17H 4Y5YA 2PCPA 1FNFA 4D0CB 2V9RA 3IGAB 4QRQA 4L9LA 4JY5H 1LK2B 4G6JL 4PRBB 1D6EA 4ZSOE 5FHAL 3RJDA 3VD3A 1BQHA 1A4KB 4JFXB 2D7OA 4NUJA 4L9DA 4UILH 2BSTB 5TJWK 3H9SB 2MJWA 2GTZB 3EOTH 4UU9A 5AD0A 3O41B 2ZCKL 5BZWB 1Q0YL 4OFPA 1ZANH 1X5AA 2N7BA 3ECBA 5L2KA 3CMOH 4NC0B 5C1MB 4S2SA 4YGVA 1G7LB 1U3YA 4NQSA 3SHSA 4QRSA 1JUFB 4U0RC 3DV6B 1FFQA 1U8NB 1KTKE 2QHRL 5HHQA 5IM7A 5AWNL 3L6FB 4FNLH 5E6IC 3ARGD 5GS1C 3EHBD 1BIHA 2EE6A 2ICWJ 3NOIA 4L4TE 3MBED 3WJLC 1T1YA 2ZNXA 3SKNB 4L3EA 2YPLD 1NDGA 3AB0C 1TCMA 4HGKC 1EEYA 3AMLA 3MR9A 1RZ7L 4MD4B 5D1XD 4RWYH 1S9VB 2CKNA 5T1LD 3FQRA 1JGVL 1UC6A 4N0YH 5B4MD 4KDTC 4Z7QF 5AZ2L 1T7VA 3C2AH 4FQLH 5T1DL 1FORH 1EO5A 5IG7B 3H7BB 1AHWB 4KMTL 3R8BB 5HHVL 3CVIL 5EU7E 2FX8L 1I1AB 4Z0BL 2XN9D 3NCJH 1GHFL 3LQAH 3MNWB 1XGRA 4MX7B 2CSPA 4QEGA 2CLVB 4PYGA 3UTPE 5E00A 4BQCA 3GBNL 3IDYC 2IAMD 2BY3A 3BE1L 3Q5OA 3L6FA 2VIRA 1QP1A 5K59E 3I6KB 1SMAA 3AAZB 3VFVA 4LFHG 5DJ2A 1MFAL 2HMID 5IHBA 4KAQL 4X7CC 5CBAA 4XZUA 3SKOA 2DQGH 1YJDH 4JAMB 2PR4L 3UPCA 1UJTA 3OPZH 4WEMB 4PV9A 2XYCA 3BO8B 3HB3D 3T2QA 4AMKH 3TNMB 1AGCA 2ILLA 2X4NB 1SVCP 4MJ2A 2PO6B 5CWSB 2FGWL 5F88A 4ONOA 1JRHL 2C9AA 3KG5A 4ZUTA 1RK0B 3TIDB 2C3WA 1B0GA 3THMH 4P3CL 1S5HB 4CADB 1YEIL 1XT5A 1QFWM 4WI7A 1AIFA 4FRWA 5T3XH 1BREA 3GUTA 3MMEA 1MLCA 1EBAA 2BMKB 1HH9A 1DBBL 1FL6A 4NYLA 4ZTPH 3IAPA 3MUZ1 2Y25A 3L3IA 3AS3A 4B53A 2HVJB 3PABB 4M3KB 4HUXA 4G9DA 2DWEA 4OZHF 3IJYA 3RVXD 4A6YH 1AJ7H 1N26A 3TESA 5I8EA 1DQQA 1KTDB 3A67H 4MHHG 5JHDB 4X7TA 4F2MB 2CR6A 1J8HB 5EUOE 5DFTA 4B7LA 1H0DA 3X11A 4N8CH 2YPLA 3Q1SH 3MV7B 2ZCHL 3ULVE 4PBWD 3QXTA 3V8OA 1BBDL 2AKRB 4AJ0A 1QSFA 1JN6B 5FHBH 4Z7UA 2ESVB 4G8GA 3ARFB 2CDGB 2BHZA 3OWEA 4ZOBA 2R0LL 3D2UB 3KHQA 4HBCL 4QYOB 5HYJB 3RUGB 5A43C 1NMBL 1TDQA 1NFDB 1KJ3H 4L9LC 1BPVA 1IM3B 4Z6AT 3LS5L 1RU9L 3VXNB 2NY3B 2XN9E 2XZCL 4HF5L 1S9YA 1WAAE 1ZHNA 1UM5L 1NANH 3ZT5A 3H9HB 1B0RA 1ES0B 1A14H 5HGDA 2PF6A 1B0WA 1MCNA 4U49A 4PJ8D 5I75C 3H9ZA 4LSVL 1MHPH 5IHZA 3C5ZA 3QHZL 4MVBC 2ID5A 4N0FB 3WIHA 1J05A 4KVCL 2QADC 4P4RB 3RWCA 4IRJB 2VE6B 3WS6A 5ITFA 5EZLA 5HVWA 1FFNA 5CMAA 3HPJA 1P69B 5DJAB 2XQBH 2HFEB 1YUHA 1V7NL 3HG1B 