4PUZA

Crystal structure of spleen tyrosine kinase (syk) in complex with gs-9973
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 83
structure length 263
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4puzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4puzA01
4CT2A 3PVGA 3R1SA 1W98A 3GNIB 3OWJA 4S2ZA 5EW9A 3PIXA 3FKLA 3AT2A 5HNBA 1WBPA 1XH7A 3GB2A 3P7AA 4PMMA 1T46A 1E9HA 2BAJA 4X0MA 2RKUA 5B2LA 2J90A 1O6LA 3RHXA 4Y5HA 4U9AA 3ALOA 3RK9A 4O1PA 4CSVA 4L00A 2R3FA 3DDQA 3ZZWA 1LPUA 4O0YA 4FZAB 2BTRA 3GFEA 2HZNA 4C34A 4E93A 4P2KA 3NWWA 5HG9A 4DCAA 4QNYA 4BTMA 4EQCA 1H24A 5CX9A 4Y8DA 4Z7GA 5L2WA 3ZBXA 3POOA 4PMPA 2W9FB 2QG5A 2JKMA 4OTIA 2DYLA 5JH6A 1DM2A 3TDWA 4IE9A 4G6LA 3UVQA 5FG8A 2IZRA 3DB6A 4JDHA 3VS3A 5J9LA 3O51A 2YIQA 3HL7A 4QMZA 4BCIA 3GC0A 4CV9A 3ZSIA 2C3KA 3IS5A 4I6HA 2ITOA 3DS6A 4CLIA 4E20A 5IH6A 3PZEA 3A4OX 4ZY5A 5JGAA 3QZIA 2VWXA 3FYJX 2WO6A 3UMXA 3WZEA 3EOCA 3C13A 5EOLA 3C9WA 5J7BA 3U6JA 2W9ZB 1URCA 2CKQA 1GNGA 3QKKA 4ZMFA 2GTMA 2QOFA 4QYEA 4MKCA 2PTKA 3TV4A 5F95A 4L45A 5EDRA 3VAPA 3BYOA 2RF9A 4JNWA 5HE3A 1YQJA 2HAKA 3CY3A 2R3OA 4IWDA 4EHVA 2JEDA 2NNWB 4YBJA 3QHWA 3L8XA 4XV2A 3NUUA 3G90X 3E7OA 4C7TA 1CTPE 4DFXE 3DK7A 4FIJA 5IQHA 3D14A 4FR4A 3RWQA 1MRVA 4OBQA 2PZRA 3MVHA 4N0SA 3VJOA 5LWMA 4QD6A 2IPXA 4IVBA 3QQJA 2C5VA 2WQEA 4V0GB 4ASXA 3MTLA 2Z7SA 5EM7A 4BDJA 5FBOA 2JD5A 4YTIA 2QKRA 5C1QB 4FKSA 1H1PA 3SVVA 5GZ8A 4O0RA 4UEUA 1X8BA 4QMUA 4KWPA 4IAFA 4G2FA 1YKRA 1YXXA 4RMZA 3FHRA 4I6BA 2Y6MA 3UNKA 2P33A 5IA3A 3MPTA 1KWPA 1DS5A 2H96A 4IC7A 3DKGA 4MNFA 4OT5A 3MA3A 4QYHA 3GCVA 4YU2A 5B7VA 3QZHA 4EWHA 1CDKA 3QU0A 4FSMA 2PZYA 3UG1A 1PF8A 3FDNA 3HDNA 4J99A 4D4RA 3GC9A 4TWOA 4XV1A 4M12A 1Q4LA 3II5A 3EN4A 5HVYA 2Z7RA 3BPRA 3ZO3A 4EOSA 4DF3A 4GMYA 2VV9A 5D10A 5K0KA 1OM1A 4AT3A 4X21A 2Y4IC 4CG8A 4FEXA 3LZBA 3EYGA 5HNIX 1KE9A 3OF0A 4BCGA 1H1RA 4WNMA 2EB3A 4AT4A 5J5TA 2W06A 1ZY5A 2F2CB 4BZNA 2HXLA 3FMKA 4MXXA 5GIPE 3DBEA 4J7BA 4D1SA 4QP1A 1DI8A 2OGVA 3OWKA 3ZFMA 2GNGA 4R78A 3NRMA 4GUEA 3A7JA 1XBCA 3QTQA 4FTJA 4H3QA 3UP7A 4BL1A 5KMLA 4LOPA 2QO9A 5IEXA 3FI2A 3HMPA 3LKMA 3GQLA 2ZM3A 4JIKA 4RVLA 4RIXA 1VZOA 5HIBA 3Q60A 5IU2A 4B8LA 5C27A 1WVYA 3GI3A 4NM0A 4HVGA 4TPTA 3CJFA 3UMWA 4KSPA 2XK4A 4EOKA 3BELA 4IAZA 4X3JA 5EQEA 1G5SA 1QPCA 2ZB1A 4ACDA 1PHKA 4CRLA 4ENXA 1WBWA 1YW2A 4GVJA 1NVSA 2O65A 4IWOA 5CZIA 4G31A 5JRSA 4ALWA 1RE8A 2X8DA 4FVRA 2XNPA 1YDRE 1IASA 2LGCA 3AD6A 2W1CA 4QP6A 4J1RA 5A4LA 2B9FA 5CF6A 4FTMA 4A9YA 4E73A 4KAOA 4YP8A 5KNJA 4LMNA 3VQHA 4TY1A 1ZOEA 4I6FA 4YJUA 5CU0A 3CC6A 3R9HA 3TV6A 4CYIA 4A4XA 4L8MA 3HGKA 3QALE 5CSHA 4ITHA 3FQSA 1OL6A 5AR8A 3UO6A 4M8TA 2C5YA 2X4FA 4HVSA 2X9FA 3R83A 1ZYDA 2OH0E 3V04A 3ZUUA 4FA2A 5BQ0A 4QMPA 4EH6A 3AOXA 2WTWA 4M68A 4FT0A 4X2FA 2PYWA 3A7FA 1JKTA 2XJ2A 2C1BA 3KMUA 4DG2E 4C59A 3O96A 5HLWA 2W7XA 3A60A 3RCDA 1W84A 2ITUA 5HEZA 3O7LB 4I5MA 2V62A 4IZ5A 2BIYA 4FSZA 3S2PA 3VF8A 5HLNA 5AR4A 4C62A 3KRLA 4RJ3A 2HYYA 5KKRB 3KVWA 4WA9A 2PVLA 5JFWA 4MD7E 4RIWA 3ACJA 2G2IA 3DOGA 5LVPA 2G2HA 4FEVA 5EM6A 2ITZA 5KZ0A 3ZO2A 2XCHA 3LJ2A 4MTAA 4LMUA 1J91A 2C6LA 3LFDA 3MIAA 4S30A 5HO6A 4YJNA 3P08A 3MH0A 3NIEA 3EL7A 1A06A 2R64A 4J95A 3WIKA 4M97A 5LVOA 5HI2A 3PFQA 3GU4A 4FTRA 5I5ZA 2UW0A 4AAAA 3Q2MA 1A9UA 3QX4A 5HU3A 2J51A 3OBGA 4NFMA 3SOCA 4LV8A 3F2AA 4MD9E 4M0YA 4WBBB 4GG5A 4U40A 3RPVA 1Y6AA 5HLPA 4O83A 3JYAA 2E2BA 3DV3A 1F3MC 3L8PA 3Q4CA 3ATSA 2C6MA 4QP9A 2PZIA 2XNBA 1XR1A 3W18A 3QF9A 3OHTA 4U41A 2C6IA 2WXVA 3MYGA 2Y9QA 4JXFA 3CE3A 3G0EA 3G15A 3A8WA 3V8SA 3F82A 4ZLZA 4BI2A 3EQGA 4C4EA 3LPBA 4QMXA 3UQGA 5E91A 3N4TA 5EHYA 2P2HA 1OI9A 4I93A 3ZRMA 2WMQA 3G0FA 2R3IA 4FKJA 3RWPA 1UKIA 3LFEA 3SRVB 2BFXA 3U6IA 3UPZA 3BGPA 3EQBA 4PPCA 3E8DA 2PU8A 5CAOA 2HW6A 2ZMCA 