4PUBH

Crystal structure of fab dx-2930
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
212
Chain Sequence
b'VQLLESGGGLVQPGGSLRLSCAASGHYIMMWVRQAPGKGLEWVSGIYGGITVYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIRDEFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DX-2930 HEAVY CHAIN
publication title Inhibition of plasma kallikrein by a highly specific active site blocking antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pubH01
2DYPB 3PGFL 4ZYKB 1ZSDB 2DQTH 3CZFA 3CXDL 3TA3B 5F1OB 3B9KA 4ALAL 1XF1A 5FDWA 4HUXB 5EC1B 5EOCL 1UWGH 4UT6H 6CGTA 1G7IB 3H9SD 3VD5A 1UJ3C 2O26U 4HIHB 4N1HB 3SQBA 1LO5B 4CU7A 3U0PA 4L5FH 1CDHA 1OTUC 2VDRL 4U1NA 4AYFA 3DWTA 4WI4A 3MBXL 4ONGH 1QZ1A 3LV3A 4G8EA 1WT5A 2H2PD 4LRIA 3O2WL 1RURL 3HI5H 5IJKC 1ORQA 1HXMA 5D7KD 1RHFA 1UH3A 2OQJA 3CXHJ 3MQIA 5D7KE 4TSCL 3MRBB 4MA8L 1SVZA 1KLGA 3BHBA 3SE3A 5KTEL 4ODVL 4P57A 2FGWL 3S9DB 1EO7A 3UJTH 3VFWA 4Y5YA 1YJDH 5FV2A 1I9IL 3AVEA 2Z4QA 3V4UL 2H9GB 1WK0A 5ICYA 3SDCC 2O5ZH 3NFPA 2PO6C 4NNXB 1JPFA 1KPRA 3LEVH 1O7SA 1K4CA 3B43A 1QYGH 5I1HL 2NY7L 4HS3A 3ARDB 4U6XB 2DQEH 3KPSA 3U7YH 4OZFH 1NAMH 1QO3A 1X5GA 2G75A 2E7BA 3J8F7 3O45A 4LLQB 4NWTL 4L4TA 3BGFC 3QIBA 3RWGA 3IVKB 1W2KT 4YC2C 1HKLL 3L7FB 1OT2A 3ZKQD 1EFXD 4Y2OA 1YEDB 1B0RB 5AD0B 4PJ8B 4YLQT 4XP5H 1B2WL 5DT1L 5I66B 4I3SL 4N9GA 4P59L 3RWCA 8CGTA 4FHBD 2CIKB 1VESA 3CMOH 4V1DB 3QI9C 5KSAA 1B4JL 5GZNC 5TF1H 1YNLL 3EFFA 2YD7A 5DSCA 5FYLL 4HGWA 3IFPB 1EEZB 2Y5TA 2HJKB 2VLJA 3TBYB 3KPMA 2HKHH 4IOSD 4PB9H 4W70A 1I8KA 3WN5C 1JV5A 1IGYA 4XPHL 1NC4D 1INEL 1FJ1B 1DQJB 2C3VA 5EU7E 2Y6SC 3GGWB 4OCYL 1H3UA 3KYOB 1T20B 3ORJA 4ZPTA 4BZ1H 3RPKA 1DE4B 2QJDA 3SDAC 1CICA 3HC4L 1JPSH 3PWVB 4XVSL 3EFDH 2F8VA 3U0WL 1D9KB 3LN4A 4FRWA 1HDMA 1R3IL 4XBGA 4MS8D 5JXED 1JZ3A 4KROD 3B8YA 3DX7A 4Z7UF 4KUCF 4MSWA 1XAUA 4YR6B 3ZDZE 4QHMB 1VACB 2O5XL 2DS4A 1SJHA 1BZ7A 5SWZD 5JO5A 4KRPC 2XYCA 3HZVA 5D1QA 5F1IB 4JQIL 3PP4L 1BD2B 5EU4B 4BZYA 1WIOA 4KKAC 5CMAB 4PJBA 1QOKA 5J9PB 5EU3A 1RK0A 3SE4C 3QQNA 1MFDL 5DJAA 5HYSB 5IGXH 5ITBH 4IIQB 2YN3A 5ELIA 4NKDB 3NA4A 4U1GB 3MLXH 3MUGA 1YYLH 1W72L 3H2WA 1QQDB 2P24A 5D7LE 1N64L 2XQYG 4YIQA 5CIPH 2FSEB 5BVJA 5DVKA 1SYSA 4NCDA 1NMAH 1WTGT 1Z2KA 2BFVL 2CLVB 4JM2F 3LD8C 2UWEE 4GKZB 2QQNL 4N0RA 1AQDB 4IS6B 3ALPA 4OLEA 1Y6NR 5TE7L 1TJHL 1MFCH 3LQAH 1I85A 3B9KC 3T77A 1YNTA 2ZP0T 3ARBD 2AXFB 5FYJE 4GSDL 2E8YA 3JWOC 5T1DH 3OKOA 5F9AC 4U31A 4M1DL 4K23H 1ONQB 3OAZK 4KRLB 5LCVL 4O00A 2VQTA 4GS7B 4MCYA 1QSVA 3T08A 4PJDE 1DUZB 1X4ZA 3O9WD 4YDVB 1QSEB 4KTEL 2LV4A 3E6FB 3G04A 3RL2B 5IBUG 1WT5C 4LRIC 4CN6A 4F15C 3DV6A 3HE7D 5D7IE 2X44D 4Z7NE 1NANH 4CNIA 3F7VA 1KNOA 4NRYA 4HPOL 4WHCA 1YEJL 2DM3A 1FP5A 5EZLA 4GG6B 4XPFL 3SE3C 3QHZH 4HKJA 1MQKL 4NBYB 2FJGA 4BFIB 2J5LB 3MACH 4Y5YC 3Q1SL 5IMKA 3UTTE 5DJ2A 4KK5D 3G6JE 3C60A 1JNNL 4PLKD 4JN2B 4W68A 4JN1H 2OZ4A 2MTPA 1OPGL 1XGTA 4OFIA 5HDQH 3S36L 5L8JB 1CL7I 2RIKA 1GOGA 5JIKA 1HYRC 4WU5A 2NXZD 4JQXA 5DF0A 1S3KH 2KH2B 4YBLB 1FRGL 3KGRA 5ESQA 5KAQG 1FO0H 1J10A 2V7HB 3TIEA 3QIBC 2BNQD 1KCSH 1ACYH 4QRSB 2MHAB 2Z8RA 1P84K 3T3PF 1CTNA 2NR6D 4FXKA 4PJEF 2J8UB 2XACC 5JOFA 2F8OA 3D69A 3WS3B 4PJGF 3UBXB 2NPLX 3GMNB 3MLYL 2OK0L 1YYML 3GJEA 5KSAC 4O2FB 4EDWL 1DVFB 4JFQB 3ESVF 1MH5A 1QBBA 1KLFA 5ACMA 4EXKA 2LAAA 1BFSA 2V17L 5EPMB 1F90H 3QP3A 5EO1B 4HAFA 2W0FA 2SEBB 2LU7A 1OQOA 4LIQH 2R23A 1BFOA 1J0HA 3SGEI 2X4QA 1N5AB 4PP2A 2ARJA 3FHAA 1JI1A 1JWMA 4RFNC 3FN9A 4NRZA 5HGBA 1EHLL 2Z35A 3AS3A 4LLYA 2WMPA 3IDUA 3SPVB 2FECL 3BJ91 1YEEL 4ODTL 5J12C 5FUZH 4NQXB 4B0MM 4NUGH 3CH8A 4FZEH 1PX3A 5ACZB 3NH7H 3F65A 1FZJB 1X6NA 5KS9A 1OTSD 5JZ7C 4Q6IA 2R1XB 4XP9L 1DANU 3GK8H 3BH8B 1CFSB 5D1QC 4FABH 1U91B 1I7ZA 3SJVE 5D7JB 4ZAKA 2AAVA 4M8QA 2DIJA 5DFWH 2VC2H 4DGYH 4K94C 3V5DA 2C1OB 4Y2DA 5HHPA 4GRWE 4JFFB 5HHME 1CFNB 3U82B 5CEZD 5CEZE 3HR5B 2FH6A 4R97C 4X4YB 4L8CB 4BYHA 1SBBA 1CLCA 1EK3A 1EFQA 3RVVD 4MZ3A 2ICWI 4KKCD 5EU5B 3EO1A 3MBEA 3ARFD 3T4AB 5MENA 3WIHL 3EOBA 4BZ2L 4K55A 1QEWB 4YHZL 2ITCB 2VL5B 3DMMA 3OKKA 3PHOB 4ZQKB 4P4KD 1V7NH 4XXDA 2AS5M 4HH9A 1I85C 2D7PA 1JN6B 2X89D 1N4XL 3V52L 2F19L 4MAUH 1PSKL 2BVYA 4UIKL 3QQ4B 1EMTL 1NDGB 2GT9B 2X4SA 5EBLB 3T4YB 3MRHA 1U8JA 3KYKL 5SX4H 2VABA 1WBYA 2YC1A 2HTKD 2G2RA 5A2JH 5CD5D 3JWDH 5KAQF 1CE1H 3SDDB 3OF6A 2V2TA 1A7PL 2HLAA 1Q9WA 3D2UD 4JANA 2B1AL 3WO3B 4FG6C 5ANME 2IAMB 5E2UL 5L2KE 4TRPH 3QUXD 5L88L 1X7QA 3CFCH 4NO5B 1JGDB 1R3LB 3QEHB 1UKTA 2OZ4L 1HHHB 1OY3B 4NUJB 1U8QA 4GH7B 4DOHB 4EN3B 2Y25A 1RHHB 3GMOB 4H88H 2GTZA 5IW1A 1BFVL 2JLLA 3OKLA 5DMJB 5FKAB 1QFWL 2BJML 2WUBL 3C60C 1LEKB 5TH2A 4QY8B 1WWAX 5JQHC 1PKQB 5CEXA 1BAFL 1T21B 3BW9B 1F4XL 5A3ID 4DUVA 4F33A 5JDJA 5AZ2H 1U8PA 3KYNB 4OZFG 1KJ3L 5E70A 5FO8A 1LDPL 2F54D 4GRMA 2FEDC 3PL6D 2F54E 3TFKC 3V6FA 3VFSB 1LO2H 1UXWA 4HIEA 5E2WL 3IAGC 4MJIB 1NCBL 5FYKD 3UYPA 4X7TB 2WINA 1T0MA 1JWUB 3PABB 3MRMB 4YQXH 1KB5H 3ARQA 5C0RH 3L3GA 4LSTH 1IGMH 1DUYB 2DJUA 4DVBB 1OHQA 4Z0BL 4F8QA 1JF5A 3JXAA 5DLML 4HQQL 3UJJL 4PJ5E 4PRIB 3MRFA 4OTXL 4AEIL 4WEMB 1HQRB 3PIQB 1DLFL 3WCYA 1BECA 5C0JA 4M6OL 