5C8JA 4OKVB 3D2UA 4Z77A 3LKSB 4R0LC 3QBTB 5EZOL 3EGSA 5EBMA 4IOSD 5H2BA 4PJEA 2HT2C 4Y2OA 3CU7A 5F21B 4QHLB 1MRFH 5D2NA 2OXGA 3ZTNH 5JW3L 4HMDA 2OTUB 4KKBD 5CGMA 4X9HA 5E2TH 1BF8A 3K2UH 5SWQA 4PJCF 3OXSA 4XRCB 4M7LT 2UVEA 5JXAH 1CTOA 5JMOC 5JUEH 2GUOA 4MNQD 3PWNB 5I1EL 3BDYL 1O7VA 5DJXA 5CJXC 5CJBA 2Y07H 4K23L 2M26A 3PIQB 3O3AA 3CSPA 3VXPB 1HYSC 1KC5L 1FG9C 1URLA 5DEFA 4ZAKC 1V3LA 1T0MA 3B9DA 3P4OA 4NRZA 3PV6A 5J6GB 4TSBH 2G2RB 3IKKA 4JM2C 1I3GL 4YNYA 2GTZA 1KBGL 4GJTB 2O5XL 2ESVD 3MJGX 3MRHB 1CR9H 5GHWL 1RULL 5J56B 5HHOA 4Z7OF 2XTJB 2QSTA 1AFVH 1XGQB 1IGFL 4XPHL 1RI8A 3IS1X 4Z95L 5LGJA 4L29A 1UM4L 3U30B 4PS4H 3QQ9C 4GUPA 2OTPA 2NYYD 3CSGA 4GSDH 4L3CB 4OZFB 3KYOA 4JCLA 4LKXA 2X4OA 5KSVA 3HE7B 4JZNB 3RHWF 1B9ZA 1E0OB 3BT2L 3A0OA 1QR4A 1OTTC 1AI1H 3KAAA 1NCWH 1QBML 4QCIB 2VO5A 5TDOB 1QLRB 1FLRH 3B9KA 5F1SA 2AK4D 1RZIA 4LBEB 4BQBA 4BSVB 3E8UH 1RZ8B 1UB5B 1F3JB 1TENA 3LN5B 3R06B 5D7JA 5I9QC 3BH9B 1LEKA 1E6OH 5HDLA 5HYQB 4EQ2A 1QBAA 2AXFA 1GGUA 3QJHB 4LKCB 4HC1A 5HI4C 2NPLX 4JFZH 2BXZA 1HI6A 5TQ0L 1D5ZB 3WLBB 1J11A 3GSQB 5C0EB 3GKWL 1SEQH 1U36A 4JFEA 2RQ8A 4GRLB 4OM1L 1YDPB 3IFLL 4LHUB 3HC4L 4BFIA 4F7CA 3ALWA 2Q87A 5KSBF 2YUVA 5KTEH 1UB6A 4HLZG 3UBXA 5EU4A 3S96A 2N1KA 5CKGA 1SBBA 5K9QI 4Y1AD 4L3ED 3MOAH 1NLDH 2QLVB 4NGHH 1C5CL 3VFUA 3HCVB 5GRXG 3DRQB 1NUFA 1P7HL 4PJFA 2BVEA 3L3HB 4Z0XA 1Q94A 3P0VH 2X4QB 1NAMH 1LEKB 5HYQA 1J87A 3H42L 4FZEH 5E2WH 3OKKA 4ODVL 5JA9A 2DYPD 5IB4A 3GSNB 5F6HI 5IROA 3CFBB 3C5ZC 2AJXH 4H8WH 3EFFA 1KJVA 3IFLH 1A3RH 4XVJH 3B6SA 5FDWB 4YXLH 1SEQL 1Z6JT 3MACL 5KVDH 3VFMA 4F33B 4MXWH 4RAUA 1EO8H 1OGTB 1FE8H 4RMWA 4TTDD 4M61A 4QF1A 5KN5A 3O11A 1RJLB 2CRIA 4JGUA 3UYOD 1GCFA 3MO1A 2DQIH 5IEHA 4ENEC 3V6ZB 5DTFB 4XNZB 4HKZB 2EYTB 3CZJA 4IOIA 3QR2A 4Q9QH 5EBLB 4OCXH 3HLAA 4BK4A 2NCMA 5LG1A 3Q2CA 1OLLA 3MRPA 4G8EB 4PRDB 4X0KA 5E2VH 5F7NC 1IAII 1N0LA 2VLLB 4EI5B 5IB4B 4MJ6A 2PYED 3GSNA 4CGTA 3CFBA 2C4FU 1CU4H 4Q9BA 2AEWA 4BA8A 5EO1B 4JFYA 3QDMB 1SEBB 4GSDL 1A1NA 3LZFH 3TO4B 4PGBB 3SOBH 4PS4L 1BJ8A 3QO0B 4KQ4L 5E9DD 4M6ML 2P8PA 3ARBD 1HN1A 2EE3A 2NY3C 2VSDA 3B9AA 2V2TB 4Q74A 2YSSA 1KPRB 2A9NH 4L9LB 4PJIB 