1YWNA 4XS2A 2R7IA 4AT5A 5IISA 4RVTA 5EW8A 3QKLA 1PMUA 3QRIA 4GW8A 4FTUA 3KXGA 4HGTA 1WBNA 5AUZA 5FWKK 5CEKA 5M4UA 3A8XA 4ZLOA 5IF1A 5L2QA 2JGZA 3V5WA 4AU8A 2A4LA 3ENHA 5J1WA 3FLQA 1JPAA 4X3FB 3LMHA 4L44A 3SG9A 3V5PA 4I94A 4R3CA 2GNFA 3COMA 3TI1A 2NPQA 3UIBA 5TF9A 1M17A 4C4GA 3LXPA 4D4SA 4F08A 3CSVA 5AA8A 1KE6A 1KV2A 4K9YA 5E7RA 5HIEA 5C4LA 4ZSLA 5BYYA 3JS2A 4BWPA 4YLKA 1PYXA 4EJNA 3HDMA 1OBDA 4E7WA 5LVNA 2W5AA 5K9IA 2C5XA 3KVXA 2BRHA 2HOGA 1OZ1A 4AG8A 5HORA 5IQGA 1YI6A 2UW3A 4ERWA 4AW2A 3DBDA 5HIDA 5EOBA 3VULA 2E9OA 3DK6A 4ZP5A 1WVXA 1OL2A 4O2ZA 1H00A 4AOTA 5HQ0A 4RA5A 3VVHA 5ICPA 4IMYA 5ACBC 4GUBA 3IPHA 4O7LA 2XCKA 3NW5A 1Q8YA 4MWHA 3BKBA 2O8YA 2RIOA 2OICA 3W2OA 5FXRA 1JAMA 2QO7A 1KOAA 3BHYA 4N6YA 3RGFA 4AA5A 4WUNA 3I4BA 4GU9A 5AUUA 4BVUA 4O7TA 4AFJA 5DA3A 3WILA 2V55A 3FUPA 4FV0A 4YGAA 2C47A 3RZBA 2J7TA 2CKEA 2R7BA 3NNUA 4CFFA 5AV2A 2PMNX 4YC8A 1OL7A 4EOIA 5HBEA 2XK3A 2ZM4A 3BCEA 1M2RA 3U4WA 3LQ3A 3OTUA 1P4FA 4EBWA 3N9XA 4YJTA 5CVHA 2QR8A 3KA0A 1WCCA 3NUYA 4L7FA 4DGOA 1UKHA 3MTFA 2XYUA 2OJJA 3K3IA 4FV7A 5M51A 1IAHA 4RZVA 4FNZA 2X4ZA 3O71A 4DG3E 3A7GA 1WZYA 1NW1A 2HY0A 1OBGA 1Q8UA 2C0OA 1YI4A 3QQHA 5A46A 4QOXA 3PJ3A 3FJQE 2VWVA 4QP8A 4U97A 3TNPC 3FZ1A 4L53A 5CAVA 1P4OA 2PVYA 2WTIA 3LM0A 4ID7A 2YIYA 1ZRZA 4QMSA 4AZSA 4WG3A 2Y6OA 2CKOA 1Q5KA 4J8MA 4F9AA 1I09A 3NUNA 3QRKA 4NFNA 4IM0A 4NW5A 4ZZMA 4L9IA 5ANOA 2LAVA 3R7OA 3WIGA 4CQGA 1M52A 4IWPA 1JVPP 4QQCA 4DH8A 4RIYA 3W2QA 4RRVA 4JG7A 1GY3A 3VUMA 4D2SA 2CGUA 4W4VA 3OC1A 4XOYA 4QMNA 3AD4A 4G9RA 4I5PA 4XV3A 5AFVA 3F2RA 4W8DA 1LEZA 2XA4A 2BZHB 2C3IB 5HG7A 4D2WA 2Z02A 5CU2A 2P4IA 2REIA 1OITA 3R9NA 3U9NA 4AS0A 3PPKA 2CHLA 5AEPA 4RIWB 4KBCA 4XNEA 2BALA 5IQDA 5CSVA 2R3JA 1E1VA 5D1JA 3AC2A 3U9CA 2QOHA 4CFWA 3PXYA 3OUKA 3PIZA 2OXDA 2JIUA 3CBLA 3FXWA 3NNVA 3PTGA 4R3PA 3GCQA 3KF7A 4ITJA 3KULA 4FOCA 5IA0A 4W4XA 4S32A 3LMIA 1XH8A 4C3RA 2UW5A 4TRLA 3H10A 2UVYA 4RIOA 2YLEA 3UIXA 4NCTA 5D11A 4RGJA 5FXSA 3V6RA 3W1FA 1OMWA 3KMWA 4UMQA 3OWLA 3VBYA 3VS5A 3OOMA 5DRDA 5L4QA 4ZMEA 4RSSA 5CANA 3PXZA 4JQ8A 5E8XA 5CSPA 2OO8X 4A9SA 4XCUA 2UUEA 5CEQA 1ZLTA 2WTJA 4O6LA 2YZLA 2PY3A 2YZAA 3HA6A 4K2RA 3UVRA 2YABA 3K5VA 4DAWA 2UZUE 5A3XA 4AUAA 4DBNA 4QMLA 3HAVA 4ZSEA 3TNWA 1ZZLA 3TACA 4E3CA 4I3ZA 3FL4A 4DEBA 3IDCA 4ZTNA 4YLLA 4BB4A 3KB7A 2CLQA 5HOAA 2X0GA 5A4EA 3TNQB 2HW7A 1U59A 2VZ6A 4P5ZA 5AWMA 4FZDB 4CFMA 3FHIA 3ANRA 5C8MA 3MJ2A 3BEAA 3PJ2A 1GJOA 1UU3A 5CSWA 5JGBA 4BKYA 3Q9XA 5CS6A 2PVRA 2X81A 4RC4A 2DS1A 2ZDTA 3G51A 4I24A 4IH8A 1H25A 1MRUA 2JIVA 2B9HA 3QBNA 4EONA 1JNKA 1BI7A 3KULB 2J0MB 4ZTQA 3PJ8A 3N4UA 3QQLA 2ESMA 4DC2A 2JFLA 4O91A 2XK7A 4D2RA 2FVDA 2BVAA 2VTLA 4G3DA 1LUFA 3SGCA 3CCNA 2XB7A 4GRBA 3BU6A 2VWYA 4W9WA 5E8YA 4BDGA 5I9ZA 2CKPA 5C4KA 5HHWA 4XRJA 5J7HA 3AC5A 2BKKA 4YTCA 1T45A 3OUNB 5EKOA 1M7NA 3QC9A 5HTIA 3O23A 2HENA 3ZU7A 2BZKB 3VW8A 2J0JA 2YCFA 4FKPA 1J7LA 3Q96A 5KUPA 4DFUA 3PDTA 5DVRA 2OIBA 3D7TB 3LMGA 2UW9A 3I81A 3O8PA 3P7BA 5IA5A 4ALVA 3CIKA 3H3CA 3KK8A 3PA3A 2H34A 4D0XA 4E6CA 3QQUA 5JN2A 3R1YA 4JDIA 4DHFA 3RAKA 4G17A 5JSMA 2XNEA 3NYOA 3Q52A 4TXCA 4F1MA 5ANGA 2YWVA 3KREA 2GS2A 2WELA 3U6HA 2QODA 3SDJA 4LV5A 3DTWA 1WMKA 2OJFE 5CQWA 3FZTA 2F7ZE 3KQ7A 3VS4A 5AV1A 2FB8A 3MB7A 2X39A 2J5FA 4FF8A 4I4EA 4WD5A 4QMWA 3EQRA 3IDPA 2YAAA 4F1TA 5FTQA 3ZO4A 5J5SA 2GHGA 3KCFA 3W16A 2WIHA 4BDEA 5A4CA 4TYGA 2PZ5A 4JDJA 3MY0A 4TZRA 3UO4A 1OPLA 2OJ9A 2UZTA 4FVPA 4IVCA 2A1AB 4YMJA 3QD3A 3D4QA 4DH3A 4GT4A 4LUDA 3FI8A 3F5GA 4K0YA 4M15A 4XG4A 3QCXA 3D5VA 4YC6A 3P0MA 3UO5A 3LXNA 2F2UA 5KHXA 4EKKA 2B4SB 2VTRA 4M13A 5GZ9A 2YJSA 3DBFA 4YNEA 3W32A 1W0XC 5HBJA 4AWIA 4PY1A 4D0WA 3HA8A 3HRCA 5I9VA 4QMQA 4WSYA 4RWKA 3BLRA 2PHKA 3ZXZA 4S34A 2RSVA 1BX6A 4NTTA 4E6AA 4ANLA 4FNXA 4ZSAA 3IONA 