4PUXA

Crystal structure of a beta-barrel like protein (abaye2633) from acinetobacter baumannii aye at 1.43 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
157
structure length
157
Chain Sequence
QYNPPPIQLEPLAKFSVDLNAPVWELGTTSDAGKRRIIPITGGTFEGKSLKGRILNNGADWQIVDSKGLAIIDTRYLLETDDGALIYLQTKGYRHGSAETLKQLAQGKDVDPKNYYFKITMQFETSSPKYSWLNQTVAVGSAMRLGKAVIYDAYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (ABAYE2633) from Acinetobacter baumannii AYE at 1.43 A resolution
rcsb
source organism Acinetobacter baumannii
molecule tags Structural genomics, unknown function
total genus 32
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 4puxA00
3C5OA 1MM4A 3QRAA 2MHLA 1MM5A 2JMMA 2LHFA 2N2LA 4RLCA 1Q9GA 1QJ9A 2M07A 1QJ8A 1BXWA 2X27X 1G90A 1THQA 2F1VA 3QRCA 2F1TA 3GP6A 2GE4A 2MNHA 2M06A 1Q9FA 1QJPA 1ORMA 1P4TA 2ERVA 4PUXA 2K0LA 2N2MA 3G7GA
chains in the Genus database with same CATH superfamily
5AFUL 3POQA 5E79O 1IZNB 2R89A 2MHLA 2Y7SA 5DL8A 5DL5A 3V8UA 5EE2A 2LFUA 5B66O 3AA7A 1S5LO 1GFMA 3KZIO 4AZLA 5GV0A 4RLCA 1Q9GA 4AFKA 4E1SA 2XE2A 2Y0HA 3VZWX 4AYID 4FSOA 4AYNA 2M07A 3UPGA 1QJ8A 2IWVA 4QQ1A 2YNKA 3PF1A 3RBHA 3VY9X 1OSMA 3AA1A 1BXWA 2X27X 3AA6A 4Z3TA 4O3XB 3JTYA 4O4UA 4AYEC 1E54A 2QTKA 3K19A 2F1CX 3LK2B 3QRCA 3VZTX 3WU2O 3GP6A 4PJ0O 5FVNA 3WI5A 4C00A 5DL7A 2GE4A 4GCQA 4RJWA 4RL9A 3VY8X 3AAEA 4N74A 4D65A 4LSHA 1Q9FA 4AKRA 1ORMA 3LK42 4FUVA 3NSGA 2XE3A 2K0LA 2WJRA 4C4VA 1ZHXA 5B5EO 4O3ZA 3BRZA 4FESA 4LSIA 4GF4A 4FZLA 1ZHWA 4D64A 1BT9A 3SY7A 4FQEA 1ZHYA 2KZ7A 2JMMA 2ODJA 2XE5A 4KR8A 4LSFA 3VE1A 3WI4A 3POUA 5AFUK 2N2LA 1ZHTA 3LK3A 1PRNA 4FZMA 5T5FA 1QJ9A 5G38A 2W80C 4FOZA 5JDPA 4FSPA 4CTDA 3O0EA 4O49A 4N59A 1G90A 3DWNA 3SYBA 7PRNA 2F1VA 2KC0A 3DWOX 3POXA 4N75A 4LSEA 2Y0KA 3HOLA 3VZUX 3PGSA 4KR4A 5G26A 2KXPB 1T1LA 4JFBA 1QJPA 2ERVA 4FRTA 4PUXA 3T0SA 1YS5A 2N2MA 2XG6A 1ZHZA 4D5UA 3NJTA 4FT6A 2J1NA 2XE1A 3C5OA 3DA3A 5DL6A 2R4OA 3LK41 4F4BA 2AXTO 3QRAA 4FRXA 3A0HO 4O3WA 2O4VA 3AAAA 4FZNA 1MM5A 2LHFA 1GFPA 2W81C 2R4NA 