4PUZA

Crystal structure of spleen tyrosine kinase (syk) in complex with gs-9973
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 263
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4puzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4puzA01
5FP5A 3TXOA 4DINA 2BRHA 2PVRA 3GI3A 3TTJA 3KK8A 3LCSA 3C4XA 3ZFYA 3LMGA 3RAKA 1JWHA 4RVLA 5ETCA 3TT0A 4FVRA 2OIQA 3EYHA 4E5AX 2C1AA 2FSOX 4C34A 1YDSE 3OY1A 2EU9A 4E3CA 1PYXA 1Y6AA 3PJ8A 3JS2A 3D2KA 3JY9A 4HW7A 4BDKA 2WEIA 3ATTA 1JVPP 5EHLA 2ZVAA 2NRUA 4ZY6A 2UZNA 2XZSA 3MIYA 1GIIA 4O27B 5H2UA 4DH5A 4K33A 2IN6A 4L53A 1K2PA 2OIDA 2BALA 1YWNA 3F7WA 3KN5A 2UV2A 3W2CA 4DH1A 2W5AA 3OOGA 5HTIA 2WMVA 3O8PA 3BV2A 5CANA 4K6ZA 4CZTA 3RPVA 4U79A 3ZM4A 4S33A 5IQDA 1HCLA 4UWBA 2C0OA 3OHTA 5DRBA 3D7TA 5ANJA 3RPSA 4E6AA 4E93A 4IWPA 2P4IA 2VX3A 1NY3A 5KHWA 5JQ5A 1NVRA 2RG6A 3E3BX 4E4XA 1YHVA 4BB4A 2CPKE 3KMWA 3OTVA 2Z8CA 3PPZA 5EI2A 4TXCA 3BWFA 4LV8A 2R0IA 2OXDA 3IDCA 3Q9XA 3MW1A 2DWBA 4XG3A 2OXYA 5JH6A 5IQBA 2YAAA 1XO2B 3ORPA 5CU0A 3EL7A 5EQEA 4FT9A 5IDNA 2C3KA 3UJGA 5EK7A 3RNIA 4LUEA 4W8DA 3TZ9A 1FVTA 2VD5A 2QOFA 3WZDA 4FG8A 3C13A 3SXRA 3EQDA 4F0GA 5ITAA 3VN9A 4QMVA 3C4EA 2HY81 1VEBA 5CXHA 3BWJA 4IB3A 2QR7A 4L8MA 2YDIA 3QZHA 2KTYA 3CE3A 3H10A 4C3PA 3K3JA 3QTIA 5FD2A 4IH8A 4L3PA 4QYGA 4AE6A 3OBGA 1J1BA 1VJYA 1G3NA 3HMNA 2WTDA 3R30A 4V05A 5H8BA 4W4YA 4JR3A 4H39A 1WMKA 5AAGA 3ODYX 3P4KA 4JAJA 4NCTC 4CKIA 4XMOA 2B55A 1GOLA 1OB3A 2OFUA 5IUHA 1SVGA 4UMPA 3ORIA 1ZY4A 4NK9A 2IG7A 3ODZX 5AMNA 1IR3A 3REPA 4F6WA 4YMJA 2EB3A 3DBDA 3O8UA 3OY3A 4B7TA 5F94A 3CD8A 1DI9A 2XP2A 3PFQA 4O0YA 1YXUA 4D55A 2W17A 4H58A 5HBHA 4CFMA 2XEYA 2J4ZA 4X2NA 5E1EA 3R73A 4D0WA 5TO8A 1TVOA 4S31A 2WEVA 3WYYA 3IDPA 3WZUA 3CQUA 3QRKA 3QX2A 2BAJA 3ZZWA 2CSNA 2QHNA 4EYJA 2X4ZA 4BHZA 2R3JA 4YTFA 5DYJA 5EQPA 3R8MA 3FMEA 3I1AA 4FTNA 3QC4A 3TM0A 5GIOE 5HHWA 1A9UA 2GNJA 5CQWA 3EN5A 4OAUC 2F9GA 4WO5A 4BF2A 1KE9A 5M4UA 1OI9A 2C4GA 3QTSA 3RK5A 2PSQA 1T46A 3F82A 3WOWA 2W05A 4TNDA 4DEAA 2JKOA 4BCIA 4C02A 5KMNA 1KV1A 2CCHA 3UBDA 4ASXA 4GT5A 3ULZA 3JR1A 2WMSA 2C3JA 4MH7A 1OECA 1F3MC 3ID6C 2RL5A 2Y7JA 4KKHA 4B6LA 3E8EA 4EEVA 2I6LA 4P90A 5IU2A 2JC6A 3FXXA 4FKRA 4MAOA 2NPQA 4ZSGA 2V5QA 3H0ZA 3WE4A 5I9VA 3BHYA 3KMMA 5IQFA 2W9FB 3PUPA 3QQUA 3GXLA 3R21A 4JQ8A 4F9BA 5J9LA 3SOCA 2HZ0A 2XIXA 1SNUA 5CS6A 5DIAA 4D4RA 2WQEA 3LFQA 3D9VA 4QMLA 4JIKA 1KE6A 3O71A 4I5PA 2Q83A 5F1ZA 5C1QB 5HD4A 4YU2A 3UZRA 5IZFA 3AGLA 4I6QA 3TZ7A 3I5ZA 4O2ZA 5FTQA 4EZ7A 4EOKA 5AM7A 1M17A 4EK3A 4BZNA 1Y8YA 5IUGA 4LRMA 2O3PA 2H6DA 4ZIMA 3V8SA 3ENMA 4AA5A 4F09A 3ZC6A 1H1QA 5CAUA 4FV3A 3ZEPA 4YJVA 2YERA 5LVNA 4ASDA 3LCTA 1YI3A 5F4NA 3IGGA 1ZOEA 1FINA 2BDJA 1FGKA 2EXEA 4QP7A 4C57A 4GFOA 5IA3A 4CKRA 2OK1A 4GYGA 1ZYSA 3IW4A 3OP5A 4ANMA 1UA2A 4MXZA 3HYHA 4PTEA 5JRSA 4GK4A 1XBAA 3NNUA 4C8BA 4CFVA 3QFVA 1PRYA 4YJNA 3QA8A 3POZA 4DGOA 4WD5A 4XP0A 2GNHA 3AC1A 5FTOA 4WA9A 3A60A 4XJ0A 4IFCA 3NYXA 4NL0A 3DFCB 3F2RA 4IB0A 2RFEA 4G3GA 3FWQA 4GT4A 2W5HA 3QXOA 4FUXA 4IJ9A 4TNBA 5GZAA 5IA0A 4M15A 1UV5A 4TYHB 4E7WA 5KKRB 4DH8A 1J3HA 3D94A 2BZJA 4X2GA 3C0GA 3EIDA 3LAUA 4YPSA 4DEHA 4ZOGA 4NZWB 1MP8A 4WG3A 4N4SA 3GEQA 3HVCA 2YIWA 5DEWA 4FZFB 4G31A 4NJ3A 5CSWA 5BPYA 1H0VA 4YLKA 4EH2A 5FXQA 4YBJA 4QMNA 4MK0A 3ALOA 3GUBA 5LOHA 3RPYA 2YCQA 5AR8A 1W8CA 2VAGA 1RDQE 3DTWA 4OLIA 4J7BA 1KOBA 3SXSA 3O17A 3KULB 2BR1A 4PRJA 2WMTA 1H1RA 1UU8A 1YVJA 3GC7A 5LMKC 3CKXA 3QQGA 1AD5A 3LCOA 4GK2A 3KXZA 5ETAA 1OPKA 2ETRA 3FI4A 2QKRA 5HU9A 1CMKE 2F4JA 4JBVA 5AAFA 4PL3A 3QUEA 5BYZA 5JKGA 2J5FA 3KA0A 4AE9A 2C6IA 2J51A 5B2LA 3K5VA 3CY2A 4BZOA 4EHEA 5E8ZA 3FXZA 4P4CA 2VO6A 3KRXA 3G51A 3VBXA 3W2PA 3BYMA 4KBKA 2ONLC 5IUIA 4BDAA 4DFYA 4IQ6A 1NA7A 2O65A 1FPUA 4CTCA 3L8SA 3JXWA 1W0XC 1GZNA 4E4NA 3F6XA 5HIBA 4HGSA 4DAWA 3IGOA 3LXLA 5E8YA 3PIXA 1YXSA 2OGVA 2UVYA 3FLZA 3L8VA 3PSDA 2C6MA 2ETMA 1Q3DA 3QTQA 5I9XA 2BTRA 3FZ1A 4IW0A 4PUZA 2ZAZA 2UUEA 3MA6A 3NS9A 4HCVA 3I7BA 1SM2A 3EN4A 3CLYA 5LVPA 3R7UA 5KMLA 5AR5A 1IEPA 2R7IA 4JL9A 2ACXA 2GFCA 4G2FA 3RMFA 3W18A 5IEXA 3BV3A 3QGYA 5I0BA 2CKQA 5D7AA 4MF0A 1JSUA 4NFMA 4ZSAA 4Y95A 4D2VA 5A6NA 2C6EA 1H1PA 2FA2A 3RPOA 3ZLYA 3F69A 4FTMA 3COMA 3FPMA 3AG9A 5ANDA 5GHVA 2ZDUA 4J52A 1M52A 4AW2A 2HXLA 3TUDA 1DM2A 5EYKA 3BQCA 3PZHA 4CQEA 2QCSA 3HZTA 4AGWA 4WNKA 4W9XA 3PLSA 3COIA 4JBQA 2QOOA 2PVKA 2Y6OA 3UE4A 2IZRA 3CP9A 1W84A 4G17A 4LGDA 2X7GA 4U6RA 3MY5A 4E5BA 4MD9E 5IQGA 3F3UA 4OTPA 1Q4LA 3UPXA 2PVNA 3QC9A 4L43A 4NT4A 5KX8A 5J9ZA 4H05A 1WFCA 3PXYA 2OXXA 3FBVA 2C6DA 1JAMA 2Q0NA 5CWZA 4B8LA 4I0TA 3DLSA 1UNGA 4MBJA 4C38A 2PZ5A 2PY3A 4EHGA 3WI6A 4E6DA 1WBPA 3OXZA 3CTQA 4KUJA 4MBIA 2BFXA 4CG9A 3VHEA 3W8QA 4FSRA 4NCTA 3PYYA 1MRUA 3G2FA 3K2LA 5AM6A 5AP7A 3EQFA 3GCVA 4FK3A 3V01A 4AZEA 5B7VA 3A8WA 4HVDA 4FEWA 3RK9A 3QRIA 2LGCA 3KY2A 3P7BA 5KO1A 5E8TA 4KS8A 4IX5A 4BWKA 3ACJA 3UMXA 4E4LA 5J1WA 4IC7A 5FEEA 3A7FA 2OLCA 2XB7A 3KF7A 4JS8A 4RIYA 4O7WA 4XLVA 5AFVA 2FSMX 4ANNA 2UZOA 2FO0A 4FKSA 3RCJA 4C2WA 3AMBA 1HCKA 4FKIA 1Y6BA 3QD4A 4YO4A 5I9YA 2RF9A 2ZV9A 4PDOA 3R00A 4B8MA 5BX0A 4TYEA 