4PUBH

Crystal structure of fab dx-2930
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
212
Chain Sequence
VQLLESGGGLVQPGGSLRLSCAASGHYIMMWVRQAPGKGLEWVSGIYGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DX-2930 HEAVY CHAIN
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH01
1L6XA 3QZWB 3IETA 2JJUA 1K6QH 1WFTA 4L9DA 2X1XR 4Z7QF 4X0KB 2QV2A 3CGTA 4H26B 2NW3B 1AXTL 2XXCB 2D7QA 2EDTA 5KTEH 4WU7B 4O5LH 5HVFB 4KJYA 2W0KA 1R3JB 4LLYA 2H26B 4MLSA 4IRSC 2DKSA 3LSOA 4POYA 5L7XL 4QRUB 3HC4H 5EZJB 4YAQA 1KIRA 1YEHL 1TJHL 3NACH 4NRZB 2BSRB 1W0VA 4TUKL 4G9DA 4JKKA 2X4RB 4LHUG 1NL0H 3PGCA 4NRYB 3O4LE 3D0VB 5E2WL 2ZUTA 4J3UA 4PJBE 5JW4M 2DM2A 3RDTA 1PFCA 3W81A 5D2NA 5EZLA 4PJ9C 1SQ2N 5L2JB 3FCTB 1Q9KA 1UJ3B 5ADPL 2M1KA 4I5BA 2R69H 5K9OA 3IDGB 4YXLH 3KXFD 5T3XD 1F6AA 1AH1A 1IM9B 5E7BA 3M1BB 4OB5H 2AK4A 1RIUH 1UCBH 3IT8D 4P2OA 4QRRD 4R9HA 4BQ8A 3BOVA 4X6DF 2FHBA 5HGAB 3K7UA 4GBXD 1QSFB 4U0QB 1KPVA 3RP1A 5L9DL 3SDCC 2HP4A 1UACH 2R0LL 1YNLH 3WNKA 5FKPA 2ZP0T 4MX7B 5ADOH 4NQDD 4U0RC 5I1CH 1BJ1H 3JTTB 4X5WB 5D7JB 1FNGA 1VACB 1I9JH 3B2UC 3OJVC 5E99L 4MAUL 1ITBB 3MV7D 4BKLB 3O6MH 4TVPH 5C0IB 2BSSB 5TF1H 4ODTH 3BYTA 3RIFF 2VWEE 2BVQB 1Y0LA 3NCCB 5DMJB 1OAZL 4HGKC 3NA9H 3QI9A 4G6MH 4AG4H 3CPLA 1W0WA 4N8VA 3PGFH 4HGMA 1C5BL 5KVMC 3QXAA 4HC1L 5CLTA 5T1KD 4OZGF 1QSEE 2X4QA 3H9SA 4PJHA 3G6JF 5KBNC 3IJYA 4KJQD 4UBDD 4LLWA 3UROR 2VJXA 4WUKH 5DJXA 4ZD3H 4LDOB 4XAWH 1MJ8H 25C8H 3KPPB 3VXUE 3T4YA 1I7TA 3MRNB 4TQEH 3F5WA 1KIPA 3GNMH 4UDUB 2VLME 3HE7C 2PXYB 2HVJB 2VNCA 3TO2A 3IKKA 3IRZA 4ZFOL 2BXZA 2RJMA 5IT2H 2ITCA 3HZKB 4HKXB 2RCSL 4BA8A 1IC7L 1TVBB 4G8IB 1RZ7H 3HMXH 5IBLC 1NEZB 4G6FB 3I3DA 3O6FD 5IM7B 5IMKB 5MEOA 1FGNH 4GMTH 3OBAA 5C0FB 5JR1L 2VB5A 1UA6L 1JWUB 3IDNA 4L8DB 1REIA 5GS2D 3SPVB 4DGVH 3OAYK 3EO0B 3QIWD 3CFEB 4GQ9H 5F9JB 3QIUA 2XG4A 2NY4C 1XT5A 3QCVH 2FZ3B 3WUWA 1ZLSH 2I26N 3G08A 2CDEA 3QWOB 2VLKD 3RNQB 5KSAD 1ZXQA 2IG2L 4MA7H 3E2HB 4ZPVA 3S4SG 1J9CT 4BK5A 4KK9D 2EKSB 5FECA 5K9KB 5F44A 1T5XA 1VFAA 3G5VA 3FJTA 5JIKA 1BOGA 2EH7H 2X41A 2J6EL 4ENED 4F8TA 4IRSA 4PRBB 1A2YA 2L7UA 4PTTB 4XNZB 4GRMB 1YNKL 4JJHA 4NYLA 1HH6A 5B3NA 4OSUH 5I0ZA 3HUJE 2BXYA 3EO1A 3RWJB 2WBKA 4HCRA 3K74B 3RVXC 1TXKA 4KUCD 3CCHB 1CGVA 1M7DA 3MX0A 4S2SB 1NFDA 1J1OL 2DBJA 3NZ8A 5D7IE 2Z92B 4MCZA 4PJ9A 1D5ZA 4ZUVA 2E8YA 2FD6H 1TVDA 4XBEH 1EV2E 3A6CL 1NKRA 1JPGB 5F71A 5DHYB 1AY1L 1PEWA 5JLZA 1VDGA 4KKNA 1NC4A 1J87A 3S98A 2DYPD 3EJYD 1ZA3A 3TBSA 1KV3A 4QHLB 3SDCA 3STBA 5BQ7B 5D6CB 5L8KB 2EICA 2Z8VC 1CXKA 3A6BH 3S5LB 4K71C 5BS0A 2OK0L 4PGZA 1QBLH 5I16B 4G6JH 2KH2B 1LNUB 1JYVA 1KG0B 4LSPH 1VEMA 3WIHA 1A1MB 1T21B 4NO2A 2AQ2A 4YO0B 2A38A 4KMQA 3LKPA 4MNGB 4YDJA 4OIIH 5F7FA 5HD8C 5FGCE 1MJUL 2GTWA 1KJ2B 1OQXA 3MRQB 1WBXB 2W9EH 1JWMB 1KFAL 2D7MA 3B5GA 4KKCC 5C08A 3GGWB 1Z0MA 3F7VB 1BAFH 3GMOA 1B6DA 4K7PY 3V79C 2RB8A 1CXFA 4R0LA 2F5BL 1G9MC 3C6LC 3S34H 2I9TA 5GGTH 1II4E 1KOAA 1ZLWK 1ZSDB 3MRRA 4KPHL 5LXGL 1H0DB 1NC2B 1RIVL 3L3DB 4XCCH 2BCKA 4EI5C 3RGHA 4LEXL 1FE8H 2N1KA 1S7RA 1XIWD 2CDGA 4KI5D 4OGXL 5ENWA 3HZVB 3V6OC 5DJZB 5DQ9A 1GSMA 2R4RH 3U9PL 2AEIT 3MRMA 4PLKD 4XP6L 3X12B 3P4LA 3LCYA 4JRXD 4HIHB 1VEPA 3QRGL 3CLFH 5INCA 4DW2L 4JY5L 3HE7A 3LHPH 2KKQA 3P4MB 2MWCA 3P77B 4FQ2L 4UOJA 3BT2L 1IKFL 1S7SA 3KS0H 4H8WH 3Q3GA 3VXRD 2H6PB 4JFFA 4QRTB 5CP7A 1IGFH 1RULL 3D85A 5FKAB 3PJSB 4PS4H 1SBBA 2A6JB 3ES6B 3HMWL 3RL1A 1CICD 1RK0A 4P5KA 1EXUB 3O9WC 2X7LA 2VN4A 3TJHD 4PJEB 1JF1B 4XAKD 2A6DA 1H3UA 3Q6GH 1KT2A 4OF0A 3MRGB 4IHOB 4LLVA 1LO0L 2VZVA 3PL6D 5HYJB 4NO5B 1NCAH 4D9LL 1GC1H 1BX2B 3L3HA 5GRJL 5I76B 4TPRL 5IMMB 5IMLA 2VUOA 1MCWW 1ZVSB 2GJ6D 3O3BB 1S9VB 1FSKC 5SWSE 1L9MA 1NUDA 2NXZC 1F3RB 5HHME 1XF5B 2Q8AL 3LKNA 3BE1L 4ODHL 4K7PX 5LBSH 3RA7H 2DICA 4P5TD 4XXDA 5GXBB 4X83A 3DXAE 2W38A 1KJ2L 4D0CB 1JWSB 1VADA 3DGCR 4Q0XH 1JZ7A 3UBXI 3TBTB 4Y88A 5H2BB 1G9NH 3RKDC 5H8DA 3QFJE 4OLVL 4MAYB 1R0AH 1OWRM 3SE4A 4HS8L 4OM0H 3JV0A 2AXGB 1B0GA 5EPMA 3BHBA 4U3CA 1SY6H 5FOBA 2VISA 4J23A 3RFZC 3S6CA 5E9DA 2E6PA 5DEFB 4HIXL 3ECBA 5D7IF 2NY7H 1FVDA 1TZHA 4W70A 4YDKH 1H8OA 3PHQB 4MGXA 3HE6B 4Y4KB 1D9KB 3RWEA 2HT2C 4W4NA 1NBZA 4GOSA 1HZHL 4PFEA 5I1AB 5IHLB 3NCFB 4MVBD 5C6TH 5TE4L 4OD3L 1BLNA 5T1LD 2AQ3A 2B1HH 4M4PA 3EO9L 4FQXA 2OI9B 2W65B 4HJJH 5IK3A 1TETH 5GIRB 1Z5LA 1MREH 3Q6FA 1LEKA 1FC1A 3KLAB 1ZTXL 3KLSA 1A14H 1J05A 1JUFA 1MY7A 5AYQA 4EN3D 1HHKA 2D7TH 5CHNB 1ZKAA 2G2RB 2PR4L 4Z77A 4ZFGL 4N5UA 1CXEA 1O7SA 1QO3A 3QUYC 2GITB 5EU5B 2IPUG 2X1QA 5MEQA 4J4PC 1W72B 4BQ9A 3NPSC 3C6LA 3ARZA 1LO2L 3AB0B 3S3JA 5IVXA 3QIBC 1WWAX 1XMWA 1RK1B 2ZJSH 4C54A 3HTLX 1A7RL 4TOYH 3I75A 5F21B 2EXYD 2GAZB 1AR2A 4Y19E 2IPKA 1ONQB 1E28A 3V8CA 3U0TA 4YZFE 3DUUB 5EORH 1CFVL 3U4AA 4BH8B 2CLRA 3V6OA 4P9ML 5GZNC 5T3ZD 4Y2OA 5DYOB 3VFUB 1W8OA 1CE1H 3FRUB 4NSKB 5JDSA 4MSWA 4A6YA 2H32B 1GOFA 4PLJD 4G7VL 1AFVL 1BREA 1LO5B 2PCPB 1KULA 3MUHL 1VB9A 5EO1B 1U95B 3DBXA 1WQVT 1EFXD 1D6VL 2C7UB 4JDTH 5GGRY 2FWOB 2BZDA 3HPJB 3L7EA 4MD5B 1AD0A 5D7LE 3H2WA 4HULB 2DQFA 4PY7B 3K3QA 5C71A 1PGRB 1TLKA 2DQTH 3WNPA 