3AA0A 3FYXA 3HW9A 4K3BA 4UB6O 2R8AA 3SYSA 4XNLA 5H2FO 1MPFA 1HXTA 2J4UP 2PORA 4PR7A 5PRNA 4AUIA 1OPFA 1IZNA 2K4TA 3PGUA 3T24A 3SZDA 4AKMA 2KDYA 3HWBA 4C69X 3KVDD 1THQA 3DZMA 4AKRB 3A2SX 3A0BO 5ADXL 4C4VB 4B61A 4JCHA 2IWWA 3T20A 1GFOA 2MNHA 3TZGA 2M06A 5IYUA 5GTHO 4FMSA 3PRNA 1GFNA 2FGQX 2OMFA 2PRNA 3LK2A 4RJXA 4XNKA 4BUMX 3G7GA 2KXPA 1GFQA 3BRYA 3DA4A 3AA7B 4G75A 5KAIO 3LK3B 4RLBA 4O3YA 2YPVA 2XMXA 2XTRA 4GHBA 1MM4A 3VE2A 1BH3A 3HOEA 5TISO 4AYMC 4IL6O 4E1TA 4N58A 3AA1B 2JQYA 3AA6B 3PQUA 4GCPA 2R4PA 4AYDC 2WVPA 3PQSA 1T16A 2ZLDA 1PHOA 3BS0A 2Y2XA 3AA0B 4K3CA 2R4LA 6PRNA 5D5DA 5G39A 1HXXA 3PORA 3AAEB 2Y0LA 2ZFGA 3EMNX 4GCSA 4UB8O 5GTIO 2F1TA 4KRAA 5KAFO 1H6S1 3SZVA 3UAQA 3PGRA 2FGRA 1HXUA 5ADXK 2R88A 4O4XA 5G3AA 3JCUO 3UU2A 1P4TA 3SY9A 2WJQA 3AAAB 4G76A 2XTQA 2X9KA 2KZ7B 4U9CA 8PRNA
chains in the Genus database with same CATH topology
5AFUL 3POQA 1IZNB 2MHLA 2Y7SA 5DL8A 5DL5A 3V8UA 5EE2A 2LFUA 3AA7A 4AZLA 1GFMA 5GV0A 4RLCA 1Q9GA 4AFKA 4E1SA 2XE2A 2Y0HA 3VZWX 4AYID 4FSOA 4AYNA 2M07A 3UPGA 1QJ8A 4QQ1A 2YNKA 3RBHA 3VY9X 1OSMA 3AA1A 1BXWA 2X27X 3AA6A 4Z3TA 4O3XB 3JTYA 4O4UA 4AYEC 1E54A 2QTKA 3K19A 3LK2B 3QRCA 3VZTX 3GP6A 5FVNA 3WI5A 5DL7A 2GE4A 4GCQA 4RJWA 4RL9A 3VY8X 3AAEA 4D65A 4LSHA 1Q9FA 4AKRA 1ORMA 3LK42 4FUVA 3NSGA 2XE3A 2K0LA 1ZHXA 4O3ZA 4FESA 4LSIA 4GF4A 4FZLA 1ZHWA 4D64A 1BT9A 3SY7A 3VE1A 1ZHYA 2KZ7A 2JMMA 2ODJA 2XE5A 4KR8A 4LSFA 3WI4A 5AFUK 3POUA 2N2LA 1ZHTA 3LK3A 1PRNA 4FZMA 5T5FA 1QJ9A 2W80C 4FOZA 5JDPA 4FSPA 3O0EA 4O49A 4N59A 1G90A 3SYBA 7PRNA 2F1VA 2KC0A 3POXA 4LSEA 2Y0KA 3HOLA 3VZUX 4KR4A 5G26A 2KXPB 4JFBA 1QJPA 2ERVA 4FRTA 4PUXA 3T0SA 1YS5A 2N2MA 2XG6A 1ZHZA 4D5UA 4FT6A 2J1NA 2XE1A 3C5OA 3DA3A 5DL6A 4F4BA 3LK41 3QRAA 4FRXA 4O3WA 2O4VA 3AAAA 4FZNA 1MM5A 2LHFA 1GFPA 2W81C 3FYXA 3AA0A 3HW9A 4C69X 3SYSA 4XNLA 1MPFA 1HXTA 2J4UP 2PORA 4AUIA 1OPFA 1IZNA 2K4TA 3T24A 3SZDA 4AKMA 2KDYA 3HWBA 3KVDD 1THQA 4AKRB 3A2SX 5ADXL 4B61A 4JCHA 3T20A 1GFOA 2MNHA 3TZGA 2M06A 5IYUA 4FMSA 3PRNA 1GFNA 2FGQX 2OMFA 2PRNA 