3L9LA 3ZFMA 5IISA 4F70A 4KBCA 3MFRA 4XRJA 4Y83A 3KXGA 1L3RE 5KMKA 4L52A 5LVMA 4I1ZA 3OEZA 2OSCA 3R7YA 4QTCA 1PY5A 3D5WA 2ZMDA 5DE2A 1KE7A 2QU6A 4RJ5A 4JOAA 4BCFA 4AN2A 4QMTA 3LFDA 3HP5A 4XHKB 4GUEA 3UZPA 2X9EA 3NYOA 4QP9A 2W1HA 2ZM3A 1URWA 3GCUA 4WHZA 3VS0A 4WOVA 5CAPA 3F3ZA 3EN6A 1H27A 3ZLWA 2XCHA 5BYLA 3FLQA 2XYUA 2BRNA 3KVWA 4J1RA 4EH9A 3VJOA 1V0PA 2G1TA 2YJSA 3QD3A 4KS7A 5BVFA 4ZP5A 5LMAA 4GV1A 1FVRA 2EXCX 3H3CA 2R9SA 4W8EA 3Q53A 5HCZA 3DV3A 5E7RA 2GNFA 3KN6A 2XYNA 3FLYA 1J7LA 4GK3A 4AZSA 2XKCA 3EJ1A 5IPJA 5KMJA 3BYVA 3OFMA 4UMQA 3EOCA 4IVBA 2VTHA 4EKLA 3ZDIA 1MQBA 2VWBA 1YXVA 3HRCA 3S2PA 1FOTA 3LFEA 3O7LD 2WAJA 5H8EA 3NIEA 3L9NA 4OBQA 4FTUA 5KE0A 1J91A 4BWPA 4NTTA 3GU8A 2AC5A 2WQMA 3NNWA 2DQ7X 4FZDB 3S0OA 3ET7A 4JRNA 2WTKC 3G15A 3LJ0A 3BZ3A 3MH0A 5DFPA 3NDMA 1SVEA 3RHXA 4GU6A 3UQFA 1DAYA 2GPHA 3ZUTA 1OPJA 1JSVA 4F64A 1PHKA 2YDJA 3ZZEA 4RZVA 3KRRA 4I23A 4JQ7A 2A4LA 2R3LA 3QKKA 4K9YA 4R1YA 3PVGA 4IANA 4ZMEA 3A8XA 3M42A 3PSBA 5CI6A 3CSVA 2P2HA 4PV0A 2HXQA 1AGWA 4IADA 3E8CA 3Q9YA 3R9HA 3ZM9A 3TV4A 1ZZLA 2XIYA 5D1JA 4YBKA 4YR8A 1M7NA 3NUAA 5HQ0A 4DFUA 3ZUUA 4MD8E 5AP4A 4LV5A 5GZ8A 4GKIA 3FJQE 4NWMA 3ZCLA 2YIXA 4ALWA 5AP6A 4M69B 3Q52A 3QQJA 4KIOA 4EZ3A 5CENA 4BFMA 4D0XA 1OM1A 2WQOA 5HORA 4D5HA 2PUUA 3CJGA 3DKCA 4NKAA 1MQ4A 1JNKA 3FKOA 4W4VA 5DT4A 4AZTA 2WTCA 3ZO1A 4R77A 4C36A 4EH6A 2YM8A 4M66A 4O2PA 4IAAA 3S95A 4DT9A 4IVCA 4BI0A 4LUDA 5H8GA 2VO3A 4UXLA 4WRSA 3SLSA 4CCUA 4E1ZA 1KWPA 2VTOA 4IHPA 4IAFA 5AR2A 1Q8UA 4FKUA 5LMKA 1H07A 4QMPA 5AX9A 2XA4A 3NCGA 4DFLA 3SG9A 3F5UA 1REKA 5A4CA 2QVSE 4DBXA 5BUJA 4CMTA 4EUUA 3TJCA 3O51A 5AEPA 3AQVA 4U40A 4MX9A 5HNGA 3RTPA 2PZIA 3ETAA 4PX6A 4G16A 3PDTA 2W1EA 3PXQA 3NW6A 3UVPA 2B53A 3POOA 3DB6A 4XCUA 5C03A 4NW6A 4YHFA 3V5LA 3TV6A 1UU7A 3RVGA 4AZFA 2Y4IB 1YDTE 4RIOA 5G1XA 2XEZA 3HV5A 3DDQA 2UW9A 3GU5A 3RALA 3VQUA 3VBTA 2PVLA 3R63A 3EFKA 5IEVA 4E4MA 4C4JA 3ERKA 3CC6A 4GIIA 4G9RA 5HG7A 2W7XA 5CT0A 4DC2A 2A2AA 2R3GA 3ORTA 4IX4A 4QTDA 5CTPA 3VS2A 4X2KA 4M0YA 4BGHA 2UW3A 2XH5A 1JKLA 3QKLA 4IWOA 2BZHB 1X8BA 4ZTSA 3ZOSA 3PP0A 4HCTA 4LRJA 4MBLA 4G3DA 4YTHA 5AUZA 2IW9A 3FLWA 1JOWB 2GFSA 4QMWA 1Y8GA 4QP2A 2NO3A 3LQ8A 4QO9A 4BDCA 1M2RA 5HX6A 4D1XA 3C51A 3EL8A 4BDGA 2R3MA 3H30A 2C5VA 2HWOA 4O7LA 2PMIA 2FGIA 4S30A 1XBCA 2F57A 5DT0A 3WE8A 4AOJA 5IQIA 1UNLA 2BMCA 3IONA 5HX8A 1JKKA 2C69A 4CFUA 2G2HA 5IQCA 3Q4UA 4IAYA 1JLUE 3V3VA 4M84A 5B2KA 2X0GA 3DK7A 1UVRA 5BMSA 3I0OA 2OJJA 4RC3A 5HE1A 3W2RA 1G8SA 5M55A 4MTAA 3QCXA 5DMZA 3WZJA 1ERKA 2OBJA 2RSVA 3EQPA 2PVJA 2BROA 4FV7A 4IWQA 3VBVA 5AADA 1YWRA 3P79A 5L2SA 4JXFA 4RZWA 4M7IA 3KC3A 4ANSA 4CLJA 4MXAA 4AXAA 2QOKA 3P23A 3D5XA 3QAME 5AUWA 4AW5A 4FI1A 5IG1A 5CEIA 2EXMA 5HE3A 4U44A 4JDIA 4TYIA 3U9CA 2IVTA 2R3OA 4BI1A 3L8PA 4F1TA 1XH8A 3MESA 1I44A 2C47A 3IK3A 4WUNA 5M07A 3QYZA 5IH4A 4BGQA 3HMMA 3PG3A 2OICA 3FEGA 3R9RA 5CSHA 3BHHA 2X39A 1PKGA 4HGEA 3K54A 5D9HA 3RBWA 3R9NA 4O6LA 3RHKA 4O82A 3PJ1A 4FMQA 4GG7A 4J53A 4CYIA 2X2LA 3KVXA 4KB8A 4M8TA 4AF3A 5CYIA 4ENYA 4KABA 2JIVA 4I6BA 4KIQA 3DBCA 5GJGA 3EHAA 2G9XA 4FKQA 2P55A 4XBRA 1B39A 3A61A 2HENA 2B4SB 3QALE 4NIFA 5JFWA 4L68A 2V7OA 3NWWA 2UZTA 3EH9A 4BIDA 5CNNA 2J2IB 3WF7A 1U54A 4R7BA 1H8FA 1M7QA 5K9IA 5C8MA 1LR4A 3S3IA 3W10A 2VGPA 5A4TA 5AR3A 4I94A 2YIQA 4BBFA 1KV2A 3I4BA 2BZKB 3QQHA 4YC3A 2P2IA 4EWQA 4FA2A 3CGFA 3EQCA 1OKZA 2BPMA 2QU5A 4WRGA 2OZAA 3EB0A 4MCVA 3AT3A 4M12A 3V8TA 2NRYA 5J5SA 5E8VA 4ACMA 2R3FA 3KXMA 4ITJA 4QMMA 4BCJA 4C35A 1YKRA 2VTQA 3MI9A 4BR3A 3LXPA 1MRYA 4CRLA 2XK7A 3QTWA 4AACA 5CX9A 3E63A 2QONA 4KSPA 4R6VA 3LFFA 3NLBA 4AZVA 4HVIA 4UEUA 3VW6A 2J0LA 2VN9A 1MUOA 2CJMA 2YABA 1OBDA 3OWLA 5CEQA 1H01A 1YOJA 4QYEA 3ATSA 4DTBA 3R9OA 5D11A 3II5A 4NJDA 5H9BA 4C4IA 1BYGA 1A06A 1XH5A 2GQGA 4LOOA 3DJ7A 2XKEA 2HIWA 3ACKA 4FZAB 4QTBA 3JVRA 4ZTNA 4FBXA 5K5NA 1IASA 3R8PA 2PZRA 1R1WA 4DFNA 2HAKA 2UW8A 4LFIA 4N6YA 5BVNA 4XG6A 5C4LA 3HKOA 4J99A 4O0VA 3EZVA 3Q3BA 3FC1X 2WMQA 4U5JA 3BGPA 4TT7A 3QCQA 3LKMA 5DH3A 3W16A 2XNNA 1MRVA 3D83A 4FVPA 4QNYA 5EH0A 4WNPA 2GHLA 4X7QA 2UW5A 3SD0A 1M14A 2ITXA 3UG1A 3SA0A 4O86A 1QPDA 2CNVA 2PTKA 4H3QA 4HPUE 4BCKA 4EOMA 5CF6A 4XG8A 4R8QA 2ZDTA 1UWHA 2EWAA 3E3PA 4AOIA 3UVRA 3D2IA 2KULA 4ZTLA 3LCKA 3Q2JA 1XHAA 1W83A 5E4HA 4QP6A 4F7SA 2YEXA 2WD1A 2B9HA 4G6OA 4YNOA 3ZBFA 1KE5A 3PA5A 4ASEA 5ANGA 5EOLA 4EQCA 3KGAA 3SRVA 4B9DA 1Y57A 4KRCA 2G2IA 1ZYJA 2YLEA 5AR4A 4YURA 3OT3A 3K3IA 4BCMA 4ZLOA 3HV7A 4KRDA 3O50A 4CV9A 3UQGA 3OXIA 4D28A 4YJRA 4N6ZA 2E2BA 4BCHA 1OGUA 4XH6A 2VWVA 4RMZA 3OOMA 2PVMA 4O81A 2YAKA 2WB8A 4Y72A 3U87A 4Z3VA 2Z7LA 3K5UA 3TI1A 4LL5A 1O6YA 1R78A 5LCKA 1OUYA 3HP2A 2Z60A 5L2IA 3BIZA 1NT2A 3TIYA 1GAGA 4WSYA 1NW1A 2R3NA 2XNGA 3SW7A 2IVVA 4A7CA 1APME 2I40A 2Y6MA 3HMOA 3BBTB 3GFEA 3TNWA 4YHTA 2GS7A 4AS0A 5JK3A 2UZUE 5LJJA 3H4JA 3N51A 4F9AA 5M51A 5JQ8A 4XBUA 4RIXB 4MXXA 2C5OA 5AUTA 5KBRA 4FV1A 2HY0A 3MPAA 3ROCA 3C5UA 4BYIA 1DAWA 4OR5A 5EI8A 4ACGA 5HNIX 3I0QA 2OU7A 4CGAA 5L3AA 3LQ3A 5JGBA 2JDRA 3UOJA 2OFVA 3S00A 4O0TA 3T3VA 3DZQA 4PWNA 4IVAA 3QHRA 1FVVA 2VTMA 4O91A 