3NIFE 2DBJA 2YS4A 2XPGA 5HHVH 5DUML 1N7MH 2EE6A 2EXWC 2L4OA 1PVHA 1ZAGA 4P5TD 5GJTH 1WZMA 3SGDI 4XCYA 3DECA 4OZIF 4LSQH 4NKIL 4I0PD 1AQKL 4ORGA 4NYLB 1MWAB 1KYOJ 4B5EA 4YXKH 3M07A 3ZE2E 1E27B 3MV11 3A6CL 1F97A 4QF1B 5C6TH 3VG0H 3KDMA 5ISZB 2GCYB 4MJ5B 4X6CE 4J4PD 5GRVL 4WV1A 2P7TA 3QNZA 4GQPH 1TVDA 5HDBF 1IKFH 2NLJA 3MNWB 5JOPD 1A7NH 4Q6IC 2Y06L 4KJPD 4MJ6A 4WO4A 4DEPB 4ZUWA 3MZTA 4JPKH 3QWRA 3N85L 4ZAKC 3OSKA 2JCCB 2IMNA 1OLZA 5GGUA 5HVGB 2FO1A 1EGJA 2A6KA 3FT4A 4L8DB 3UJIL 1I1FB 4Y2DC 4X9HA 5IEKA 1CGSL 3V95A 2ZUTA 1FNSH 1F11B 2EDQA 4GAJL 1IAII 4X6DE 3JTTA 1U8MA 4CJ1A 5IVXB 1ZT7B 5JR1H 2C7UB 3MJ9A 2NNAA 4YHIB 4YXHL 1M6OB 1T03H 3ARUA 5EWIL 3QWQB 1S7VA 4EI5D 8FABA 1JE6A 4P5KB 2NY1C 3MBEC 4L3EB 4N0UE 3N9GL 2JJUA 1RJZB 3HNSH 5I1IL 3T0VA 1E6OL 1HN1A 4IRJD 3DMMC 1LE5B 5TGBB 1AHWB 1S9VB 4JR9H 5IBLC 2IPTH 3O6KL 4IJ3B 5E8PB 4YFLF 4M7LT 2EH8L 2R0WH 2VAAA 4LEXH 4KXZI 2AEPH 1GGIL 4H25A 1MRFL 3BPNB 3IFOA 5F44A 1GRWA 3HI6H 1UWEH 1FVEA 4RZCA 1LHZA 2ZOKB 5ADOL 3CLFH 4AG4L 1OD9A 3GB7A 1WC7B 4PYHA 2DWEA 1W0VB 2AQ1A 4NP4H 1I8IB 4OLUH 4NN6B 4TVSa 4ETYA 2ZPKL 1A7QL 4JDZB 1TZIB 3VXUA 5HHOB 1U2HA 3D3VD 5DRWA 1OWRM 3D3VE 2DD8L 1AR1D 2CLZA 4U05A 1IC5H 2GIYA 1K5NB 1RK1B 4D8PB 4AMKH 1PDKA 3WHXA 3P9WB 4YDJB 3MGTB 3HAEH 3KYMA 1OWWA 1U92B 2CXGA 2AJUH 3QUYA 2OR9L 2W9EL 1RIUH 3FO1A 1MF2H 2A77H 4Y4KB 4ZUTA 43C9B 3MGOA 3WFCH 1UWXH 5FGRA 1C08A 2EICA 5TQ2L 3QYCA 3T0DA 5I18L 4ZS7H 1A4JA 2NW3B 3MV9D 4CDGC 3MV9E 5EBGA 3MLWL 4JVPA 4RNRA 4HKBB 1AXSA 4AJ0A 4QWWC 5IVOA 4TULH 3O3AA 5TQ0L 4P46A 3RKPA 1BBDL 1RULL 3O2DA 1LEGB 2PNDA 5FYKH 4IDJH 1G7JB 4GW5A 5CJOH 5JHDD 2P5EB 2O61B 2CDGB 3DLQR 3GI9H 1N8ZB 1KFAH 5EDXA 3GSVB 3GO1L 5C8JB 4G5ZL 2ZUSA 1X5ZA 4Y4FD 5TDOA 3WFHA 3C5ZA 1QSZA 1WWBX 3HE6B 4GFTB 4ZSOB 3U30B 4F3FA 4Y5XB 5C7XH 2R2BA 1WBXA 3I6LD 3LH2L 3QQ9D 5FECB 2FBJH 2DRUA 2Z93B 3IJSA 4JRXB 3PWLA 1MFEL 1WISA 5GHWH 3VU2A 2MKLC 2VXTH 2G5BA 1OTTD 3RGVC 1A6WH 5L9DH 5DD3H 2AJZA 2R0LH 3N0PB 1OM3H 4QYOA 5HVFB 3K4DA 1EXUB 1HE7A 2CLRA 2XQYK 3B9AA 3BKYL 4RFEA 3TF7C 5KZCD 3RQ3A 1NCDL 5IEHB 3X14B 2FLRT 2WQ8A 2O5YL 1NDMA 3LPWA 3VFGL 1JMZA 3REVA 3QDMA 4NDMB 3VFNA 1WAAF 5T33L 2W65A 1A5FL 3ZTJH 3V5HB 1MI5D 5BRZE 4PGDB 1X5YA 1FG2B 1AFVL 4OJFL 5EA0H 1Z9SA 5E6IB 3EOYG 1N5YL 4I18A 2X4NB 1AI1L 2FD6L 4OIIL 5I76B 3GHBL 1F2QA 1HEZB 1F4HA 2QQKL 2UUDH 2WZPD 5I8OH 4OLZL 4LGSB 4N8VB 1AO7B 1NC2A 5D2NA 4K7FB 4WO4C 4NKOB 5SX5K 4Y19B 3FFCD 2H3NA 3FFCE 4QKXB 4C56D 4PGCB 1MY7A 4OD2A 2XWJB 5F96H 1V5JA 2RCSH 1NKRA 5H37G 4TPRL 3V0VA 5D2LF 3KPLA 3H6JA 1KN4H 1A47A 1GSMA 5DQDH 4OCSL 3RNKA 5KSBB 2R0ZL 3KPQB 3UYRH 4PJIA 3VE0A 4ZUVA 3QCVH 1KCVH 5F3BA 3V79C 3SOBL 2HVJB 4HMEA 1T04A 4HD9A 1MEXH 2A83B 2VQUA 5ALCH 4PV8B 4Z95H 3UTSA 1DSFH 1H3PH 5HYSG 3D0VA 4XPBL 5GGRA 3VDBA 1ZGLP 3FB5A 3CFKB 2VXVH 3BGAA 3QWOA 3ZSTA 5DMKA 4X7SL 2ZKHH 2VZVA 3ZT7A 2D0FA 5DVLA 2ICEB 2IFGA 3IDMA 2J8OA 3GEWB 1O5DT 3FFDB 1D5XB 5EZJA 4JFDD 1IQWH 4JFDE 3QUZA 3C08H 2HT4C 2EKSB 2AP2A 2YRLA 2OR8A 1XIWB 3FT3B 2AK1L 3MLSL 4BH8A 4BKLA 1UZ6F 5IP4A 1S5IL 1OGAB 1S7QA 4KPHL 4WDIA 4PRPA 3MRPB 4XXCA 5B8CB 3K2UL 3MO1A 1YNKL 3MRJA 4HUWB 5EO0A 2DMKA 1IFHH 1CGXA 4PTTB 3WFDL 2H32H 5CGYC 1IM3B 2D7TL 4MD5B 3KYAA 1UH2A 3FRUB 3FOLA 4U1KB 2A73A 1OAKH 4LHQB 4HT1L 5E4EB 4OGXH 1DEEA 1DL7H 3K81A 1J18A 2BVQA 2I9LB 1BIIB 2NY5L 1H8SA 4M6AA 3EO0A 1FFRA 4FTVA 1RZKH 3FO9B 1Q94A 1U8KA 4UAOC 1S7RB 3SY0B 4M6NL 1KTLB 1S9YA 1OAUL 1T6WA 2X7LB 1BWWA 1P4IL 2JJSA 2FIKA 4G42A 4P46C 3MNZB 4ODXA 2Q87A 1J12A 1JK8A 2C4FU 5KVDH 1IL1A 4LP4A 3VMNA 2DQHH 3CH1B 3OGOE 4QCIA 1P7QB 3GKWL 5FV1L 4OAWB 1RZGB 2W60A 1OF2B 1ZHBB 3PWPD 2BSTA 3PWPE 3JZ7A 4LNRA 5CP3A 3T0EB 3VXOB 4Z6AT 1WZ1L 2VXSL 4TNVF 3FB7B 5CLTA 2NTFA 1INQA 1F00I 1RIVL 5CILH 1OAXH 4MNHA 4BFBD 1KENL 4HBCH 5A16B 3SGDH 2G5RA 1OAQL 1O0VA 1UT9A 3TO4D 4RGND 4JFEE 3RAJH 1EZVX 4Z7WA 1UJ3B 1IC4L 1U95A 3ROLA 1NGZB 4NZDA 3MREA 5C0EB 3UCRA 4YDLC 5IB5B 5E8NA 4JG1L 1AGEA 3MXVH 4JJ5A 1DQQB 3MLZL 4PJ7F 1B90A 3MRGB 3MR9A 4WW1A 3HZKB 3BPLC 5IB2A 2GKIA 2YPLD 2YPLE 4K8RL 3LN9A 4KHTH 1NPUA 1HSAA 4JY4A 1VSCA 3FQNA 1BMGA 2X9XA 4S1SL 5C08B 2GK0B 3ABZA 4A2LA 2YK1L 1CU4L 3X12A 4NO0D 1NGYB 2BNRE 4DKAA 5IF0B 3O6ML 4I18C 1ADQH 1ETZB 4X8JB 1CXIA 2AJSL 3GJFH 3U2SB 4N68A 4PY8I 4XZUA 3TGXA 3CPLA 3TH3T 4OF3A 3W2DL 2LU3A 2ZSWB 3WS6A 2VIRA 3VDAA 5D2NC 1HILB 4JY6B 3HC0B 3T2QA 1YY8B 1JNHB 3SDCB 3WIIH 4PJAF 2PO6B 4ZOEA 2E27L 5FYJL 3UTPD 3ALWA 3HI1A 3RZCA 3OJDB 2ATKA 1I7UB 3BEWB 2CKBB 2HH0L 1D5IL 3L5XL 4JCMA 3K8KA 5M7QA 5FM5M 1EUUA 3CU7A 3P4NB 1SM3H 1S9XA 3JWNC 1IAIH 4LKXA 4N5ED 4QHKJ 4OZ4B 4OB5H 1FYTA 4RAVA 1U58B 2DLGA 1XF4A 3BGFB 3MSPA 1T7ZA 4YC2B 1JWSB 4HPYH 5DD1L 5HHXH 1G6VK 2HFGL 1P84J 4Q0XL 5C0IA 5KG9B 4XPGL 4NQVB 3RVUC 5I16B 3RWEA 2A38A 1JYNA 4R3SA 3ME0A 4G7YL 4ZOCA 4YWGH 1FVCB 1V7MH 3CFJA 3BN9D 4XVTH 3O0RL 5C86A 1E28A 2VLMD 4KXZH 4Z7VE 4CBPA 2X4RA 4NGHL 4QRRB 4M5YH 2GAZA 4K9EL 3OB0H 5CKGA 3CIQA 5C1MB 4EUPA 4JDVB 5C6WH 4OLWH 5E08L 3QJFB 2RFXA 3WN5B 3HMWH 1A1MA 4QTIH 4G6KL 4LLMA 5E8DL 2X1PA 5FF6A 1A9BB 3QUZC 1J0IA 4OLXL 4E41E 4F9PA 3SDAB 4HW6A 1EO5A 3GMLB 