3OKEA 3QQ4A 1BJMA 4H25A 2IQAA 4OZIF 3KGRA 1ZGLA 4KKBC 3HI1A 2JIXD 4NM8L 3ZE2E 1S7UB 2Z31C 3G6DH 2B7DT 3SKJH 3WHXA 4QF1A 4F37K 5I6XC 2YPLA 3VG9B 3QRFM 1HQ4B 5E2UL 4I13B 1J5OL 1TMCB 1HSAA 5L2KE 5HHOE 4XNYH 1N5YL 4HIIA 5F1NB 3WSQL 2FJFA 1YEIL 3L3JB 1FG2A 3GJFH 3QNYB 4ONHB 1N2RB 4J3VA 2DQDH 3OKOA 4U6XB 2XTJC 1YMMA 5IB1A 3ZHDA 5HGDA 3SHSA 3VWJA 3P9LB 4GW5B 4QT5B 5F3HA 3V5DB 5KW9H 3RGVB 1YECL 1YEJH 5CJOH 1I7RB 3LEVL 4U1SB 4M7ZC 3UZVB 2GFBB 1ZHLA 2AW2A 3CXDL 2DM7A 1WC7B 1KN2L 2ICWA 3B4NA 5CS7A 3C5ZC 3H7LA 3OR7A 1X7QB 3WUWG 4F7PA 4WI3A 4M7KL 4JO4H 2D0FA 7FABH 2VDKL 4O2CA 1A9BB 1NMAH 1JZ5A 3GSWA 4WW1A 3HFML 4YGAB 1HQRB 1XGYH 1SYSB 1WBZB 5T3XH 2Q6WB 5B21A 3U1SH 3A67L 3EIFA 1T0NA 4IS6B 5GRUH 3P4NA 3RWFA 3UTSA 3MA7A 2F8OA 3C2AH 2IWGA 1T2QL 4NKDB 3LKSB 1JN6B 1IC1A 5CBEB 1AKJB 3T65B 1FRGL 2X4NA 1L7IL 3GBNL 4PJ8C 2IGFL 4K55A 4LLMA 3WYRA 5JPNB 2WUBL 4HUNB 4X4ZA 4LVEA 3VXMA 1UYWL 3GJFK 2WBJA 3MLZL 3SGEI 4NQEA 1S9YA 2P5WD 3O2DL 5JOFA 1F02I 5KVFH 3BP5B 1ADQH 5ID0B 2HMID 1NCBH 5JW3L 4OQTH 2D7OA 4WFGE 1DLFH 4UAOB 1MHEB 3QUYA 4F7EB 1LEGB 1QLRB 1BFVL 4J4PA 1MCEA 3LEXB 1NLBL 3RTQD 4X6CE 1I8MA 3ZTNH 4M5ZL 4NWTH 3TA3C 5HGHB 1BVKA 3MRBB 2VXUH 4WW2F 1BQHG 5JDJA 2IJ0C 3CC5A 3QDGE 4PJ5B 3L1OH 5KTEL 1H8SA 4O5LL 3MGOB 4OAWB 1PG7H 3QEGL 3PWJB 3IAPA 5CUSL 2X70B 4M48H 1VEOA 1MFBH 4XPHH 4JB9H 4UOW0 3V95A 2BRRH 1HXYB 2ID5A 4YXHL 5J9PB 1G6VK 1LD9B 5E6ID 3U9UB 4JM2B 5DVMA 2QQKH 5I9QB 4ELMB 1MPAL 4WNQB 3NACL 2I5YH 2IH1A 4YZFF 1BM3L 1K4CB 1NL0L 5DT1H 2X42A 2AERT 3ZDZE 5E8NA 1FIGL 3MBED 1YDPB 3VFMB 1JZ4A 3SE9H 3SDXB 5D1ZD 1WAAF 5MENB 2LVCA 1G7QB 1MEXL 2EDJA 4KRLB 4U49A 3ZKNC 1MIEH 4NCC2 1A4KA 4L4TE 4WUUA 2VDRL 4GT7A 2P5EA 4U33A 1RIUL 3FO0L 3SDAC 1DBBL 4G9FA 4KRNA 1KB5A 4DQOL 3GO1L 1S7XB 1UACL 1MFNA 1T7YA 1RZJL 2BHZA 3BKJH 5GRYA 3B8YA 3QEHB 4R4NC 3LZFL 5BV7L 1R24B 1KGCD 3H9SD 4C55A 2PTTA 5GS2H 3IFPA 4P3CL 1QRNB 5IG7B 4RSVA 3BISA 3FQWA 2ZZUT 5DSCA 4Y8AA 2B2XH 3UBXB 1UCTA 1U93B 1F4XL 2DWEB 5BO1L 1DUZB 2BMKA 5FCSH 5ISZA 1I1YA 3O6ML 1F97A 5GGUA 1BJ1J 1QRKA 1CXIA 1KTLB 4JKMA 1A02N 3U46A 5C09B 3U0WL 2VKXA 3FZUC 1BFTA 1E6JH 1SEQL 5E1HB 3UX9B 3NA9L 6FABL 5IP4A 4XVSH 1AC0A 5DJ6B 5FF6B 3MUJA 1OP3H 2K9UA 4CBPA 3QUXA 1MRCH 2UZIH 5JHLL 4WHYH 3PGFL 4P2QB 4HK0B 3OAZH 4GAGH 1LK2B 4AMKH 3T0XA 1PLGH 3TBVB 1BGXH 4N8PA 3W11C 5C0AE 5JO5A 4HG4K 1WIPA 1FZOB 2P49B 1CD1A 3C5ZA 3QDJB 3F7YB 5DMKB 4GXVH 3REWB 4NQXB 3DMMA 3EJZC 4X6DA 3VGAB 1HHHB 1R5WA 4LVOB 3AREB 4C56D 4WUKL 4IDLA 3VRJB 4IRJB 4ZD3L 4A2MA 1XGQA 1F11B 25C8L 3OX8B 5DEZA 3BYYA 4AJ0A 4Y5XC 2HFFA 5CBAA 4NHCH 1CS6A 3N85L 2ZCHL 1X6LA 1FFOA 4EUPG 4LKCA 4HUUB 2BNQA 1IQWH 3WFDH 3WHE1 1A5FH 1VFBB 2YD1A 2JELL 3T0VA 1I1CA 2OZ4H 5C8JA 5IT2L 5D8JH 3KYKH 3ETBF 2P45B 5DJAB 4RBPH 1RZ7L 2AEPH 3HMXL 4PB0L 3RWIB 3X3FL 3BP4A 4A2LA 4ZNCD 2R8SH 1U8KA 3LEYL 3HPLB 4NT6B 5IMOB 1FFPA 3TZVD 1AI1L 4DUVA 5DC9B 1DLHB 4DGVL 4M6AA 4UINH 4HV8A 3RUGB 1HILB 2F74B 4OM1H 2Q7NA 4GQ9L 5F7NC 4TRPH 3WD5H 2VWEC 4Y4FB 1ZOXA 4OZGA 4OD1H 5IWLC 4HQQL 2O5ZL 4TNWK 4MA7L 5I30H 3AXLA 1N4XH 3TA3A 5JPMB 4Q9QH 1QSZA 3L9RB 1YJDC 3WDJA 4KRPD 1OGTB 1KPRB 3VFWA 3ZYIA 2MCPL 4AENB 4XNMA 4QRPB 5BS0D 4YX2L 3LN5A 4X6CF 4Q58C 1BZ7B 1IRAY 1BIHA 4OSUL 4PIRF 4LNRA 5EC1A 2R1YB 3C60A 1A6PA 4NKMA 3DVGB 2EC8A 4I0PA 3P2TA 5DD0H 2OJZH 2MJWA 3CFCL 2Z8RA 2VL5A 4U1LA 2JJVA 5IJKC 4LRIC 3DRQA 1CLZL 2FD6L 5JORB 3DX7A 4GH7B 3E6HB 5DUBB 3EDJA 1X4XA 4K8RL 4KKAC 3QHZH 5DTFB 3WN5B 1NAMH 4AT6B 3ZDZF 4ONOA 4OUUB 4CW1A 4Y4HD 4YWGH 1G6RA 3SDAA 3TN0D 4G8FB 4PGEB 3AS3A 3HCVB 2HJLA 4WO4B 3PQYB 2QQQA 4JDVB 5E8OB 5GJTL 1NGPL 5GS1B 3FOMA 1IQDA 1ZV5A 1M7XA 1WGOA 1QA9B 5JXEC 1P5VA 2Q7YA 3BRGC 4PRHD 1BVLA 1RSFA 5C0DB 1MLBB 5FYLD 3NN8B 4FRWA 4JFPB 4PGBA 3EOBA 4J3SA 3BESR 4WI4A 5TDPA 3BZ4A 43C9A 2Q8BL 3VGHA 3DHMA 5SX4H 1AO7B 1KCUL 3IJHB 4OV6F 1DQTA 5GHWH 5IV2A 1IM3A 3WNLA 1JPTH 1NBVL 2ADFL 4MWFB 1QLEH 2DQIH 3TEUA 5J11C 3LS5H 4JFFD 1AQDB 2KL6A 4P4RA 3TT1H 5E94A 3DROA 5GGTL 2DWDB 5FUOL 3O4LA 4PJBA 1NJ9A 3KPQB 4XCCL 1UWEH 5I1LA 1FE8L 2QR0B 4WFFE 4IDJH 1A7BA 3PWNA 4XCFH 4MQSB 1HHJB 4XI5C 3T2NL 4QOKB 4Y5XA 2R1WA 2ZUQC 5IR1A 4KK8D 5KVEL 4LEOA 4YHIB 4ODXA 5EA0H 2BP3A 5J0BA 2C4FT 5LGHL 2JK5B 1GOHA 2DD8H 3MREA 4H8WL 4ETQB 3MC0A 3RZCC 2XKNA 5DDHB 5DFTA 3TYFA 5FO8A 1V3MA 3MROB 2IAMB 5FUZH 2D7PA 3PNWA 3WE6B 1VPOL 5F7EH 4URTB 1X5GA 1JZ8A 4MJIB 3BW9B 2E6JA 1DQLL 3KS0J 1AGCA 4YEFA 2FGZA 4GJTB 4NP4L 4XT1C 3VGEA 3L3KA 4LCUA 5CD5C 4GKSA 5J89A 2YRPA 4KHTL 2E7LC 1HWHB 1F45A 3G6AA 3RWGB 1CFNA 1T7XA 5I1JH 3C6SB 2P43B 3KPSB 5IWLA 4NJ9H 1NCAL 3ESVF 4RMQA 5E5MB 1OAXH 5E9DD 4KJWC 3FQNA 4Q9CA 4YGVA 1EGJL 4L29A 4IMKC 3ULVD 3WXVH 1U8JB 4FG6C 4NZTH 4ONGL 2DMKA 5BVPL 5IFAH 1HKFA 4HFWA 1OGAE 1QEWA 1SJHB 4LPYA 3TCLB 3V4PH 5ICYB 1SM3H 2H2SC 1QSEA 3HNSL 3RVVD 2P8MA 4U3HA 5MI0B 1WTGT 3RA7L 3V7AE 3OXSB 1XGTB 3U30B 5A16A 1MJ7H 4KUZH 4PP2A 4J1UB 5HY9A 4ZG1A 3QUZA 4Q0XL 1G9NL 4HWBH 2BOBA 4RQQA 4FQXD 3CSGA 3VXUA 5T3ZH 4OLUH 4OM0L 4KHXH 4M6NH 3QSKB 1T20B 3LY6A 4GRLD 4YDIH 2WINA 5C07E 4I3GA 3ZKMC 1FDLL 3WFBL 3O0RL 2Z35A 2NR6D 4QHUA 