3BE9A 1Q8TA 2X81A 4FSQA 1O9UA 3HLLA 3E92A 3DFAA 4YC8A 5BUEA 3OMVA 4QQTA 4LOPA 2C3LA 2ITPA 3GCPA 1Q3WA 4Y5HA 4RRVA 3LFAA 3RKBA 3UZTA 4GKHA 4HYSA 4L00A 2RFDA 5F20A 2OJGA 3BEGA 4D2SA 5E8WA 3R8UA 4QQCA 4U7ZA 3FZOA 5JFVA 5J9YA 3FMKA 5AX3A 3OBJA 3CCNA 4BHNA 3G0EA 4KINA 4FE2A 4OTFA 5CNOA 5EKNA 3DU8A 4KKGA 5F95A 5C27A 4A4OA 3EFJA 4TRLA 3PXKA 3R7EA 5H3QA 3QQFA 3OCSA 1ZXEA 4RA5A 3QZFA 4RX9A 4F9WA 3E64A 4MXOA 4ANBA 4IAZA 3BKBA 3PXRA 1OITA 5ETIA 4AGDA 3D4QA 3L9PA 3UDBA 3TG1A 3DBQA 3BGQA 3MS9A 4O96A 5ANOA 3UIMA 2QNJA 4FK6A 3D5UA 2I7QA 4JG8A 5EW9A 2CGWA 2I0YA 3W1FA 4L3LA 5HO8A 2PUIA 5EDQA 3EKNA 4F6UA 4MNFA 1J1CA 3T9TA 3EQGA 5KZ0A 4GL9A 3PJ2A 5BMMA 5FXRA 3GU7A 1YRPA 2X8IA 4FTTA 4QOXA 3OW4A 4DLJA 2C3IB 1XJDA 4LM5A 4A9YA 4C3RA 4FEXA 1KOAA 2R3HA 4H1JA 4ERWA 4ITIA 4CMUA 3PWDA 4G9CA 1ZMWA 4IM2A 4DTAA 2C0IA 4IIRA 3LIJA 4NKSA 2BRBA 4V0GA 3A7IA 4KIKB 3FQEA 3D7TB 4D9TA 4FEUA 5E92A 4U41A 4Z16A 3Q9ZA 4WBBB 4FSTA 2PMOX 5B2MA 5CEKA 4E73A 5K4JA 5CU2A 5D7VA 3KULA 3QLFA 4BKZA 4J97A 4F0IA 4ASZA 1ATPE 4K18A 2FVDA 3ZRMA 4OTGA 5DT3A 3FLNC 5CF8A 1OIUA 2HOGA 4M14A 1GIJA 2VTIA 5HKMA 3Q96A 3OCTA 4DEBA 4YTCA 3ZO3A 1P4FA 4FOCA 4BVUA 4G5JA 3DXQA 5EM5A 3S1HA 3TUCA 1Z5MA 1BX6A 3H9FA 4R3RA 3NSZA 2X2MA 1WVWA 5CEPA 5L2WA 4UYNA 3CEKA 2OO8X 1Z9XA 2FB8A 3NX8A 4TYGA 2C6OA 1YHSA 4FIEA 2X7FA 4IX6A 3L1SA 4PMMA 5LVOA 5IA4A 3TUBA 3SV0A 4M13A 4K8AA 2ERZE 1Q62A 4YSMA 4ERKA 5JFSA 1UU3A 3B2WA 3M2WA 3OTUA 4XG7A 4AN3A 3PWYA 5GZ9A 2GNGA 4FTAA 4G3CA 1JSTA 3QLGA 3LVPA 4MWIA 4Q9ZA 4FSWA 1W82A 5CSXA 1DS5A 3CIKA 3SX9A 1RW8A 1BUHA 5CU4A 2CLXA 1CKJA 2B9IA 4J96A 2W96B 3MVMA 5FG8A 3UTOA 3VS5A 4HVGA 2JITA 4F0FA 4UMTA 3ZRKA 1PJKA 3F61A 3HAVA 4FV2A 5FM2A 4O0UA 4Q2AA 4FSMA 2BIYA 3V6SA 4HVSA 4RLLA 5EYDA 4FTOA 2GDOA 4NM7A 3PG1A 2VO7A 4TYJA 2FSLX 3BPRA 1HOWA 3BEAA 2DUVA 1ZY5A 3V5JA 3EQBA 4G34A 4I93A 3AOXA 2W1ZA 2ITQA 3GC0A 3OS3A 4Q9SA 3OZ6A 3EN9A 4FTQA 1XH7A 4GVAA 5TR6A 1ZMVA 2YN8A 1BI7A 3EN7A 4MQ1A 5AUVA 4AT4A 4FIHA 1PXMA 4R5SA 3CQEA 3I5NA 2E9PA 3C4WA 3QGWA 4IWDA 4GIHA 4RIWA 4II5A 3SAYA 3QF9A 4QNAA 3UC4A 4FV6A 4JI9A 2F7XE 2J50A 2OF4A 3JYAA 4I6HA 4LOQA 4RGJA 4RSSA 3VWAA 3UQCA 1G8AA 3CXWA 4L6QA 1RJBA 3U6IA 3F5GA 3PE2A 2AYPA 2YCRA 3VF8A 4YP8A 3MFSA 4FYOA 4DGMA 3F7ZA 5AV0A 4UZHA 3TDWA 1ZOGA 5KHXA 3IQ7A 4QRCA 2BAQA 4HVHA 2H96A 3VRYA 5FWKK 3MB6A 4LRKA 3G9NA 4FKPA 3ZU7A 4OGRA 3BE2A 1UKIA 4QD6A 4BDBA 4ZK5A 4X3FC 1S9IA 4DEEA 4KBAA 4ZEGA 2WTWA 2IJMA 4OTQA 1CKPA 1NXKA 3NVKI 5KCVA 3QUDA 3BLRA 2HW7A 3NAXA 4GVJA 4BDFA 3AC3A 3O23A 5EW3A 3UP2A 3FXWA 2JFMA 3BRBA 4PL4A 1H1SA 5HG8A 3A7HA 5DGZA 3UOHA 5HLPA 2XIZA 3VS6A 3O7LB 1YI4A 3WBLA 2H8HA 2W4JA 3MJ1A 3H9RA 3A99A 4GMYA 4WT6A 4EOLA 2XRUA 1JKTA 3ORLA 4NU1A 2HYYA 2UVZA 4C2VA 3GC9A 3OEFX 4BDEA 3I60A 5DI1A 3FSFA 2YJRA 3FL4A 4AW0A 3KXXA 2J7TA 4FKGA 5D10A 3AMYA 1PYEA 4FKOA 1ZZ2A 2J0IA 3DTCA 3TL8A 3ORXA 3W2OA 5AR7A 2ITOA 2PULA 4TTHB 3CY3A 3U51A 4AX8A 1ZOHA 5J8IA 2WMAA 5CU6A 5ANEA 3OCBA 4FEQA 4JQEA 4EOOA 2PPQA 2PHKA 4A9RA 3FDNA 5JT2A 4KWPA 1K9AA 5HU3A 1PXOA 4AT3A 2IVSA 2BIKB 4E6CA 4IC8A 5IQHA 5GINE 4FYNA 2WMXA 2VRXA 2E9UA 3OWKA 3VS3A 4I21A 3UG2A 3NUXA 4QMQA 5LVLA 2HK5A 2ITTA 2XNBA 5AV3A 5HNBA 2X6EA 3NNXA 3FZRA 5M09A 3DXNA 5HESA 3FL5A 4DLIA 3MH3A 4U9AA 3IDBA 4D4YA 3AXWA 4A9SA 1QPCA 4FR4A 3VO3A 2VTNA 4GJ2A 2YHVA 2PUPA 2GQRA 2BDFA 1PXIA 4EJNA 2JEDA 2RKUA 1OL6A 3HECA 2QD9A 4F1OA 5DPVA 4Y73A 1SYKA 4AA0A 4UV0A 5I5ZA 3G0FA 5HG9A 3U9NA 4GFMA 1OKWA 3R6XA 4JT3A 4QPAA 3UIUA 1XKKA 2P33A 3M11A 3Q04A 2YM4A 4F7JA 2VTRA 2PE0A 5C9CA 3WZKA 3F3WA 1UNHA 3R28A 4J8MA 2WIHA 4QYFA 5FM3A 3TTIA 2PE1A 3ZC5A 4DH7A 2WMWA 3QRUA 5HD7A 4RFYA 5AP0A 4N70A 4U8ZA 5CQUA 4F99A 3DLZA 4ANOA 3NMUF 2QQ7A 1XH9A 2B1PA 3EQHA 4IAIA 3HL7A 3MGYA 4EH8A 4FUYA 3WF5A 2J0JA 4X3JA 1OKVA 5FBNC 4FG7A 2DYLA 2GQSA 2WMRA 4O1OA 5A9UA 2QOIA 4J8NA 4DEDA 3R9DA 2YWVA 2VTPA 5A14A 3C4ZA 2JIIA 3VUDA 1OIQA 3HUCA 3VUTA 2O0UA 4BL1A 5KMOA 3RZFA 4ORKA 4WNMA 4V01A 4FIGA 3EFLA 4RC4A 5M4IA 1OMWA 5JZNA 3I81A 3PY0A 3D7ZA 2QOQA 2PL0A 3KRWA 5AUXA 1WAKA 3FUPA 1U59A 3MJ2A 4AU8A 2P3GX 2C5YA 5CZHA 5HE0A 3FKNA 4LMUA 2Y0AA 3VBYA 1ZWSA 3DA6A 4O84A 4IVDA 3KFAA 1BKXA 1P2AA 3VF9A 3R02A 3COHA 3UO6A 4EHZA 4RJ3A 2OKRA 4CFFA 3ZTXA 5L6OA 3D5VA 2CHLA 4YJUA 4FGBA 2BVAA 1NVQA 3HNGA 1O6KA 4MNEA 3F88A 5FLFA 4BY9E 4XP3A 4TWNA 4HYIA 4FF8A 2XBJA 4DGLC 3QTUA 2WFYA 3MVHA 1CTPE 4H3BA 3G9LX 4L7SA 2V0DA 2V7AA 5AJQA 5AP2A 4C62A 4ZXTA 3F3VA 4YZBA 1LPUA 4I0RA 3MTFA 4ANLA 4O21A 4RJ8A 2ZM4A 5CEMA 3RGFA 2CGUA 3UVQA 1W98A 3ANRA 4XG2A 4JDJA 3AGMA 4EONA 2F7EE 2A1AB 3MSSA 5E8XA 3QRJA 4NEUA 4IXPA 3FI3A 2ITNA 5A4EA 4QT1A 1L8TA 4EORA 4ZSEA 4AW1A 4LYNA 3DY7A 3V6RA 5E8SA 2GCDA 4H3PA 3PA3A 4EOSA 4BDIA 2C30A 3KREA 3LMHA 4U3YA 3TZ8A 2BKKA 3ORKA 2ZJWA 1OL1A 4BCGA 3V5WA 2GNIA 4RIYB 2PWLA 2IZUA 4KSQA 2JDVA 4NUSA 1WCCA 3DXPA 2J0KA 5LMBA 2QOBA 4EI4A 4XYFA 1O6LA 3F5PA 2PZPA 5J79A 5DG5A 5FBOA 3G33A 4BBEA 1PMVA 4FSZA 4RWKA 3FYJX 2ZV8A 2ITVA 3ZBXA 3PRIA 4X6RA 2Z2WA 1PXPA 2IW6A 2O63A 2BHEA 2OIBA 3Q5ZA 5CT7A 4YLJA 4JRVA 3E8DA 1WBOA 5EKOA 1ZARA 3Q60A 3VS4A 3U6HA 2ZB0A 4D1SA 3VVHA 4NM5A 