5J9ZA 3DAJA 4IACA 1L3RE 1PY5A 4XG7A 4PDSA 4BZDA 3ERKA 4Q5HA 3L1SA 1UU8A 3EHAA 3BX5A 3RKBA 4BDKA 4F6SA 5HU9A 3FI4A 4IM2A 1XBAA 5F9EA 3V8WA 4HYSA 1KE8A 4P4CA 4G34A 2PPQA 2VTSA 3BQCA 3OROA 4MXOA 3U8WA 4BCOA 4DEHA 3BRBA 4WNPA 3MSSA 1JKSA 1MUOA 5EHOA 5LJJA 3CQEA 3R9DA 4P90A 2IWIA 2XIRA 4RWIA 2AYPA 5FGKA 3DNDA 3F5PA 3I79A 2OIQA 1Y91A 2O0UA 4YC3A 3WZUA 3IECA 3MH3A 2JDTA 4JBOA 4ZTHA 5ETFA 4L3JA 3R73A 3FI3A 4OTPA 3SV0A 4RPVA 3NS9A 1H26A 4V05A 3W2RA 3GCPA 4E4MA 2QLUA 4BR3A 1PJKA 2GTNA 3BV2A 3HECA 5T6KA 4D2TA 1H27A 5EI8A 3DXQA 3AT4A 4MF1A 3OD6X 5HICA 1RDQE 5L2TA 1B39A 4F4PA 4TT7A 5L3AA 4HVHA 2UVZA 4BHZA 2BR1A 5FXQA 3PY1A 3VN9A 5I9XA 3M1SA 5BVEA 4FV5A 2Q0NA 3CTHA 4E5WA 4FSUA 4NK9A 4DLJA 2ITWA 3AMBA 3TTJA 4EC8A 1SNXA 2I0HA 2J0IA 5K5NA 3LFSA 4GJ2A 1M2QA 2XKFA 2XRUA 3GOPA 1H1QA 3ORLA 4G5JA 4WNKA 3MPMA 5FLFA 1UWJA 2I0VA 2I40A 3SAYA 5IH4A 2CLXA 5JGDA 2HWPA 4JIAA 4N4SA 5EI2A 2QHNA 1NXKA 4MF0A 2OH4A 3I6UA 4KIKA 3QRTA 4QMTA 1YOMA 4AOJA 5T3QA 2CN8A 3DXNA 2ZDUA 2W4OA 1SZMA 3DJ5A 3E3PA 3MFUA 3PG3A 5HVKA 4AZEA 3POZA 2G15A 3UJGA 3UNJA 4OGRA 3WF8A 4EZ5A 4M67A 4NUSA 3R8LA 1I44A 1OKVA 4IB0A 5HTCA 3EJ1A 1H0WA 3RCJA 4H36A 4HYIA 3QTRA 3FKNA 3KXZA 4BYIA 3SG8A 2UZEA 4UB7A 5DYJA 2Z7QA 1BMKA 5CEIA 3ZFXA 3ZH8A 3TJDA 4NW6A 4CVAA 2WFYA 3O7LD 2EVAA 2PUUA 3E62A 3BZ3A 2CJMA 3IW4A 4PDOA 5L2SA 4KKEA 4DLIA 3ZMMA 4YBKA 2VTAA 2Z7LA 3FPQA 3V6SA 4JDKA 4KUJA 1UA2A 2F7EE 2OZAA 3QA8A 3CQUA 3TNIA 4EBVA 3R9RA 4U5JA 2P0CA 4U80A 4P5QA 4X7QA 2PUNA 2R3QA 3VBQA 5JFVA 2E9PA 5AP2A 4AGWA 4R1YA 3C5UA 1YXUA 1YXSA 2CGVA 3I0OA 3BIZA 1J7UA 4RC3A 4PUZA 4DEIA 4O0XA 4GG7A 3EN7A 5H3QA 5ACKA 5CEMA 1DAYA 3ZONA 1CM8A 3FSKA 5B2KA 1NA7A 5AP5A 4RJ5A 2ETMA 3WYYA 2C30A 5IQEA 4UWYA 1JKLA 1U5RA 4ZLYA 3ZC5A 4D55A 5F1ZA 2JAMA 3QWJA 3MH1A 3PVBA 4FTAA 2J50A 5TT7A 1YXTA 4MXCA 4O27B 3LHJA 3DDPA 5M53A 3QUPA 4N6ZA 4DH7A 2QOQA 2I0YA 2X1NA 1AGWA 1CSNA 3AMAA 2VTMA 2YDKA 2EUFB 2OIDA 3PRFA 4ZTLA 4C37A 3AQVA 2F4JA 4PNIA 3GU7A 4HZRA 4Z9LA 3SXRA 5M44A 2RFNA 3K54A 1DI9A 3JVSA 4FL3A 3S00A 4J71A 4HGEA 5AUTA 5C01A 3KXNA 4B7TA 4JBPA 4YPDA 4LRKA 3W8QA 3AC4A 4W4YA 5IZFA 5JQ5A 2FSTX 4KBKA 3TXOA 2FH9A 2W1GA 4TWPA 2ZV9A 2WMTA 3LAUA 4E8AA 4EH9A 2YA9A 4CLJA 3NX8A 4MHAA 3BV3A 4EYMA 2R2PA 1UWHA 5AP6A 3KL8A 4DT9A 4BKJA 4G16A 1MQ4A 4FKVA 4LM5A 3VNTA 4AW1A 5KO1A 5DI1A 3RP9A 4ZTRA 3ZO1A 3M2WA 1YVJA 3QQGA 5HE2A 5EDPA 3U51A 1SYKA 3HZTA 3ZFYA 3A7HA 3ORKA 2QONA 3KCKA 3NW6A 2ERZE 3PP1A 4J52A 4FSRA 5HVJA 4CD0A 4O7ZA 4PF4A 4GFGA 4GV1A 3R2YA 4C35A 4DGNA 3RPOA 4TYJA 3P9JA 3QD4A 3QTWA 4AGUA 2IW8A 3L9PA 4JI9A 5E8WA 3BYSA 2KULA 3KXHA 5I9UA 1PXNA 2FO0A 4DITA 5IQAA 4B99A 4DGLC 5C8NA 3A61A 3ANQA 2OWBA 3DKOA 4IAAA 2GSFA 4GH2A 3AC1A 4Q9SA 4KINA 3VWAA 4U3ZA 3ZHPC 3OXIA 4QTAA 4NWMA 3KGAA 1SM2A 4IDVA 1ZYCA 4RX8A 4GT3A 5LMAA 3G9LX 3NYXA 1XH6A 2WMBA 3PXQA 4W4WA 5CLPA 4ZY4A 4U0IA 4PRJA 2X7FA 2YCQA 3IQ7A 3PVWA 1PXLA 1XH9A 2XJ0A 4L67A 4PL4A 3WF5A 4A9TA 4BBMA 1OGUA 4EOMA 3QLFA 5IQIA 2B9JA 4F6UA 5H8EA 2WMVA 3ZDIA 5AP0A 5FEEA 2NP8A 1R39A 2PMIA 3LQ5A 1REJA 5KX8A 2XK8A 5L8KA 3D2KA 4ANBA 4O96A 2UZVA 3HRBA 3RNYA 1RJBA 2WIPA 3L9NA 2IZTA 1FBNA 1NVRA 3VW6A 4GCJA 3SLSA 3NUAA 2OJIA 1FINA 3FZRA 4G9CA 2OU7A 3B2TA 4UZDA 4NKSA 2PVJA 4RQVA 2VWIA 1W83A 4GSBA 5B0XA 3LOKA 5HX8A 4UWCA 3DY7A 2UW7A 3P79A 3NDMA 4ANOA 1XHAA 4EHEA 1V0PA 4JOAA 3GP0A 3GU5A 4DA5A 1HCLA 4MXAA 4CMOA 4C02A 4CCBA 4TNBA 3E63A 4OTGA 2C68A 4BDIA 2WKMA 4CMTA 3DLSA 2VAGA 3C0HA 4FTQA 4ASZA 4R7BA 5E9EA 3BE2A 4CEGA 4YJRA 2G9XA 4FG7A 4TL0A 5JRQA 4RBLA 4EK8A 3AD5A 3IW5A 3FKOA 3LJ1A 4BGHA 4LGHA 4Z7HA 3Q6WA 4PTGA 4AOIA 4HVIA 4QNAA 1ND4A 2R3NA 3ATTA 1R0PA 3PZHA 1LR4A 5E8UA 4O7NA 4ITIA 3ZLYA 4BYJA 2J6MA 4BDBA 3GXLA 5AX3A 4L7SA 4UWBA 5KMOA 3W2PA 3R7GA 4YZDA 4WHZA 4H58A 3RPSA 3R8PA 