4Y5VB 3SCMA 2GT9A 1S8DB 2ZOKB 4NBZB 2VR9A 3GMRA 4KY1L 4XX1G 4DN4L 1CFQA 1I8IA 2W60A 4Y1AB 4YDKL 4F2MB 1XCQA 4R7DB 4O58H 2I27N 3T1WA 5AWNL 4JPKH 2R2BB 2FRGP 1FYTE 2VABB 4HJ0D 4M5YL 5DI8B 1P1ZA 2AABH 3BPLC 4ZUWB 2XRAL 5JXEA 4O4YH 5LGJA 2E7BA 5C6TL 4N90E 3VXOA 5D1XB 1ZT1A 2B1HL 3TJEH 1I4FB 3T08A 1KELH 2V17H 3AS0A 4MHHG 3PABB 4Y89A 4YPJA 5C2BH 3H7BA 3GJFB 3GMNA 1A14L 1YZZA 4IRZL 3ZHKA 3JV4B 1KXVC 1D7FA 1MF2H 3OXRB 4BSWA 1NCUA 1MIMH 1VGEL 5A3ID 5I2IB 3HUJA 3OKDB 4R7NA 3X3GL 4PV9A 1ZLUK 2APTA 1YUHB 1MSPA 4TOYL 1DBKH 1U8HB 4KJPD 4G8GD 4P23A 2XN9D 3EYQC 3PP3H 5SX4I 3MACH 2EC9T 2FJGB 4ZTOH 4QYOB 1DR9A 5D7IA 4FTVD 1NGQH 1RPQA 5ANMB 1QUNA 4GS7C 1CD8A 4NQCE 5CEZL 1UB5A 4OGYL 3P9MA 3IVKA 3KPRB 1FO0L 5CEZE 3CFBB 1AXIB 1DEEA 4P3WA 5EU3B 3KXFB 5E4EC 2WANA 3QWRA 1CE1L 4Z7WB 1YMHB 3OR6B 2P24B 4IBLT 2NX5B 3DVFA 1MFEL 4QRRB 5IBUB 2RBLA 4WWKD 1JNHA 4YC2C 3AU1B 1URLA 2C1OB 5E8PB 4UTAH 2ITDA 3L3OB 4QXGL 5IESL 1AGBB 3RZCA 2C1PA 3OQ3B 3CFKA 4OZ4A 1ZLVH 3JWOC 3ISWA 1U41A 3D3VE 5HI3C 3TNMA 3V6FA 4NQDB 1UM6H 2BSTA 2FH8A 3VWJD 5FUCC 3RKDD 5I1DA 3N1MC 3MMEB 1HYSC 3EUUA 3IXAB 5IJVA 4I0CC 3REVA 5TE6L 3MV7B 4N0FB 3ULSA 5TQ2H 3L95A 4NKOB 2E7LA 1PBYA 1ES0B 2O5XL 2YS4A 1FH5L 3FB8B 3VXTB 1QQDA 3SKJL 2A83A 4YXKL 3GFUA 1SVZA 4WHCA 4I48A 4RGNC 4WW2C 43CAB 4GRWE 1K8DB 1UM5H 2DIJA 3QQNA 4IMKA 3F58L 1JNNH 1ZEAH 1KCLA 1U8OB 1ND0B 5J1SC 4PBXA 3HB3D 5I1HL 3FQTB 4PJ7B 4R4FL 2ADIA 1ED3A 4JFDB 4FQLH 4KDTA 4ALAH 5IQ7L 4M6OH 4Y2DD 1I85C 5DEGA 1YY8B 5I75C 3X11B 3NVQA 4EI6B 1MCWM 3CVHH 3DSFH 3BPOC 2N56A 8FABB 2H9GB 4MCYA 4NPYA 1XGUB 4BFGA 2ZCKH 5KW9L 5CJOL 3RWDA 4NFDA 1T5WA 1JTTA 2WBJD 4QKXB 1DTUA 4M1CC 1MH5B 4CN4A 1FNSL 3C9NA 1HK6A 4NC0B 2O26U 4Y5YA 1H3GA 1NLDL 5I8EB 1AIFB 4JO4L 1F8TH 7FABL 3TGXA 1QFWM 1NMAL 4KZDL 1DQDH 1N3NB 2DRUA 4L3EE 5C0CE 3QUYD 3LPGA 1XGYL 1A1OA 3JWDL 2NW2B 5T3XL 1YEGH 3U1SL 1A3QA 1CFBA 3O6FB 1MQKH 4U6YB 2ARJQ 4YHZH 3FN0H 4N9GB 1GZQA 4JFEA 3CH1A 3G5XB 4XNQA 4P48A 3VRLE 3MOBH 3PXJA 2DDQL 3EDFA 2VIRA 4XPBL 3N9GL 1K5NA 1XCTA 5HBBA 2VLKB 4JFYA 5KSAB 2IPUK 1RUKL 4U1GB 1HI6A 1OT2A 3DGGB 2UVFA 5SWSA 1DN0B 4X4XA 4YBQC 3ULUD 3SKNA 2NY3C 4DWHA 2YHGA 4BQBA 3MV9D 4XZUA 3TBYA 1U3JA 4H1LG 1EO8L 1LEIB 1IGYB 3DXAA 4LMQE 2V7HB 2OJEA 3S96B 3QB7C 4ODUB 5BZWA 1QKZH 2XIDA 2VERN 3ZTNL 1A4JB 4NWTL 4HAGA 3UTPD 3VXPB 3TNNA 2XG5A 3QFJA 3MOAL 4NQVB 1YEKH 4XMPL 3VGFA 3BGAA 3K4ZA 1ORSB 3L1OL 4PJCF 4E42B 3DX9B 4E41E 1MHCA 5I19H 4PJFE 3MXWH 2QADC 3HAEH 1U8IB 2DIAA 4LHUB 2OXGA 4M48L 4JFZL 3P4OB 4R3SB 4MD4B 1CL7H 3BVNB 3MLTB 3IJSA 2EYSB 1IEHA 4F37F 5GSVA 1FJ1B 4HKBA 2Z8SA 4WVRA 2P7TB 3GI8H 2QQKL 3DO7A 3QO1B 5DT1L 4YHYC 4OF3A 3CFJB 4ZOBA 3CFDB 2X4SB 3EZ8A 4YDLC 4UUJA 3TH4T 2DQGH 3BKCL 1CFTB 1ACYH 3V4UH 1VGKB 1WEJH 2Y5TB 3PGDB 4EVNB 2FR4A 3GKZA 3BPNB 4LLAA 1C08A 4JFOA 1MIEL 1N7MH 3QUXD 1P69B 1S7WA 4ISVB 2FYYB 1T1ZA 4U6VL 5FM5O 4F15B 1MHHA 3FO9B 1YN7B 2UWEB 4HDIA 4X7TB 3T1FA 4BQCA 1U8PB 2VLJB 4OF7A 3T2OA 2V2XB 5J1TC 5FYJD 5IBTH 1JMXA 2W9DH 1Y6NR 4JFHE 5DD6A 4N1CA 1MI5D 4HCRH 5JW5B 2FHFA 4IOSD 1J1XL 4CMMB 4OLYH 4QTIH 4Y16A 3DMMD 2IADB 4K94H 4WW2A 4X8JB 2ICES 2GUOA 1C5DB 1BZ9A 3NFPA 4MNQD 1S78C 4GFTB 2R4SH 4S1QH 4HAFA 3QDMB 3JV6B 1CVRA 4KAQH 1U8NA 1TCMA 1OM3H 3X13B 3DRTB 1SJEA 4KKLC 4YHNA 1ZS8B 2OTPA 3H3BC 3U7AA 2V2WA 4X6BA 1YC7A 4Y19A 5FFLA 2GJJA 4GRWF 4FXKB 1I85A 1DDHB 2VDMH 3H6JA 4K3JL 1QNZH 1E6JL 1WF5A 2BNQD 3TVMD 2VR4A 1EHNA 1BQSA 1HSBA 3MCG1 1OTTC 4GAGL 1J0KA 1XR8B 2Y6SD 4PRNA 3IDJB 5FHAL 5CGYC 3MYJB 2F58H 3T77B 3WIHH 4X9HA 5ABDE 1FZJB 3V6ZB 1EEUA 2ESVD 3CUPA 4JRXB 1DQQB 4GXVL 4K3EL 4JPWL 2FNBA 4JPIA 1IAKA 1OARH 1NUNB 4PJDB 2Y23A 2CPCA 4OZFA 3AMLA 1NAMB 5A2LH 5D7LA 4G6KH 5IVOA 5I1KL 4X9IA 3KAAA 4DZ8B 4JDZA 4Z7VB 2FB4H 2WIIA 4UIKL 2RHEA 1SMAA 2AJ3B 3W0WD 3I2CL 4F33B 2HJFA 4X7CC 2XFXB 3K8MA 2VYRE 4TN9A 5K9JH 4KDVA 3SDYH 4NHCL 3MLWH 5KS9E 2CK2A 1CXHA 1TNNA 1CICB 1QR4A 3QUML 5FK9B 2CIIB 1TVHA 2EDLA 3VFOA 1IQWL 3P0GB 1A5FL 4YPGA 4ZSOE 3M17A 1OSZB 3ROOA 3EYVB 3F6IA 3H42L 5I8OH 3B6SB 4MXQC 1PKQB 1GGBH 3ZE0F 4AZ8A 4QRSA 4RISH 1FZKB 5I8KL 2R8SL 3C60D 2X5PA 3UC0L 4XBGB 1MCHA 2OTUA 1VSCA 1CDCA 1PEZA 4KTEH 3GHBL 5TQ0H 3RX7A 4I0PD 5HHOA 3WS3A 5L2KA 5FYLH 4ODWA 2GJ6B 4UINL 1FFNA 3S4SB 1NSNH 1YYLH 1DL7H 2R9HD 4TRPL 4R2GC 3ROLA 3UTOA 4LSDA 1KJMA 2DQHL 5ELIA 3UJIH 4P5TB 3U36A 3JBG7 2FIRT 2EE3A 1YQVH 4FXLA 5I30L 5EC2B 3BEVA 2AEQH 2OYPA 5C6WH 3D9AL 2QLVB 3VW3H 4MDIB 5CWSB 4AEIL 3U79A 2BK8A 1QYGL 1EO7A 3G5ZA 3FB5A 1Q9OB 4BSVA 5A2IH 4CL7A 3S37X 3GUTB 3SKMA 1T66D 2BNRB 3GM8A 1Q0YH 2HT3C 4LASH 3T0EC 2J88H 3I6LE 3ARDA 1D5XA 4P2RB 1XH3A 4JM4H 1BFSA 1CDIA 2VDLH 1D6EB 1MAKA 5IB4A 1EEQA 1PW3A 3PDOB 2QQLH 4X6EA 1NKOA 1UWXK 4XVJL 1UXWA 4K7PL 1INEL 4PJFF 2W0LA 5ERWA 3BQUA 4M02A 1UVQA 2OJZL 1BIIA 4K9EL 1OPGH 3IU3A 4U1IA 2VQTA 1EPFA 4XTRD 3D25A 3O6KH 5E00B 3BDYH 4JGJA 3STLB 1M7IA 2BVTA 4XNXH 4CJ1A 2IMMA 3P30H 1AC6A 3IFNH 5D1QD 1CL7I 5DS8A 4U1JB 1AP2B 1U92A 1LE5B 3EKCA 1NAML 2A6KA 5T1LB 4JY4B 4CMHB 3PWUA 3WL9B 4YWGL 1I1RA 1P4BH 2CLVB 2V7NA 4O51A 4N0CD 5JOEA 1K2DB 4F7TA 3PP4H 1JRHH 2EECA 