5FKPA 4XNYH 2HTLD 4X7EC 5HY9B 2Q76A 1MCSA 2R4SH 4XXCC 4KI1A 3MOAL 4PR5A 5T1KD 1RZ8A 1ZKAA 2YPKB 4LNVA 3TCXA 1IT9L 2WIIB 4Q9CA 4UB0L 1S9WB 1ZMYA 3MRKA 4FQ1H 1CK0L 4KJQD 1N59B 5BS0B 4WEBL 2A74A 3MOQA 5J11C 1SJEA 1EAPB 5ADPH 1R3KA 1RZFH 4KRPB 4NZTH 1V05A 3HPJA 2NX5D 4XP4H 2H6PA 4MB4A 3Q3GB 1VGKA 2VTFA 3R06B 3ARSA 5IESH 1FDLH 5DEGA 5JLZB 3VMOA 2JJSC 3SGJA 3B3IB 3NIDE 4RMQA 3QXUA 1S7WA 1WSST 5J6GA 2R9HD 1ZT1B 3WIFA 4UNUA 12E8H 5FM8A 5E5UB 4ZD3L 1AY1L 5TE6H 5D93C 1U93A 1FNHA 3DRTB 1NFKA 5E1AA 3GSNA 3CNKA 1MCPL 2Y36H 4JPIB 4IHOB 3CSYB 5I1LA 3VXMB 4GW4B 2MCPH 1T5WA 1RUQL 4WI3A 4YBQD 1IEBB 3LD8B 3LKOA 4R2GC 1QHOA 1W72B 4Z7UA 5EOQH 4NNPL 4PY7B 4KZDH 1YN6A 3CZFB 1P6AB 3GBML 3B9KB 2Q3AA 3QUMH 5EZOL 3SDYL 5FDWB 1T2XA 2WWMD 3ZKXC 1WAAE 1E4WL 3TJHD 4K3GA 5D8JL 4NQDA 2BDNH 1N2RB 1VGEH 3CSPA 4LLAA 3SCMD 1JFQH 3QEGL 3A6BH 3U0PB 5MEOA 4MQTB 1CG9A 4DTGL 5DZLA 5BO1L 5BVPH 4U1NB 3BDXA 3FQRA 3MA9L 2AKRB 3GBLA 2X5PA 4G8EB 3WD5L 3LZFL 4F15B 2UZYB 3U7WL 4JDTH 3QDJA 5SV3A 1ORQB 5JW3L 1HXMB 2B39A 1JNLL 2HKFL 2OQJB 3TYGL 4JO3H 3LB6D 3HB3C 1KPUA 1KLGB 3BHBB 4P57B 4JHAH 2JTDA 2YD2A 1QFOA 3TA3D 2EYSA 3VFWB 5I15H 1QR1A 4Y5YB 4DKEH 3GM0A 1FE8L 1BGXL 2OL3H 5GRUL 3WS6C 4MJ4A 3OB8A 5FHBH 5ICYB 4ZPVA 5DK2A 1P69B 3NFPB 4HC1H 1YEHL 3RZCC 1JPFB 1JTTA 1KPRB 4RMSA 4X4ZA 1K4CB 1LK2A 2Q20A 3KPOA 4HS3B 4MQSB 1VFOA 3NABH 1CFTA 3KPSB 5FUOL 2E7LA 1JTPA 2DQDL 3VXSD 4H8WL 1QO3B 2ZG3A 2G75B 5DD0H 3TO2A 3O45B 2D3VA 1C5BH 3WNOA 3VD7A 1LVEA 1A3RH 2YZ1A 1MFAH 3IFLH 4L4TB 3M8OH 3QIBB 3RWGB 5JIHA 5DO2C 4Y7MA 5IFAH 5HGGS 4O9HH 3H7BB 1N6VA 3PDOA 3MUJA 2X42A 4M00A 2VR5A 4N9GB 3WJLC 4YDIL 3RWCB 2DMBA 2DLFH 4ZXBD 3HNVL 5CZXC 4QOKB 1A7BA 1WITA 2VZUA 4P9MH 4QO1A 5KSAB 3EGSA 2I60H 3EFFB 3K0WA 4RRPG 5DSCB 4ONFH 4DKFH 1QBMH 2Y5TB 2VLJB 1TZGL 3A67L 5GS0L 1ZLUH 2VDOH 3TVMA 3KPMB 5IHBA 3FQXA 4P3CL 2BK8A 4HFUH 2Q7NA 2HAZA 1I8KB 1JV5B 1IGYB 3W0WA 2ZUWA 3RWHA 1QRND 2C3VB 4LBEA 3UTOA 1K6QL 3QHFL 1QRNE 2DJSA 2IGFH 4ZPTB 2DI9A 4RFNB 4GQ9L 4F9PC 4TUKL 5GS0C 5IT2L 5GRJL 1R6VA 1QBLH 4FQ2H 2A2QT 5TDNA 5J12B 2CO7B 5HYIA 5SWSA 2W9DH 4PJEA 3MJ7A 3LN4B 5DJXA 1CZ8L 3JSSA 1DN2A 1HDMB 4XCNA 3LDBC 2PTVA 2XZAL 3HZYA 5C07A 2ITDA 5KN5A 1RAMA 3OZ9H 4XBGB 3UXFA 1I9JL 1Y6KR 3DX7B 3RX5A 4MSWB 3MYJA 4PJ9D 1SJHB 1BZ7B 3HZVB 5D1QB 3RDTA 3O6LH 4OLVH 4PJBB 5L6YL 5EU3B 2I5YH 1VFBA 5DJAB 3SGJC 2R0KL 3KHOA 5EIQA 5FCSH 1BX2A 5DJDA 1MCEA 3LKQA 3QCTL 3MUGB 4MWFA 1RZJL 3CVHL 3L6FA 4P3DA 2V5SA 2P24B 4R97B 5DXWA 3ARZA 2X4OA 2CJUH 1D9KD 4YIQB 1CDCA 3U4BL 5BVJB 1JRHL 1YA5A 4HIIA 5LXGL 3KXFA 5FO7A 5HYFA 2W07A 4OCWH 4UT7H 3P9MA 4OLYH 1RZJC 3HG1D 4NWUH 2R29L 4U1IA 1MCDA 4GUPA 4OZHF 2W0PA 1X4YA 2Y07H 1BFTA 2OTUB 5JOEA 4Q74A 3T77B 1FFPA 1YNTB 1BD2E 2E9JA 2Y72A 4QRTA 4DZ8A 5E2TH 4M43L 4NT6A 3OKOB 4U0RC 1XR8A 2FLBT 3TZVD 3W5MA 3HS0A 1MJ7H 1CE6A 1PY9A 2EYRA 2VOTA 4MCYB 2BVEA 5E5MA 2CK0H 3VRLE 2P5WA 3UO1L 2R8SH 2XKNA 2Q3ZA 2DDQH 3DV6B 4QRPA 4G6MH 4PJFB 2H2SD 2FJFA 4JM2C 4CNIB 3WUWA 4HJJL 4HUVA 3F7VB 4D0DA 4BQ6A 1KNOB 3BE1L 3O4LB 2DQIH 4JHWH 4NRYB 4POYA 3DO7A 2EE9A 5EZLB 2GQHA 4DVRL 4F57L 4Q6YA 4HKJB 4JZNA 1PLGL 1L0QA 1NCAL 2FJGB 2YD3A 4YZFE 2E9WA 1T3FA 4IRSA 4B7LA 5DJ2B 1ZANL 3NACH 3C60B 3RWFB 2J6EL 5IVXF 1B3JA 1LO0H 1KIRA 5GS3A 1UM6L 5LVEA 1M7IB 1XGTB 4LSSL 3UTZA 1FSKC 4U6HA 4HX1B 2E7LC 3V6OE 2G9HA 4Z18A 3NFSH 2QSQA 2EDJA 4WI8A 3BGMA 4O5LL 1NUDA 1BF2A 1C16B 4MLSA 5ESQB 3AM8A 1QSED 1F58H 3VWKD 4ELKA 1QSEE 5E9DA 2NZ9C 1HHKA 1XZ0A 2V9TA 1XT5A 3T09A 3TIEB 1JHLH 5F8RC 2DAVA 3TNMB 1X4XA 4N8VG 1M4KA 2DOCA 3MJ8A 1UM5H 4GOSA 4PJHF 4FXKB 4HBQA 1A6VH 5JOFB 4GG6E 3D69B 3ZDXF 4LPYA 3DX9A 3GJEB 2FDBP 4WWKC 2VLLA 2Q8BH 4LLVA 5CINL 4M48L 3PGDA 4MQ7B 1EBPA 5GJSL 4HK3J 5EU6A 2COQA 1MH5B 5E99L 3V7MA 4J3SA 2W0FB 5J1TC 1RUAL 1TJIL 3TVMC 2R23B 4Y88A 1BFOB 2QSCL 1Q9KA 3MLTA 1KCUL 4ISVA 2VERN 2X4QB 1J1XL 3X13A 3ZO0A 2FZ3A 1QKZH 2ARJB 4A6YA 4YHNA 1FN4A 4ZFGL 4KMTH 5LG1A 4NRZB 5HGBB 1RUKH 2Z35B 2E5EA 3GIZH 4OGYH 4LLYB 4UI2A 4NN5C 4YEFA 3BP5A 2ADFH 5ITFA 1HCVA 3AY4A 3WFBL 4WI5A 2EDHA 2A1WH 2J8UE 4M62H 3LMJL 5KVEH 2ORBL 3BXNA 3O8XA 4FFWD 2K7PA 5KS9B 2VDNH 1J05A 4Q6IB 2PXYA 2R56L 2AJYH 5MP6H 3VA2C 1NLBH 1BBJA 4F7MA 4QNPF 1DVFD 3UTQA 5I1EH 5GRWA 1MCFA 4CUCA 4LPTA 3RDTC 3I50L 4OZIA 5KW9H 1I7ZB 1Z0MA 2CGRL 4X4ME 5D96C 2M1KA 4ZAKB 4M8QB 4K2UH 4LCIL 5C3LD 4D9RE 2X70B 2AJXH 1G1CA 2E7MA 4KK6C 3V5DB 4X5XB 4Y2DB 4ZO6A 1Q1JH 4F37K 5HHPB 1UEYA 4C55A 4UBDC 4MD0A 2A0LD 2A9NL 3HKFA 1HINL 1KJ2L 2HA1A 3EHBD 4EEEA 3C87A 2NY1B 3EO1B 3MBEB 5MENB 2NY3C 3TJEL 3BKCL 4APQD 2OBGA 3EOBB 1C1EL 4NZRL 1CT8A 1IAOA 2ERJB 3DMMB 3OKKB 2EYTA 4M6ML 4XXDB 1CXHA 4LU5H 4HH9B 2NYYD 5I19L 1JBJA 2D31B 1DFBH 5LWYH 5D7JD 5CJQL 2X4SB 4D0CA 3MRHB 1U8JB 4QEGA 1J8KA 2NCMA 3GDBA 3SKJH 2VABB 5E0QA 1WBYB 3ARYA 2YA2A 3CDYA 2HLFC 2YC1B 1ZA3A 2G2RB 3FONA 2H1PL 4JFFD 4JFFE 4KKBC 2V2TB 2HLAB 2P42B 3G6DH 5C0GA 4LHUA 4Z7QF 1Q9WB 4JANB 2F53A 3DBXA 4H20H 4K3EL 3AREA 2B4CL 1X7QB 3P0VL 2FIRT 3T1FA 2VAJA 3LOWA 1ZWIA 3V4VL 3M1BA 5K9JL 1U8QB 1QLEH 4XP1L 3MV7A 2GTZB 4RQQA 3GMQB 4ACPA 5IW1B 3OKLB 4HWZA 1MHPH 2E6PA 3F5WA 