4TL0A 5A3XA 3PTGA 2G2FA 3OROA 4FNWA 4I5CA 4JJRA 5CALA 4BIEA 4W9WA 5KBQA 3FI2A 2PMLX 3QCSA 5GJDA 4F6SA 5F9EA 3ROYA 3DK6A 3HX4A 1OL5A 3I7CA 4QTAA 3NGAA 3LM5A 3FPQA 2JBPA 5M4CA 1H24A 3W32A 3HMIA 3OW3A 2I0HA 3DNDA 3P9JA 4KIPA 4CCBA 5DHJA 3V8WA 4ID7A 5BUIA 4PP9A 5CZIA 1GZOA 3EYGA 4RG0A 4M67A 3HUBA 2EUFB 2VWZA 1RE8A 3FMLA 1ZYCA 3MVJA 4R5YA 4X3FA 3JUHA 4DFZE 4DG3E 2HZ4A 4USFA 3GOKA 4MD7E 4APCA 4QMSA 3DCVA 1R39A 1IG1A 3TACA 4U45A 4ZS4A 4OBPA 2FUMA 3A2CA 4GG5A 4XG9A 5D12A 3ZS5A 5IMEA 1WZYA 2ETKA 4ZY5A 4BBMA 5A46A 2WOTA 4FIIA 1H00A 4EH7A 4CRSA 5EM8A 1PMUA 4YZ9A 1S9JA 5IEYA 4Z55A 3GFWA 4IZYA 2OJ9A 4EOPA 4H36A 1UWJA 2VWWA 3AMAA 2YACA 5JMSA 4GUBA 1STCE 4ANQA 2V62A 2YFXA 3R71A 3SW4A 3BYUA 4AFJA 2R3PA 2YWPA 4K2RA 3C1XA 2WELA 3VUKA 3NVMB 4DE4A 3KCKA 4W4WA 4F9CA 5KMIA 2VTSA 2RIOA 4FV8A 1P14A 2W4KA 2PVYA 1JBPE 4GW8A 2CMWA 5T3QA 5HBJA 2CGVA 2J6MA 5IA1A 3ZMMA 3LJ1A 4FNZA 1U5QA 4FKJA 3NAYA 4XOZA 3HV6A 3MH1A 3O0GA 4L01A 4XNEA 3ZLXA 3ZO4A 2F2CB 2BILB 2XM8A 3DK3A 4C33A 4Z7GA 3LE6A 4HGTA 3ZEWA 5BVKA 3PVUA 4DEIA 4S32A 3BELA 2GS2A 2YLFA 3LQ5A 2XNOA 3CPCA 1PF8A 3OG7A 4JX7A 2XF0A 5L6WL 1QPEA 2C6KA 3D0EA 4QMOA 3NW5A 4K11A 4EH3A 2XNPA 4L7FA 4MF1A 4ZAUA 2WOUA 4LL0A 3NRMA 4U80A 2IZSA 3PJ3A 3Q4TA 4EOJA 1OKYA 4L3JA 4PPAA 4O7SA 5IQAA 3RJCA 2VZ6A 3NUUA 3MDYA 3P7AA 4AUAA 5HIEA 2YIRA 4YJPA 3MBLA 3BHUA 4C3FA 2VX1A 5FDPA 5K4IA 4UX9A 1F0QA 3R2YA 4QPMA 4YC6A 2WTVA 4RT7A 4ZSJA 2R3RA 3ORZA 3IOKA 3UYSA 5EHOA 1BL7A 4FV9A 2VUWA 3RM7A 1VYZA 3HA8A 3GCSA 4BKJA 2CNUA 4KAOA 4YNEA 4O22A 2V22A 3TEIA 5HVYA 4C4EA 4O7RA 4X21A 4UZDA 4BGGA 3KMUA 3TNIA 1OBGA 3KF4A 5EDRA 5HLNA 3IKAA 5EG3A 1OIRA 4JBOA 4CXAA 2WQNA 2I0EA 2OJIA 5BVOA 5EYMA 4G6LA 1URCA 3A7JA 4O0RA 2CNQA 4M0ZA 2Y4PA 3PVWA 4GS6A 4FVQA 5AP3A 3AT4A 4ITHA 1GY3A 5CVGA 4C4FA 3PZEA 4EK5A 5HG5A 4J95A 3Q5IA 2WIPA 3PXFA 4MVFA 2QO2A 4RWIA 2CLQA 4C7TA 3G6GA 4PNKA 4ZMFA 5D41A 5IDPA 4CSVA 5K0XA 4XX9A 2C6LA 3R1NA 3Q4CA 4BRXA 4O6EA 5DR2A 3MIAA 4I22A 5AP5A 3GQIA 3QXPA 5JGAA 5L2QA 4ACHA 1IRKA 3CTJA 1I09A 3CPBA 4RBLA 4L67A 3QU0A 1SNXA 2WQBA 1WBWA 5AV4A 1LUFA 4OUCA 4QMZA 4EHVA 2JKKA 4B0GA 4AGCA 1GZKA 5LXMA 3Q32A 1OUKA 3EZRA 2WTIA 4FTRA 4PTGA 4WUAA 1RQQA 4YSJA 3C4CA 3E7OA 5EI6A 2PMNX 3ZLSA 3QCYA 2UZVA 3HDNA 4D1ZA 3UNKA 5GJFA 3EMGA 3Q2MA 3BU6A 1YQJA 3SG8A 2W4OA 4RA4A 4G6NA 3OC1A 3MPMA 3FMHA 2QLUA 1ZYDA 2UVXA 4FT0A 3NUPA 3FY2A 3O2MA 5L8LA 1XWSA 5EHYA 4WSQA 5CEOA 3HEGA 3MYGA 3MY0A 4Z9LA 5J7HA 4CT2A 3GOPA 3B2TA 4QYHA 5KZIA 1CDKA 5DOSA 2W0JA 3SKCA 3QTZA 5CY3A 4E6QA 5C4KA 4QMUA 2WMBA 5M57A 4O7TA 3FMDA 2BFYA 3QKMA 4E5WA 5I9WA 2C68A 5JSMA 3WZEA 3PPKA 4QMXA 1FMKA 5A4LA 4DA5A 4E26A 1F5QA 2WXVA 5J1VA 3UNJA 3LHJA 3CJFA 3NUYA 4O7VA 4OTWA 4UALA 3LJ2A 2GSFA 5EQYA 2LAVA 3FMNA 1R3CA 4YLLA 2A27A 3L9MA 2QOLA 3S4QA 3Q4ZA 3TKHA 4ZTMA 3LFBA 2XKDA 4DH3A 4NIFB 4FT5A 3JVSA 4A4LA 1Q24A 5FRIA 2IPXA 3R1YA 5K3YA 4O38A 2UW0A 5E1SA 1Q5KA 5BQ0A 3AT2A 1U54B 4QMYA 3R8LA 3OF0A 5JGDA 3GENA 5M53A 4ZZOA 4HPTE 2OZAB 4FC0A 4DT8A 2CN5A 4HCUA 2C5XA 4MXYA 4G5PA 1IAJA 5JZJA 3TWJA 4EK8A 4YGAA 2E9NA 4I5HA 3UNZA 2BAKA 3BGZA 3A62A 2OF2A 4P2KA 2J9MA 2QC6A 2R3QA 3DQXA 5AA9A 1BL6A 3BHVA 3KXHA 4XS2A 3AD5A 5CVFA 5EM6A 4U42A 4KIKA 3R7OA 5ICPA 3H9OA 4P7EA 3N4TA 3E5AA 5C01A 1ZAOA 2Q0BA 4U43A 2H9VA 5GIPE 3ZYAA 2XK6A 2WU7A 3WARA 4Z7HA 3NZ0A 5I4NA 3OXTA 3U55A 3QTXA 4RX8A 4CYJA 3PIZA 4IAKA 5A4QA 4YHJA 4TWPA 2GTNA 2WZJA 3CKWA 4HZRA 3LM0A 5HGIA 2E9VA 4EKKA 4DCEA 2ITYA 4DITA 3R7VA 3LMIA 4K77A 4I5MA 2XK8A 3V04A 3PLAE 2CKOA 3ORNA 3FSKA 1J7IA 4W4XA 3ZXTA 4AZWA 3QD0A 3AC2A 3PSCA 5L4QA 4PNIA 3TDVA 3MN3A 2VWYA 3DQWA 4WKQA 3ZRLA 4YZDA 5CAOA 2WTKB 3CGOA 2REIA 2O2UA 3IW8A 2R5TA 5LARA 3PP1A 4R3PA 4PPCA 4ACCA 3LXKA 3UC3A 3V51A 3VRZA 4PQNA 3VJNA 4XOYA 4EQUA 3KKVA 4HOKA 1Q8ZA 2VWIA 1CKIA 4HZSA 5HVKA 4YO6A 4E8AA 2CDZA 2UZEA 4DHFA 4BDJA 2IW8A 5FXSA 3ZSHA 3FZPA 3C7QA 3T9IA 2Z02A 2WNTA 3SRVB 4MHAA 4G3EA 1QPJA 2X4FA 1NVSA 2PVHA 2ZM1A 3E62A 4NFNA 2PE2A 4K0YA 4TYHA 1PMNA 5DA3A 2ZMCA 5HCYA 4EZ5A 1IA9A 4CD0A 4FV5A 4BTMA 2X7OA 3HRBA 4OAVB 4KA3A 2VV9A 3V5TA 2CGXA 1UU9A 2YM7A 1B38A 4S2ZA 2W1IA 4KD1A 3W55A 3RWPA 4CZUA 4QPSA 2XRWA 4TZRA 2HCKA 2XIRA 3OD6X 4PDPA 4HNFA 1GIHA 4EOIA 4RVMA 4YZMA 3QHWA 5T68A 3ZFXA 5L6PA 4JDKA 4L44A 3RWQA 3D14A 5G6VA 4DEGA 2Z7SA 4O0XA 2I1MA 3NEWA 4FSNA 4RLKA 5DBXA 2CCIA 3TNHA 5AA8A 1QL6A 3GU6A 2PUNA 4R7IA 4FV0A 4BKYA 1PXKA 2WKMA 1CSNA 2XVDA 3LLTA 4JLCA 4NW5A 3RI1A 3TN8A 3TNQB 3W2QA 2QKWB 2C5NA 2GNLA 2XBAA 4A4XA 3OVVA 4EK4A 4YZCA 2R7BA 4EQMA 2HWPA 5EFQA 3ORMA 3C0IA 4FNXA 2ZYBA 2C0TA 2RFSA 2ZB1A 4MWHA 1PW2A 1PXJA 1Q8WA 2BDWA 4DG2E 2Y4IC 3W8LA 3NUNA 3C5IA 4RC2A 3ELJA 3GT8A 2HZNA 3EQIA 2Z7QA 3R22A 3QYWA 3A4PA 4FNYA 3VC4A 5JN2A 3QRTA 4G1WA 3P78A 4GCJA 4KKEA 4Y5QA 4BTKA 4D5KA 5AP1A 5FDXA 4U3ZA 2UW6A 3AC4A 5IA2A 5I9ZA 1H28A 4QTEA 5JRQA 3SGCA 4XV2A 3VQHA 5I3RA 5HE2A 3QZIA 3RAHA 3SOAA 4FX3A 2VNYA 2XM9A 3FKLA 5JFXA 2B54A 3UP7A 4RVKA 3O96A 2XMYA 5TE0A 3ZO2A 1GZ8A 2BRMA 4X2FA 1QCFA 1U5RA 4GH2A 4EWHA 1IAHA 4M68A 2BRGA 4IB5A 3O8TA 4QQ5A 4FTJA 2WU6A 4O7NA 2A0CX 2BZIB 3TCPA 1YWVA 4IDVA 3DPKA 1E9HA 