4F9YA 1V0OA 4NH1A 4IZYA 2XJ1A 3VF9A 1MRYA 4FTTA 3AT3A 2JDVA 4U3YA 3ORIA 4HCVA 4PX6A 3MDYA 2XS0A 3O50A 4WG5A 4B8MA 2QOOA 3BU3A 3LXKA 4YLJA 2GS7A 4L68A 5LWNA 4JG8A 1XO2B 4EUUA 1ZMUA 4WG4A 1YWRA 4XG8A 4FSTA 5AV0A 2YITA 5AX9A 1R0EA 1SNUA 4FX3A 3FZOA 4BDHA 2H6DA 3MVLA 4U44A 3MFTA 3IOKA 3R1QA 1SVEA 3FEGA 3DFCB 5DT3A 2JBOA 2X2MA 4UXLA 2H8HA 5LCKA 3LCSA 3FMDA 4XEYA 4RLKA 4KIPA 4BTFA 2UZNA 4EH5A 3EIDA 4K77A 5J1VA 3PPZA 3K3JA 3VO3A 5KHWA 5DR2A 2J4ZA 3TL8A 4IFGA 2PVMA 3VS0A 5K5XA 3GC8A 4IAIA 4LGGA 3R63A 2XVDA 1Q24A 3QRJA 4V0GA 5CI7A 3LLAA 4IHPA 2JDSA 2YHVA 4LOQA 4O0UA 3FYKX 5L2IA 3EQDA 5AP3A 1MP8A 4QT1A 3SXFA 2QKWB 3PE2A 3QRUA 3R21A 4NCTC 5CWZA 3QGWA 4U42A 5DEYA 4QP4A 1NY3A 1KV1A 4HNFA 3PIYA 3ZYAA 3R30A 5CT7A 2ITPA 2UVXA 4S33A 4JAIA 4E4XA 2EU9A 4OLIA 5IPJA 3NCGA 4L3PA 2YCSA 5B2MA 3BGZA 3GQIA 3BI6A 4JX7A 4L6QA 3VBWA 1URWA 4GK2A 5FEQA 4FT5A 4FVQA 3BYMA 4QYGA 2XKCA 3R7UA 4IEBA 4CZTA 3VBXA 5KCVA 4IM3A 4JR3A 4M7IA 5AADA 4FODA 3NR9A 5AUWA 2ZYBA 3TT0A 5M08A 2X7OA 5JFXA 5AP4A 3VBTA 2JKQA 2PZPA 3ULIA 3F2NA 4C38A 1UVRA 3KMMA 4Z16A 3RINA 5BVDA 4EHZA 1M14A 3AGMA 3RI1A 3P86A 5M06A 3NNXA 3BHUA 4L46A 2WTKC 1MQBA 4LFIA 4FE2A 1U46A 1O6YA 2FSMX 2GQGA 4FTIA 1OL5A 2B0QA 2GMXA 4RJ8A 4PDYA 4HPTE 4OTQA 5LXMA 4MNEB 1YHVA 5KMNA 1LP4A 2RG5A 3I5NA 1F0QA 1IA8A 4KRDA 5FP5A 3N51A 5CAQA 1FGKA 2BTSA 2C5NA 4ACCA 4BZOA 3MV5A 3NAXA 4R3RA 1UNLA 5DGZA 2QOCA 3F66A 1YHWA 4JS8A 3BYVA 4ENYA 1F5QA 1P14A 3G6GA 4BFMA 3KK9A 4ZXTA 2UW6A 3UZPA 3ZUVA 4NEUA 3ETAA 3VS2A 3MJ1A 4D5KA 1P5EA 2CGWA 3Q6UA 3QQKA 3QTIA 4TWNA 3PXRA 3BE9A 1VJYA 3W2CA 2ZV2A 3R7VA 3LM5A 1H07A 5F4NA 5IKWA 4C4FA 4FT9A 3AC8A 4GFOA 4TNDA 3UDBA 2W1FA 2V22A 1FGIA 3HEGA 3H9FA 3OCGA 2HY81 2WMAA 3PG1A 4U43A 4QMOA 5DE2A 2QR7A 3WZJA 3UOJA 3NW7A 2VO7A 2OK1A 3Q9WA 1J3HA 2R3HA 3IW8A 4LL5A 4NM3A 2R0IA 2WQNA 1PYEA 2BRMA 4EZ3A 2W1HA 3UZRA 2R4BA 5CZHA 2VGPA 3H0YA 3NSZA 2C0IA 3SC1A 4MH7A 4RX7A 3EFJA 2GU8A 3JY9A 3PY0A 2GPHA 4I0TA 1ZY4A 3ENMA 3TZ8A 1O6KA 3FMLA 2OLCA 1U5QA 4CTCA 1JSTA 4PMTA 4FIIA 3BLHA 4TWCA 4L52A 3ODYX 5HD4A 4O82A 2IVVA 4FV2A 4DE4A 4ZSGA 3WI6A 4BC6A 5AM6A 4AZTA 3CLYA 1RQQA 2I0EA 4D4YA 3D7ZA 4F70A 4ZTMA 3ZSGA 3MN3A 4DEAA 4MQ2A 4RJ7A 1UNHA 5DN3A 4X6QC 1S9JA 2BILB 4PQNA 4RJ6A 4YZNA 3HVCA 4WT6A 4JQEA 4YHJA 3VQUA 4BCMA 3ZC6A 3MGYA 4BIEA 3QZFA 3HLLA 5KKRC 3GUBA 3FLZA 4IDTA 2XH5A 3I6WA 3CY2A 3OWPA 5M56A 4D28A 1ERKA 1Q97A 4AXAA 4ANSA 4V01A 3QYWA 4XLIA 3C4FA 4I5CA 4OBPA 3S95A 4R7IA 3ORZA 3REPA 5LMKC 4FEWA 3COHA 4PPAA 3ROYA 3RAIA 1CKJA 2ZOQA 4DEGA 5JKGA 5DG5A 4N57A 4FKUA 2VGOA 3Q04A 4MWIA 4BCQA 1B6CB 4ARKA 2R3MA 3IGGA 4FUXA 3P23A 5E1EA 2X8EA 4JJRA 3PLSA 4B9DA 1H28A 2AC3A 4PP9A 2W4JA 4D9TA 3FC1X 2YERA 3DFAA 4XG6A 3IK3A 4YJVA 5D12A 4QMYA 2QOBA 3JPVA 1K9AA 5AP7A 3CD3A 3DZOA 3OXZA 4NSTA 3VUIA 3CGFA 4G6OA 3EQPA 2WOTA 3MS9A 5E8VA 2UV2A 3F3VA 2PMOX 3ZS5A 3EB0A 3OXTA 5HO8A 4Q2AA 1WBTA 2QU6A 2OI4X 2GFCA 4FL2A 3QTZA 2R3LA 4APPA 2UZOA 4IANA 4IW0A 5EFQA 2GQSA 5K3YA 4FBXA 2BKZA 2B53A 1JSUA 2YDJA 3HV5A 4R5YA 2BCJA 4G3CA 3MVMA 4KSQA 5KE0A 2CN5A 3F3TA 1STCE 4JQ7A 4BCPA 1FMOE 3D9VA 1H4LA 5J87A 4BRXA 1OUYA 3ZDUA 4EOQA 4HW7A 3QQFA 2XBJA 1OB3A 5BX0A 2XEZA 2UZDA 3A4PA 2NO3A 4XP3A 4E6DA 4OTFA 4RX5A 5ITAA 1OUKA 1BL7A 2GFSA 2AUHA 3LFCA 4FSWA 4J53A 5HESA 4E4NA 1KOBA 3NYNA 4F7SA 1AD5A 1PW2A 3R01A 1G8SA 4FTOA 2ITXA 4II5A 5CU6A 4IZ7A 4GFMA 3C51A 4EOOA 4K1BA 3ZUTA 4FKQA 1BKXA 4PNKA 3WF7A 2VX1A 3H0ZA 4YURA 4PDPA 3DA6A 4UMPA 3MESA 2OJGA 2Y4IB 3QA0A 3C4XA 4FC0A 1QPDA 1REKA 4ACMA 1XBBA 3CS9A 4MBIA 4RG0A 3TIYA 4U7ZA 1GIIA 3ALNA 4FZFB 1WBVA 3EFKA 4FOBA 3QYZA 4FSNA 3S0OA 4Q5EA 4EEVA 2ITNA 5CI6A 5JFSA 5FBNC 1XWSA 4C57A 1Y6BA 2ETRA 1J7IA 3MY5A 4NZWB 2GQRA 4DT8A 4OTWA 3C4ZA 3QZGA 3NYVA 2WMWA 1OL1A 3KXMA 5M09A 1FQ1B 3Q3BA 3VUKA 