5FGBA 5TH2B 1NAMA 3OHXA 3MLRH 5ILTH 3BYYA 5CEXB 2DICA 3VD3A 4F33B 1U8PB 5DR5H 5FO8B 3EYSL 4GRMB 3MV01 3V6FB 4HS8L 5IBTL 2BXZA 3MV8D 4HIEB 1P6FA 3CVIL 2DTSA 3MV8E 3QEUA 4LPCA 3SDDD 5AEAA 1WGOA 5D71H 4QHNA 3HMXL 4TSBH 4U1LA 3AM8C 1OCWH 1T0MB 2WINB 3X11B 4B50A 3L5HA 5J6HA 2IAMD 4IDLA 3OJVC 3UPRB 3L3GB 4LL9A 1Y0LA 3THMH 4YHLH 1X5XA 1U6AH 3QIUD 3H9YA 3S6CA 4NCC1 1VADA 1YMMD 3VCLA 3ELAT 4JVWA 3MRFB 3STZA 4DOHE 1GIGH 1G84A 2HT3C 3T2NH 3VGEA 5C0AD 4JAMA 4GKOA 4RBPH 1PKOA 1IGFH 3EYQC 3LQZB 4G7VL 3HN3A 1T7VA 2F58L 3I2CL 4ORGB 5CCKL 3KPRA 5CWSA 4MJIE 2DMCA 3VD4A 5KVFL 3GRWH 5D70L 5A2LH 3RA7H 3KDMB 3WXWL 2UVEA 3AY4C 2OXGA 3RX8A 1CR9H 2P7TB 3QNZB 5IFHH 4S1DD 4M7LH 2BHUA 4PRID 1GL4B 4ONHA 2NLJB 3O8XC 5DVNA 4PRIE 5EC2A 4XI5C 3N1MC 3VGDA 3O2VH 3GBNH 4O2CA 2PXYC 4HXAL 3F58L 3C5JA 4MJ6B 4K71C 1I3GH 3C9NA 4WO4B 5F7KC 3TBVA 1MCHA 3K4AA 1J11A 4ZUWB 4HK0A 1UEMA 3EO9H 1ZHNA 4ERSL 4P5MB 1UH4A 2ED8A 5CIPA 3RHWF 1A0QH 5IEKB 1ITCA 2VLRD 1CDYA 1UWGL 1VKXA 4X8XA 1CBVH 3JTTB 4WVRA 2NNAB 3P4LA 5ISZE 1A6AA 1FQ9C 5ABDE 3MJ6A 5DD6A 3HR6A 2VQ1A 3K8LA 3NCCB 5DK0A 4TVPD 5LGKA 3H9SA 5A2FA 1EIBA 1R5VA 1HZHH 3O3BA 4JRYA 1NCWH 3VRJA 3WLBA 4H25B 3RZWA 2ZJSH 3IFOB 3T3MF 4GKNB 4D94A 2JCCE 4EDXA 1FVEB 3V7AE 4RZCB 2DKSA 5D2LA 3OWEA 1MSPA 3GB7B 1AKJD 2DWEB 1G9ML 1B4RA 3VXUB 1NMBH 5DRWB 1F4WH 4XCCH 5IVXE 4XBEL 2WBJD 3LEVL 3TH2T 1BJMA 1CDGA 1QYGL 2ICCA 4HCRL 3CD4A 3WHXB 4O58H 2DQEL 1YJDC 3KYMB 4L3EE 3FO1B 2XG5A 4ZUTB 2DWDA 5HGAA 1OB1B 3QXWA 3MGOB 3NGBC 3LRHA 1C08B 1IEAA 1A4JB 2QKIA 4P2OA 3VFUA 3V6BR 3ULVC 4RNRB 4UAOB 4XP5L 1Z3GH 1HYSC 4G3YL 1AXSB 4ZOBA 1P7KA 3BSZL 2JB5H 5CSZA 4U6TA 1FO0A 4P46B 2E7HA 1EFXA 5DHYB 5F7NC 1AP2A 5TF1L 5I71C 4Q97A 5HHOE 4GW5B 3KPPA 3PP3H 5K9OA 3MUHL 1AD9A 1JGLH 5FYKU 2HKHL 2GJZA 1Z6JT 3OV6A 1SEQL 4PB9L 1TXKA 1WQVT 1U3JA 5TDOB 3MUY1 3WFHB 2XI9A 1G0YR 4FNLL 3BAEL 2ZSVA 4F3FB 2R2BB 4J3OC 3MRIA 3I84A 1NC4A 5ICZA 3SKNA 3IJSB 2MQ3A 3QXDA 3PWLB 2IFFL 3MLVH 3DV4A 1CGWA 2MJWA 5IV2B 2G5BB 4M8VA 4MXQC 3VH8G 2AJ3A 6FABH 3B5HA 3DVIA 2AJZB 5DC0A 3CSBA 1RMFL 3U36A 1X5JA 4QYOB 4FQQB 2W0KA 4YDLB 2CLRB 1FORL 1HIMH 4U1MA 3RU8H 1FNLA 3BPLB 3X3FL 5JXEA 2P5ED 1NDMB 5I1KL 2P5EE 3REVB 3ZKNC 3QDMB 3VFNB 2W65B 1G9EA 1X5KA 4Y5VA 3OJ2C 1PY4A 4J6RL 5SWZA 5T3XD 5IGXL 5ITBL 1MREH 3HE6D 5T3XE 2HRLA 2YUXA 4NPYA 4ZSOE 3GUTA 2ZCLH 4I18B 4JFYA 3JV4B 4Y1AB 2B7DT 5K9QG 5IW6A 5IVZB 2QSTA 5JPNA 1KN2L 4JRXD 5DFTA 4WY7H 4JRXE 1NC2B 5D2NB 1G9NH 2WP3T 3RL1A 5CBAA 2H3NB 3FN0H 3EAKA 3QNYB 5KVGH 2XTJC 1F4YL 1F4AA 3V0VB 4FFVC 4PJ7A 3KPLB 3FQWB 3QFJD 5DUBB 1OP3H 2UWEA 1L9NA 2JB6A 3RNKB 2PYED 3NA9H 4YO0A 2PYEE 4PJIB 4AEHH 4F9LA 3VE0B 3GSRA 4ZUVB 5T1DL 2Q86A 5F3BB 1KOAA 4KDWA 4TVPH 1T04B 2FO4A 3LQAC 4PRHB 1PJ9A 4OUUA 5E6ID 4ETQB 2VXQL 2R15A 3UTSB 1HHIA 3NPSC 5IUSA 2P8PA 5TFSH 4MYWB 3IRPX 5DMGD 1TNNA 4JFZL 3D0VB 1FVDA 1EGJH 4XPAH 5GGRB 3FB5B 4PJAA 1F3DJ 4CW1A 3QWOB 5FB8A 1GHFH 1C7SA 4JKWA 4LAQL 3VRIA 3WLWD 1A2YA 4Y19E 4LSPH 1MLBA 3U83A 2VLKD 3O9WA 3LS5H 4KC3B 1ZLVH 5DMKB 1XGYH 1G6RH 5F89A 3IDMB 4IRZL 2NZIA 1NBYB 5D7IA 3HE7A 1FLRH 3MJ9H 2YD6A 4UNTA 2HVKA 1VENA 3MACL 5BMFH 5ACLA 4YAQA 3QUZB 3WO4C 1RZIA 5HI5D 5KSBE 1ZE3C 4BH8B 4BKLB 4NFDA 4ZS6D 5DFVD 4JN1L 1S7QB 4WDIB 2RR3A 5HDQL 2F15A 1N0XH 3MO1B 3H9ZA 3MRJB 4OQ1A 1F8TH 5EO0B 2OP4L 2ZUXA 5F1SA 3DI2B 3BWUC 3WKMH 2IH1A 1S3KL 1BEYL 3FOLB 2A73B 2ADJA 2OJZH 3S5LA 4IOIA 3N1FC 2P43B 1OQXA 4NFCA 5J11B 4P2QD 1KCSL 2BVQB 5IROA 2JJWA 3DXAD 3NTCL 3FZUD 3EO0B 4P2OC 4FTVB 1HSBA 3L3IA 1Q94B 1U8KB 5HYJD 1S9YB 2BNQA 5H2BA 3T04D 4BQBA 4HLZH 2NTSP 4G42B 2FIKB 4MDJA 2EDDA 3NIGE 1IL1B 1EO8H 1KB5A 3L1OH 4HS6B 4YHKH 1UB5A 4ZUSA 4QCIB 3SE9L 1S8DB 2V7NB 3W5NA 1GOFA 1WCQA 5GGVH 5D93B 1F90L 2XZQL 1OGAE 2W60B 2IQ9H 4LIQL 4NKQB 3DX8A 3MX0A 2BSTB 4D0BA 1JGEA 2UZIH 4LNRB 4C4KT 5EIIA 2WNGA 3VDCA 5C0ND 2F8XC 4NC1C 4YFDB 4R2GB 2LVCA 3H42H 5LAXA 1UG9A 2NTFB 1INQB 4KAQH 1QLRA 2OMBA 1TTGA 4MNHB 5KANI 2X2YA 4UIMA 5JNYA 4R26H 3ZKXB 3D9AH 1MCOH 3LKSB 5IJVA 1JIBA 3DVNA 4Z7WB 4FZEL 5GGRY 3R0NA 5HI4D 4S0SD 1XH3A 3NH7L 3ROLB 2QADC 2VISA 3MREB 1J9CT 4GJTB 4Q9QH 4R9HA 1AGEB 4WIQA 4JJ5B 5F1NA 1MCRA 4WW1B 1DBBH 4MS8C 4RMTA 4FABL 5IB2B 5JXEC 4KROC 5H35A 4UTAH 1KEGH 4LLDB 1HSAB 4JY4B 3FQNB 4Y5VC 4PJBF 3T0ED 2VC2L 3T0EE 1YEGL 3X12B 5GZOC 4URTB 1ZTXH 5DMIH 4GMSL 4W81A 1KTDA 1B6UA 1MAJA 3JTSA 3MRNB 4CJ0A 1KBGH 4JFPA 5EOTA 1MIML 1MPAH 1YQVH 1MRCL 4AQOA 3IJHA 2V6HA 3CPLB 4XZUB 4EBQH 4F7EB 2CPCA 4WNQA 1LE9A 2VIRB 1KTRL 3RZCB 3HI1B 2ATKB 3PDDA 3KJ6H 1ND0B 1I8LA 2ZG2A 1OTUD 1S9XB 3ARFA 3CX5K 3MFFA 2R69H 4I48A 5E94A 4LKXB 1FYTB 4RAVB 1WWCA 5GGTH 2VR9A 3BIKA 3G08A 2F74B 4P4KA 1UQSA 5AYQA 3LPGA 5C0IB 1NBVH 2MPAL 1AGCB 1NJ9A 4KDVA 4TOYH 1ZHKA 4YDKL 3RWEB 2X89A 4X9GA 3JWDL 1CE1L 1LO3H 1AJ7H 4R3SB 3QDAA 1PG7H 3PJSA 3ETBF 2YR3A 4POZC 4DJMA 2KKQA 3CFJB 4UDUA 2XZCH 4DGIL 1E28B 5HD8D 5FHAL 3VFVA 2X4RB 3BZ4A 2VN4A 2APBA 3CFCL 4M7KH 3SDCD 4C54A 4JPVH 2PO6D 2C26A 2BVUA 2GAZB 3D2UA 4EUPB 4H0IA 1MELA 4P9HC 2RFXB 3SKUD 1CFVL 3QUXA 4MQXD 1TIUA 3HE7C 3K1KC 4GXVH 1A1MB 1C5CH 4LLMB 5FF6B 25C8H 3CMGA 3SKOB 3HAEA 