2HT4D 1ZMYA 4HS3B 4W6WB 5C2UB 1DQJB 3O2DA 5I8CB 1X9QA 1GYAA 4TNVK 4NN6C 3ZYJA 5JNYB 3GMMA 4WI5A 1JGEA 3FB7A 2N4IA 5J13C 4EN3B 4Q6YA 3QBTB 1LQSR 1H3PH 2I60L 1FN4B 3FMGH 5IB5B 1UZ8B 1D5MB 5D9SB 1A6VL 4LPCA 4NUGL 4X6CA 5D96C 1S7VA 4ODSH 5EDXA 2FX9H 3GJEB 1JFQH 3ULVH 4XP4L 1U8QA 3HC0B 3QDGA 1I1AC 1PY4A 1CWVA 2YD2A 5GHWL 3CDGB 2DLEA 2DQIL 2OSLA 3LS5L 3VCLA 2ED8A 3OGCB 4P9HC 3P0VL 3LVEA 3TT1L 2BNUA 3EOTH 1KCSL 4I9WE 3KYOB 4HT1H 3G04A 4MJ5B 2G5BB 2OQJA 3DV4B 1UM4H 2HLFD 3ESUF 2VXSL 4DUXA 3ZKSD 3GSNA 5CD3A 2CRMA 3ARBC 2B4CC 3D69B 2R2HB 4BZ1L 4OI8A 1P9MC 1FQ9C 3KJ6H 4PJAF 5D72H 4L4TA 4XWOD 4TNWF 1OP5K 3GMLA 4I4WB 2GTZA 3JVGC 4X7SH 3LKOA 5F7LB 5TPWL 3OKKA 1NUGA 3JUZA 3MJ8A 4JRYB 3FQXA 4Z7UA 4YE4L 1J1PL 3UEZA 4PRDA 4QWWC 3FAXA 5CJQL 5T33H 5CKGA 2PYFB 3W2DH 5KS9F 3O3EB 3QUZD 2ZG3A 2LE9A 1KUMA 3IGAA 1JHTB 3TPUB 2R2EB 2X4UB 3BO8B 4OI9A 1FCGA 2NPLX 1S9WA 3HAEG 4QHMA 4BZYA 3K46A 3UTTD 5E5UB 2ZKHH 3DURA 5EBMB 1DE4B 4A6YH 1T22B 5HXMA 3UTQA 2VLMD 2J2ZA 4QXUH 5GJSH 3LD8C 2GQHA 2MHAB 4JFXB 4NJ9L 5EU6E 4Q9BA 3SCMD 5JW4Q 1V7NH 4ZOEA 3H0TB 4JVWA 3ZKXC 3IF1B 2AJUH 4FNLL 4P59L 5GQBA 5B3JE 3HG1D 5IFAL 1ZE3C 3TV3H 5C0AA 3DX6A 4X98A 3V4PL 1IM9D 1L6ZA 4HPYH 2H45A 4Z7NE 5F6HJ 3T0EA 3IXTA 4AYFA 2RIKA 3FFDB 4KUZL 3CSYA 5DC0A 3RPKA 5J6GA 1GIGH 3HI5L 3DVNA 5TGBB 3GSXB 3DUSB 3V5HA 1A9EB 5IGXH 4GAJL 4Z5RB 4HWBL 5AZEH 1H15B 4H20L 1QG3A 3MXVL 1DQML 1K3IA 5F1IA 4EXKA 2QL1A 5DJ8A 5D7JD 4KHXL 4ELKB 2CLZA 1C12A 4OJFH 1AQKH 2X9YA 4L3CA 3IETB 5CIPA 1VHPA 1GAFH 1EEYA 4L3AA 4KJYB 3BPCA 1JZ3A 4LLYB 3ILQD 1RUAH 3K0WA 4PP1C 3B9KC 1S3KL 1NFIA 3UJTH 1FYHB 1I3RA 4LU5L 2V5TA 4RMTA 4YAQB 1KIRB 5DQJB 1ZAGA 4KQ3L 4P23D 3Q1SH 1W0VB 5FM8A 4G9DB 2P5WB 4I3SH 3HI6H 2GSGB 3PGCB 1BFOB 3FB6A 4PUBH 3T8XA 4GG6F 3RDTB 4KVNL 4O4YL 4QTHA 5I17B 1MCDA 5D2NB 5EZLB 3M45A 5CILL 5KANG 1Q9KB 4JGUA 3TJEL 4F7MA 4I5BB 1JYWA 4XMLH 5K9OB 4X9GA 1F6AB 4D94A 2PW2A 3CMGA 1R5VA 1WV7T 3RHWK 1JRHI 4HIJA 2AK4B 1J11A 4P2OB 5ESQA 1I1AA 2LTQC 3CFIC 1XF4B 3JTSA 3NMEA 4XMKL 3C09C 4ZO9A 1MCIA 3I3EA 5FKPB 4J6RL 5IFJB 4P4KD 3VFGL 5K9QG 4U7KA 4ZMAT 1JK8A 5C9KA 4L9LA 2D31A 1Y18A 1UQSA 3TH3T 2IALB 5DFWH 5IW3A 2NY5H 1FNGB 4RGOL 5F9OH 4FQCL 4XRCA 2CR3A 1OWWA 5IF0A 2HWZH 4G6FD 1NGQL 3FT4A 2XPGA 1NDMA 3MBEB 4OIAA 3VFVB 1T80A 1OOAA 1NCCH 1Y0LB 1I9EA 3LRHA 5D1ZB 2R23B 2X4PA 4ZUTA 1OAUL 3BKMH 3CPLB 4PJXE 5D2LE 4N8VB 1TCRB 2CJUL 5B22A 1NAKL 1KLUA 3NPZB 1MFAH 3GM0A 1WWCA 5HVHC 1CTNA 3KG5A 3QXAB 1U3ZA 2H2SD 4K2UH 3WFZA 4M8QA 1CE6A 4UTAL 4TVPE 1T7WA 3OJDA 2IF7A 1A7QH 2G75B 5F96L 3H9SB 5EBWA 4PJHB 5MP6L 2NXYD 2YXFA 4O00A 3IJYB 3UYRH 2OCFD 4DCQA 4LFHG 4LLWB 4XGZA 5DJXB 1MJJA 3UYPA 3IKCB 3T4YB 1I7TB 1IGMH 3LN4A 4GXUN 1YY9C 4NIKB 1MNUH 3GK8H 3B9DA 3QQ9C 1KIPB 1EZVY 4UV7H 5KVGL 3ULUH 1KEGL 3TO2B 1RQ5A 4PPTA 1HHIA 1I7ZB 1BBJB 3NA4A 1TPXB 4YDVA 1IAIM 3VXSE 1UM5L 5I1EH 5LWYL 1JNNL 4FFWC 1ZEAL 2ITCB 2DQJL 4JVPA 2D3VA 3L5IA 3KYNA 3TO4C 2EE9A 3VMOA 4JHWH 1QR1A 3TIEB 3O4OC 3LAFA 1OCWH 5MEOB 3P73A 4ELME 4HBQA 3IDNB 4E5XA 1KB5H 2AGJH 5B3JF 5AG9A 1G1CA 3QIUB 4S11A 3LIZH 1FV1A 3G08B 5GS0L 3SE3A 2CDEB 1NBYA 2ZNWA 3SDXE 5GZOC 1JHKH 4ZPVB 5LQBH 3ZT7A 32C2A 3SKOB 4PJIF 3L6FA 4PRPE 4M9PA 1BQLH 4C59B 1VFAB 1RY7B 5HHMD 3G5VB 1F4YH 1TTFA 1BOGB 1DQDL 3V5KA 3QXUA 1G7IB 3DXAD 1A2YB 2DJSA 1XGRB 1HHGA 3B9KA 4GSDH 2AV7A 1WZKA 2J1KA 4PRIE 4NYLB 4D9RD 1YEGL 1F42A 1QRNE 2KPNA 3K8LA 1FCCA 5FYJH 3TZVB 1NFDB 4MS8C 2A0LC 2DB8A 5C0BA 3NZ8B 5DJDB 3ARPA 4MCZB 5DD5H 3MOBL 1D5ZB 4XPGL 4ZUVB 3QFDB 1WCQA 4POZD 3P11H 1NC2D 1EVTC 2B5IC 4WWID 4RNRB 2DLIA 4LIQH 2P47B 5C09E 5JLZB 3QCTL 5EUKA 1CTOA 2XY2A 1RZKC 3V8OA 5INDA 1EZVX 1MCPH 2OR7A 1RFDH 2R0KL 4KMTH 4KRPB 4LP4A 3UJJL 4N0UA 1OGAA 3WIIH 5C0GB 3BUTA 2FHCA 5JZ7C 2XA8H 4DKFL 2AJYL 3EFFB 5BS0B 2ICWI 2GY5A 1DBMH 3BKYH 2BC4A 4M7LT 1Q0XL 4ZNEE 5IHUH 3BFOA 1YEKL 1ZANH 3NABH 5CSGA 2K7PA 2K1MA 1NANI 3VWKC 5ESAA 4HFUH 1H9VA 5E6YA 5SWZE 3QR2A 5C07A 5I19L 5B39B 1C7SA 3MRJB 4NGHL 4Y16D 2FSEA 1RMFH 4XBPA 5D5MF 1D3CA 4K3DH 5T1DH 2GTWB 2PO6C 1JV5B 4OCWH 4NWUL 3C5JA 3GMOB 1RVFL 3GBML 5HYJD 4Y4HB 1E6OH 2P8LA 4O02H 4R0LB 3TN0B 2AJZB 5DD1H 1E4XL 1LDPL 3GB7A 2HKFH 3CX5K 1U8MA 4MNHB 1IC4H 1A6UH 2C9AA 1MCQA 2DQGL 1FYTA 3KLHD 4Y19D 1WEJL 4PJXF 5D2LF 3BZFA 3MRRB 1KJ3H 5IEHA 1NGYA 4LVNB 1ROWA 4R90L 2DMCA 3BP7A 2NYYC 1S7RB 2CDGB 5HHNA 1XF2B 1P7HL 4PRHB 4V2BA 1LHZA 3V0WH 4HHAB 3OZ9L 4UQ2A 5DQ9B 1XGPA 4M1CD 4HWZB 2QSTA 3OPZH 1WCBA 1UG9A 3MRMB 3R06A 2MKWA 1F90H 5EO0A 4OLYL 2VXQL 4RFOH 5B38A 4KWUA 5INCB 3SJVE 4G6AC 4UZGA 1A21A 3QNXA 2AXFA 3FO1B 1AXSB 5F72S 2YD5A 1X5ZA 4XCEA 3R1GL 3TO4A 1WFUA 5CGMA 4EOWH 3DO3A 2IH3B 4JFFB 4XVUC 1EMTL 1UB6A 2K3TA 3VJ6A 3QPQC 5CMAA 3WMSA 4Q74A 5CINL 1G6RH 1ZHKA 1HH9A 1RK0B 2VDML 1FORH 1JTPA 1TZIA 1QNZL 4P5KB 2IPTH 4XB7A 4BZ2L 1NCDH 3W39A 2A6DB 4NQCA 4Y4KD 1L0YA 3TIDB 4HWEH 5EN2A 5FAAA 3LH2H 4LLVB 2NNAB 1V05A 5DRWA 4BQ6A 4OF5A 4OLZH 5FYKH 2PXYC 5GPRA 5I0DA 3WIHL 5IMLB 1B4RA 4V1DE 4X5LA 4RMVA 3KR3H 4L1HA 5FV1L 2AI0L 5M95B 1OARL 1GGIH 2IQ9L 1FPTL 2HTKD 4G6KL 2PN5A 1HOCA 3PQYE 4XXDB 3D3VA 1BEYH 