3M1SA 3F2NA 4IE9A 1T45A 2FSTX 2XK9A 3C9WA 4YTIA 2IVUA 4NM0A 3VS1A 4UXQA 4X6QC 3DS6A 4FT3A 4GYIA 3OUKA 4R3CA 1H0WA 5I9UA 2PZYA 4U97A 2P0CA 1PXLA 2V55A 4F63A 5J87A 3U54A 4IZ7A 3QD2B 4QP1A 3ZHPC 4AQCA 3R2BA 4F4PA 1JPAA 3BHTA 4QP4A 4RX5A 2OG8A 2XNMA 2XUUA 2EB2A 2VO0A 3R7IA 2QG5A 5HBEA 4PY1A 2FYSA 4N0SA 4ZY4A 5E9EA 1YHWA 4L42A 4BCNA 2GMXA 3LW0A 3DBFA 2JAVA 3GBZA 3NIZA 3OUNB 5CVHA 5CF4A 5KUPA 2OW3A 3TNPC 2YZAA 3FHRA 4DYMA 4E20A 3VUMA 1H1WA 2YA9A 4I3ZA 3MFUA 3THBA 4ALVA 5LWMA 4HYUA 4LG4A 4RFMA 2QLQA 4FL3A 2XJ0A 2RFNA 3G5DA 2IO6A 2O64A 3GGFA 3OWJA 3Q6WA 1XR1A 5GNKA 4AWIA 3LFSA 3GQLA 4UWCA 2PU8A 4UMRA 3P08A 4HNIA 3KCFA 3UYTA 3FZSA 4LMNA 4OTDA 4V0GB 4YJTA 3U4WA 4P5QA 3QTRA 1W7HA 2WPAA 4ZJJA 3VHKA 3QBNA 1YI6A 4FZ6A 4IZAA 4RJ6A 4C37A 3UPZA 3HRFA 4QP8A 4FV4A 4TKSA 3FE3A 2W1DA 5M4FA 3C0HA 4UMUA 4DCAA 3R1SA 4BN1A 4EK6A 4AFEA 1E1XA 5BVWA 1WVYA 4RJ7A 3G6HA 3PIYA 3BLHA 3CR0A 5DR9A 3MV5A 1M2QA 3MVLA 3B8RA 3RINA 1ZLTA 4JBPA 2B52A 4PDSA 2JAMA 2OJFE 1CM8A 2I0VA 3VUIA 4O83A 4C61A 5CLPA 4R78A 1J7UA 3BU3A 4F7NA 3R8VA 1G5SA 2VTJA 3WF8A 5M06A 4CTBA 2W1GA 3QWKA 1LEZA 5L2TA 4CZYB 2RGPA 3I6UA 4FTIA 2OZOA 2X1NA 2XK4A 3E7VA 3P7CA 3F2AA 1OL2A 1V1KA 2C1BA 4JVGA 4LGGA 3P0MA 4PL5A 2F49A 4PTCA 3GC8A 3E8NA 2A19B 3FMMA 3TKIA 4YPDA 1FMOE 3UOLA 4EBVA 1R0PA 4N57A 3QL8A 3DZOA 5DRDA 1BMKA 3MH2A 4BTFA 4CV8A 5LCJA 4ZTRA 3GCQA 2ERKA 4EYMA 3BQRA 1Q41A 4RPVA 4GSBA 1M2PA 4X2JA 4D2RA 1YXTA 2AC3A 2WHBA 3IG7A 3MPTA 5ACBC 2VTLA 3FMJA 4R7HA 3COKA 4H1MA 4YJSA 3TIZA 4CFXA 5HICA 3FLSA 3DAEA 4RJ4A 4TY1A 4LQMA 3WILA 1SVHA 2QOCA 3DKFA 4JX3A 4AAAA 1GJOA 4ZZNA 3HV3A 3EWHA 3LOKA 3ZXZA 1WBNA 3T3UA 1U46A 3EFWA 4ZSLA 2YM5A 4C59A 4MYGA 5C8KA 5BNJA 1E1VA 4ZZMA 1WBVA 3BCEA 5AUUA 3HV4A 4Y8DA 4IB1A 4EOQA 5TF9A 1GNGA 2JIUA 3BU5A 3UMWA 1YDRE 3U6JA 1OZ1A 4RQVA 3KEXA 5L8JA 4RIWB 4FKWA 2JDSA 3MWUA 3FI8A 4NTSA 4MQ2A 2ZV7A 4UYAA 2CN8A 3VBWA 3F3TA 4DTKA 3W33A 4HGLA 3CS9A 3DKGA 3F5XA 2R64A 2ZOQA 3ZSIA 3QWJA 5IF1A 2R4BA 1H25A 2YISA 4YZNA 3R1QA 4ENXA 4K1BA 3R83A 1BLXA 2H34A 5EOBA 1VZOA 1ZMUA 4OTHA 1YOLA 4CNHA 3IW6A 1H08A 3H0YA 4HYHA 2IZTA 4I6FA 1H4LA 4ARKA 2C6TA 2PVFA 5HZNA 3IECA 4I24A 4P5ZA 4XUFA 2XCKA 4EH5A 2XK3A 1Q97A 4MEDA 4M69A 3VIDA 3R04A 5AAEA 2ESMA 5HVJA 3CBLA 4BWXA 1IA8A 3NW7A 3PPJA 4FIFA 2YCFA 5DEYA 3RAIA 4APPA 3BLQA 2UZLA 4U0IA 5EDPA 4BC6A 5CXZA 5FEQA 5AIKA 2YM3A 3DJ6A 3RAWA 4CMOA 3DT1A 5DLSA 4CFNA 4FSYA 5AIRA 4D58A 4EUTA 2VU3A 3AC8A 3IOPA 3AD6A 4IBMA 1WVXA 4XP2A 3I6WA 3DJ5A 2QOHA 2F7ZE 4V04A 3BI6A 2VTTA 3PA4A 3HGKA 4FL1A 4CEGA 5JEBA 5ANKA 2G15A 1OPLA 2B9JA 2PK9A 4EC8A 3LFNA 1QMZA 4AGUA 5ACKA 3QZGA 4ALUA 4I92A 4EL9A 5HO7A 1VR2A 3NNVA 5IKWA 5HTBA 2GTMA 4FZ7A 3E88A 2R0UA 2X2KA 3IW5A 3GNIB 4IM3A 3JPVA 3ZDUA 3PE1A 5IA5A 1JQHA 4TWCA 4FOBA 2HW6A 3VW8A 5J95A 2O5KA 5DNRA 2Z7RA 2QR8A 2SRCA 3HAMA 1Q8YA 4PMSA 4Y85A 5HTCA 5FUTA 5IH6A 3HA6A 5CAVA 4FIJA 4FKLA 2VNWA 1DI8A 3N4VA 4D4VA 3CQWA 5AUYA 5CASA 1AQ1A 3LXNA 3UIBA 2YIYA 5HI2A 3DOGA 1Z57A 3QQKA 4IDTA 2XKFA 2UW7A 4ZS0A 3VUGA 4J71A 4UWYA 3ENHA 4MXCA 3R01A 3DNEA 4IACA 4F9YA 4JR7A 2NNWB 4UB7A 3VNTA 3ALNA 3ITZA 3PJCA 4S34A 3V5QA 2UZWE 2GU8A 3VUHA 2XJ2A 3DB8A 4UN0C 3ZSGA 4QYYA 3ULIA 4IFGA 3R8ZA 3NR9A 5AV1A 2Y8OA 5HOAA 5HLWA 3MA3A 2WGJA 4NM3A 4ONAA 3OWPA 2GHMA 5AV2A 4DFXE 5E91A 3QX4A 3SHEA 1K3AA 3BBWA 3KXNA 1TQIA 2BHHA 2GHGA 2W9ZB 3DKOA 2VTAA 3GP0A 4O0WA 4QQJA 4BDHA 4D2WA 5DVRA 2OH0E 2BTSA 5E90A 2HZIA 2VWUA 2Y9QA 1H26A 5HO6A 5IH5A 2XNEA 3A7GA 5J7BA 4RVTA 4FL2A 1FBNA 4BCQA 2UZDA 2GS6A 3B8QA 2YITA 4OTRA 3KQ7A 3CD3A 3MY1A 4XV9A 5LWNA 3U4UA 5M44A 2J90A 1REJA 4JAIA 3VS7A 4EBWA 4EH4A 3SVVA 4U81A 3OT8A 3ANQA 2QHMA 5AWMA 4DGNA 3WF6A 3SXFA 3KRLA 4F7LA 4OT5A 4CG8A 5FP6A 1P5EA 2JD5A 3RP9A 3WIGA 3NPCA 2B0QA 3R0TA 3HDMA 1WBSA 2YM6A 4TPTA 2B9FA 4G3FA 3KL8A 3P86A 2PYWA 1ZRZA 4B99A 3E87A 2J0MB 5IQEA 4BIBA 5M56A 4USDA 2W99B 4LI5A 5M08A 3MTLA 2QO9A 1OL7A 3N4UA 1YXXA 4C0TA 3CTHA 5HEZA 2ITZA 4IMYA 4KNBA 3Q6UA 4PMTA 3FV8A 3P1AA 3U8WA 4L46A 1YOMA 4Q5HA 5B0XA 3BX5A 2VX0A 2ONLA 3FY0A 4AOTA 4BZDA 1U4DA 4CVAA 5IMXA 4GT3A 4O7YA 3L8XA 3LPBA 4D4SA 2JFLA 1ND4A 4A06A 4IZ5A 2ITUA 5DWRA 2QODA 4D2TA 3DBEA 4D2PA 3VBQA 4FICA 3DGKA 3G90X 4XRLA 4NH1A 4AG8A 4TW9A 4EC9A 2W06A 4WG4A 4DG0E 2O8YA 4MNEB 3ZH8A 5E8UA 3SC1A 2JLDA 5DN3A 2QURA 2YDKA 2WMUA 2JBOA 4I0SA 5FGKA 5T6KA 5DR6A 1XQZA 3W2SA 3GB2A 3UOKA 4DN5A 4IJPA 5FQDC 3VULA 1BI8A 4GEOA 3D15A 4BCPA 4XEYA 4FTCA 1ZYLA 4R1VA 5I3OA 4D9UA 3FYKX 4FKVA 4BDDA 5CAQA 1V0OA 4L45A 1Q61A 2CKEA 5TT7A 3V5PA 4CLIA 4OTIA 2R3IA 3EQRA 1R0EA 4FG9A 1V0BA 4WIHA 3PRFA 3VAPA 4F65A 5C8NA 5KKRC 4WNOA 4ZTHA 5EW8A 4TWOA 2NP8A 3UO5A 4I4FA 4MKCA 4PDYA 3NYNA 3MB7A 3WYXA 4GU9A 1OIYA 2BCJA 4YJQA 4GJ3A 4IM0A 2F2UA 4ACDA 3QA0A 3RCDA 2XS0A 3KU2A 4PMPA 3MFTA 5BYYA 3PY3A 2XIKA 2R3KA 3T8OA 4TN6A 5KMMA 2RG5A 4FEVA 4HJOA 4RWLA 4C58A 2CKPA 3DAJA 3I79A 3IW7A 3LCDA 1JKSA 4Y46A 5FTGA 2X8DA 4OT6A 4GFGA 3GVUA 4LGHA 4Q5EA 1XH6A 4PF4A 4OW8A 3N9XA 4JG7A 2ZV2A 4I41A 3SDJA 2W1CA 5C26A 2ITWA 3RPRA 5K0KA 3IO7A 2J5EA 4BICA 2FH9A 3C50A 4XLIA 1KUTA 2R2PA 2X6DA 3PXZA 2BUJA 4GRBA 4ZLZA 