3T2OA 5EBMA 4U6VH 3KPNA 4HMCA 4RWYH 5FKPB 1X5HA 2Q76B 1GGCH 1XR9A 4PR5B 5I8EA 1IGIH 2LTQC 1A8JH 1RZ8B 3PXHA 4OD3L 3NVQA 3LDBB 4PPTA 3IDGA 3J7HA 3L3HA 3MRKB 4HIXH 3O41A 2C9AA 3Q5TA 3QI9D 5L2JA 4MX7A 2A74B 1SJEB 1NCUA 1R3KB 5IROC 4OIAA 3Q48A 3B6SA 1Q0XL 4QRRE 4LSTL 1IGML 1UXSA 1CD0A 3HPJB 2OXHA 3NOIA 2ZUVA 3VGAC 4H26A 3CXHK 2H6PB 4KZEH 1EEUA 1VGKB 2VDMH 3FOMA 4P0DA 2BY1A 5DEGB 3QA3A 2I9TA 3QPXH 5FYLD 1X5IA 1S7WB 3VI3F 3I85A 2NR6C 1S7TA 2XXCB 3WIFB 4HWEH 5HHVL 3UC0H 3SDAD 4HWUA 5IHUH 5CHNA 4WFHD 4WFHE 1U93B 2IAND 5E1AB 3GSNB 2K7QA 4UINH 2IF7A 4PIRF 5I1LB 3HC3H 5ID1A 2WLZA 1K8DA 3W9EA 2ED7A 4NHCH 1T5WB 4P5TA 3WE6A 5CBEB 1HQ4A 2A9MH 1L6ZA 2FECI 1FV1A 4JFHE 4Z7UB 1MUJB 4I0PA 1YN6B 3ARTA 5BS0E 3GNMH 1K8IA 2Z8SA 3LSOA 4KRPD 5C6TL 5F1KC 4NSKA 1IEHA 4KKAD 2MCG1 4NQDB 4U0RB 1J0ZA 2VWEC 3C6LD 1IKFL 4J4PA 4JLRB 4WW2A 3G6AA 5MEOB 5KS9F 1CG9B 3FQRB 1MFNA 4BA8A 1EUTA 2RJMA 4OF6A 5DVOA 1OTSC 3JV6A 1MY5A 3VXME 4JM2B 43CAA 1D5MA 4ZO9A 4XNZC 2LAGB 5BZDA 2OI9C 1KPUB 1T7YA 1FNSL 2NQCA 4N1EA 2EYSB 2IG2H 1QR1B 3VD9A 1Q0YL 4I77L 5JR1L 2WWKO 1GZPA 3P4MA 1T03L 4ZPVB 5DK2B 1Z5LA 4TQEL 2AXGA 3UZQA 4Z78A 3W81A 3H0TA 1SY6L 4X80H 1LK2B 3P9LA 1FSKB 3KPOB 4OCXL 3HNSL 1T66D 3RVVC 5EOCH 1CFTB 1I8LC 2ICWA 1U8NA 1TQBC 4K3DL 3OAUL 3CSGA 2QQLH 1DBJH 3GSXA 4EI5A 3ARFC 3D39D 1T89A 3TO2B 5HPMA 3JBG7 4ELMF 4LEXL 2AEPL 3DVGA 1B6DA 1DDHA 4PLJD 4IRJA 3RIAF 5HPOA 1MVUA 4P4KC 2FX8H 3PDOB 2IBZY 3MBXH 5E2JA 5DYOA 4JHZA 4OLUL 4NP4L 1I8MB 4XGZA 3O2WH 3F7YA 5KVMC 5HYEA 2CUHA 3O3DA 2YD4A 4WWKB 2QSVA 1IC5L 3EGSB 5CD5C 5KTEH 4ODVH 2FGWH 5DC4B 3TVMB 5FFLA 2AJUL 1SQ2N 3MPCA 1FCCA 3FQXB 1RIUL 3W11D 1I9IH 3KPSD 2Z31A 3CFDA 3AMLA 3KPSE 3W0WB 1E4XL 1QFWI 4LBEB 3IRZA 3GI8H 3ZDYE 2YSSA 3HRPA 4ZS7L 5INDA 4DN3H 2DKMA 2H32A 5I1JH 2NY7H 4L4TE 4NN5B 1RFDL 4JQVA 5D1XD 3KWWA 5E03A 4TULL 5TDNB 2CK2A 4XNQA 4HF5L 5SWSB 4PJEB 3MJ7B 3MV9A 3RKDC 5DJXB 4PJGB 4XCNB 3HZYB 5I1CL 5C07B 2ITDB 4ZNCD 1HKLH 3ZHKA 4LP5A 3RIFF 3ZLQC 2AK4A 4QOKD 4FQHA 4QOKE 1CQYA 4W6YB 2X41A 1B2WH 3GI9L 1KFAL 3DIFA 4OFVA 1CGYA 3C6SA 1OAYH 2BY0A 5MI0C 2VLJE 3RDTB 3C2AH 5D96B 1TCMA 5JHDA 4RMVA 1B4JH 5FYLH 1VFBB 5F3HA 2BOCB 2PCPA 4Y4FA 4S2SB 1BX2B 5DJDB 3V5KA 1TITA 4MWFB 5GHWL 3L6FB 4P3DB 1INEH 1A6WL 1OSPL 2X4OB 4OCYH 3WFEH 5L9DL 5DD3L 2R0LL 1OM3L 3BESR 4LMQI 4HIIB 3KXFB 5FO7B 3ULUH 4E0RA 1WEJH 2NY3B 4P5TC 5K9KA 3P9MB 2GHWB 4U1IB 4GUPB 1R0AH 2ARJQ 1EX0A 5J89A 4JKPL 1SYVA 4I0PC 2GEEA 5K59F 3T0WA 4KK8D 3WL9B 5D1QD 1FFPB 1R3IH 2DI7A 3DUHA 1TTFA 4QRTB 4DZ8B 4PJBE 4NT6B 4PJXF 5C9KA 1JZ2A 4PG2A 4PFEA 2EYRB 1MI5A 3PP4H 4J4PC 3OKMA 3ZZ1A 1UFUA 4KVCH 4WW2C 4AEEA 2ILLA 5E2VH 2R1WB 3BO8A 1MWAL 2P5WB 3K46A 2CIIA 2J1KA 1UVQA 5AWNL 1EJ6A 4MNQD 2XKNB 1ADQA 2KDGA 3PV6A 1H0DA 4QRPB 3HFMH 5F96L 3VXTA 2RCSL 4J12A 2FJFB 3GJFA 3WUWB 4HUVB 2J2ZA 1CQKA 4D0DB 3QEQD 1N64H 3DO7B 4Z7OF 3VFMA 4KV5F 4C56A 3UROR 3NN8A 32C2B 5DQDL 3AB0C 3WDHA 1UB6A 4HLJA 5F7LB 2BFVH 3RUGA 4P4RA 1T3FB 4MA3A 1KCVL 3TN0D 1TENA 4W6XB 1MOEA 1HNFA 2YWYA 1KIRB 5JIIA 1BPVA 1GYAA 1MEXL 1TJHH 2CXKA 3UTZB 4U6HB 5GSRA 4GSDH 2X40A 4EI5C 4IBLT 2EDLA 3BGMB 1T89C 2MMXA 4X7FC 1H15A 2VXVL 4ELKB 3BT2L 4M1DH 3OPZH 3B5GA 4FG6D 5E9DB 1HHKB 1RUPL 3KHQA 2B5IC 5BZWA 4IRJC 3UX9B 4Q9RL 1F13A 2HFEA 4PJFE 4TN9A 2YN5A 5D1ZA 3MJ8B 3O4LD 3O81A 3O4LE 4LLWA 3V2AR 1ACZA 1IQWL 1RJYA 1T1ZA 2KPNA 3DX9B 1VEMA 5HXMA 4XX1E 1KGCD 4LLVB 3PGDB 1YEJH 1X9QA 5DRZA 3I3DA 2WBWB 4DQOH 4HK3N 1R3JA 1AGBB 4Y8AA 4XNXH 4G6JH 4X7DC 3SE8L 1Q9KB 1OAKL 4WCYL 3MLTB 2BSSB 4G9FD 4ISVB 4ODHH 1JNNH 4OGXL 2FEDD 3X13B 2Z31C 2DQGL 3TFKD 2FZ3B 4L4VA 1FIEA 1V8HA 3B4NA 4A6YB 4YHNB 1FN4B 5FXCH 1AH1A 2EIBA 2CRIA 1OPGH 1G7LB 4FS0A 5GRXG 5IKCA 1RZKL 3TEUA 2FWOA 1J5OL 3BP5B 4JQVC 1FZKA 1UC6A 2OS7A 4MMZC 4HV8A 1UACL 1FRGH 4OT1L 5AAMA 1JI2A 2CRMA 4E5XA 5KVDL 1KV3A 2DQHL 3HTLX 5ENWA 1CGTA 3BP4B 1T0NA 3BXNB 3O8XB 3MYZA 1RZKC 1J05B 2XA3A 2PXYB 3SDXE 3VJ6B 1BBJB 4F7MB 1D6VH 3UTQB 2EXWD 4I4WA 5IMMA 4K71B 4GBXC 1DLHA 3MLYH 1QUNA 2X1QA 5DHVH 2OK0H 4OZIB 5DI8A 2X05A 2EDFA 5HDLA 1FBIL 3RI5F 5ALBL 1IKNA 2EDEA 2V17H 4HHAA 4Y4FC 2WLYA 4JEGB 1J0YA 4HBCL 2KZWA 4MD0B 1NFDF 1A1OA 4C83A 1PD6A 1XGRA 3RAJL 4IM8A 4WGWB 5T3ZH 1SJVA 3FRPA 2VSCA 4H1LA 5ETUA 3QUMA 4LFHD 3TO4A 4JGMA 4HAGA 4QHLA 5E5RB 1OTTC 4ODTH 4O51A 1CT8B 5T5NG 5KS9E 1IAOB 2ZUUA 1S7SA 1IVLA 1YQ2A 1W8OA 2EYTB 4OGAD 4Z76A 4KHTL 3AC0A 3EYUH 4MD4B 4PBXA 5BOZG 1J1PH 1IC7H 1FC1A 3OKYA 2XXMB 1UZ8A 4G43A 2YPLA 4ZAKD 4D0CB 4XP9H 1I3VA 3LHPH 1M05A 2VB5A 4X99A 1FG9C 2P1YA 4PG2C 1B9ZA 4ZFFA 5TE4L 1PZUB 1ZA3B 5CGMA 5J1SC 2OR7A 15C8H 1X5FA 2IPUG 5C0GB 4LHUB 2CR6A 3M17A 4YGVA 5DWUL 2F53B 3DBXB 3O11A 4HEPG 2AERT 1EPFA 1RUML 3T1FB 4O4YL 1JF1B 4YE4L 2NY1D 3MBED 5MENE 1ZWIB 1U42A 1SM3L 3M1BB 4JY5H 5JHLH 3EYFA 1GC1L 1KYOK 3IDJA 3NGBB 2AV1A 3MV7B 4RQQB 2FH8A 3LKPA 4HPYL 3WIHH 4PJIF 4BZ2H 1QP1A 4HWZB 4OZFB 1A6PA 2J4WH 1NAMB 1Y6MR 3LIZH 2ENYA 3OHXB 4YHZH 5C0CD 2XZZA 5F7EH 2XICA 2Z9TA 3V52H 4YWGL 2F19H 3VXQA 1XEDA 4XVTL 1EMTH 4EOWL 1J8HB 3QEUB 5I71B 4RX4A 1JZ8A 4QHNB 3KYKH 1U3HD 3WMSA 4U1LB 4NRXA 4M5YL 3T0XA 4YJZL 