4QPMA 1ZOGA 5D7VA 4E1ZA 2WQBA 4MBJA 4YZBA 4UX9A 1WBOA 4TYHB 4CFXA 3ORPA 3GVUA 5M55A 1BYGA 1PXMA 3P7CA 4LI5A 3FQEA 2FA2A 2NRUA 4FTLA 4XP2A 2ERKA 1GZKA 4O7SA 2YEXA 5EQPA 5ETIA 2HXQA 3ZSHA 3FLNC 4BTJA 5BUJA 3AC3A 4EUTA 3DTCA 4QTEA 3EH9A 1M2PA 4FK6A 5GHVA 4EWQA 4FV4A 2A2AA 2BUJA 4KIOA 2OZOA 3ZOSA 3T9IA 5CQUA 4EOJA 4C33A 3EKNA 3TEIA 5IG1A 4BHNA 2BZIB 3UIUA 2CNVA 3D15A 3R04A 3ODZX 3OCBA 3LJ0A 3MY1A 4IJ9A 3P5KA 3CD8A 2R3GA 5A6OA 4JRVA 2C1AA 4FI1A 4X6RA 4RFZA 3A62A 3OVVA 3WE8A 3R2BA 4QRCA 1KE7A 1VYZA 4NKAA 5DEWA 4DEEA 4O0SA 4BIDA 4O84A 2XIZA 2P3GX 2C6OA 1PMEA 4H3PA 2RFSA 4HPUE 5LCJA 2VTTA 4C58A 3FMNA 5L8LA 2BROA 3E8CA 4NYEA 2UW4A 4NM7A 4QP2A 3LW0A 4OAUC 4J98A 4EC9A 4BDDA 4IX3A 3VHEA 1ZARA 4CFUA 2J9MA 3PRIA 5F94A 5HKMA 2ACXA 5FEDA 1TKIA 2WMUA 3MVJA 4X2NA 5G6VA 3ZM4A 4EH3A 4K11A 5DR6A 4U79A 1KSWA 4U8ZA 3DK3A 3WZKA 2PSQA 3ZEPA 5AA9A 5JQ8A 3P4KA 3RMFA 4ZJVA 4QYFA 2BDJA 4CKRA 1IRKA 3FMEA 2O2UA 4C61A 5ANKA 2W1IA 3IG7A 2J0LA 2CDZA 2W1DA 4RZWA 3FXZA 2PE2A 1OECA 3H9RA 4J8NA 4YHTA 4IFCA 2W1EA 4C3PA 3ORNA 5A14A 2XRWA 4EZ7A 4F64A 2WTVA 2DQ7X 3DCVA 3KN5A 2GNJA 3CR0A 4FSQA 3ZRKA 4IAYA 5C26A 3OOGA 3PJCA 2XNNA 3PA4A 4MXYA 3CPBA 4ANMA 3GFWA 4C4JA 3LCDA 4EORA 5GZAA 1SMHA 4GIIA 4O7RA 4QP7A 4XV9A 2YN8A 3BEGA 2J5EA 4CGAA 1OIRA 4QQJA 5L6OA 3C4CA 4YPSA 2VWZA 4KKHA 3BBWA 2O3PA 4MNEA 1YWVA 2B55A 3SW7A 2R3PA 1UNGA 3ZLSA 4EYJA 2XP2A 3IW6A 4TN6A 1HOWA 3U54A 4C36A 4GVAA 4K6ZA 3DPKA 5J8IA 2JFMA 4ANNA 3B8RA 2V7AA 4TYIA 5M4FA 3FZSA 2Z60A 4AE9A 4O0WA 3SQQA 3IKAA 3OFMA 5A6NA 1WBSA 3MIYA 1Z5MA 3D94A 4M69A 1Q8TA 4DFLA 1XJDA 4FV6A 3HMOA 3OS3A 2QQ7A 2JC6A 5BYZA 3QUDA 3F7ZA 4U6RA 4ORKA 4JT3A 3F61A 3OMVA 4A06A 2EXEA 5FQDC 4X3FC 4YSJA 4MVFA 2XNMA 4BICA 3G33A 4I21A 3PPJA 3EN5A 2O63A 3MH2A 4LL0A 3R00A 4IVDA 5D9HA 4FGBA 1Q41A 1H01A 4GEOA 3OEZA 2JBPA 3IW7A 3P1AA 2ZMDA 5IMEA 5JMSA 2PK9A 4XH6A 4EH8A 3FLYA 5FDPA 4A4LA 4QQTA 3LVPA 3ZZEA 2OXXA 4BI0A 3KRJA 4KIQA 4WIHA 4FV1A 4MXZA 4X2GA 5I0BA 3OCTA 4H1MA 3PXKA 5CTPA 5JEBA 2XKEA 4Y46A 2ITQA 3SX9A 4AGDA 2Q83A 3L9MA 5HE0A 3TZMA 4AX8A 5IA4A 2WMXA 1H1SA 4FYNA 3I1AA 3JUHA 3TV7A 2QHMA 2IVUA 3GENA 3ZRLA 1OVEA 2OG8A 5I9YA 3WF6A 4DG0E 1Q99A 2Z2WA 1VEBA 2C69A 4QP3A 2CPKE 2YM8A 4QYYA 4E6QA 5CF8A 4TYEA 1IG1A 4IC8A 4UYAA 4JX3A 4O0TA 5CALA 3V01A 4F7LA 2W96B 3ZLXA 1TQIA 3EFWA 4L42A 3HMIA 2JDRA 2QOIA 4E4LA 1XH5A 1J1CA 4TKSA 3CTQA 4OTDA 2CSNA 2XBAA 2I6LA 1B38A 2A19B 4FUYA 5CU4A 5L6PA 3DGKA 2XNGA 3FLWA 4I20A 2ZVAA 4PPBA 5GJGA 3QXOA 1ZWSA 2X6DA 4ZOGA 4XLVA 3MI9A 5E92A 4ALUA 2VTQA 3PE1A 4PMSA 4RIXB 3ULZA 1K3AA 2PVKA 3G5DA 4E5AX 4USEA 2OXYA 4ZK5A 2B52A 1DAWA 5I3RA 1U54A 4G1WA 2JITA 5FP6A 1QPJA 2ONLA 2FSOX 3ITZA 4O38A 4O21A 3RAHA 4FKLA 4FIHA 1H1WA 4CT1A 4BBEA 1R3CA 2HCKA 4OT6A 5CY3A 2VNYA 5E90A 4XHKB 4FIGA 4RJ4A 4YJOA 3R7EA 4UZHA 4ASEA 4DBXA 3EQHA 1FOTA 1PMNA 3V5QA 3W2SA 4GKIA 3UOHA 2VU3A 2IW6A 1QPEA 4Z3VA 5AR5A 2IVTA 2PVNA 4NL0A 3RNIA 2R3KA 2IN6A 3BLQA 2QVSE 2UZLA 3RPYA 4H05A 3G9NA 5TKDA 3ORXA 4F65A 4CZYB 1XKKA 1OIUA 2IJMA 3OCSA 3WF9A 2W05A 2XEYA 4KNBA 3NMUF 4IVAA 4HVDA 3L8VA 2BRBA 5AIKA 3PA5A 3LFQA 2QCSA 3D5XA 1OPKA 3MBLA 4Y72A 2CNUA 4IWQA 3T8OA 3R02A 5IDPA 2VTNA 4BTKA 1YOJA 5EYCA 3GU6A 3EQFA 2CNQA 2X2KA 3COKA 4FEQA 4R8QA 4HGSA 1FPUA 4FYOA 1TVOA 4KBAA 3RK5A 1UU9A 3OY1A 4EOLA 4RLLA 1ZZ2A 2G2FA 1H0VA 3R8ZA 4AQCA 5JZJA 3E87A 3E92A 3F6XA 3ZEWA 1G8AA 2A0CX 1Q8WA 3THBA 4C4IA 3TWJA 4EQMA 5L8JA 2ITVA 2VX3A 4I41A 4AN9A 2RFDA 3E7VA 4FSYA 3DJ7A 3OW3A 5DNRA 4AE6A 5HBHA 2ZAZA 3C4WA 2V7OA 3BGQA 3IDBA 5DOSA 4JLCA 1H8FA 5AR2A 3R8MA 4JBVA 2W5HA 2B7AA 3QTXA 4YZ9A 3V5JA 5GINE 2PWLA 5AJQA 5BVOA 3Q9ZA 4FNYA 4XUFA 4MEDA 4ZSJA 3FZPA 3RJCA 3UG2A 4HZSA 4EK6A 5HNGA 4AZFA 3DLZA 4G3EA 4F1OA 5FRIA 5BNJA 5HZNA 3QGYA 3R9OA 5IUGA 5J9YA 4FNWA 