4C4HA 5LQFA 1LEWA 3OCGA 4UBAA 4EJ7A 2JKMA 4WG5A 3WF9A 1SZMA 4F1MA 3UGCA 2E9OA 3A4OX 2EVAA 2WTJA 1TQPA 2UW4A 3EKKA 2G01A 4XV3A 4F08A 4RFZA 4FODA 1TKIA 2JDOA 2UZBA 3FAAA 1EH4A 4RX7A 3TZMA 3PY1A 3FQHA 2DS1A 4JDHA 2IWIA 4FT7A 4J98A 4BCOA 4CFWA 3KB7A 3ZUVA 4FTLA 3UODA 3IS5A 3BYOA 4CT1A 4C4GA 4X3FB 2OH4A 4AA4A 4WBOA 4ZTQA 3TJDA 3WIKA 4O0SA 1A48A 3QQLA 5HIDA 5K5XA 4DGGA 1OVEA 1TQMA 3IPHA 3RM6A 5L8KA 5A6OA 1FQ1B 4M97A 1PMEA 2JKQA 4L9IA 4AT5A 1UKHA 2HELA 3KRJA 5CSPA 4O1PA 1YW2A 3P5KA 4FGRA 1WBTA 4QP3A 3LZBA 4JG6A 3R7GA 4RWJA 4DF3A 1XH4A 3RNYA 3AD4A 5CU3A 3RZBA 1PKDA 4DBNA 3F9NA 4ZJVA 2XJ1A 1KSWA 4FSUA 4I4EA 3KK9A 4CQGA 4A9TA 4AP7A 4ZLYA 4RIXA 4YUQA 4NYEA 4PPBA 5TKDA 5CF5A 1LP4A 1FGIA 2X9FA 2JGZA 2YCSA 5HCXA 5EYCA 1XBBA 2B7AA 3FC2A 4JIAA 4I20A 4XG4A 4XV1A 3C4FA 3NYVA 3SQQA 2W1FA 2OWBA 3GU4A 3RK7A 3BYSA 4B4LA 5FEDA 4PP7A 2QI8A 3E93A 3JY0A 4ZJIA 2X8EA 3LFCA 4JNWA 1SMHA 4O7ZA 5ETFA 1PXNA 1P4OA 3FHIA 4AN9A 3Q9WA 3UO4A 4BI2A 3HMPA 5BVDA 3TV7A 4A07A 2VGOA 2BKZA 1Y91A 5A54A 3F66A 2AUHA 3DDPA 4NSTA 4OBOA 4CKJA 3UIXA 1Q99A 4FTKA 2W5BA 3TKUA 4USEA 4X0MA 5ANIA 3LLAA 1VYWA 2OI4X 3QUPA 4RQKA 4UY9A 3ZONA 2QG7A 2QO7A 5CSVA 4A9UA 3DAKA 2WO6A 1B6CB 2YZLA 4BTJA 5BVEA 4IEBA 4FKTA 2VWXA 5J5TA 5KNJA 3NCZA 5EM7A 4M3QA 4YJOA 3AC5A 3PVBA 4BYJA 5TOZA 5CI7A 4IX3A 4DFBA 3FZTA 3NUSA 1KE8A 2JDTA 3FQSA
chains in the Genus database with same CATH superfamily
5FP5A 3TXOA 4DINA 2BRHA 2PVRA 3GI3A 3TTJA 3KK8A 3LCSA 3C4XA 3ZFYA 3LMGA 3RAKA 1JWHA 4RVLA 5ETCA 3TT0A 4FVRA 2OIQA 3EYHA 4E5AX 2C1AA 2FSOX 4C34A 3W0OA 1YDSE 3OY1A 2EU9A 4E3CA 1PYXA 1Y6AA 3PJ8A 3JS2A 3D2KA 3JY9A 4HW7A 4BDKA 2WEIA 3ATTA 1JVPP 5EHLA 2ZVAA 2NRUA 4ZY6A 2UZNA 2XZSA 3MIYA 1GIIA 4O27B 5H2UA 4DH5A 4K33A 2IN6A 4L53A 1K2PA 2OIDA 2BALA 1YWNA 3F7WA 3KN5A 2UV2A 3W2CA 4DH1A 2W5AA 3OOGA 5HTIA 2WMVA 3O8PA 4AXEA 3BV2A 5CANA 4K6ZA 4CZTA 3RPVA 4U79A 3ZM4A 4S33A 5IQDA 1HCLA 4UWBA 2C0OA 3OHTA 5DRBA 3D7TA 5ANJA 3RPSA 4E6AA 4E93A 4IWPA 2P4IA 2VX3A 1NY3A 5KHWA 5JQ5A 1NVRA 2RG6A 3E3BX 4E4XA 1YHVA 4BB4A 2CPKE 3KMWA 3OTVA 2Z8CA 3PPZA 5EI2A 4TXCA 3BWFA 4LV8A 2R0IA 2OXDA 3IDCA 3Q9XA 3MW1A 2DWBA 4XG3A 2OXYA 5JH6A 5IQBA 2YAAA 1XO2B 3ORPA 5CU0A 3EL7A 5EQEA 4FT9A 5IDNA 2C3KA 3UJGA 5EK7A 3RNIA 4LUEA 4W8DA 3TZ9A 1FVTA 2VD5A 2QOFA 3WZDA 4FG8A 3C13A 3SXRA 3EQDA 4F0GA 5ITAA 3VN9A 4QMVA 3C4EA 2HY81 1VEBA 5CXHA 3BWJA 4IB3A 2QR7A 4L8MA 2YDIA 3QZHA 2KTYA 3CE3A 3H10A 4C3PA 3K3JA 3QTIA 5FD2A 4IH8A 4L3PA 4QYGA 4AE6A 3OBGA 1J1BA 1VJYA 1G3NA 3HMNA 2WTDA 3R30A 4V05A 5H8BA 4W4YA 4JR3A 4H39A 1WMKA 5AAGA 3ODYX 3P4KA 4JAJA 4NCTC 4CKIA 4XMOA 2B55A 1GOLA 1OB3A 2OFUA 5IUHA 1SVGA 4UMPA 3ORIA 1ZY4A 4NK9A 2IG7A 3ODZX 5AMNA 1IR3A 3REPA 4F6WA 4YMJA 2EB3A 2XAMA 3DBDA 3O8UA 3OY3A 4B7TA 5F94A 3CD8A 1DI9A 2XP2A 3PFQA 4O0YA 1YXUA 4D55A 2W17A 4H58A 5HBHA 4CFMA 2XEYA 2J4ZA 4X2NA 5E1EA 3R73A 4D0WA 5TO8A 1TVOA 4S31A 2WEVA 3WYYA 3IDPA 3WZUA 3CQUA 3QRKA 3QX2A 2BAJA 3ZZWA 2CSNA 2QHNA 4EYJA 2X4ZA 4BHZA 2R3JA 4YTFA 5DYJA 5EQPA 3R8MA 3FMEA 3I1AA 4FTNA 3QC4A 3TM0A 5GIOE 5HHWA 1A9UA 2GNJA 5CQWA 3EN5A 4OAUC 2F9GA 4WO5A 4BF2A 1KE9A 5M4UA 1OI9A 2C4GA 3QTSA 3RK5A 2PSQA 1T46A 3F82A 3WOWA 2W05A 4TNDA 4DEAA 2JKOA 4BCIA 4C02A 5KMNA 1KV1A 2CCHA 3UBDA 4ASXA 4GT5A 3ULZA 3JR1A 2WMSA 2C3JA 4MH7A 1OECA 1F3MC 3ID6C 2RL5A 2Y7JA 4KKHA 1XMMA 4B6LA 3E8EA 4EEVA 2I6LA 4P90A 5IU2A 1ST0A 2JC6A 3FXXA 4FKRA 4MAOA 2NPQA 4ZSGA 2V5QA 3H0ZA 3WE4A 5I9VA 3BHYA 3KMMA 5IQFA 2W9FB 3PUPA 3QQUA 3GXLA 3R21A 4JQ8A 4F9BA 5J9LA 3SOCA 2HZ0A 2XIXA 1SNUA 5CS6A 5DIAA 4D4RA 2WQEA 3LFQA 3D9VA 4QMLA 4JIKA 1KE6A 3O71A 4I5PA 2Q83A 5F1ZA 5C1QB 5HD4A 4YU2A 3UZRA 5IZFA 3AGLA 4I6QA 3TZ7A 3I5ZA 4O2ZA 5FTQA 4EZ7A 4EOKA 5AM7A 4QDVA 1M17A 4EK3A 4BZNA 1Y8YA 5IUGA 4LRMA 2O3PA 2H6DA 4ZIMA 3V8SA 3ENMA 4AA5A 4F09A 3ZC6A 1H1QA 5CAUA 4FV3A 3ZEPA 4YJVA 2YERA 5LVNA 4ASDA 3LCTA 1YI3A 5F4NA 3IGGA 1ZOEA 1FINA 2BDJA 1FGKA 2EXEA 4QP7A 4C57A 4GFOA 5IA3A 4CKRA 2OK1A 4GYGA 1ZYSA 3IW4A 3OP5A 4ANMA 1UA2A 4MXZA 3HYHA 4PTEA 5JRSA 4GK4A 1XBAA 3NNUA 4C8BA 4CFVA 3QFVA 1PRYA 4AXDA 4YJNA 3QA8A 3POZA 4DGOA 4WD5A 4XP0A 2GNHA 3AC1A 5FTOA 4WA9A 3A60A 4XJ0A 4IFCA 3NYXA 4NL0A 3DFCB 3F2RA 4IB0A 2RFEA 4G3GA 3FWQA 4GT4A 2W5HA 3QXOA 4FUXA 4IJ9A 4TNBA 5GZAA 5IA0A 4M15A 1UV5A 4TYHB 4E7WA 5KKRB 4DH8A 1J3HA 3D94A 2BZJA 4X2GA 3C0GA 3EIDA 3LAUA 4YPSA 4DEHA 4ZOGA 4NZWB 1MP8A 4WG3A 4N4SA 3GEQA 3HVCA 2YIWA 5DEWA 4FZFB 4G31A 4NJ3A 5CSWA 5BPYA 1H0VA 4YLKA 4EH2A 5FXQA 4YBJA 4QMNA 4MK0A 3ALOA 3GUBA 5LOHA 3RPYA 2YCQA 5AR8A 1W8CA 2VAGA 1RDQE 3DTWA 4OLIA 4J7BA 1KOBA 3SXSA 3O17A 3KULB 2BR1A 4PRJA 2WMTA 1H1RA 1UU8A 1YVJA 3GC7A 5LMKC 3CKXA 3QQGA 1AD5A 3LCOA 4GK2A 3KXZA 5ETAA 1OPKA 2ETRA 3FI4A 2QKRA 5HU9A 1CMKE 2F4JA 4JBVA 5AAFA 4PL3A 3QUEA 5BYZA 5JKGA 2J5FA 3KA0A 4AE9A 2C6IA 2J51A 5B2LA 3K5VA 3CY2A 4BZOA 4EHEA 5E8ZA 3FXZA 4P4CA 2VO6A 3KRXA 3G51A 3VBXA 3W2PA 3BYMA 4KBKA 2ONLC 5IUIA 4BDAA 4DFYA 4IQ6A 1NA7A 2O65A 1FPUA 4CTCA 3L8SA 3JXWA 1W0XC 1GZNA 4E4NA 3F6XA 5HIBA 4HGSA 4DAWA 3AKJA 3IGOA 3LXLA 5E8YA 3PIXA 1YXSA 2OGVA 2UVYA 3FLZA 3L8VA 3PSDA 2C6MA 2ETMA 