4FOMA 5J6HB 2BXYA 4ZTPH 4OM0H 5GGSY 4OLWL 4AT6A 1KCLA 2IWGA 4X5WB 5D1ZC 4XCFH 1Y0LB 4QTIL 2FBOJ 5E2UH 1VADB 5TDPA 2M2DA 1JVKA 5L88H 5L8LB 3VCLB 2YOCA 4UTBH 3OR7A 1NCTA 1QSFD 4G6FB 4TYUA 4XRCA 2R4SL 2Y7QA 4JAMB 5ID0A 3TV3L 1RJCA 4O02H 5DUPH 2WUCL 4LCWD 2YXMA 4AY0A 2RGSA 4LVOC 4XVUD 1QFWH 1IQDA 2BJMH 4FQ1L 5T1KA 3SGKA 3KPRB 5ADPL 5CWSB 1F4XH 1RZFL 3CFIC 3QRGL 5J56B 2W92A 4XP4L 1LDPH 4NOBA 3DRQA 3GMPA 5E2WH 1EEQA 1N0LA 3A0OA 4X83A 1V3LA 3LS4L 1NCBH 3RIFK 4LSUL 2NX5A 5T5NF 1T1WA 4FZ8H 4EUPG 1KT2A 1OD7A 3NAAH 4ONHB 1DEDA 5EC2B 4MNGA 1XGPA 4O2CB 4XHJD 4KHXL 4Z0BH 4KQ3H 1KSRA 3C5JB 4MDIA 2Y36L 2X4TA 3QXTA 5I0ZA 3C9NB 3TBVB 2DN7A 2Z0BA 2MCPL 3RGVD 2NY6C 2HG5B 3ILPA 2UYLB 4LLUA 1DLFH 4HK0B 4M6OH 2P8MA 4M1CD 5DUMH 3BYTA 2XTJB 5EOQL 1ZHNB 1BIHA 4NC2B 2W9LA 4KZDL 1IKNC 2XOTA 5E00A 3NCYS 5CIPB 2ESVB 3VXRA 3CX5J 1F42A 2HJFB 4P2RD 4Q58C 5K59E 4PGEA 1VKXB 4KY1H 3IXAA 1GVIA 2GY5A 5C2UB 5LGJA 1K4DA 4ZODA 1A4KA 1VGEL 2I26N 4G9DB 4RDQG 4RWHA 1A6AB 5B21A 2NXYD 4K3JH 4TUJA 3A6BL 3ZKMC 5DD6B 2VQ1B 5DK0B 3TO4C 3IXTA 4RGNC 3Q6FB 5BVPL 3NPSB 3H9SB 4FQCL 4S1RH 1R5VB 3DO3A 3SCMA 4JRYB 4JDTL 3VRJB 2V2XA 4PRNA 1OP5H 5KSUA 3WLBB 5F9OH 2Y06H 4JO3L 4EDXB 3VXNA 4WHYG 5D2LB 1CD8A 4Z7OE 4DKEL 3OX8A 3N85H 2OL3L 2R2EA 4PD4K 3NFNA 4TNWF 4U1SA 3WO4B 3MXWL 1FL6A 5FHBL 1UGNA 4HC1L 4ZYKA 5I8CB 3TA3A 1MVFA 3OKEA 3UP1A 5DGQA 1CGSH 1TFHA 4MHHG 4LQFL 1RJLA 1G7IA 5DD0L 2DWDB 5HGAB 3EJJX 1C5BL 4RIRA 2QQQA 1A3RL 2MFNA 5EWIH 4G8IA 5I17A 3M8OL 3G9VA 4BUHA 1IZJA 3VXSA 1IEAB 1Z0NA 5IFAL 2QKIB 4O9HL 4KJWC 4P2OB 4LASH 4J3XA 5C71A 5SWQA 1AGFA 4C59B 1P7KB 4PS4H 3QIWA 1FO0B 3VWJD 5TJWK 1G7HA 1EFXB 2CKBL 1CF8H 4UU9A 1GGIH 1AP2B 1MRFH 1QR4A 3VXUD 4ONFL 3VXUE 4J2XA 4QHKI 3KPPB 1QBML 3NZHL 3QB7C 4DKFL 2PW2A 5K9OB 4M7JL 2VXUL 4AG4H 1AD9B 4ZXBA 4HDIA 3BDBA 3BN9C 2GJZB 2ZPKH 1A7QH 3VW3H 2DD8H 4UV4H 1JGVH 3ULVH 3JV5A 1YECL 2ZSVB 3S98A 4LAJH 3VH8A 5F72S 1NC4B 3EDEA 3A6OA 5ICZB 1QRNA 5I9QC 3F12A 2GJJA 5GS2D 3SKNB 3QXDB 4FQXD 1MJUH 2W9DL 1J88A 1DQDL 3DV4B 2IALA 1DQLL 4CAGA 2V5MA 3OZ9L 1P4LA 3U36B 2QADB 3WNKA 3SGKC 4NQEB 3ES6A 2DQCL 5HJ3A 2YUVA 1JZ5A 2JJTA 4U1MB 3IS1X 4RDQF 1BBDH 4KROB 5J7CC 5I1DA 3ULUF 3B2UD 1RIHH 1RULH 4KJQC 5LKNA 3QULB 3TT1H 4Y5VB 4PJ9A 4HWBL 5SWZB 2HRPH 1VHPA 3KNBA 4NQTA 1GPOL 2PW1A 4NPYB 3GUTB 4I9WE 4WFGD 4JFYB 4WFGE 1C12A 3H8NA 3WDJA 2UY6A 3HUJA 3ZT6A 5IW6B 2HJLB 5JPNB 2CJUL 1CXEA 3KYOA 4HUUA 2AGJH 1VERA 1EEYB 2R9HC 4ZDHA 3DYMA 1G7PA 5FDYA 3RL1B 5CBAB 3LH2H 4OCWL 4UT7L 5E8OA 3PWVA 1ODAA 4NWUL 2CUIA 5AG9A 2J88H 4L9LA 1MFEH 3MCLH 1TCRA 3FAXA 4DW2L 2Y07L 4PJ7B 2EEBA 3JUZA 4ZG1A 2UWEB 4YBQC 2JB6B 4PG9A 3HG1A 4YO0B 1QFHA 2X1OA 3QDMD 5E2TL 3QDME 3GSRB 5HYQA 3DROB 3Q6GH 2P47B 2VRAA 1MJ7L 3C2SA 4I0KA 2FO4B 5E6ZA 3VFGH 5CMAA 4OUUB 3TJHC 1HHIB 4U7KA 1DBAH 3MRLB 3EDKA 4Y1AD 1A5FH 2CK0L 2P8PB 3CX2A 3DX6B 4K8RD 4Y1AE 3TZVA 2R8SL 2QHLA 1FCGA 4GAGL 1NSNH 5D7LD 4G8FA 1XF2A 1FVDB 4NKDA 2P46B 4PJAB 4G6ML 5D2NE 4CW1B 5FB8B 4I13B 4N90E 3VRIB 2FD6H 4OIIH 4X5LA 3GHBH 1MLBB 2DQIL 1ZLSL 3W9DA 5GRZA 5DA0B 4XAWL 3BEVA 4GT7A 3JWOL 4OLZH 5D7IB 2FSEA 3HE7B 3AU1B 5BOPA 1GGYA 1JUFA 2GTWA 3WNPA 2HVKB 3LEXA 4KDTA 3I9GH 3BDYL 4YAQB 5EUOE 4GKZA 3NACL 1RZIB 5FYJD 3IU3B 4EVNB 4PJIE 4TPRH 2D03L 2H26A 1TDQA 2YPVH 3PNWA 2LTQB 1C7TA 2BC4A 2R2CA 4PRHD 2IH1B 4PRHE 5IWLA 3S8WA 1SMOA 2ADJB 3S5LB 3SOBH 1ZVSB 4IOIB 4WHTA 4YHMH 3V6OA 1JHLL 5F71A 4X9BA 1H3XA 4M61A 3VGAB 1UM5L 2GFBB 4JREC 4PTUB 1HSBB 3L3IB 3VWKA 1QSEA 3QXVA 4ODWA 4XPBH 5D72H 1A6VL 4R4ND 2BHYA 2BNQB 3QIWC 4FMFA 2YMXH 3B8SA 4MDJB 3WUWG 3L95A 1KB5B 2Q8BL 3UTTD 4X7SH 1UB5B 4ZUSB 4I0CC 1P1ZA 1F6FB 3EOTH 3RWIA 4ZXBC 4Q2ZA 3DX8B 4D0BB 3LN5A 4PGJA 1IC1A 5EIIB 1QKZL 4PRDB 2B1HL 2IH3A 4KPHH 3N06B 4KMTL 3BQUA 5LAXB 1L7IH 4YPJA 2C3HA 2QEJA 1QLRB 2D7TH 2BY2A 1IGJA 2HWZH 3AROA 2ADFL 2JIXB 5JNYB 3GSOA 4KK9D 4FTVE 4PUBH 5IJVB 1FAIL 2A1WL 3DVNB 3WKNA 5KVEL 4NN7C 2PTTA 3GRWA 1XH3B 2NY5H 2VISB 2VDNL 3QO1A 1OSZB 2AJYL 1N6UA 2FHFA 3ECBA 4R7DA 1OAUH 2JJTC 3BN3B 2WBKA 3UBXA 2GYSA 4AK1A 1N3NA 5H35B 3SO3C 1IBGH 5KW9L 1Y18A 4OZGA 1QBAA 2Z91A 1A21A 2NW2A 5EN2B 2XY1A 3IFNH 4K2UL 4PJ9C 4YHOH 2W1NA 5C09A 2EC8A 3HCVA 4XNZB 2AJXL 5FOBA 2OJEA 2OI9B 1KTDB 4WFED 4WFEE 5HGDA 4JFPB 4NO2A 5EOTB 4Y4HD 1CICC 4KU1A 3IJHB 1WZ1H 1PW3A 2VXSH 4WNQB 5CKAA 3LEYL 1FH5H 3RY4A 1YPZF 4KI5F 1I3UA 4Z7WE 2IPUK 1CD1A 4L9LC 3H7LA 3P4OB 1OAQH 1TQBB 1T5XA 4EQ3A 3ZL4L 3ARFB 3MFFB 4K94L 1HNGA 2AJVL 4I48B 5E94B 4APQA 1P5VA 5CJXA 1FZJA 2BVOA 5LWYL 3SJVD 2NY0D 4JG1H 2Y1VA 3BIKB 3G08B 4P4KB 1UQSB 3SKJL 4K7PH 3BH8A 1NJ9B 5F7UA 1ZHKB 1AE6H 3MOBH 3QDGA 4K8RH 5D7JA 3PJSB 5HHMD 3TZVC 2W38A 3RBSA 4UDUB 2CQVA 3FT2A 2EDRA 2DQFA 1PGRB 2ZUYA 4JFFA 3F62A 2N4IA 4F58H 1T83A 4W4NA 1TMCB 3ESUF 2X09A 3D2UB 2KBGA 5EH1A 2YEZA 4RGMC 3OAZH 4P23D 2BZDA 4TNWK 1QLEL 3D18A 5FYJH 4KDTC 4ELMA 1RVFH 3QG6B 3L5XH 1D5IH 1FYTD 3H3PH 1QEWA 3HAEB 3IKKA 1FYTE 5EBMB 3KPNB 3OAYK 3JVGA 3MLRL 5DO2D 3MCG1 4WUUA 1HXYB 3U6RA 4JKLA 2BCKA 5DTFA 5CD3A 3IDGB 5IWLC 3T4YA 2E8ZA 3L3HB 1M7DA 3O41B 2KQMA 1ZK9A 3IF1A 4P9HH 1OCWL 5L2JB 4MX7B 4ENED 4GG8A 