3QEUA 2VC2H 1A3LL 3HKFA 3R8QA 3RVUC 4NO3A 1VADB 3DX8B 4QY8A 5C08E 1PY9A 4G80A 5HYSB 1RUPH 5L7XH 3TYGH 4IOFD 3U7YH 1PX3A 3QZWA 1B0GB 4TUKH 4PG9A 3ARDD 4H26A 2HH0H 3MUGA 2O5YL 5CSZA 5E2WH 2NW3A 5I8OL 1GGBL 3BMWA 1U3HD 3LQMA 5E9DB 4HX1A 2H26A 5IROC 2XICA 4DN3L 3V0VB 5TQ0L 5ADPH 3BQUD 4NNPL 1TZHB 3RX5A 2R56H 1JGVL 1Z3GL 3VFSB 4K71B 3RWEB 4DK6A 2X4TA 5IFHL 1KYOJ 4H88H 1I8LC 5AG8A 2R0LH 4J3XA 1BLNB 5L2JA 4BFEA 5KG9A 4FQXB 3IDGA 3VWKA 5JW4N 5IK3B 1LEKB 1Z5LB 3D39D 3E0GA 2L0DA 3M1BA 4X99A 4NNXA 4OCRL 1TQCB 1J05B 3OKLB 4JM4L 4MAUH 1T2JA 4WEBL 1CGXA 4L3EA 5E99H 1UADC 3PWVB 2PO6A 4HWNA 2NTFB 1A6AA 5GS3A 4MDJB 3S88L 1HHKB 3NH7L 3SDDD 3ZSTA 1QO3B 1P53A 2JJWA 4U05A 2DQCL 2XT1B 3FONA 4MX7A 5HI4D 5H35B 5MEQB 1OAZH 1ZT7A 3WJJA 1R5IA 4R8WL 5IVXB 4WEUD 2EEDA 4GUPA 1VACA 3QDGD 3TM6A 1MFDH 1SJVA 4XNXL 2XYCA 1MCFA 3IFNL 4OGAC 1EEZB 3MRPB 2EXWD 3BGFC 1PAMA 1DVFC 2CLRB 5DUML 1J0ZA 2E8ZA 1P4BL 3WLWD 4AH2B 5ETUA 1JRHL 5JDSB 1N0LA 4A6YB 1T1XB 5IB3B 3RGVD 3GKWL 1CU4L 3DBXB 4UV4L 5HHVL 3BUYA 5E56A 3DYMA 3CMOL 1AD0B 3NCJH 1NGZA 2DQFB 4L4TD 2F54E 2V5SA 3FFCE 2YA0A 3QQ4B 1NEUA 2FX9L 1WWBX 4H25B 1UXSA 1YEEL 3OF6D 4G8GB 2RCSH 5C70A 1ZGLB 1DANU 1IC7H 4E41A 4FQPA 4YBHA 1ERNA 4PJFA 3HI1B 2GCYB 3TBWA 5JR1H 2DBLH 4JO3L 1UA6H 1UEYA 4UDUA 3WHXB 1FVCA 4QF1B 3OJ2C 3NAAH 1E27B 4LRNL 1F6FB 4HT1L 2C3WA 4K23L 3OAUL 1LO3H 1UM4L 1HSAB 1FSKB 4O9HL 1TVBA 2EDYA 4JO2L 1CK0L 3N1QC 5ILTL 2ZUWA 1FG2B 1RIHH 1AR1C 1JWUA 3EO0A 3KJ6L 3LQAC 3OKOB 4LGRB 3CFEA 2VAAA 2J6EH 5EZIL 2B0SL 5IB1B 1CGSL 5HGDB 3VWJB 3FO2B 4X7SL 3IU4H 1YNKH 1OTUD 4HGWB 1G9ML 5F89A 1JMZA 3RNQA 1Z6JT 4M43H 1F2XK 4CNIA 2WLZA 4D8PB 2J7LA 3T0BA 5BRZE 2ICWB 5T33L 4F7PB 4XP1H 3W2DL 4ZFFA 1B90A 1J1OH 4O2CB 3QJFA 3GSWB 4WW1B 3UTZA 3RI5K 5IROA 4DGYL 3GRWA 4PTTA 2PYEE 4DOHE 4GRMA 4F7CB 3TESA 3P0YH 2BJMH 1OW0C 1QHPA 1AY1H 5HDBE 4JM2D 4A6YL 4Z95L 4ZS7H 3T3ME 2Y5EA 3RWFB 3UTSB 1R3LB 5SWQA 4MAYC 4OFPA 1M05A 2BVPB 2X4NB 2OLDA 3V6BR 3MRIB 5MEND 2OK0H 4LLMB 3NIDE 4PLNC 5CKAA 5DJ0B 1BBDL 2QKIA 3HN3A 3UAJD 2WBJB 3GEWB 5C0ND 2J5LC 2A9NL 1S9YB 5JOFB 8CGTA 4HH9A 3SOBL 3MR9A 4TNVF 4QRRE 2FATL 5BQ7A 3SGDH 1KTDB 3DETC 1GIGL 3Q2CA 3FOLB 4JN1L 3HE6C 3QUYB 4EZMA 1PZ5B 1B88A 3NPSB 3CAFA 5I16A 1MJUH 3G5YB 2YPLE 1I8MB 2A77L 1KFAH 5KS9A 4NOBA 4ONFL 1A1MA 4APQD 1BVKB 3V7AG 3CU1A 3VFNA 1CZ8L 1OTSD 3CC5B 5FA4B 2F5BH 3DNKA 3QUMA 1FL5A 4R97B 1DVFA 4CUCA 1DN2A 1MUJA 2GK2A 1TQBB 1MRDH 4KPHH 4BFIA 5LXGH 4WJ5A 2H3NA 3UJTL 3CK0H 4MA3A 1RIVH 4J2XA 4X9BA 4U2ZA 6CGTA 3CD4A 1GRWA 35C8H 4LEXH 4P2QD 4OGXH 4OLWL 2IH1B 5E2TL 3O2VL 4YBLC 1B0WA 3HI6L 4PUBL 4M3JA 2CXGA 1IFHL 1RJCA 3AB0C 5E8NB 2A73A 4QO1A 5GSRB 4XP6H 3MV9B 5DRNB 3QDJD 4WTXA 1ZSDA 5HYFA 3QRGH 4DW2H 3Q0HA 3L3DA 3MJ9A 4K8RD 1CFSB 2J8HA 5HJ3B 1A4KB 4WUUB 1IKFH 4RCAA 2P5EB 2IEPA 2OMBA 3E3QE 4GLRH 4HLZH 1KB5B 2EE6A 1RULH 4OCLC 3MRHB 3WFCL 1FGVL 1VA9A 3HMWH 1BP3B 2HFGH 3IFPB 4IOIA 1U0QA 3P77A 1WT5A 3PXHA 5ICXA 4LLQA 1HIMH 5F9OL 3BX7C 2IBZY 3MRLB 1LO0H 3VU2A 5ISZB 2H6PA 5AUMA 4D9LH 2N7BA 5GGUB 5GRJH 5FKAA 3VXME 5DHVA 4LVHB 2IBBA 3ES6A 3U46B 3LS4H 2EDKA 2UV3A 2AS5M 1N0XL 3ZT5A 2VQUA 5MHSE 4PREB 2XTJB 3O3DB 2F19L 1JF1A 3QUXB 3A0OA 2NY0D 2Q8AH 4ODHH 3BEWA 4F9LC 3B8SA 1S7TA 3MRGA 1ZGLP 4IHOA 1MFAL 4M7ZB 3VG9C 3S9DB 3QQ3A 5JO5B 1DBAL 5DMGD 1MI5B 2WSKA 1CD1B 2GJZA 4ZQKA 4JKLA 4MQXC 4XX1E 5SX5K 3VFRA 5T5NG 1A7QL 2NZ9D 4CU7A 1PZUB 1ZVSA 3DMMB 4XVTL 4HS8H 3SO3B 4X6DB 4FFVC 1R5WB 4JVUA 3UYRL 4UT9L 1XF5A 2IAND 1X5FA 4MNQB 2Y36L 5IVXF 3THML 4LCIH 1OW0A 2HTLC 2HFFB 1MNUL 5CBAB 3GK8L 4HIXH 3PDGA 2P42B 4MAYA 1FFOB 2H2PC 4LKCB 4X7DC 2BNQB 2ZOLA 5I1EL 5HDBF 2IMNA 5EBGA 3V4VL 4NQSA 1HZHH 4WFED 1TJGH 4JQIL 5GGQL 4JHWL 5C9JA 5TE4H 3CVIH 1U8KB 5DEFA 4S1RL 3QZWG 4GAFB 5DK0B 3EO9H 1G7LA 4P46A 2AJSL 3VD7A 3NIDF 4G9FE 5CLWA 3QH3A 5CZVH 3HE6A 1ZTXH 2W0FA 4NZRL 5I1AA 4OZGB 4WTZG 3DTXA 1S9XA 5FDWA 1EHLL 4P0DA 4DAGH 2GHWB 1KB9K 3AXLB 3TA3B 3G6JB 1OAYL 3RHWF 4JGMA 4JN2A 1HEZA 5EUOE 1FBIL 3MLVL 3NFNA 1LO2H 3VFWB 1F4YL 5LAXA 3SGDI 5HHPB 1OP9A 1A7RH 3KLAA 3LN5B 1AO7D 4LQ1A 1YPZE 4ZO7A 4EDXB 4LNRB 5EC1B 5FOJA 1CFVH 1J10A 3C60B 2HVKA 4P9MH 3GMPA 2GITA 4X9FA 5E4IA 5CEXA 4I0PB 2KZWA 1W72A 4MZ3A 5FHBH 4U1LB 3FT3A 2VDOL 3DRQB 1RK1A 4G7VH 1AFVH 4X4ME 4LARL 3EAKA 1JPFA 4LIQL 5FDYA 1D6VH 4HUWA 4KROD 4U31A 2XZZA 4LSTH 1CCZA 4BH8A 1MCPL 1RFDL 1W0YT 4KMTL 5HDOA 1G6RB 4CW1B 3SDAB 3G9AB 3L5XL 3WIIL 1T3FA 4QOKD 1WWWX 4TSBH 5BVJA 3W82A 3VFUA 2XA8L 3B43A 4NSKA 3FRUA 4HUXB 4L4VE 5E6ZA 5BOPA 5I9QC 2DTML 5HVGB 1DBML 4RFEA 1CXLA 1IQDB 3FOMB 2PCPA 3GI9L 4N90D 2CMRL 2DL2A 2MTPA 2Q7YB 3IB4A 1IEBB 1QFHA 1BVLB 5IHUL 3QXVA 3HPJA 1G9EA 4MD5A 3EOBB 4QXWA 3MTRA 1KENL 4IJ3C 5JUEL 4MJID 3VXRE 5TDPB 3BZ4B 1P7QA 2ZSVB 43C9B 1RJYA 4XC1H 1G7MB 5E2UH 3FN9A 4ZYKA 1J5OH 1SJXA 1F13A 1N5YH 4OCSL 5HYQA 5IV2B 1IM3B 3S37L 3WSQH 1YEIH 1S7UA 3UPAA 1B0RA 4Z76A 4F9LA 3QULA 5ESVA 3KPSD 1E6OL 1HCFX 4QNPE 4P4RB 3VDBA 5E94B 3DROB 4EEEA 1A6UL 1ZT4A 4UNTA 1FFRA 3O4LB 4UB0H 5F93C 2MPAH 1NJ9B 3LEVH 4XHJD 2Z0BA 4NQCD 4WRLA 5I1LB 2ADGA 3BIKA 5GGRA 3NCYP 3O2WH 4RRPA 