4WKQA 5KBQA 1W8CA 3R8VA 2F7XE 3TIZA 5FD2A 4ZS4A 3HV7A 4F7NA 3AGLA 1GOLA 3RHKA 3HKOA 3LFFA 3GT8A 4J96A 4U81A 5CYIA 4YJQA 3UYTA 2B9IA 5EH0A 3UNZA 3UTOA 2YM5A 4TYHA 3K5UA 2BHEA 1PXJA 3OG7A 3WBLA 2C6KA 2IO6A 4NM5A 2O5KA 3SOAA 4AFEA 3ROCA 2CMWA 3F3ZA 1PXIA 3FMJA 5EI6A 4BCHA 3Q5IA 4KABA 4BGQA 3DKCA 3D0EA 4DFZE 2WAJA 4FKWA 4I22A 4EL9A 3PWDA 5DLSA 5CAPA 4R6VA 3GCSA 3RALA 3QFVA 3K2LA 4XG2A 3TJCA 3WOWA 3IO7A 3D5WA 5BUIA 3PSBA 2BPMA 5FDXA 2JIIA 3HMNA 5CSXA 2X6EA 2XYNA 3ELJA 5DT0A 2JDOA 4QTCA 2Y0AA 3O17A 4RWJA 2XMYA 4ZY6A 2EXCX 1GIHA 3TKUA 4D1ZA 3FMMA 3P78A 2GDOA 3NEWA 4I5HA 1UV5A 1OKZA 4DCEA 2WTCA 2BDWA 1JSVA 5DR9A 3I0QA 4AP7A 4AN3A 4CZUA 4FG9A 2C3LA 4DYMA 4CCUA 3ORTA 3C7QA 2OZAB 5AP1A 3UPXA 2QNJA 4BI1A 4FMQA 3TUDA 4M66A 4BCNA 3MFRA 3E93A 3FBVA 4D4VA 1SVGA 4UALA 4BDAA 3B2WA 4HYHA 4R7HA 5HG5A 1XQZA 1YDTE 3PUPA 3QCYA 4DTAA 3SRVA 3PVUA 5F20A 1SVHA 5H8GA 3V51A 4F0FA 4JL9A 2NRYA 5H9BA 3TM0A 4KS8A 2YACA 5JK3A 2W5BA 4L01A 4O1OA 2Y4PA 2YM3A 2RG6A 4OBOA 2BAKA 5CXHA 1Q61A 5C9CA 3VS6A 3UE4A 4BIBA 4N70A 3VJNA 4HOKA 4IAKA 4I23A 4BBFA 5EK7A 3CJGA 3O8UA 4BN1A 5CNOA 4LQMA 1FVRA 3DXPA 1PKDA 4X2KA 1Q3DA 4PV0A 5A54A 4AN2A 2QOKA 5CAUA 4ZIMA 5IH5A 5CXZA 4FK3A 3MPAA 3OEFX 3HAMA 2C6EA 3ET7A 3UGCA 2C0TA 2EXMA 2YM4A 1KE5A 4RT7A 5TO8A 3RVGA 1GAGA 3HMMA 3HNGA 3DNEA 5EHLA 4PP7A 3BWFA 2XM8A 3OY3A 4UY9A 2FUMA 1GZNA 3KU2A 3EZVA 3EN9A 4BDFA 4EHGA 5AMNA 2BZJA 1OIQA 2YIXA 3OW4A 3W33A 5KBRA 5FTGA 1QMZA 2WTDA 3DU8A 3LCOA 1Z57A 4PL3A 3TTIA 3JVRA 5CVFA 2J0KA 5LMBA 1M7QA 1YXVA 5KMKA 4QTDA 3FXXA 2VN9A 1Z9XA 5CENA 4K8AA 4K33A 4KB8A 4P7EA 4UMTA 1Q3WA 1V0BA 4LG4A 5AV3A 3LIJA 4BWXA 3QHRA 5H8BA 3FPMA 5AAGA 2VTPA 5BUEA 2ZM1A 4EOPA 2V5QA 3GBZA 3KEXA 4BGGA 4CYJA 3FY2A 4QMVA 5J95A 5BPYA 2ITTA 5DMZA 2XK9A 4B6LA 3HUBA 3DBQA 2WNTA 4EK3A 5AV4A 2Q0BA 4XG9A 3R71A 2CGXA 4FTNA 5CU3A 1EH4A 5LQFA 2Z8CA 2WMSA 3BHHA 3DBCA 4KA3A 1CKPA 4I4FA 3E88A 2VWUA 5TOZA 1BUHA 1G3NA 3F5UA 1FVTA 2VNWA 4ONAA 4E5BA 4G5PA 4F7JA 5LOHA 5LVMA 1QL6A 4ZJIA 4DGMA 5M4CA 2P2IA 4F9CA 2VTOA 2XM9A 4RX9A 3LLTA 5DIAA 4Y73A 3TUBA 3N4VA 2XIKA 2VO0A 2W17A 2YM7A 4DINA 2OFUA 2YLFA 3NCZA 4F0GA 3HP5A 3O8TA 4APCA 4M69B 3E8NA 2PMLX 3W10A 4D58A 3JR1A 3TKHA 1RW8A 5IQFA 4W9XA 4S31A 1Q8ZA 3EQCA 2H9VA 4C0TA 5JT2A 1JLUE 4Y95A 2VTIA 4ACHA 4TW9A 2X9EA 4F09A 3UP2A 3HV6A 5EW3A 3NNWA 4XJ0A 1OIYA 5CVGA 1ATPE 3CGOA 2VO6A 4G3FA 1ZMWA 4ANQA 4YR8A 4L3LA 2YJRA 3WARA 4XX9A 3T3VA 2GHMA 4IB3A 2R3RA 4FICA 4H3BA 3BYUA 4C8BA 3R6XA 4UBAA 5EKNA 1YRPA 5HCXA 5HG8A 2QURA 2XIYA 2GNLA 4Y85A 1LEWA 3GU8A 3C1XA 3WE4A 4O2PA 3HV3A 4PTEA 5IEVA 4FT3A 2GNHA 1ZYSA 3EMGA 4ZJJA 1H08A 5BMSA 2JAVA 3Q2JA 3VIDA 4YUQA 3QTSA 5E4HA 2GHLA 2JKKA 5BVFA 2BRGA 4X2JA 4QPAA 5KMIA 1FVVA 3NGAA 5DFPA 4KS7A 4F0IA 1ZYJA 3GCUA 4FV8A 4G6NA 4ACGA 4OW8A 5CASA 1PXOA 3NZ0A 4OAVB 3VUDA 4D2PA 4F6WA 3ZXTA 1W7HA 3NUXA 3HV4A 5D7AA 4YZCA 2WU6A 3BHTA 3FL5A 3Q53A 3R1NA 5E8TA 3SA0A 4ZAUA 5EG3A 4UYNA 4EH4A 2J2IB 5D41A 4PWNA 4H39A 4V04A 2VWWA 5DWRA 3W8LA 5K4JA 3QL8A 2R0UA 4MBLA 2GNIA 5AM7A 3C0IA 3QAME 4Y5QA 3Q4UA 2JLDA 1NT2A 3ZCLA 5AR7A 2PULA 4AZWA 5C8KA 4HCUA 4U45A 3H9OA 4FTCA 4XP0A 2WB8A 2ZB0A 3A7IA 4YJSA 4A07A 3PP0A 2GS6A 4R5SA 4LGDA 4O7YA 3JY0A 1IEPA 1U54B 4OTHA 3TN8A 1ZXEA 2RFEA 1ZAOA 5BVKA 4Z55A 2EB2A 5FM3A 3WZDA 3NVMB 3QUEA 2QI8A 2PE1A 1S9IA 4HNIA 4DN5A 4QQ5A 1JQHA 3F9NA 3B8QA 2IW9A 3H4JA 1YHSA 2QC6A 2VTHA 3TCPA 2FSLX 1PRYA 2BMCA 3GEQA 1IA9A 3RM6A 2YIWA 4I0SA 4AGCA 3COIA 1R78A 3R22A 3TKIA 2OF2A 4R77A 4FZ7A 4WRSA 3Q4ZA 4I6QA 3R7YA 3VUTA 2WGJA 4D9UA 2YAKA 2WQOA 4RWLA 3JXWA 3FLSA 2YIRA 5HE1A 3KKVA 3O0GA 4C4HA 4IX4A 4DTKA 1V1KA 4Q9ZA 2WMRA 4FKRA 1PKGA 2OBJA 2IZUA 3BHVA 5M57A 1E1XA 5KMMA 3PSDA 5JZNA 5IQBA 2SRCA 3D83A 3RBWA 4NIFA 4NJDA 4YSMA 5AUYA 4UXQA 1BL6A 4IX6A 3U87A 