1D5BB 3OAUH 1TMCB 4PJHF 3X3GH 3WIIH 2GK2A 2DM7A 4PRAB 3D85B 4MA7H 5DTFA 4JO4H 2JJSC 4JZJB 5IHZB 4N0CC 5DVKA 4RFOH 4ZOEA 2Y9RT 4OCRH 5EBLA 4L1HA 3BGFC 5E99L 5AYUL 3RY4A 3WFHB 1T7WA 3FT2A 3LQZB 1KC5H 4KDWA 25C8H 2R2HB 5TFSH 5JIPA 5GRYA 3IF1A 5I8KL 2EH8L 4HLZH 2LAAA 3GHEL 1RJYA 5E1AB 1U8HA 1OF2B 4I3RH 5DC0A 1W0WB 1UKSA 5IVZA 3WFBH 4P5MA 5EIIA 4NO2B 1K8IB 2VXSL 3V2AR 3O6KH 2H3NA 1TQBC 1KB5H 4P9HC 3F6LA 4XRCA 1T66C 1D5BA 1HHGA 1S9VA 1X5HA 1IQWL 3EW3B 4O2EA 2BJML 1OAZL 1NMAL 4KROC 1I1FB 3U0TA 1S7RA 3VXUA 2A83A 3ZE0F 2OR8A 1EFQA 2HFFB 4YHZL 4YGAB 3NGBC 1MCKA 5JO5B 1AP2B 1F6LL 5EU6E 2AV1A 2R23A 3L95B 2WIIB 3HZYA 2VQTA 2NY1D 1TPXB 4UMGA 1L6XA 3FAWA 5C07B 3HFMH 4YH6A 4QXGH 2FX9H 3OGCB 2EIZB 5DLML 3FFCB 1KENH 2WV3A 5HHOB 1VCAA 3NMEA 4HFUL 3GM8A 4XNXL 2IAMB 2SEBA 4RMUA 4KZEH 2LQRA 2P5EA 3U46A 4J8RA 5E7FA 4PJ9D 3WDJA 1KULA 3V6FB 3IDGA 3X12B 4Q9CA 3F7VB 3FT3A 3E0GA 5ADPL 1LP9B 1F4YH 2F54D 2FZ3A 3VFWB 1WT5C 4KI5C 4LLUB 4TYUA 3BKMH 5E8NA 4KGJA 5I1KL 1EEZA 2V2XA 2VQ1B 3TBSB 2Z92B 5GS0L 3S4SB 4LPVA 4PJXE 4OGAC 1KN2H 2X4NA 3NN8A 2JKXA 2V5YA 1CICC 1T7XA 3QIUD 4YXHH 4DGIL 4L4VB 2GJ6B 3MXWL 3QG7H 3UYRL 4N8CL 1FNAA 2GTWB 4NQCE 1I7UB 4R4BB 4JPVH 5DDHA 1S9XA 3EYFA 1K85A 4JFDA 4LVNB 4PJBE 4TNVF 3UTZB 3HRZB 3WUWG 3L3KB 4DN4L 4H88H 3MCLH 3UJIL 3JUZA 3QQ4A 1E4WL 1ZT1B 4D8PA 1N4XH 3RFZC 4LPWA 5GS2D 1FIGL 1H8SA 4ZTPL 5BVPH 3PL6D 3D39B 4NJAH 1OSZB 3LDBC 1G7QA 5GGVL 2ESVE 1QRNA 2VC2L 1A7OL 4F37K 4U7KA 2EO9A 4RQQA 5DJYB 1FSKC 2VXQH 5I0ZA 4S0TD 5AG9A 3AGVA 4WY7H 4XPTH 3BZEB 5BRZB 4LLYA 2YZ8A 2ZG2A 3MCLL 2J8UE 4H88L 2GT9B 1WEJH 5EUOB 4FQQB 4UNUA 1J8HE 3EDFA 5JHDE 4YHNB 5EC1A 3F12B 3T8XB 5ID0B 3PJSB 1E4XL 2Z91A 5I1HL 3D87B 2C1OA 5GGSA 1RZGB 3REWA 1ZSDB 5IFJA 4LCCB 2DQGL 1AQDA 3DX8A 4XXDB 3WJLA 2O26U 5GSVA 2MFNA 4C4KT 1EHLH 3FZUC 3P11H 2HFTA 1AKJA 4OQTL 3GSWB 4LCIH 4PY8I 1IC4H 3RPIA 5IIEA 4QOKE 1A4JA 4DOHE 5A40E 3P9WB 1T66D 4H1LH 1MY5A 4AM0B 2K3TA 4DKFH 4C83A 4OCWH 1H3UA 3GGWB 3LCYA 2W91A 1M6OB 2FX8H 4RIRB 2X4UA 4M6OH 3SEPA 1A6VH 4B41A 3C60D 4IRJA 5CIPB 2X1WL 1MOEA 4C56A 1FORL 4FQLL 2K9UA 5ILTL 3BQUC 2MMXA 1NCDH 3EJZD 2FX9L 5IWLC 3GHBH 5LQBL 3LS4H