5CEZD 3CXDH 1U42A 3PWNB 1B9ZA 2VE6B 1AJ7L 3V0WL 4G42A 4G5ZL 2ZSWA 5SV3A 2R1WB 1DP0A 3HFMH 1NEZG 4JE4B 2M26A 1GPOL 4NDMA 4PGCB 4HW6A 4QT5A 1J0JA 2IBGA 3V5DA 4ODXB 1I7RA 2YK1L 4NHUB 4XC3L 5CZXC 3MREB 1WC7A 5J3HD 2XKNB 3TYFB 5FO8B 5I15L 1VENA 4JR9H 4M62L 1T2QH 1GGUA 3PNWB 3ELAT 3VGAC 5KANI 4LVOC 1AGCB 1L7IH 1G6RL 2IGFH 3L3KB 4MS8D 4LCUB 4F3FB 1FORL 4QHKI 2IPTL 4IRJC 4LOUC 2EDOA 4LPXA 2Q6WA 1UYWH 2XZCL 2PW1A 5D6DC 3MLZH 1MCKA 4HWEL 3G6AB 3O2DH 3JZ7A 3VXQA 1FLTX 5FV2A 4PJXA 5D2LA 2F8VA 3EZJB 3ORJA 1HDMB 4HMCA 2Y7QA 5FYKL 5JW3H 3LKSA 4NO0A 3FQNB 1IAMA 2A74A 4YGVB 3TFKC 4L29B 2ORBH 2B20A 1NMBL 5HI5D 1BFVH 3B3IB 5HDQL 1QEWB 1EAJA 4XP9L 2XWBA 1T03L 4ETYA 1RZGA 3GSOA 4HXAL 4M5ZH 3VD4A 2P8MB 2C4XA 1OB1A 4S1DC 3QAZB 3CXHK 1BEYL 5A16B 2P48B 2VC2L 3EDKA 3EHBC 5FO9A 3MV11 1OAQL 5EUOF 3QUZB 5I74B 3QEGH 5CUSH 1MHEA 2CSPA 1RZFH 4F7EA 4RQQB 2BOBB 3JWNC 2DIBA 1QLRA 1RUPL 3GIZL 3LEXA 4Y4FC 2GIYA 4YXHH 3TYGL 3UTTB 1YPZF 1J0IA 2I07B 3U7YL 1G1YA 2V2TA 1MPAH 3S5LG 2Y1VA 2Z35B 1BM3H 3CSPA 2HH0L 5ACZB 5C0CD 3AM8A 3VXSA 1I3GL 4YK4C 3SCMB 2GT9B 1FIGH 4WI2A 3GMRB 2X70A 1G0DA 4ZFOB 1F2QA 3KPRD 4RX4A 4QGTA 1I8IB 2FLBT 1HXYA 2W60B 1MEXH 3HG1B 3LQZA 5LKNA 2R56L 5GRVK 5T3ZE 4ELMA 2VDRH 2DLGA 5TJWK 2NX5D 5K59E 4OV5A 1P1ZB 3FO0H 4WFHE 4H88L 1DBBH 5C3LD 4DQOH 4LSSL 1BF8A 3GO1H 3QT2A 3VXOB 3CJJA 1RZJH 1ZT1B 2YN3A 3LZFH 4ZAKA 5BV7H 3SDXA 3RU8H 5F9DC 2PUQT 3EFDL 4P3CH 3D2UA 4DFIA 4PRPA 3WN5C 3H7BB 4R4BA 2EIBA 1F4XH 3I84A 5BO1H 1NCTA 3GMNB 4Z8FH 2JKXA 3T3PE 4NNYB 1XFPA 3OKNB 1RJLB 4LLUA 4BSWB 4WO4C 2XNAA 4PRIA 5ALCH 3R4DA 1WUNT 3O8XC 1KC5L 3U0WH 3HUJB 3KNBA 1JP5A 1SEQH 3BIAX 4R7NB 6FABH 4PV9B 1QRNA 5F7DA 4ZXBD 1M6OB 1GC1C 1YJDL 3OAYH 3BIBX 3KPOB 5JHLH 3WV0A 4FQ1H 4OKVA 4P23B 1U93A 1MFDL 4X7FC 4E41D 5D7IB 3BD5A 3FQUB 4QNPF 4JFDD 1KTLA 5B8CC 1UB5B 3H3PH 3P9MB 3IVKB 4ZS6C 3LB6C 5C09A 2VZSA 2ICEA 2VZ3A 4DVBB 1NDGA 5GGVY 3VDCA 4F58L 3LDBB 1LK2A 5F9WC 5JHDD 1G9NC 1JNHB 4WHTB 2LVEA 5CIPH 2ITDB 5J57B 1FZOA 1ZA6B 4N5EC 3N85H 2ZCHH 3F7YA 3RZCB 3NCJL 4BFBD 1NBQA 2Z91B 1WBYA 3CFKB 4OZ4B 4P4KB 5CZKA 1S7QA 4RIRB 2ATPA 2VLRE 2UUDK 4OZHE 4ZNEA 5J8OA 3V6FB 4U1HA 4KQ4L 2BSTB 5I1DB 2JELH 3QEQD 2ATKA 5EU4A 1MWAL 2E3VA 2MQ3A 1S5HA 4EQ2A 4IRJA 1IBGH 3REVB 1F11A 5SWZA 3UZQA 4KXZI 3ULSB 4PY8J 4PB0H 4H0HB 5KSVB 3X3FH 5LCVL 2DBLL 2CDFA 3HNVL 3LEYH 1FVEA 4O2EB 2C26A 1AI1H 3BH9B 4W4OA 1SEBA 2A83B 3NAAL 2BVYA 4I48B 3KHOA 2R39A 5E2VH 1LO3L 4JREC 4L4JA 4HQQH 1J18A 2O5ZH 3KPTA 4FMFA 2BSED 2IAMC 4PR5B 5AZ2L 2A1WL 2ZNXA 3D0LA 1FC2D 1FAIL 5DC4B 3RWIA 2ADIB 1ED3B 4M1GL 4S1SH 1RIHL 3EYOA 3K2UL 1QD0A 4YFDB 4NT6A 3RIAK 1X5AA 1HXMB 5DEGB 4KGLA 2NY1D 1DLHA 2P5WE 2WWMD 2EEBA 4NM4L 4RMSA 2NXYB 2P46B 4R26L 1C5CL 2KBGA 2MCPH 4YX2H 4FQHA 3IU4L 4NPYB 4ZDHA 4LBEB 5LGKA 3BN9D 3VI3E 1T5WB 4M43L 1JZ2A 3C9NB 3L9RA 4Y5YB 3UMTA 1OGTA 1KPRA 3SJVA 1VESA 4U6HA 4WI9A 2LU7A 4XP1L 4OZIB 2YC1A 3CFCH 1I7UB 4LHUD 1CLZH 3HZYA 1A1OB 2W0PA 3P0YL 3RY5A 3U30C 1ZLWH 2BJML 4K8RH 1BZ7A 1VCAA 4Z0XB 2V5MA 3QYCA 4I77H 4PJBF 1PG7W 2WP3T 4ZS7L 4KK5C 4CVXA 3DVGA 5DWUL 3CH1B 5F88A 4K3HA 4XNQB 1UZ6E 3T0WA 2DJ4A 3BWAB 5GJTH 1BQHA 1NGPH 4HIEA 1K5NB 5DUBA 3KPMB 1FL3B 4JFYB 5DTFA 3WN5A 4KMLB 2YUWA 4V1DA 5EOCH 4AT6A 1HI6B 1OHQA 4UOW1 1WICA 3ME0A 5DO2C 4OUUA 2VLJD 1BD2D 2D0GA 5SWSB 2QQNL 4X4XB 3FN3A 5HHMB 5BOZG 1BMGA 2Q8BH 3TBYB 4RMUA 3PQYA 1JGUL 3DXAB 5E8OA 3O8XA 2OJEB 4JFQA 1KCUH 5E8EA 5BZWB 1XR9A 3RVWD 2ED7A 3BP6A 5EG6C 1KGCE 3J7HA 1NBVH 2ADFH 3T3PF 4C57C 5D1XC 3QFJB 4XCYA 5C0DA 3QDMD 3VD5A 4JFPA 3RAJH 1FNAA 4WU5A 4EBQH 1MVUB 1MHCB 4W81A 2E7CA 5B8CA 5FUOH 1KBGH 1LILA 4WV1B 3GSUA 3GBLA 1YEDA 1MRDL 3PWPE 3RBGA 4TSCL 3IJSB 3CK0L 3RY6C 1N8ZA 4HKBB 35C8L 1IEAA 3NOIA 2RR3A 5EH1A 1N6QH 2NY2D 3UDWC 3PG2A 4DZBB 4YC2B 1G7PA 3T2NH 1M71B 3BGMA 5DURB 5KVEH 1C08B 4YNYB 4OF8A 4YH6A 1HINH 1SY6A 1S7WB 5D70L 1T1ZB 5LGHH 1F4WH 1IAOB 1MHHB 4JG1H 4HDIB 4MXWL 5C0JB 3T1FB 1FIEA 4OBRA 4C56E 4MA1B 4OIBA 1YN6A 1JI1A 2MSPA 3BAEL 5DD6B 4BH7A 1VPOH 5ICZB 2G60H 4GW4A 4OZHF 1DQLH 1XZ0A 1CDHA 1KIQA 4RRPG 4NP4H 1H3WM 4Y16B 1WK0A 4YHIA 2HFGL 4QHNA 1KEMH 3V52L 2CR6A 4GBXC 4JFEE 4WW2B 2GUOB 4KHTH 3RI5F 1BZ9B 4UI2A 1HIML 1T1YA 4ETQA 3B83A 4J7RA 2DF3A 3T2QA 2PF6A 4N1EA 1TIUA 1JZ6A 3T2PA 3WE6A 1U8NB 1SJEB 3BW9A 2YKLL 2V2WB 1EGJH 2ZCLL 4Y19B 1E4WL 3LS4L 4ONGH 5BVPH 3MNWA 2MCG1 1HSBB 3Q5TA 1KLFA 3M07A 1ODAA 4JZOB 3HNSH 1CQKA 5F1OB 4CVZA 4PRNB 4EUPA 2BERA 4HLJA 1P84K 3CUPB 4QEGA 4P46D 1HKLL 4WCYL 4JPIB 1IAKB 3U6RA 1SJHA 5ICYA 4TULL 4P99A 2BNRD 3VI3F 4OZFB 2MFNA 4OT1H 5D7LB 2VXVL 1CR9H 2ZWLT 3HUJF 1FDLH 3WFBH 3O0RH 4P2RD 5ITFB 1AHWC 5L88L 2F54A 4WI6A 3FFCA 1KACB 4LCIL 4M00A 2YWZA 2HJFB 2YSSB 2VDNL 4MZ2A 2ZUXA 4KY1H 3IDXL 4DN4H 3E3QC 4KJQC 4YR6B 4UBDC 2JCCE 1R3KB 4M7LH 1L7TL 3B5HA 3SGEH 1TVHB 1RAMA 3BJ91 3VFOB 3QUKA 5AWNH 4YPGB 1DBJH 4O2FA 3JWOL 4M5YH 4QHKJ 4UT7L 3ROOB 1TJGL 2LAGB 2XRAH 4OCXL 4ZUUB 4HXBL 4P2YA 4AIZA 3CVIL 2FGWL 2OTUB 5FUCE 2AK1L 3WS3B 1UZ6F 4ODWB 4UIMA 5EO9A 1U58A 2NY3B 1FFNB 3OB0K 3HNTH 4PGJA 4JHAL 4R7DA 5KOVC 5DZNA 3X14B 5CZVL 1MCOL 