4F99A 3PSCA 5J79A 3DAEA 4MYGA 3RPRA 1NVQA 2OF4A 4BKZA 5HX6A 3LQ8A 3NLBA 4O0VA 4RVMA 1O9UA 2PVFA 5GJDA 3SXSA 2WEIA 3ZTXA 5A4QA 5CF4A 1WVWA 2PE0A 3LXLA 3D7TA 3QCSA 1VYWA 4WBOA 4FL1A 4JG6A 5ETAA 3ZM9A 5LVLA 4XG3A 3BBTB 5C03A 4KD1A 3VS7A 2XKDA 4MD8E 3CP9A 3M11A 5CEOA 2VX0A 3UOLA 2AC5A 3QWKA 4WSQA 4HYUA 3IGOA 2FGIA 3DJ6A 3DT1A 5EYDA 5BVNA 1PMVA 3PY3A 3CQWA 4RFMA 4RIYB 2HZ0A 2QLQA 3KF4A 4IIRA 2C6DA 5BMMA 4AF3A 3GOKA 4WO5A 2BDFA 3V8TA 3G6HA 2VWBA 4DTBA 3SW4A 2F49A 4IJPA 3LFAA 2E9UA 3W55A 2CCHA 4DFYA 5IDNA 4UMUA 4IB5A 5K4IA 1JKKA 4GYGA 4LYNA 4JVGA 4KKGA 2F57A 1JWHA 4OR5A 5HO7A 3FC2A 1FMKA 2WZJA 3HRFA 3T3UA 1HCKA 4CKIA 4YTHA 4J97A 3PLAE 3H30A 3PJ1A 2QU5A 3DB8A 3UQFA 4IXPA 4CV8A 4BWKA 2QG7A 2XNOA 4F9BA 1IAJA 5DT4A 3EWHA 3NIZA 5DHJA 4LRJA 2C4GA 5I9WA 1P2AA 3UC4A 4NIFB 3MFSA 4CTBA 1UU7A 2YM6A 4NTSA 2F9GA 3C50A 3UVPA 3NUSA 4EH7A 2PL0A 2WU7A 2YDIA 2WTKB 3UOKA 3QD2B 3RAWA 2W4KA 1ZMVA 4O86A 2PVHA 3F88A 5BYLA 3E3BX 3QXPA 1WFCA 4PTCA 4CNHA 4CG9A 3KN6A 1QCFA 2IVSA 3HX4A 1JBPE 3IOPA 1GZOA 4O7VA 4ZEGA 3BU5A 1R1WA 1TQPA 3FE3A 3QCQA 4QPSA 3D5UA 3G2FA 4O7WA 1APME 4C3FA 3OTVA 5IUIA 2BAQA 4FT7A 3E64A 5FM2A 5IUHA 2E9VA 3F3WA 5EYKA 3KY2A 4FV9A 1PXKA 5I4NA 5CEPA 4RQKA 4AACA 4YTFA 1OKWA 3VRYA 3LFBA 3PYYA 4ZZNA 4L43A 2UZWE 2Y8OA 4FG8A 4A7CA 2WHBA 3E5AA 3QX2A 4BCJA 4C2WA 1YI3A 4FV3A 4GT5A 4MCVA 3I7BA 3C0GA 4FTKA 4A4OA 3TDVA 5ANDA 2BHHA 4CMUA 5LMKA 4KIKB 4FKIA 3VBVA 2R9SA 2X7GA 4CFNA 4QO9A 3WYXA 4RA4A 4QMMA 4MAOA 3QD0A 4RFYA 5E8ZA 3GC7A 4H1JA 1Y57A 1U4DA 3TZ9A 4UN0C 5IA2A 4O6EA 3ZLWA 4C2VA 4XYFA 4BCKA 2HK5A 2I1MA 2VTJA 2G1TA 4PL5A 2WQMA 4FIFA 5EDQA 3DKFA 3OZ6A 4I1ZA 3U4UA 4GKHA 4XBRA 4IZAA 3EQIA 3OBJA 4OUCA 5IA1A 3PWYA 4RVKA 4BF2A 3EFLA 4CQEA 4DFNA 3D2IA 3I5ZA 1PXPA 5FUTA 1TQMA 1GIJA 3CEKA 3FSFA 3T9TA 5AAEA 2X2LA 2BRNA 2B54A 2R5TA 2UW8A 4IADA 4O81A 3AXWA 3QKMA 2YWPA 2OW3A 3R0TA 4DH5A 4JRNA 4Y83A 5ANIA 4E26A 2OFVA 4EKLA 4AW5A 3ID6C 5CT0A 2G01A 3SHEA 4XOZA 4I0RA 2O64A 3MA6A 4QTBA 5BVWA 5IQCA 3CKWA 3KRWA 5M07A 3UIMA 4D1XA 4GJ3A 1Y8GA 1ZYLA 3HYHA 2HZ4A 2OSCA 4DGGA 3FWQA 2V0DA 4WNOA 3DQXA 2WD1A 3V5LA 2ETKA 5EQYA 2IZSA 5T68A 4M14A 3DZQA 2HELA 2C3JA 5AUVA 4MX9A 5FTOA 5G1XA 4ASDA 2PUPA 5M4IA 3F3UA 4TTHB 3FMHA 3QTUA 4FKOA 3S1HA 4IB1A 1J1BA 5DRBA 4EH2A 2CCIA 3EYHA 3TNHA 5AR3A 4CRSA 2BFYA 3F69A 4NJ3A 2XZSA 3OT8A 4DFBA 2YISA 3QC4A 3CKXA 3UBDA 3HP2A 4YJPA 4M3QA 5E1SA 4FEUA 3E8EA 4EK4A 4AA4A 4F63A 5CF5A 5HD7A 4MK0A 3OT3A 2GCDA 3VHKA 3MB6A 5GIOE 4NT4A 4R1VA 1YDSE 3F7WA 4HJOA 1XH4A 4JBQA 5DH3A 1OPJA 4ZS0A 2C5OA 5ETCA 5GJFA 5I3OA 2VUWA 3Q32A 3V5TA 4IQ6A 4LUEA 2Y7JA 4FKTA 3LCKA 4G3GA 3Q4TA 3VS1A 4GS6A 4EJ7A 3S3IA 1WAKA 4FZ6A 4LOOA 1W82A 3DQWA 4B0GA 3NPCA 4UMRA 2ITYA 2RL5A 3RM7A 2DUVA 2PUIA 4JR7A 3VUHA 1CKIA 3AMYA 4BCFA 4USFA 5EM5A 1Y8YA 4M0ZA 3CPCA 3U55A 3LFNA 3MWUA 4RC2A 2QD9A 3DAKA 4USDA 4YO4A 4A9UA 3RTPA 3S4QA 2XF0A 3I60A 2EWAA 3LCTA 4XMOA 3HUCA 4W8EA 2XIXA 5DPVA 5GNKA 3TG1A 3FQHA 4F9WA 2I7QA 4CFVA 2WPAA 4FKGA 1K2PA 3ORMA 4AZVA 4DEDA 4BDCA 3C4EA 2C6TA 2HIWA 3KRXA 1BLXA 1CMKE 3OP5A 4GU6A 3UODA 4B4LA 5IEYA 1AQ1A 3PXFA 1A48A 2W0JA 4D2VA 3EZRA 3TZ7A 3R28A 4GK3A 4WUAA 3CXWA 5TE0A 4NU1A 2VO3A 3EN6A 3TUCA 5E8SA 3SD0A 4K18A 5LARA 2FYSA 5ANJA 4WRGA 3A99A 3BWJA 4FGRA 3CTJA 5AUXA 5HCZA 2WEVA 2X8IA 2P55A 3V3VA 2IG7A 2WOUA 5KMJA 4WOVA 4YZMA 3SKCA 3UZTA 4O22A 1GZ8A 5ANEA 3VUGA 3NUPA 4UV0A 3QLGA 1VR2A 4AA0A 3NVKI 3VRZA 3F5XA 2YFXA 2KTYA 3FV8A 4GYIA 4FIEA 2ZV7A 2ZJWA 4XBUA 3GGFA 5AIRA 4ZTSA 3RZFA 5EYMA 1YOLA 3L9LA 5L6WL 1IR3A 4BY9E 4EI4A 4XRLA 3UQCA 5EM8A 5HGIA 2ZV8A 1ZOHA 1OKYA 2YCRA 5TR6A 3FAAA 3KFAA 4DH1A 2VD5A 4YNOA 4ZZOA 3UC3A 2VRXA 3R8UA 4GK4A 4M84A 5A4TA 5HCYA 5A9UA 3EL8A 3NAYA 5DBXA 1L8TA 4KRCA 1Q62A 2OKRA 2QOLA 3BQRA 3VC4A 4D5HA 3AG9A 4ERKA 2A27A 4IBMA 4JAJA 3UYSA 3ACKA 1BI8A 5H2UA 3Q9YA 3M42A 3A2CA 4EK5A 2W1ZA 4HGLA 3KRRA 2RGPA 3EKKA 4EQUA 2ONLC 5K0XA 2HWOA 2JKOA 3O2MA 4LRMA 2DWBA 1JOWB 2HZIA 4GIHA 4OTRA 4YO6A 4IX5A 2B1PA 2UZBA 2XK6A 3KC3A 4GL9A 3LE6A 5AAFA 4CKJA 5HTBA 4HCTA 4A9RA 3KXXA 2E9NA 3L8SA 3C5IA 4AW0A 4CXAA 2QO2A 3RK7A 5CNNA 3I7CA 4X3FA 3R7IA 2W99B 2XUUA 4MQ1A 5KZIA 3FY0A 3ZBFA 2BIKB 4YHFA 5IMXA 4I92A 3Q5ZA 1KUTA 3MW1A