3EDDA 4CVXB 5L2KD 1VEPA 2XA8H 2D4FA 1JPTH 3C5SA 3MV8A 3B6SB 2FB4L 5MI0B 1UXSB 4LHUG 4H26B 3VWKC 2J8HA 1U3ZA 3O0RH 3B9EA 3FOMB 5JW4Q 3D0LA 3QA3B 4NGHH 3MLUL 1CXLA 4K7PX 5EUKA 1GIGL 2AV7B 1BHGA 4NO5A 4NKMA 4K9EH 1JGDA 1CGUA 5IOPA 3T2NL 1S7TB 4M4PA 3MRQB 3QIUA 5E08H 1BWMA 3X3GH 4WWID 5GS0D 1YMMA 4IMKA 5CHNB 4ODSL 1RHHA 1IGFL 4Y16A 3FB6A 5C0AA 1DN0A 5ID1B 5EULV 1F02I 1K8DB 3W9EB 1IGCL 3P0YL 4P5TB 3WE6B 4JQXC 1HQ4B 3MOAH 3BQUC 3MCKA 3W82A 1FV1B 4PJCF 3GRWL 5ESVA 4I0PB 3FCTA 1P9MA 3VFSA 1RD6A 1K8IB 1IT9H 2P44B 3IDXH 3MROA 5GPRA 3RPIA 4NSKB 4UB0H 3MFGB 1RU9L 1CR9L 1A6UH 4ZMAT 4JGJA 2Y5EA 5IFHL 4QXGL 2OSLA 1KEMH 4MJ2A 4PJ5D 4AZ8A 1KPVA 2X9YA 4R96A 1A02N 3MJGX 4GRLA 1DUYA 3GBNL 3FQTA 3L3OA 4DVBA 1YDPA 2CUMA 3G6AB 4WW2B 4Y0GA 5MEPA 2EEAA 4I8DA 1B88A 4FFWC 3U4AA 3QG7H 1I4FB 4P99A 4I3RL 4N0CC 43CAB 4OKVA 1AY1H 4FA8A 4ZD3H 5M94B 1D5MB 1CLOL 4FQLL 4OZHB 5BZDB 3R8QA 1BZQK 5BV7H 4KUCD 3AB0B 3V0AC 4Z7UE 2P45B 5HBBA 3KLHC 1RUQH 2MQ0A 1ZGLM 2ZCKL 2JELL 1GZPB 1MJ8L 2VLRA 1Z5LB 4N0YL 2AXGB 4PJXA 4Z78B 4NQDE 5F7WC 3H0TB 3IS0X 3RVWD 3GBMH 3P9LB 4UILH 4WFFD 2CDEA 5EB9A 5EZOH 2VH5L 5JUEL 4WFFE 5B3JF 4LGRB 2ICWB 1U8NB 7FABL 1E4WH 1RZ7H 3GSXB 4EI5B 3OG4B 2R1YA 3FQUB 1NCWL 4APQC 2GSGA 5HPMB 5CJXC 4TSAL 3DVGB 5F6HJ 1DDHB 2ZJSL 3P0GB 2B5IB 4IRJB 4AIXA 5BO1H 1NUNB 1D5ZA 4JM2D 3GSWA 2BMKA 3MA9H 2NYYC 4GRWH 5DJCA 1MHCA 5DYOB 5DA4A 5F70A 5CEZH 4XGZB 2JCCA 3U7WH 3F7YB 4XCCL 3CFBA 3O3DB 3UZEA 3EJYC 3KR3H 3TYGH 1G6RA 1CLZH 1AKJA 4X6FA 1IM9D 1I1FA 3FTGA 5KOMC 3KVQA 1YUHA 2RBLA 1FL3A 3AGVA 4O58L 3BD5A 1X44A 2E6JA 3G5YA 1KF9B 1BGXH 5IFJA 1NCCH 2WBJA 5CEYA 1A1NA 4NJAH 2Z31B 3CFDB 2ERJC 1EHAA 4P5KA 5F9JB 5CGTA 1ZLWK 2YSSB 4I2XA 5INDB 2H32B 4KUZH 2NZ9D 5A1AA 1M71B 5FUOH 4WTZG 2QHRH 2DQDH 1Z3GL 3ULVF 3KWWB 1S9VA 4OI7A 4PJHB 4XNQB 5E4IA 5E8PA 3MV9B 2XN9A 1NGQL 1T7WA 4KMLB 4QXTA 4NIKB 4BQ9A 3S35L 3UAJC 5IR1A 4Y8DC 2AABL 5HVWA 2AK4B 2ZOKA 4FQHB 2IBBA 4WWKD 3U9PL 5AYUH 3NCJH 4XHQA 1JGLL 4O2EA 1W0VA 3DIFB 1FIGL 4YDIH 4GBXB 3C6SB 4JDZA 3HNVH 5DRXA 4MLIA 3TVMD 3HZMA 3WYRA 5JHDB 4G6AD 4UQ2B 5F3HB 4BSJA 3W0WE 3A67H 2PCPB 5FIEA 3WUZA 4Y4FB 3TBWA 5C2BH 3V5KB 1YY9C 3QIUC 1ZGLA 5L8KB 1K2DB 3MLVL 5I6XC 1FPTH 1CL7H 3T3PE 1C8PA 3QHFH 4Y16C 1FNGA 4PJEE 4LDEB 2KZ1B 1DBKL 4PJGE 4PV9A 5K9KB 5C07E 4NM8L 1HIML 4S11A 3R1GL 3RU8L 4JO1H 4OFPA 2WV3A 1FFOA 2A6IA 1SYVB 1CZ8H 1P9MC 3KLDA 3BIBX 1LO4H 3V9FA 2HT2C 5KZCB 2ATPA 1FL5A 5I30H 3K74B 1I9JH 2O93L 1MREL 4YUEH 35C8H 1DBMH 5AZEH 1S5HA 4LHJB 3F8UB 4J7RA 3CFEA 3GIVA 4V2CB 4LPWA 3O6FD 5ESAB 4GRLC 1MI5B 4LEOA 3HE6A 4AIZA 4UBDD 4XB7A 1NFDA 4PD4J 4WY7L 1G9NL 4R0LA 3BO8B 2CIIB 4XNMA 1EZVY 1UVQB 3DTXA 5DVMA 3GZKA 3FN0L 3DGGA 3SGEH 3PV6B 1FYHB 3VXTB 3QCTH 3GJFB 3CVHH 3KXFE 1JZ7A 5FK9A 4JG0H 1G9NC 1MCIA 3VFMB 5GRYA 4AL8H 4C56B 3NN8B 4M5ZL 2IEPA 3U4BH 3NA9L 1UB6B 2Q8AL 4AEHL 1I7RA 3RUGB 4DFHA 4P4RB 2YHGA 3QFJA 1BLNB 3X14A 5BRZD 4WV1C 3TM6A 3AS0A 1ES0A 2PYEA 2YRPA 2FYYA 4NDMA 3P11H 4FFZL 5GGTA 5GSRB 4FQJL 5TFSL 4L1DA 4U1HA 3P77B 1EGJL 1RI8A 1KXTB 1P5UA 4KKBD 1RV6X 4OCLC 1H15B 1NAKH 2OM5A 5F9WC 2VSDA 2FJHA 4LSPL 3LS5L 5BZWB 2F9BT 5JQ6H 4QRPD 1P4BL 4QRPE 1XGYL 1G6RL 2HFEB 1UM4H 2N56A 1CGVA 3MJ9L 5D1ZB 3L5IA 4M9OA 1WZLA 3KS0J 4LLWB 2AEIT 5HTSA 5BMFL 1N6QH 4OF8A 2VLKA 1T2QL 2KUTA 3V6ZA 1RJYB 3TPUB 1T1ZB 4CMHC 4IMLA 4HXBL 1A3LH 3MA7A 3BE1H 1Z9LA 4D2NA 1F8TL 1I9EA 1NCNA 3EW3B 5KSBA 5FGSA 1R3JB 3KPQA 2VDQL 5H94B 1S7XA 3WKML 3FO0L 1UYWH 4LVOB 4CADA 2WBJC 1MFBH 2HVJA 1U8OA 2C5DC 4LVNC 4L4VB 1UM6H 2XWTA 3FAWA 4LSSH 1JJUA 5C0FA 5IKCB 2HMID 5E9DE 3BMVA 2FWOB 2CMRH 2FNBA 4LK4A 1FZKB 4P2QA 4XMLH 3IDIA 3P73A 4HV8B 4PBVC 4O5LH 3DXAA 2EECA 2YXFA 3RNQA 4E5XB 1EO8L 4RISL 5BJTA 5ENWB 2XQBH 1QTYT 1T0NB 5HHNA 3RY5A 5HYJA 3QDHA 2EO9A 3QZWG 3T65B 5HHQA 1FGNH 3FFDA 2IQ9L 5IMMB 1DLHB 2UZIL 2NY6B 3FT3A 2DQUH 4XPTL 3ZYJA 2BSED 5DI8B 5GJSH 3QUYC 5CINH 1MCKA 4G8GA 5B8CA 4HUWA 3H42L 3B2VH 4N8CH 5E99H 4PTTA 5E56A 1IM3A 4HHAB 2B0SL 4OCRH 5D7SH 4UT9H 3O2DL 5LJYH 1KCUH 1H9VA 1A1OB 3S5LG 3D9AL 1MCOL 4C83B 3PE9A 1XGRB 5ECJE 2ZOLA 3RTQA 4Q9QL 5ETUB 3QUMB 3B9DA 2DLHA 2VMFA 5ICXA 1T1YA 4RGNB 3RVXD 4QHLB 3TO4B 4Q9BA 1LK3L 3O8XD 4XI5D 4DCQA 2X7LA 4O51B 5JPMA 1DBBL 5T1LA 3MNZA 1IRAY 1S7SB 4EJ1C 3KJ4C 3MLPA 1KEGL 4PB0H 4M1GH 4YNYA 1VCAA 3ZDZF 4OZIE 4H5SA 1UZ8B 3C5ZC 4G43B 1OF2A 4U7SA 1M1SA 1M05B 1PEWA 3ZYOA 4X99B 5FA3A 5C0DA 3L5WA 2Q7YB 4ZFFB 4OF7A 3T0EA 5I1GH 1AGDA 4LSVL 5LGHL 3PG2A 1AIFA 4R0LC 1CFQA 2LVEA 4JFED 1T4KA 4MAYA 3O11B 1U3YA 1SBSH 3KJ6L 2Z92A 1C5DA 2PTUA 2X4PA 1QNZH 2OL3B 3H9HA 5HDBE 5B3JE 1UCBH 3EYFB 1JHKL 3E6HA 3IDJB 1KJ2H 5GGTL 4FQIH 2UWEF 3MRRA 5IB5A 4CDHA 4OIBA 3LKPB 4OUOA 3TJEH 1F45A 2EXYC 5SX5H 1U8IA 1FNFA 1NBVL 1C1EH 2PN5A 4NM4H 4N5UA 2BNRD 3QR2A 1AJ7L 3ZHLA 4M6MH 1PG7L 2AEWA 3U1SL 1BM3H 1UKSA 4JGUA 4DWHA 5IJKA 3GMMA 3VXQB 3PQYB 3VFRA 2FL5A 2FX7L 4DGVH 4M7KL 2F53E 4JHBA 5DMGC 4PJDF 4XVJH 1HILA 4LF3B 3WLWC 5D7IF 5F7DA 4Z7NF 1C5CL 1PZ5A 4K3EH 5F93C 5I2IA 2B4CH 3S34H 3P0VH 3OR7B 4U6VL 4GLRI 4LCUA 4RWYL 3MV7E 3INUL 4NZJA 4XRCB 5I9QB 3V0WH 2F5AH 3NCFB 3BISA 4NQCA 5ID0B 