3C8HA 1G7JA 5EU6D 3O6FC 2R2BA 1KJMB 4RA0C 3U2SA 3F62A 5DGQA 5CJXC 3U36B 3CZFA 4IRZH 3L7FA 3ARGD 4DAGL 1Q38A 3QIWC 4PYHA 3BEVB 4RGNE 5D1XA 2FCBA 4N8CH 4PRHE 1VGEH 3G5ZB 3FB5B 5DLML 3X3GH 1I9RL 4G43A 3PABA 5FYLE 1NPUA 5BRZA 3SKMB 5TF0A 5IKCB 4KK9C 3ARDB 1D5XB 4HZLA 2EDBA 3OHXB 4EI5A 2VLLA 4PB9H 2D4DA 3JV4A 1U3HB 2PYEA 3FKUS 2XKSA 4X6EB 1UXWB 5CEZH 4ENEC 3UDWA 4OGYH 1JPSL 1FO0H 5ERWB 3BQUB 1UVQB 2BY3A 3IU3B 1P7QD 5FHBL 5CCKL 3D25B 3IFLL 4KV5E 1M7IB 1MFEH 2VZOA 2XQBL 2J8UE 2FJGA 1CD0A 4QYOA 4DKEH 4LF3A 4LSTL 2A6KB 4QXGH 5IESH 4TSBL 2V7NB 4O51B 2VSDA 3D39B 3OR6A 1K4DA 4ODVH 5CGTA 4QRRA 3EJYC 3O9WA 3GMMB 4GBXA 4HBCL 4JRYD 5TE6H 2OS7A 1JGEB 3FB7B 2A9MH 3AU1A 2C1OA 1UJTA 4YHPA 5DFVD 3AVEA 3SDDB 2O5XH 1FH5H 3JV5A 3MRFA 4X6CB 4GRWH 3BPNC 4YXKH 5FYJU 4JANA 3LKQB 4F15C 3MMEA 4XC1L 3F58H 1Z0NA 4CADA 1U8QB 4S0TD 3QDGB 3S36X 1I8KB 4Q97A 1ADQA 2O93L 5I1HH 1P4LB 4NKOA 1T0MA 4XPTL 4OQTA 4R4FH 1ES0A 3OKMA 2OSLB 2HRLA 3O41A 5IQ7H 1UGNA 1KSRA 3VXTA 3IDYB 2VL4A 3GIVA 4OFVA 1PD6A 1JL8A 2BNUB 3WIFA 4PD4J 4MQ7A 3GHEH 1K8DA 2OQJB 3H9YA 4UB0L 3ZYZA 1H3TA 4OI7A 1U8OA 2MPAL 2WNGA 3T4AA 4EDWL 3NFSL 2ZUYA 5CD3B 1OLZA 4PJ7A 4JKPL 4XXCC 3O2WL 1FNSH 4OGZA 1I1FA 1IGJB 3MLSL 5T1KA 1AHWA 1C1EL 1NLDH 4I18C 1C16B 3VFTB 4L4TB 4NO0D 4EI6A 4KZDH 4D3CL 5DK2A 2H9GA 1XIWC 4KI5C 4HUVA 1C7TA 3B2VH 2FECI 1ZHNA 3MLRL 3JWDH 3OKKB 3MJ8B 3FQXB 4ORGB 1LK3H 4G8EA 2GI7A 4I0KA 4HF5H 2FEDD 4PRDB 2VZ1A 3KWWA 4PLKC 2E7HA 5A40E 5BV7B 4UTBL 4JR9L 5F6IB 2JCCF 4TTDD 1FG9C 2YMXL 2HLAB 3A6OA 2IC2A 1EJOL 1AGEA 3IGAB 2DDQH 5E1AB 4XPBH 3N9GH 5FXCH 3DURB 1RUKH 4LHQB 3RVTC 3UTQB 1CIDA 4KTDL 2HFEA 3O6FA 4PBVC 5GRVL 4L8SB 3D1MC 4M3KB 5CJXA 4FZEH 3VGDA 2H41A 1RD6A 3RDTD 1CICC 3VFPA 3G5XA 1DSFL 1OAKH 3EJJX 3QIWA 3PIQA 3TJHC 4UQ3A 2ZG1A 2CRZA 5CP3A 1EO8H 4RX4D 4H5SB 3MV8E 2ORBL 3S7GA 4HZAA 3ZDXE 5C0AB 3DX6B 3PL6C 3QIBA 1U36A 4NC1E 3IFOA 4JPVH 2AK4D 4P2OD 3MOAH 3DGGA 4XMPH 2G9HB 2X4OA 3CSYB 5I1IH 5J6GB 4KRMB 4MYWB 1Z2KA 3DVNB 2FL5A 3OWEA 5E0QA 4ZAKD 2J4WH 1RZFL 4JFZH 2V7HA 3DARA 3S96A 5GS0D 3KPNB 1NMCB 5KJRL 5F1IB 3D2UD 4P5TC 1T1WB 3ZO0A 4PRPD 5DJ8B 5H37H 4XB8A 5E70A 4L3CB 3VXPA 5CIPB 5JIHA 4DEPB 4XWGL 1EEYB 1BPVA 4G8GE 3GSNL 2XN9E 5E08L 4E42A 3BPCB 3AY4C 3BKCH 2WUCL 4PRID 4FTVE 3B9AA 1IKNC 1U8IA 3P4OA 1TJIH 1NFIB 3VG0H 1I3RB 3QI9D 2EYSA 5BZDA 2E27L 4JKWA 5F70A 2C5DC 4KDWA 3OB8A 4U6VH 2P7TA 1OSPH 3ZTJH 3K80A 3GMQB 1P7KB 4M1DL 2DYPA 4NN6B 3CFJA 1XAUA 1CGWA 3IDUA 4LCYA 3CFDA 2X4SA 3T8XB 2EDWA 2OL3A 3B9EA 3WNOA 2APWA 2Z31A 5DJCB 5IIEA 1CFTA 1EUUA 1VGKA 1J1XH 4N0YL 4Z7UE 4JO1H 2Y5TA 4F7MB 3RU8L 4N1HB 4YQXH 1YC8A 2OZ4A 4B50A 2Y06H 2YOCA 5D96B 1U6AH 1Z9LA 2PW2B 5EULV 1R5VB 1Q94A 3FO9A 4MVBC 5EOQH 4HIJB 4UDTA 2MQ0A 5ESQB 5EUOA 3ZE2F 4CMHC 4APQB 3QJHA 5B4MD 2EEAA 4YHLL 2FBOJ 4Z8FL 2YA1A 3JTSB 1OF2B 4HKZB 4LCCB 3U7WL 3ALWA 5ITBL 5GGSA 4D0DA 5ALCL 1YPZA 5TDOB 4K3JH 1JK8B 5JXAL 2C3HA 4L9LB 4LKXA 4BUHA 1Y18B 3F12B 4X8JA 4EN3C 2D4FA 2NTSP 4YHML 4FQ1L 3VE0A 1PSKH 4XRCB 3LPWA 2NY6D 5FHAH 2JJSC 4M4RA 9CGTA 3FHAA 3FT4B 4XXCA 1NGWB 2XPGB 4X4MA 3HC3L 1NDMB 4YIQA 1QVOA 3O11A 2E5EA 2EDRA 3H3PL 4K3EH 4I18A 4JPWH 1UH3A 4FXKA 3T0EE 3UO1L 2EXYC 4QCIB 1CT8B 4XCNA 3BZEB 2X4PB 4ZUTB 1KNOA 3QIUD 2GKIA 4H0GA 4PBWD 1XIWA 5I1KH 4ZTPL 1J8HE 2DM4A 1XR8A 1FHGA 1IARB 4I2XE 2A6IB 2EZ0C 3IDJA 4UIKH 3O3AA 3I2CH 3MYJA 4HS6B 4L4VA 4M8QB 1FZJA 3OJDB 4JRXA 1JE6A 5EBWB 4GG8A 3QUMH 2C4FU 4IRSD 4AL8L 2ERJB 2BVOA 4LSRH 4PJ8A 1JYXA 1MJJB 1EIBA 1IBGL 3H42H 3EYFB 3VXRA 5DF0A 3ARVA 2AJ3A 4F33A 1QLFA 5I8KH 3UC0H 3ILPA 2QTEA 3AAZB 3DHJA 3GHBH 3SJVD 2P8PA 4DGIL 5FK9A 4HEPG 4PJ9D 1HHIB 4YDVB 3ZKXB 1ZVYA 3ARYA 2NY0B 3HR5A 5E2VL 1Q9WA 2DQHH 5F7HA 1V7ML 2XY1A 3KYNB 3PL6A 1QR1B 2BHUA 3UPCA 5IHZB 3FRPG 1FZKA 2E9WA 1NC4D 3ARRA 3INUL 3P73B 4GKZB 3D9AH 4S1SL 1XF3A 1FNHA 4YEEA 4AEIH 4E5XB 3SDCD 1QYGH 1I3VA 3QCUL 2R0WL 5KSUA 3AFLA 3ZDXF 1QZ1A 3ULUE 4LMQI 2F53E 4FA8A 3MV9E 2IANB 1FV1B 3H9ZA 4P9HL 4RFNC 1NBYB 2X2YA 4LQFH 5FEBA 1R3IL 4F9PC 5DJ2A 32C2B 4M8VA 3B2UD 3L6FB 4XVJH 4K7PH 1INEH 5DRXA 4K9EH 1JBJA 4NC2B 3N06B 1WZ1L 2NCMA 3AY4A 2B4CL 3V5KB 5JOPD 4JZNA 1A7PL 1IKNA 1YA5A 1HHGB 3B9KB 5HHXH 5D4QA 2Z93B 1D6EA 2MKLC 3DI2B 5C08D 1QFUL 4H1LA 4I77L 1CLOL 5JIIA 2UY6A 3HLAA 1YEFH 1TFHA 5JA9A 4PGDB 1TITA 1DUYA 4Z0BL 1IL1A 5EUKB 3HS0A 4ZUSB 2I60H 5EOCL 1LO4H 5INDB 5T1LA 4HKJA 4JY4A 2DL9A 3CLEH 3WL9A 1A6VH 1OGAB 4HK3J 5EFIA 2CLVA 2D0HA 4Z7UF 5HHQB 4NUGH 1LP9E 3EYSH 5CFHA 5A2JH 4N5ED 1GZPB 4HS3A 1BOYA 4XP4H 1MI5E 1DQJA 4RGMB 5D93C 3HE7D 5JNYA 1AGDA 4XNUH 5L0QC 2WMPA 1B3JA 1QACA 2HMIC 5D2NC 4G3YL 5HGGS 5D9SA 3RAJL 5IBUG 3MLYH 4MNQE 3P0VH 5IBLD 5F9AC 3D85D 4EBQL 1KCSH 4L8BA 5C07B 2RGSA 4ODBD 3I6KB 3RTQC 3RY4A 1KBGL 2FSEB 2X10A 4XBPB 3HC0A 2EC9U 3LKRA 2VXSH 2NY4D 4KROB 4R96A 4BZ1H 1N6QL 1IGIH 3QG6A 1U2HA 4FQJH 3GB7B 3KYOA 4PJGE 3C8DA 1H3VA 5E6IC 4MLIA 3C5SA 2G5BA 3BZFB 3DV4A 2JB6B 2ILLA 5TPWH 3RIAF 2ESVE 2C3VA 1HINL 1EFXA 3BP7B 4LGPB 4YE4H 5LG1A 1F4WL 1J1PH 2X1WL 5HHNB 5ALBL 4JG1L 3ZL4L 3NCMA 2VXTL 5CJQH 3MBEC 4UQ2B 5D1ZC 5FO7B 1T4KB 1WCBB 