1Q3DA 4FJVA 3QTQA 5I9XA 2BTRA 3FZ1A 4IW0A 4PUZA 2ZAZA 2UUEA 3MA6A 3NS9A 4HCVA 3I7BA 1SM2A 3EN4A 3CLYA 5LVPA 1ST4A 3R7UA 5KMLA 5AR5A 1IEPA 2R7IA 4JL9A 2ACXA 2GFCA 4G2FA 3RMFA 3W18A 5IEXA 3BV3A 3QGYA 5I0BA 2CKQA 5D7AA 4MF0A 1JSUA 4NFMA 4ZSAA 4Y95A 4D2VA 5A6NA 2C6EA 1H1PA 2FA2A 3RPOA 3ZLYA 3F69A 4FTMA 3COMA 3FPMA 3AG9A 5ANDA 5GHVA 2ZDUA 4J52A 1M52A 4AW2A 2HXLA 3TUDA 1DM2A 5EYKA 3BQCA 3PZHA 4CQEA 1W2FA 2QCSA 3HZTA 4AGWA 4WNKA 4W9XA 3PLSA 3COIA 4JBQA 2QOOA 2PVKA 2Y6OA 3UE4A 2IZRA 3CP9A 1W84A 4G17A 4LGDA 2X7GA 4U6RA 3MY5A 4E5BA 4MD9E 5IQGA 3F3UA 4OTPA 1Q4LA 3UPXA 2PVNA 3QC9A 4L43A 4NT4A 5KX8A 5J9ZA 4H05A 1WFCA 3PXYA 2OXXA 3FBVA 2C6DA 1JAMA 2Q0NA 5CWZA 4B8LA 4I0TA 3DLSA 1UNGA 4MBJA 4C38A 2PZ5A 2PY3A 4EHGA 3WI6A 4E6DA 1WBPA 3OXZA 3CTQA 4KUJA 4MBIA 2BFXA 4CG9A 3VHEA 3W8QA 4FSRA 4NCTA 3PYYA 1MRUA 3G2FA 3K2LA 5AM6A 5AP7A 3EQFA 3GCVA 4FK3A 3V01A 4AZEA 5B7VA 3A8WA 4HVDA 4FEWA 3RK9A 3QRIA 4MUQA 2LGCA 3KY2A 3P7BA 5KO1A 5E8TA 4KS8A 4IX5A 4BWKA 3ACJA 3UMXA 4E4LA 5J1WA 4IC7A 5FEEA 3A7FA 2OLCA 2XB7A 3KF7A 4JS8A 4RIYA 4O7WA 4XLVA 5AFVA 2FSMX 4ANNA 2UZOA 2FO0A 4FKSA 3RCJA 4C2WA 3AMBA 1HCKA 4FKIA 1Y6BA 3QD4A 4YO4A 5I9YA 2RF9A 2ZV9A 4PDOA 3R00A 4B8MA 5BX0A 4TYEA 3L9LA 3ZFMA 5IISA 4F70A 4KBCA 3MFRA 4XRJA 4Y83A 3KXGA 1L3RE 5KMKA 4L52A 5LVMA 4I1ZA 3VONA 3OEZA 2OSCA 3R7YA 4QTCA 1PY5A 3D5WA 2ZMDA 5DE2A 1KE7A 2QU6A 4RJ5A 4JOAA 4BCFA 4AN2A 4QMTA 3LFDA 3HP5A 4XHKB 4GUEA 3UZPA 2X9EA 3NYOA 4QP9A 2W1HA 2ZM3A 1URWA 3GCUA 4WHZA 3VS0A 4WOVA 5CAPA 3F3ZA 3EN6A 1H27A 3ZLWA 2XCHA 5BYLA 3FLQA 2XYUA 2BRNA 3KVWA 4J1RA 3NFFB 4EH9A 3VJOA 1V0PA 2G1TA 2YJSA 3QD3A 4KS7A 5BVFA 4ZP5A 5LMAA 4GV1A 1FVRA 2EXCX 3H3CA 2R9SA 4W8EA 3Q53A 5HCZA 3DV3A 5E7RA 2GNFA 3KN6A 2XYNA 3FLYA 1J7LA 4GK3A 4AZSA 2XKCA 3EJ1A 5IPJA 5KMJA 3BYVA 3OFMA 4UMQA 3EOCA 4IVBA 2VTHA 4EKLA 3ZDIA 1MQBA 2VWBA 1YXVA 3HRCA 3S2PA 1FOTA 3LFEA 3O7LD 2WAJA 5H8EA 3NIEA 3L9NA 4OBQA 4FTUA 5KE0A 1J91A 4BWPA 4NTTA 3GU8A 2AC5A 2WQMA 3NNWA 2DQ7X 4FZDB 3S0OA 3ET7A 4JRNA 2WTKC 3G15A 3LJ0A 3BZ3A 3MH0A 5DFPA 3NDMA 1SVEA 3RHXA 4GU6A 3UQFA 1DAYA 2GPHA 3ZUTA 1OPJA 1JSVA 4F64A 1PHKA 2YDJA 3ZZEA 4RZVA 3KRRA 4I23A 4JQ7A 2A4LA 2R3LA 3QKKA 4K9YA 4R1YA 3PVGA 4IANA 4ZMEA 3A8XA 3M42A 3PSBA 5CI6A 3CSVA 2P2HA 4PV0A 2HXQA 1AGWA 4IADA 3E8CA 3Q9YA 3R9HA 3ZM9A 3TV4A 1ZZLA 2XIYA 5D1JA 4YBKA 4YR8A 1M7NA 3NUAA 5HQ0A 4DFUA 3ZUUA 4MD8E 5AP4A 4LV5A 5GZ8A 4GKIA 3FJQE 4NWMA 3ZCLA 2YIXA 4ALWA 5AP6A 4M69B 3Q52A 3QQJA 4KIOA 4EZ3A 5CENA 4BFMA 4D0XA 1OM1A 2WQOA 5HORA 4D5HA 2PUUA 3CJGA 3DKCA 4NKAA 1MQ4A 1JNKA 3FKOA 4W4VA 5DT4A 4AZTA 2WTCA 3ZO1A 4R77A 4C36A 4EH6A 2YM8A 4M66A 4O2PA 4IAAA 3S95A 4DT9A 4IVCA 2IEWA 4BI0A 4LUDA 5H8GA 2VO3A 4UXLA 4WRSA 3SLSA 4CCUA 4E1ZA 1KWPA 2VTOA 4IHPA 4IAFA 5AR2A 1Q8UA 4FKUA 5LMKA 1H07A 4QMPA 5AX9A 2XA4A 3NCGA 4DFLA 3SG9A 3F5UA 1REKA 5A4CA 2QVSE 4DBXA 5BUJA 4CMTA 4EUUA 3TJCA 3O51A 5AEPA 3AQVA 3NFGB 4U40A 4MX9A 5HNGA 3RTPA 2PZIA 3ETAA 4PX6A 4G16A 3PDTA 2W1EA 3PXQA 3NW6A 3UVPA 2B53A 3POOA 3DB6A 4XCUA 5C03A 4NW6A 4YHFA 3V5LA 3TV6A 3W0QA 1UU7A 3RVGA 4AZFA 2Y4IB 1YDTE 4RIOA 5G1XA 2XEZA 3HV5A 3DDQA 2UW9A 3GU5A 3RALA 3VQUA 3VBTA 2PVLA 3R63A 3EFKA 5IEVA 4E4MA 4C4JA 3ERKA 3CC6A 4GIIA 4G9RA 5HG7A 2W7XA 5CT0A 4DC2A 2A2AA 2R3GA 3ORTA 4IX4A 4QTDA 5CTPA 3VS2A 4X2KA 4M0YA 4BGHA 2UW3A 2XH5A 1JKLA 3QKLA 4IWOA 3O5AA 2BZHB 1X8BA 4ZTSA 3ZOSA 3PP0A 4HCTA 4LRJA 4MBLA 4G3DA 4YTHA 5AUZA 2IW9A 3FLWA 1JOWB 2GFSA 4QMWA 1Y8GA 4QP2A 2NO3A 3LQ8A 4QO9A 4BDCA 1M2RA 5HX6A 4D1XA 3C51A 3EL8A 4BDGA 2R3MA 3H30A 2C5VA 2HWOA 4O7LA 2PMIA 2FGIA 4S30A 1XBCA 2F57A 5DT0A 3WE8A 4AOJA 5IQIA 1UNLA 2BMCA 3IONA 5HX8A 1JKKA 2C69A 4CFUA 2G2HA 5IQCA 3Q4UA 4IAYA 1JLUE 3V3VA 4M84A 5B2KA 2X0GA 3DK7A 1UVRA 5BMSA 3I0OA 2OJJA 4RC3A 5HE1A 3W2RA 1G8SA 5M55A 4MTAA 3QCXA 5DMZA 4O4BB 1ERKA 2OBJA 2RSVA 3EQPA 2PVJA 2BROA 4FV7A 4IWQA 3WZJA 3VBVA 5AADA 1YWRA 3P79A 5L2SA 4JXFA 4RZWA 4M7IA 3KC3A 4ANSA 4CLJA 4MXAA 4AXAA 2QOKA 3P23A 3D5XA 3QAME 5AUWA 4AW5A 4FI1A 5IG1A 5CEIA 2EXMA 5HE3A 4U44A 4JDIA 4TYIA 4AQKA 3U9CA 2IVTA 2R3OA 4BI1A 3L8PA 4F1TA 1XH8A 3MESA 1I44A 2C47A 3IK3A 4WUNA 5M07A 3QYZA 5IH4A 4BGQA 3HMMA 3PG3A 2OICA 3FEGA 3R9RA 5CSHA 3BHHA 2X39A 1PKGA 4HGEA 3K54A 5D9HA 3RBWA 3R9NA 4O6LA 3RHKA 4O82A 3PJ1A 4FMQA 4GG7A 4J53A 4CYIA 2X2LA 3KVXA 4KB8A 4M8TA 4AF3A 5CYIA 4ENYA 4KABA 2JIVA 4I6BA 4KIQA 3DBCA 5GJGA 3EHAA 2G9XA 4FKQA 2P55A 4XBRA 1B39A 3A61A 2HENA 2B4SB 3QALE 4NIFA 5JFWA 4L68A 2V7OA 3NWWA 2UZTA 3EH9A 4BIDA 4QEBA 5CNNA 2J2IB 3WF7A 1U54A 4R7BA 1H8FA 1M7QA 5K9IA 5C8MA 1LR4A 3S3IA 3W10A 2VGPA 5A4TA 5AR3A 4I94A 2YIQA 4BBFA 1KV2A 3I4BA 2BZKB 3QQHA 4YC3A 2P2IA 4EWQA 4FA2A 3CGFA 3EQCA 1OKZA 2BPMA 2QU5A 4WRGA 2OZAA 3EB0A 4MCVA 3AT3A 4M12A 3V8TA 2NRYA 5J5SA 5E8VA 4ACMA 2R3FA 3KXMA 4ITJA 4QMMA 4BCJA 4C35A 1YKRA 2VTQA 3MI9A 4BR3A 3LXPA 1MRYA 4CRLA 2XK7A 3QTWA 4AACA 5CX9A 3E63A 2QONA 4KSPA 4R6VA 3LFFA 3NLBA 4AZVA 4HVIA 4UEUA 3VW6A 2J0LA 2VN9A 1MUOA 2CJMA 2YABA 1OBDA 3OWLA 5CEQA 1H01A 1YOJA 4QYEA 3ATSA 4DTBA 3R9OA 5D11A 3II5A 4NJDA 5H9BA 2X0QA 1BYGA 1A06A 1XH5A 4C4IA 2GQGA 4LOOA 