3LK2A 4RJXA 4XNKA 3G7GA 2KXPA 1GFQA 3DA4A 3AA7B 4G75A 3LK3B 4RLBA 4O3YA 2YPVA 2XMXA 2XTRA 4GHBA 1MM4A 3VE2A 1BH3A 3HOEA 4AYMC 4E1TA 4N58A 3AA1B 3AA6B 3PQUA 4GCPA 4AYDC 3PQSA 2ZLDA 1PHOA 2Y2XA 3AA0B 6PRNA 5D5DA 1HXXA 3PORA 3AAEB 2Y0LA 2ZFGA 3EMNX 4GCSA 5PRNA 3SZVA 2F1TA 4KRAA 4BUMX 1H6S1 3UAQA 2FGRA 1HXUA 5ADXK 4O4XA 3UU2A 1P4TA 3SY9A 3AAAB 4G76A 2XTQA 2KZ7B 4U9CA 8PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5O A;  1MM4 A;  3QRA A;  2MHL A;  1MM5 A;  2JMM A;  2LHF A;  2N2L A;  4RLC A;  1Q9G A;  1QJ9 A;  2M07 A;  1QJ8 A;  1BXW A;  2X27 X;  1G90 A;  1THQ A;  2F1V A;  3QRC A;  2F1T A;  3GP6 A;  2GE4 A;  2MNH A;  2M06 A;  1Q9F A;  1QJP A;  1ORM A;  1P4T A;  2ERV A;  4PUX A;  2K0L A;  2N2M A;  3G7G A; 
#chains in the Genus database with same CATH topology
 5AFU L;  3POQ A;  5E79 O;  1IZN B;  2R89 A;  2MHL A;  2Y7S A;  5DL8 A;  5DL5 A;  3V8U A;  5EE2 A;  2LFU A;  5B66 O;  3AA7 A;  1S5L O;  1GFM A;  3KZI O;  4AZL A;  5GV0 A;  4RLC A;  1Q9G A;  4AFK A;  4E1S A;  2XE2 A;  2Y0H A;  3VZW X;  4AYI D;  4FSO A;  4AYN A;  2M07 A;  3UPG A;  1QJ8 A;  2IWV A;  4QQ1 A;  2YNK A;  3PF1 A;  3RBH A;  3VY9 X;  1OSM A;  3AA1 A;  1BXW A;  2X27 X;  3AA6 A;  4Z3T A;  4O3X B;  3JTY A;  4O4U A;  4AYE C;  1E54 A;  2QTK A;  3K19 A;  2F1C X;  3LK2 B;  3QRC A;  3VZT X;  3WU2 O;  3GP6 A;  4PJ0 O;  5FVN A;  3WI5 A;  4C00 A;  5DL7 A;  2GE4 A;  4GCQ A;  4RJW A;  4RL9 A;  3VY8 X;  3AAE A;  4N74 A;  4D65 A;  4LSH A;  1Q9F A;  4AKR A;  1ORM A;  3LK4 2;  4FUV A;  3NSG A;  2XE3 A;  2K0L A;  2WJR A;  4C4V A;  1ZHX A;  5B5E O;  4O3Z A;  3BRZ A;  4FES A;  4LSI A;  4GF4 A;  4FZL A;  1ZHW A;  4D64 A;  1BT9 A;  3SY7 A;  4FQE A;  1ZHY A;  2KZ7 A;  2JMM A;  2ODJ A;  2XE5 A;  4KR8 A;  4LSF A;  3VE1 A;  3WI4 A;  3POU A;  5AFU K;  2N2L A;  1ZHT A;  3LK3 A;  1PRN A;  4FZM A;  5T5F A;  1QJ9 A;  5G38 A;  2W80 C;  4FOZ A;  5JDP A;  4FSP A;  4CTD A;  3O0E A;  4O49 A;  4N59 A;  1G90 A;  3DWN A;  3SYB A;  7PRN A;  2F1V A;  2KC0 A;  3DWO X;  3POX A;  4N75 