1IGIL 4PGBA 3ULVE 3GSQA 1GAFL 5HI5C 1U58A 4XP1H 5TPWL 2QTEA 3G6JF 3OXSA 3AFLA 5DFVC 1JWSA 1IQDB 5T1KB 5I16A 2V5YA 4BH7A 1J8HD 1J8HE 3TIDA 1CDJA 1FNAA 4ZNEE 3TBTA 3UPAA 4HS8H 3QI9A 1EVTC 1NGPH 3GMPB 1E4KA 2VDML 1KULA 1KB9J 3HMXH 1ZXQA 3EKCA 3FZUC 2NX5B 3VI4F 1T1WB 4HWEL 1KT2B 4E41D 1TETH 4MNGB 1XGPB 4L8BA 3PXJA 4KKLD 4KGLA 5F7HA 4R8WH 1KC5L 1OARH 2DIBA 2VR4A 4MDIB 1MQ8A 2X4TB 1SMAA 1NGXA 2BHZA 3HC3L 5DK3A 3HAEG 4LKCA 3ILPB 4LLUB 4NHCL 3EOAB 2P8MB 2IANA 4KFZC 5E00B 4EXPX 3U4EA 5C0NC 3KPRE 3VXRB 4LCCA 5DD5L 4G7VH 4PGEB 4OM1L 5LGJB 3IXAB 3I2CH 1K4DB 1A4KB 5CCKH 3CAFA 1BZ9B 5JW4M 1EBAA 4HUNB 3SEPA 4TUJB 5KVFH 3RTQC 4XTRD 5D70H 3M45A 4HIJA 4AENA 3WXWH 5HI4C 4YX2L 2VUYA 3C6LA 4FP8H 3ZSSA 3B3IA 5F7YC 1UJTA 4LSRH 4U49A 3QPQC 2V2XB 4PRNB 1D5BB 1JF6A 3AXLA 3VFOA 2WK2A 4FN0A 4XP6H 2XTJD 4XC3H 2XTJE 4U6YA 1TJGH 4FFVD 4WTWA 5IIEA 1F3JA 2ESVD 3OX8B 2ESVE 4H1LH 3BPCA 2R2EB 4U1SB 3NFNB 2EEDA 1FL6B 3CGTA 4GRWF 4MAYC 4X80L 3OKEB 4LOUC 1NEZA 5CUSH 4QRUA 1RJLB 2QQLL 4MA7H 1DBJL 2X6MA 1N2RA 1II4E 5IMLA 1GJIA 1J87A 3H9SE 4RIRB 1HH6A 2X10A 4G8IB 4JRYD 5I17B 5SX4I 4JRYE 3LV3B 2XTLA 3VXSB 4X0KA 5CZVL 3ZTJG 1TZHA 2FX8L 5IQ9A 3D39A 4TUOA 4JREB 1T7XA 4ZUUA 3UYOD 3Q5YA 1LDSA 2AKRA 5SWQB 1AGFB 3C8HA 3QIWB 1ZV5A 2DYPD 5D2LE 1G7HB 4TTDD 4E42A 4UU9B 4S0TD 2WAHA 5IK3A 2Z4QB 3TC9A 2D7OA 2PW2B 4ZXBB 2VL4A 4HDIB 4D9LL 4ZTOH 1G9MH 5HD8C 2AXJA 4XWOD 1NKOA 3VMPA 2RAMA 1KJMA 3GI8L 4XBEH 4DN3L 4LVHC 5I1JL 3STLA 4HCRH 1MHEA 1ZEAH 4MQXC 3VH8B 1QRNB 3HLAA 4MZ2A 3F12B 4XH2A 4P2OD 4OI8A 4Z8FL 2B2XL 2IALB 4NN7B 1I1CA 1P4LB 5D1XA 3H7BA 3ARGA 4GKSA 5GGQL 3ES6B 5HJ3B 4G3YH 4M9PA 4CKVX 3BSZH 4HGWB 1UZ6E 1YN7A 2LFGA 4JM4H 5B22A 1OAYL 5IB3A 4XCEA 2HFTA 3SO3B 4L3AA 2P4AB 4QOKA 5I1DB 3C2AL 3EJZC 1UKQA 2J3SA 2ZCHH 3CJJA 1E4KC 3BZDA 4OQTH 3ARDD 4PJ9B 3KNBB 4NC1E 2Q6WA 2PW1B 4UV7H 1SEQH 5DHVA 1C12B 3HUJB 4LIQE 2DLIA 2HN7A 1CICB 5DZNA 4LDLB 4FNLH 4NBZB 1T22A 3BAEH 3WFEL 4HUUB 4ZDHB 1EV2E 1G7PB 5F6IC 3NIFF 3TBSA 4PJ8D 3ULUL 3E1F1 4N9OB 1WEJL 5E8OB 4R4FL 3UBXI 2QADD 4L9LB 1R0AL 4RMWA 4NQED 2IFFH 4NQEE 4V1DD 4QXUL 4V1DE 3RJDA 1TCRB 4CU6A 2H41A 5JO5B 4PG9B 3ULUC 3HG1B 4LCCC 5F97E 1G7QA 1RMFH 4X9FA 1QFWM 1FORH 5HYQB 1RK0B 2YD1A 3ZE2F 3GSNL 4R6UA 2LQRA 5SWZE 5GZOD 3X3FH 5I1KH 4KVCL 4X6CF 5E2VL 4XC1H 4WW2F 1CIUA 3TZVB 3C6LC 1JYWA 5B39A 4J6RH 4G8FB 1XF2B 5J1AA 1YPZA 1J1OH 3HFML 1SYSB 4JRWA 4TNVK 3W9DB 1NL0H 4RGMB 1KN2H 3BEVB 4MNQA 3L7EA 3V4PL 3S37L 1FZOA 2DBLL 1JUFB 2GTWB 3ARPA 1D6EA 3LEXB 4PJ7E 1E6JH 3QEQA 4KJYA 4C57C 4GMTH 1F4YH 1BD2D 2ADIA 5CJ8A 2H26B 3PNWB 2OTUA 3TN0A 4X6DF 1NQBA 5INCA 2BC4B 2AEQH 2VNCA 3WIHA 1L0XA 1BQHG 3EDFA 4POZD 4F7PA 1QLFA 3OPZL 1WJ3A 3SQOL 4WHTB 2CD0A 1T66C 3G04B 1VFUA 2VXQH 2VDKL 4PJAE 2YD5A 4M61B 3RBGA 2VDLL 3VWKB 4JFZH 4ODWB 4BFEA 4PLJC 2XIDA 4PJFA 1HWGB 4LAQH 3DOSA 1KLUA 5FAAA 3U7AA 3L95B 5J57B 3O4LA 2W0LA 5IMKB 2GJ6A 1NMCC 2LE9A 3ARRA 1P1ZB 1X5AA 4IRZH 4DQOL 3RWIB 2M8XA 4Q2ZB 1DZBA 3GHEH 4XNXL 4G6JL 2EDOA 2B20A 4BQCA 1E4XI 3LN5B 4ODHL 3RWFA 4WU5B 2IH3B 1M7IA 3DUUA 4GLRH 3SHSA 3BQUB 3BKJH 4FFYH 3W11C 2AW2A 2OP4H 3PWUA 4HX1A 4G9FA 4OGZA 3IU4L 1F3DH 1IGJB 1BEYH 4M03A 3GSOB 1G7MA 1C16A 3FHQA 3QJHA 2NY2C 4YK4C 1TLKA 1XMWA 5EBWA 2BNQE 2PTTB 3TNMA 5D1XC 3VI4E 3NTCH 1CDBA 1QRKA 1DTUA 3QCUL 3ARGC 3QO1B 5JDSA 2EZ0D 2BSRA 4OCMC 1D6VL 2EH7L 1XCQA 3ECBB 4R7DB 1WTLA 2P8LA 2WP3O 3WXVH 3IDYC 1FNEA 1N3NB 3GMRA 2NY4C 3SDXA 4RFOL 1Y18B 4OZGB 2Z91B 2NW2B 4MQ7A 3SE9H 5C09B 3AS2A 1NLDL 4PP2B 1LP9A 3HCVB 5C0BA 3RVTC 4HKZA 2XZQH 5FOBB 1JWMB 1T2JA 4HUMB 1BOYA 2OJEB 4PJCA 5CFHA 2BX5A 4NO3A 1NBZA 4KVNL 3EBAA 3BP6A 5HGDB 4NO2B 2BVPA 2MNUA 1BVKA 2JIXD 4KTYA 1MCJA 1Q8MA 5DURB 2Y23A 4WI9A 2Y4SA 5T3ZL 1AXTL 1BOGA 2EC9T 4JPWH 3IGAA 3CCHA 2VWEE 3I3BA 1CD1B 3HRZA 3E3QC 1CYGA 2N1KA 1T5XB 5EORH 1QVOA 1BJ1J 3EYUL 1IGTA 4APQB 1J1PL 2DKUA 4HG4K 1IC7L 2BVOB 2R4RL 3P2TA 1MRDH 3LHPL 1A7RH 4KK8C 4D9RD 5IB1A 2YBRA 3I75A 3QDGB 5GGSA 3RWJA 2QR0A 3CLEH 3CK0L 5KJRL 2DM4A 15C8L 1MJJA 3CDFA 2ARWA 2X70A 5H37H 4MVBD 3FT2B 1YEGH 3ZKSD 2DQFB 3NPZB 4X5XA 1KG0A 4GMSH 4KI5C 1I1AA 1MIMH 1MRCH 2YEZB 2EKJA 4JY5L 4U3XA 5JHLL 1YEIH 3FRPG 2YKLL 4XWGH 4H1LG 3D18B 2DLTA 5KSVA 4ELMB 1ZT4A 3RUGF 2J4WL 3LIZL 2MQCA 2HP4A 4PRBA 3D6GA 4WUUB 5F7EL 3ZTNL 5HI3C 4ZFOA 1N26A 3SO5A 3K4ZA 5FYJU 1LNUA 3C8DA 3PF2A 1H5BA 3TT3H 3U6RB 3TN0C 2D31A 2BCKB 1FLTX 2VN7A 5DTFB 5CD3B 1EDQA 5C0CA 5I75C 1A7OH 3FKUS 1IAKA 3REWA 1M7DB 2VJXA 1ORSA 2MPAH 3IF1B 1PYWA 4YDKH 5I8KH 4GG8B 3I02A 3RY6A 4ZTPL 4A2MA 3GKZA 4OM0L 3C5SB 3MV8B 4C4KO 4OKDA 1U3HA 4XCFL 3MTRA 4DGIH 5DDHA 5LBSH 4AIOA 5D5MA 1CD9B 3D0LB 4RAUA 4OBRA 5FHAH 5B38A 4UTBL 5EUKB 1YEKL 4NKMB 3ZMRA 5IOPB 4NC0B 1NBQA 1U8LA 4IRSC 3QIUB 1WFTA 3S4SA 1CFVH 1YMMB 5I6XB 3DETD 4O02L 5DUPL 4MA1C 4Y16B 3FB6B 5IG7A 3GMQA 1QSFA 2FATH 3RKDD 4CVUA 5C0AB 1DN0B 3TWCH 3BFOA 1JGUH 2H8PA 2GW5A 1UXWB 3D85A 2H45A 4LCWA 3MCKB 3ARWA 4LRNH 4OD3H 1X3DA 1MAML 2VDPL 3QBTB 5ESVB 4AQ1B 3ILQD 3FCTB 3HNTL 3FJTA 4K07A 3MROB 3N1GC 3RPIB 1UWXK 2AI0H 2E9BA 2XWBA 2YZ8A 1INDL 5JIPA 5FYKE 2FX9H 3X11A 1CXKA 3LAFA 5DQJA 2OSLB