3DJ7A 2XKEA 2HIWA 3ACKA 4FZAB 4QTBA 3JVRA 4ZTNA 4FBXA 5K5NA 1IASA 3R8PA 2PZRA 1R1WA 4DFNA 2HAKA 2UW8A 4LFIA 4N6YA 5BVNA 4XG6A 5C4LA 2XAOA 4F78A 3HKOA 4J99A 4O0VA 3EZVA 3Q3BA 3FC1X 2WMQA 4U5JA 3BGPA 4TT7A 3QCQA 3LKMA 5DH3A 3W16A 2XNNA 1MRVA 3D83A 4FVPA 4QNYA 5EH0A 4WNPA 2GHLA 4X7QA 2UW5A 3SD0A 1M14A 2ITXA 3UG1A 3SA0A 4O86A 1QPDA 2CNVA 2PTKA 4H3QA 4HPUE 4BCKA 4EOMA 5CF6A 4XG8A 4R8QA 2ZDTA 1UWHA 2EWAA 3E3PA 4AOIA 3UVRA 3D2IA 2KULA 4ZTLA 3LCKA 3Q2JA 1XHAA 1W83A 5E4HA 4QP6A 4F7SA 2YEXA 2WD1A 2B9HA 4G6OA 4YNOA 3ZBFA 1KE5A 3PA5A 4ASEA 5ANGA 5EOLA 4EQCA 3KGAA 3SRVA 4B9DA 1Y57A 4KRCA 2G2IA 1ZYJA 2YLEA 5AR4A 4YURA 3OT3A 3K3IA 4BCMA 4ZLOA 3HV7A 4KRDA 3O50A 4CV9A 3UQGA 3OXIA 4D28A 4YJRA 4N6ZA 2E2BA 4BCHA 1OGUA 4XH6A 2VWVA 4RMZA 3OOMA 2PVMA 4O81A 2YAKA 2WB8A 4Y72A 3U87A 4Z3VA 2Z7LA 3K5UA 3TI1A 4LL5A 1O6YA 1R78A 5LCKA 1OUYA 3HP2A 2Z60A 5L2IA 3BIZA 1NT2A 3TIYA 1GAGA 4WSYA 1NW1A 2R3NA 2XNGA 3SW7A 2IVVA 4A7CA 1APME 2I40A 2Y6MA 3AKKA 3HMOA 3BBTB 3GFEA 3TNWA 4YHTA 2GS7A 4AS0A 5JK3A 2UZUE 5LJJA 3H4JA 3N51A 4F9AA 5M51A 5JQ8A 4XBUA 4RIXB 4MXXA 2C5OA 5AUTA 5KBRA 4FV1A 2HY0A 3MPAA 3ROCA 3C5UA 4BYIA 1DAWA 4OR5A 5EI8A 4ACGA 5HNIX 3I0QA 2OU7A 4CGAA 5L3AA 3LQ3A 5JGBA 2JDRA 3UOJA 2OFVA 3S00A 4O0TA 3T3VA 3DZQA 4PWNA 4IVAA 3QHRA 4O4CA 1FVVA 2VTMA 4O91A 3BE9A 1Q8TA 2X81A 4FSQA 1O9UA 3HLLA 3E92A 3DFAA 4YC8A 5BUEA 3OMVA 4QQTA 4LOPA 2C3LA 2ITPA 3GCPA 1Q3WA 4Y5HA 4RRVA 3LFAA 3RKBA 3UZTA 4GKHA 4HYSA 4L00A 2RFDA 5F20A 2OJGA 3BEGA 4D2SA 5E8WA 3R8UA 4QQCA 4U7ZA 3FZOA 5JFVA 5J9YA 3FMKA 5AX3A 3OBJA 3CCNA 4BHNA 3G0EA 4KINA 4FE2A 3PUFC 4OTFA 5CNOA 5EKNA 3DU8A 4KKGA 5F95A 5C27A 4A4OA 3EFJA 4TRLA 3PXKA 4O7RA 3R7EA 5H3QA 3QQFA 3OCSA 1ZXEA 4RA5A 3QZFA 4RX9A 4F9WA 3E64A 4MXOA 4ANBA 4IAZA 3BKBA 3PXRA 1OITA 5ETIA 4AGDA 4AXFA 3D4QA 3L9PA 3UDBA 3TG1A 3DBQA 3BGQA 3MS9A 4O96A 5ANOA 3UIMA 2QNJA 4FK6A 3D5UA 2I7QA 4JG8A 5EW9A 2CGWA 2I0YA 3W1FA 4L3LA 5HO8A 2PUIA 5EDQA 3EKNA 4F6UA 4MNFA 1J1CA 3T9TA 3EQGA 5KZ0A 4GL9A 3PJ2A 5BMMA 5FXRA 3GU7A 1YRPA 2X8IA 4FTTA 4QOXA 3OW4A 4DLJA 2C3IB 1XJDA 4LM5A 4A9YA 4C3RA 4FEXA 1KOAA 2R3HA 4H1JA 4ERWA 4ITIA 4CMUA 3PWDA 4G9CA 1ZMWA 4IM2A 4DTAA 2C0IA 4IIRA 3LIJA 4NKSA 2BRBA 4V0GA 3A7IA 4KIKB 3FQEA 3D7TB 4D9TA 4FEUA 5E92A 4U41A 4Z16A 3Q9ZA 4WBBB 4FSTA 2PMOX 5B2MA 5CEKA 4E73A 5K4JA 5CU2A 5D7VA 3KULA 3QLFA 4BKZA 4J97A 4F0IA 4ASZA 1ATPE 4K18A 2FVDA 3ZRMA 4OTGA 5DT3A 3FLNC 5CF8A 1OIUA 2HOGA 4M14A 1GIJA 2VTIA 4BJJA 5HKMA 3Q96A 3OCTA 4DEBA 4YTCA 3ZO3A 1P4FA 4FOCA 4BVUA 4G5JA 3DXQA 5EM5A 3S1HA 3TUCA 1Z5MA 1BX6A 3H9FA 4R3RA 1VLRA 3NSZA 2X2MA 1WVWA 5CEPA 5L2WA 4UYNA 3CEKA 2OO8X 1Z9XA 2FB8A 3NX8A 4TYGA 2C6OA 1YHSA 4FIEA 2X7FA 4IX6A 3L1SA 4PMMA 5LVOA 5IA4A 3TUBA 3SV0A 4M13A 4K8AA 2ERZE 1Q62A 4YSMA 4ERKA 5JFSA 1UU3A 3B2WA 3M2WA 3OTUA 4XG7A 4AN3A 3PWYA 5GZ9A 2GNGA 4FTAA 4G3CA 1JSTA 3QLGA 3LVPA 4MWIA 4Q9ZA 4FSWA 1W82A 5CSXA 1DS5A 3CIKA 3SX9A 1RW8A 1BUHA 5CU4A 2CLXA 1CKJA 2B9IA 4J96A 2W96B 3MVMA 5FG8A 3UTOA 3VS5A 4HVGA 2JITA 4F0FA 4UMTA 3ZRKA 1PJKA 3F61A 3HAVA 4FV2A 5FM2A 4O0UA 4Q2AA 4FSMA 2BIYA 3V6SA 4HVSA 4RLLA 5EYDA 4FTOA 2GDOA 4NM7A 4LDTA 3PG1A 2VO7A 4TYJA 2FSLX 3BPRA 1HOWA 3BEAA 2DUVA 1ZY5A 3V5JA 3EQBA 4G34A 4I93A 3AOXA 2W1ZA 2ITQA 3GC0A 3OS3A 4Q9SA 3OZ6A 3EN9A 4FTQA 1XH7A 4GVAA 5TR6A 1ZMVA 2YN8A 1BI7A 3EN7A 4MQ1A 5AUVA 4AT4A 4FIHA 3UDZA 1PXMA 4FRFA 4R5SA 3CQEA 3I5NA 2E9PA 3C4WA 3QGWA 4IWDA 4GIHA 4RIWA 4II5A 3SAYA 3QF9A 4QNAA 3UC4A 4FV6A 4JI9A 2F7XE 2J50A 2OF4A 3JYAA 4I6HA 4LOQA 4RGJA 4RSSA 3VWAA 3UQCA 1G8AA 3CXWA 4L6QA 1RJBA 3U6IA 3F5GA 3PE2A 2AYPA 2YCRA 3VF8A 4YP8A 3MFSA 4FYOA 4DGMA 3F7ZA 5AV0A 4UZHA 3TDWA 1ZOGA 5KHXA 3IQ7A 4QRCA 3TYKA 2BAQA 4HVHA 2H96A 3VRYA 5FWKK 3MB6A 4LRKA 3G9NA 4FKPA 3ZU7A 4OGRA 3BE2A 1UKIA 4QD6A 4BDBA 4ZK5A 4X3FC 1S9IA 4DEEA 4KBAA 4ZEGA 2WTWA 2IJMA 4OTQA 1CKPA 1NXKA 4AXCA 3NVKI 5KCVA 3QUDA 3BLRA 2HW7A 3NAXA 4GVJA 4BDFA 3AC3A 3O23A 5EW3A 3UP2A 3FXWA 2JFMA 3BRBA 4PL4A 1H1SA 5HG8A 3A7HA 5DGZA 3UOHA 5HLPA 2XIZA 3VS6A 3O7LB 1YI4A 3WBLA 2H8HA 2W4JA 3MJ1A 3H9RA 3A99A 4GMYA 4WT6A 4EOLA 2XRUA 1JKTA 3ORLA 4NU1A 2HYYA 2UVZA 4C2VA 3GC9A 3OEFX 4BDEA 1G8JA 3I60A 5DI1A 3FSFA 2YJRA 3FL4A 4AW0A 3KXXA 2J7TA 4FKGA 5D10A 3AMYA 1PYEA 4FKOA 1ZZ2A 2J0IA 3DTCA 3TL8A 3ORXA 3W2OA 5AR7A 2ITOA 2PULA 4TTHB 3CY3A 3U51A 4AX8A 1ZOHA 5J8IA 2WMAA 5CU6A 5ANEA 3OCBA 4FEQA 4JQEA 4EOOA 2PPQA 2PHKA 4A9RA 3FDNA 5JT2A 4KWPA 1K9AA 5HU3A 1PXOA 4AT3A 2IVSA 2BIKB 4E6CA 4IC8A 5IQHA 5GINE 4FYNA 2WMXA 2VRXA 2E9UA 3OWKA 3VS3A 4I21A 3UG2A 3NUXA 4QMQA 5LVLA 2HK5A 2ITTA 2XNBA 5AV3A 5HNBA 2X6EA 3NNXA 3FZRA 5M09A 3DXNA 5HESA 3FL5A 4DLIA 3MH3A 4U9AA 3IDBA 4D4YA 3AXWA 4A9SA 1QPCA 4FR4A 3VO3A 2VTNA 4GJ2A 2YHVA 2PUPA 2GQRA 2BDFA 1PXIA 4EJNA 2JEDA 2RKUA 1OL6A 3HECA 2QD9A 5BV3A 4F1OA 5DPVA 4Y73A 1SYKA 4AA0A 4UV0A 5I5ZA 3G0FA 5HG9A 3U9NA 4GFMA 1OKWA 3R6XA 4JT3A 4QPAA 3UIUA 1XKKA 2P33A 3M11A 3Q04A 2YM4A 4F7JA 2VTRA 2PE0A 5C9CA 3WZKA 3F3WA 1UNHA 3R28A 4J8MA 2WIHA 4QYFA 5FM3A 3TTIA 2PE1A 3ZC5A 4DH7A 2WMWA 3QRUA 5HD7A 4RFYA 5AP0A 4N70A 4U8ZA 5CQUA 4F99A 3DLZA 4ANOA 3NMUF 2QQ7A