A;  4LSE A;  2Y0K A;  3HOL A;  3VZU X;  3PGS A;  4KR4 A;  5G26 A;  2KXP B;  1T1L A;  4JFB A;  1QJP A;  2ERV A;  4FRT A;  4PUX A;  3T0S A;  1YS5 A;  2N2M A;  2XG6 A;  1ZHZ A;  4D5U A;  3NJT A;  4FT6 A;  2J1N A;  2XE1 A;  3C5O A;  3DA3 A;  5DL6 A;  2R4O A;  3LK4 1;  4F4B A;  2AXT O;  3QRA A;  4FRX A;  3A0H O;  4O3W A;  2O4V A;  3AAA A;  4FZN A;  1MM5 A;  2LHF A;  1GFP A;  2W81 C;  2R4N A;  3AA0 A;  3FYX A;  3HW9 A;  4K3B A;  4UB6 O;  2R8A A;  3SYS A;  4XNL A;  5H2F O;  1MPF A;  1HXT A;  2J4U P;  2POR A;  4PR7 A;  5PRN A;  4AUI A;  1OPF A;  1IZN A;  2K4T A;  3PGU A;  3T24 A;  3SZD A;  4AKM A;  2KDY A;  3HWB A;  4C69 X;  3KVD D;  1THQ A;  3DZM A;  4AKR B;  3A2S X;  3A0B O;  5ADX L;  4C4V B;  4B61 A;  4JCH A;  2IWW A;  3T20 A;  1GFO A;  2MNH A;  3TZG A;  2M06 A;  5IYU A;  5GTH O;  4FMS A;  3PRN A;  1GFN A;  2FGQ X;  2OMF A;  2PRN A;  3LK2 A;  4RJX A;  4XNK A;  4BUM X;  3G7G A;  2KXP A;  1GFQ A;  3BRY A;  3DA4 A;  3AA7 B;  4G75 A;  5KAI O;  3LK3 B;  4RLB A;  4O3Y A;  2YPV A;  2XMX A;  2XTR A;  4GHB A;  1MM4 A;  3VE2 A;  1BH3 A;  3HOE A;  5TIS O;  4AYM C;  4IL6 O;  4E1T A;  4N58 A;  3AA1 B;  2JQY A;  3AA6 B;  3PQU A;  4GCP A;  2R4P A;  4AYD C;  2WVP A;  3PQS A;  1T16 A;  2ZLD A;  1PHO A;  3BS0 A;  2Y2X A;  3AA0 B;  4K3C A;  2R4L A;  6PRN A;  5D5D A;  5G39 A;  1HXX A;  3POR A;  3AAE B;  2Y0L A;  2ZFG A;  3EMN X;  4GCS A;  4UB8 O;  5GTI O;  2F1T A;  4KRA A;  5KAF O;  1H6S 1;  3SZV A;  3UAQ A;  3PGR A;  2FGR A;  1HXU A;  5ADX K;  2R88 A;  4O4X A;  5G3A A;  3JCU O;  3UU2 A;  1P4T A;  3SY9 A;  2WJQ A;  3AAA B;  4G76 A;  2XTQ A;  2X9K A;  2KZ7 B;  4U9C A;  8PRN A; 
#chains in the Genus database with same CATH homology
 5AFU L;  3POQ A;  1IZN B;  2MHL A;  2Y7S A;  5DL8 A;  5DL5 A;  3V8U A;  5EE2 A;  2LFU A;  3AA7 A;  4AZL A;  1GFM A;  5GV0 A;  4RLC A;  1Q9G A;  4AFK A;  4E1S A;  2XE2 A;  2Y0H A;  3VZW X;  4AYI D;  4FSO A;  4AYN A;  2M07 A;  3UPG A;  1QJ8 A;  4QQ1 A;  2YNK A;  3RBH A;  3VY9 X;  1OSM A;  3AA1 A;  1BXW A;  