3RVXD 2G60L 1FLRL 3W0WE 5EO0B 4UILL 3G6JE 5B38B 1GGYA 1JGDB 2XKUA 2OR9L 2CK0L 1BWWA 1KEML 3BI9X 3QNXB 3DLQR 2AXFB 4Z18A 2DOCA 2JIXA 5H37G 4PJCB 5C0BE 2F54D 4FQQB 3LRGA 3TO4B 3Q5OA 1J86A 2V9TA 3SGKC 1CLYL 4N68A 4WGWB 1UB6B 3O3EA 4L5FH 1RURH 2ZPKL 5C0RH 3VGBA 5CMAB 2OTWA 4KVCL 1JHTA 3TPUA 2X4UA 3BO8A 4FNLH 4P59H 1ZHKB 1KJVB 2HG5B 1TZIB 2Q86A 3KJ4C 4I3RH 4N0UE 3W39B 5DUPH 5HGBA 3VMPA 1DE4A 4NQCB 2J8OA 5J12B 2X1PA 2DQEH 4NN5C 5F3BA 5EN2B 1EK3A 1LE9B 1RHHA 4PV8A 1FO0B 5DRWB 4F9PA 3HI5H 5KAQG 1TPXC 4GAJH 3IF1A 2FECL 4H20H 3MXVH 1DQMH 4X6FA 1INQA 4UU9A 5IJKA 1IE5A 3BD3A 4LRIA 4BSJA 2YZ8A 4OT1L 2EYRA 5BXFB 1CR9L 4OLXH 1ZLUH 5HD8D 5JQ6L 3D3VB 2VLRA 3FFDA 2Z4QB 4OZHA 4KKCD 3FL7A 3RNKA 4NO3B 3DUSA 1A9EA 4RA3A 1F4AA 2X1OA 5F7YC 3FTGA 4G80B 1MWAA 1S3KH 4FFZH 3C6LD 4LU5H 4M7LL 2KZ1B 3Q5YA 4ELKA 4LCWE 4KQ3H 1DBJL 1IILE 1EH9A 4PG9B 4YHOH 2B5IB 1T7VA 4WHYG 4CN6A 3MUGB 5CSZB 4EI5D 3EW3B 4GRWB 2PYED 4KVNH 1MAJA 3HA0A 5CILH 4HX1B 3UXFA 1EA9C 1P4IL 2YUVA 3ZDYE 3HNTL 5DQJA 1KCRH 4LHJB 4DJMA 4LPVA 2X4TB 5I1GL 1S5IL 2P5WA 2GSGA 5C7XH 1BFOA 4IEFB 3TZVC 2BY1A 4K94C 4XMKH 5I17A 4L8CB 1LP9F 3S3PA 1GGCL 1X4ZA 4J6RH 5KG9B 1F4HA 3VFGH 4N8CL 1ETZA 3DPBA 3VWKB 5L6YL 3IRPX 5J56B 1KLGA 3RTQA 1SMOA 3GSVA 4UMGA 2AV1A 4RGOH 4X99B 4FQCH 5T5FL 4NNXB 3O9WD 4KRPC 1XF4A 5C1MB 4L3EB 2PO6B 1A6AB 2HKHL 5C0CB 3D18A 4PB9L 4EXPX 3CVHA 5IFJA 3DIFB 3QXDA 1E4JA 5C0EA 3FONB 3MO1B 2YPLD 4PTUA 1ZT7B 1R5IB 1JNJA 1OAUH 2GK0A 2IALA 5E6IA 4GUPB 2CJUH 2HYMA 1NAKH 2EIEA 1EERB 2NXZD 1N5AA 4DKEL 1JHLH 4E9LA 1A0QL 3MBEA 1T89C 3VFVA 4PJGF 3UZEA 4Q7DA 5D1ZA 4AY0A 2R23A 3IAQA 5F96H 5ETUB 3MFGB 5MP6H 1YMMD 4RWHA 15C8L 2LQRA 5JMRA 1A6WL 4ESKA 4U1KB 1TCRA 4ODVL 1O0VA 5KSBE 4Y4HC 2M8XA 4R0LC 3TN0C 1NH6A 3WS6C 3BUYB 2A9ML 1N59A 5CJ8A 3C2SA 2CKBA 4P57B 1G84A 5D7KE 3X17A 1NGZB 2G75A 3SGKA 5KVGH 2DLFH 1KEGH 4LVNC 1RZKL 1LGVA 4ZXBB 5LWYH 5MEPB 5AAWA 1UXSB 3S35X 4WI8A 2DQJH 2Y72A 1KXTB 1E0OB 4E41B 5F7MC 3IKCA 4PJFB 5T1MB 3RKPA 5DR5L 5K93A 3TBWB 3UTTE 2HT2D 4DVRL 3PWPA 5BJTA 3UTSD 1CF8L 5IOPA 1FVCB 1F3JA 1TNMA 1R6VA 4TYUA 2VQ1B 3E6FB 1I7ZA 1KXQE 1BBJA 3GHEL 3WXWH 4IIQC 5GS0H 3SY0A 4RAVA 3VXMD 5JHDB 1H5BC 5IVZB 3TIEA 4P3DA 1I75A 3WEXA 3HG1E 4NQED 2VZUA 4NCC1 5MHSD 3HAEA 2KUTA 3W9EA 4OD2A 1FAKT 2P44B 1QSFE 2VAAB 1V8HA 3MRKA 4ZODA 3QEQB 2WZPD 3B2VL 4J4PD 4C56A 5F89B 3QIBD 4CNIB 1LK3L 4HF5L 1PG7X 3SKOA 3PDDA 4KK8C 2VN7A 4ZFFB 3GSQA 3QJFB 2F5AL 3UTZB 5KN5B 3K4DA 1G7IA 5GZND 4XPGH 1A7NL 2ADJA 1N6UA 1JCKA 1XGRA 3RBSA 3QNZA 4ZPTA 1D5BA 2VRAA 3QCTH 3Q48A 4ERSL 3DV6B 2R0KH 3UJJH 4FZEL 5SWQB 2YBRB 3TZVA 4WHDA 3PV6A 2NY1B 3SE4C 1OAKL 3ZDYF 5DJDA 4RAUB 1M05B 4DKFH 2AJYH 3FT2A 4BYHA 3QFDA 5LJYH 4RNRA 2X6MA 3DUHA 1KTRL 2QKIB 1A6ZA 3VDAA 3O6LL 4WUUD 1NUFA 4JPVL 1Q0XH 4PJAB 2P5ED 4TUJA 3NGBB 4HH9B 5I66A 3ULVC 1JGLL 4G7YL 3MR9B 4G9FD 5C0GA 5I1IL 4KKBD 4PG2C 2Z31D 3EFFA 5GGSY 2J4WL 4NGHH 4Q2ZA 3RVVC 1GCFA 4Z78A 3RJQB 5KS9B 3N1PC 2O61B 3MFFB 4WY7L 5J06A 2JCCA 3H9HB 2GY7B 4NWUH 1RVFH 3MSPA 3VFNB 3GBMH 5DQDH 5ISZD 4FQXC 1RUML 1WSST 2FBJL 5IW1A 3QUMB 3BGFB 1E4XH 1LDPH 5T5NF 3F8UB 1FL5B 3MCKA 4ZSOB 2FIKA 3QXWA 1DVFB 1T89A 1MCLA 5B39A 3MRJA 1MUJB 4BK4A 4BFIB 3MCLH 1TJIL 4GRLC 4WJ5B 3QA3B 4NKQB 2H3NB 4TTGA 4MA3B 2HN7A 4OFIA 3VG0L 1TQCC 1SVCP 2XTJD 4R90H 5GGVL 3EGSA 2NR6C 1JV5A 1OSPL 4HG4J 1BD2B 4Y4HA 3OZ9H 3TN0A 3WS6A 2AJZA 2A73B 4MNHA 1VKXB 4MQTB 5HSFA 3C5ZD 4JO1L 2VXQH 4JLRB 1F58L 4YQXL 3SQOL 2Y06L 4HJ0C 1CDBA 2WQRA 1Q72H 1JPST 1U6AL 4M93C 2EDNA 5KSBF 2FX8L 3GRWL 3WO4B 1XF2A 5EOQL 4PRHA 2PKDA 3R1GH 5C6PB 1A8JH 2AJXL 3U4EA 4HHAA 4L4VD 1EMTH 4HWZA 4NC1C 1A22B 5CINH 1GH7A 4OCNC 4TSAL 1MCCA 1B2WH 1J8KA 3MBXL 4LLDA 4IOIB 1MCJA 2BHYA 4B53A 4BZ2H 1IZJA 4OZIE 1A6TA 3FO1A 1AXSA 4IIQA 4PJ8D 4M7JH 5ICXB 4LLQB 2QHRH 1PSKL 2YD7A 2Q20A 2NY2B 4NKIL 1H5BA 2IH3A 5AUMB 5A3IC 3RVTD 4AEHL 1ZHBA 2BFVL 5DHVB 2J8UA 2Q3ZA 3ZLQC 3I3BA 4FS0A 4KJPC 2AI0H 1FNEA 1TZGH 2IQ9H 4GG6B 1FPTH 3TIDA 3BEWB 2C3XA 2BDNL 4KTYA 1S7TB 2F8XC 2QHLA 2NNAA 4C83B 1INDL 1CG9B 3U82B 3VH8A 2YD4A 4HJGB 1A3LH 2JF1A 3QQ3B 1JTOA 3TA3D 3WUZA 2GJZB 4ZQKB 5DZLA 3VFRB 3I02A 4B5EA 1UWXH 4GW1A 1S9KC 1RJZB 3SBWC 4WWKC 1IT9H 1RU9L 2DAVA 3L3IA 4KH2A 4MNGE 4LSRL 2D03L 1HE7A 3B5TA 2O5YH 2WBWB 4WI7A 4Q6IC 4D9RE 3DX8A 4DN3H 4P49A 5GRZA 3VWJC 4OF6A 5HYSA 3VRLF 2CIKA 4NNPH 4WGVB 4NRXA 1JGVH 1Z3GH 5IEKA 2ZOLB 1DCLA 5HPMB 5DRZA 3VD3A 5IFHH 4NQSB 2E6QA 3ZKND 3MJ9L 3MLUL 2HJKA 5I18L 5C9JB 2J5LB 4BELD 4JAMA 1UH4A 4U6TA 5AYUL 3WFHB 1RUQL 2UYLA 3V0VA 2YA2A 3SDAD 1G7LB 2XWTA 4P46B 1T04A 4PG2A 4ACPA 3D87B 4Q9RL 3W5NA 2EKJA 3MRCB 3SE8L 3VFSA 3HB3C 3L3GA 4R4ND 3QH3B 4JZJB 4FXGA 2W0FB 1YYML 4NZDA 2HRPH 4OCRH 3DTXB 3LV3A 1S9XB 4LQFL 4WEBH 2VAJA 5FDWB 4Y2DC 3WNNA 1G7HA 5FYKD 4YHKL 3S88H 3NH7H 3WJLC 5E8DH 1SBSH 4JN2B 2NY5C 1HEZB 2DQCH 4WENB 3NFNB 5JIPA 3EOAA 3VXNA 4R8WH 5LAXB 3ZT6A 2WBJC 4YFEA 4GRLA 5HHXL 4ORZC 1RZ8A 3FZUD 4DFHA 1M1SA 3BXNA 3LQAL 4IMLA 4WDIA 3OKLA 2R0ZH 3PWVA 2NTFA 4MDJA 1UFUA 4PJEE 3NZHH 4E0RA 3MGTB 2HVKB 5DUMH 4YBLB 1QFOA 3GMPB 4EUPH 5CEXB 1K8IA 3W11D 5H35A