2X27 X;  3AA6 A;  4Z3T A;  4O3X B;  3JTY A;  4O4U A;  4AYE C;  1E54 A;  2QTK A;  3K19 A;  3LK2 B;  3QRC A;  3VZT X;  3GP6 A;  5FVN A;  3WI5 A;  5DL7 A;  2GE4 A;  4GCQ A;  4RJW A;  4RL9 A;  3VY8 X;  3AAE A;  4D65 A;  4LSH A;  1Q9F A;  4AKR A;  1ORM A;  3LK4 2;  4FUV A;  3NSG A;  2XE3 A;  2K0L A;  1ZHX A;  4O3Z A;  4FES A;  4LSI A;  4GF4 A;  4FZL A;  1ZHW A;  4D64 A;  1BT9 A;  3SY7 A;  3VE1 A;  1ZHY A;  2KZ7 A;  2JMM A;  2ODJ A;  2XE5 A;  4KR8 A;  4LSF A;  3WI4 A;  5AFU K;  3POU A;  2N2L A;  1ZHT A;  3LK3 A;  1PRN A;  4FZM A;  5T5F A;  1QJ9 A;  2W80 C;  4FOZ A;  5JDP A;  4FSP A;  3O0E A;  4O49 A;  4N59 A;  1G90 A;  3SYB A;  7PRN A;  2F1V A;  2KC0 A;  3POX A;  4LSE A;  2Y0K A;  3HOL A;  3VZU X;  4KR4 A;  5G26 A;  2KXP B;  4JFB A;  1QJP A;  2ERV A;  4FRT A;  4PUX A;  3T0S A;  1YS5 A;  2N2M A;  2XG6 A;  1ZHZ A;  4D5U A;  4FT6 A;  2J1N A;  2XE1 A;  3C5O A;  3DA3 A;  5DL6 A;  4F4B A;  3LK4 1;  3QRA A;  4FRX A;  4O3W A;  2O4V A;  3AAA A;  4FZN A;  1MM5 A;  2LHF A;  1GFP A;  2W81 C;  3FYX A;  3AA0 A;  3HW9 A;  4C69 X;  3SYS A;  4XNL A;  1MPF A;  1HXT A;  2J4U P;  2POR A;  4AUI A;  1OPF A;  1IZN A;  2K4T A;  3T24 A;  3SZD A;  4AKM A;  2KDY A;  3HWB A;  3KVD D;  1THQ A;  4AKR B;  3A2S X;  5ADX L;  4B61 A;  4JCH A;  3T20 A;  1GFO A;  2MNH A;  3TZG A;  2M06 A;  5IYU A;  4FMS A;  3PRN A;  1GFN A;  2FGQ X;  2OMF A;  2PRN A;  3LK2 A;  4RJX A;  4XNK A;  3G7G A;  2KXP A;  1GFQ A;  3DA4 A;  3AA7 B;  4G75 A;  3LK3 B;  4RLB A;  4O3Y A;  2YPV A;  2XMX A;  2XTR A;  4GHB A;  1MM4 A;  3VE2 A;  1BH3 A;  3HOE A;  4AYM C;  4E1T A;  4N58 A;  3AA1 B;  3AA6 B;  3PQU A;  4GCP A;  4AYD C;  3PQS A;  2ZLD A;  1PHO A;  2Y2X A;  3AA0 B;  6PRN A;  5D5D A;  1HXX A;  3POR A;  3AAE B;  2Y0L A;  2ZFG A;  3EMN X;  4GCS A;  5PRN A;  3SZV A;  2F1T A;  4KRA A;  4BUM X;  1H6S 1;  3UAQ A;  2FGR A;  1HXU A;  5ADX K;  4O4X A;  3UU2 A;  1P4T A;  3SY9 A;  3AAA B;  4G76 A;  2XTQ A;  2KZ7 B;  4U9C A;  8PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...