chains in the Genus database with same CATH superfamily
4CT2A 3PVGA 3R1SA 1W98A 3GNIB 3OWJA 4S2ZA 5EW9A 3PIXA 3FKLA 3AT2A 5HNBA 1WBPA 1XH7A 3GB2A 3P7AA 4PMMA 1T46A 1E9HA 2BAJA 4X0MA 2RKUA 5B2LA 2J90A 1O6LA 3RHXA 4Y5HA 4U9AA 3ALOA 3RK9A 4O1PA 4CSVA 4L00A 2R3FA 3DDQA 3ZZWA 1LPUA 4O0YA 4FZAB 2BTRA 3GFEA 2HZNA 4C34A 4E93A 4P2KA 3NWWA 5HG9A 4DCAA 2X0PA 4QNYA 4BTMA 4EQCA 1H24A 5CX9A 4Y8DA 4Z7GA 5L2WA 3ZBXA 3POOA 4PMPA 2W9FB 2QG5A 2JKMA 4OTIA 2DYLA 5JH6A 1DM2A 3TDWA 4IE9A 4G6LA 3UVQA 5FG8A 1ST4A 2IZRA 3DB6A 4JDHA 3VS3A 5J9LA 3O51A 2YIQA 3HL7A 4QMZA 4BCIA 3GC0A 4CV9A 3ZSIA 2C3KA 3IS5A 4I6HA 2ITOA 3DS6A 4CLIA 4E20A 5IH6A 3PZEA 3A4OX 4ZY5A 5JGAA 3QZIA 2VWXA 3FYJX 2WO6A 3UMXA 3WZEA 3EOCA 3C13A 5EOLA 3C9WA 5J7BA 3U6JA 2W9ZB 1URCA 2CKQA 1GNGA 3QKKA 4ZMFA 2GTMA 2QOFA 4QYEA 4MKCA 2PTKA 3TV4A 5F95A 4JMQA 4L45A 5EDRA 1W2DA 3BYOA 3VAPA 2RF9A 4JNWA 5HE3A 1YQJA 2HAKA 3CY3A 2R3OA 4IWDA 4EHVA 2JEDA 2NNWB 4YBJA 3QHWA 3L8XA 4XV2A 3NUUA 3G90X 3E7OA 4C7TA 1CTPE 4DFXE 3DK7A 4FIJA 5IQHA 3D14A 4FR4A 3RWQA 1MRVA 4OBQA 2PZRA 3MVHA 4N0SA 3VJOA 5LWMA 4QD6A 2IPXA 4IVBA 3QQJA 2C5VA 2WQEA 4V0GB 4ASXA 3MTLA 2Z7SA 5EM7A 4BDJA 5FBOA 2JD5A 4YTIA 2QKRA 5C1QB 4FKSA 1H1PA 3SVVA 5GZ8A 4O0RA 4UEUA 1X8BA 4QMUA 4KWPA 4IAFA 4G2FA 1YKRA 1YXXA 4RMZA 3FHRA 4I6BA 2Y6MA 3UNKA 2P33A 5IA3A 3MPTA 1KWPA 1DS5A 2H96A 4IC7A 3DKGA 4MNFA 4OT5A 3MA3A 4QYHA 3GCVA 4YU2A 5B7VA 3QZHA 4EWHA 1CDKA 3QU0A 4FSMA 2PZYA 3UG1A 1PF8A 3FDNA 3HDNA 4J99A 4D4RA 3GC9A 4TWOA 4XV1A 4M12A 1Q4LA 3II5A 3EN4A 4FRFA 5HVYA 2Z7RA 2XALA 3BPRA 3ZO3A 4EOSA 4DF3A 4GMYA 2VV9A 5D10A 5K0KA 1OM1A 4AT3A 4X21A 2Y4IC 4CG8A 4FEXA 3LZBA 3EYGA 5HNIX 1KE9A 1W2FA 3OF0A 4BCGA 1H1RA 4WNMA 2EB3A 4AT4A 5J5TA 2W06A 1ZY5A 2F2CB 4BZNA 2HXLA 3FMKA 4MXXA 5GIPE 3DBEA 4J7BA 4D1SA 4QP1A 1DI8A 2OGVA 3OWKA 3ZFMA 2GNGA 4R78A 3NRMA 4GUEA 3A7JA 1XBCA 3QTQA 4FTJA 4H3QA 3UP7A 4BL1A 5KMLA 4LOPA 2QO9A 5IEXA 3NFGB 3FI2A 3HMPA 3LKMA 3GQLA 1TZDA 2ZM3A 4JIKA 4RVLA 4RIXA 1VZOA 5HIBA 3Q60A 5IU2A 4B8LA 5C27A 1WVYA 3GI3A 4NM0A 4HVGA 4TPTA 3CJFA 3UMWA 4KSPA 2XK4A 4EOKA 3BELA 4IAZA 4X3JA 5EQEA 1G5SA 1QPCA 2ZB1A 4ACDA 1PHKA 4CRLA 4ENXA 1WBWA 1YW2A 4GVJA 1NVSA 2O65A 4IWOA 5CZIA 4G31A 5JRSA 4ALWA 1RE8A 2X8DA 4FVRA 2XNPA 1YDRE 1IASA 2LGCA 3AD6A 2W1CA 4QP6A 4J1RA 5A4LA 3UDZA 2B9FA 5CF6A 4FTMA 4A9YA 4E73A 4KAOA 4YP8A 5KNJA 4LMNA 3VQHA 4TY1A 1ZOEA 4I6FA 4YJUA 5CU0A 3CC6A 3R9HA 3TV6A 4CYIA 4A4XA 4L8MA 3HGKA 3QALE 5CSHA 4ITHA 3FQSA 1OL6A 5AR8A 3UO6A 4M8TA 2C5YA 2X4FA 4HVSA 2X9FA 3R83A 1ZYDA 2OH0E 3V04A 3ZUUA 4FA2A 5BQ0A 4LDTA 4QMPA 4EH6A 3AOXA 2WTWA 4M68A 4FT0A 4X2FA 2PYWA 3A7FA 1JKTA 2XJ2A 2C1BA 3KMUA 4DG2E 4C59A 3O96A 5HLWA 2W7XA 3A60A 3RCDA 1W84A 2ITUA 5HEZA 3O7LB 4I5MA 2V62A 4IZ5A 2BIYA 4FSZA 3S2PA 3VF8A 5HLNA 5AR4A 4C62A 3KRLA 4RJ3A 2HYYA 5KKRB 3KVWA 4WA9A 2PVLA 5JFWA 4MD7E 4RIWA 3ACJA 3W0NA 2G2IA 3DOGA 5LVPA 2G2HA 4FEVA 5EM6A 2ITZA 5KZ0A 3ZO2A 2XCHA 3LJ2A 4MTAA 4LMUA 1J91A 2C6LA 3LFDA 3MIAA 4S30A 5HO6A 4YJNA 3P08A 3MH0A 3NIEA 3EL7A 1A06A 2R64A 4J95A 3WIKA 4M97A 5LVOA 5HI2A 3PFQA 3GU4A 4FTRA 5I5ZA 2UW0A 4AAAA 3Q2MA 1A9UA 3VONA 3QX4A 5HU3A 2J51A 3OBGA 4NFMA 3SOCA 4LV8A 3F2AA 4MD9E 4M0YA 4WBBB 4GG5A 4U40A 3RPVA 1Y6AA 5HLPA 4O83A 3JYAA 2E2BA 3DV3A 1F3MC 3L8PA 3Q4CA 3ATSA 2C6MA 4QP9A 2PZIA 2XNBA 1XR1A 3W18A 3QF9A 3OHTA 4U41A 2C6IA 2WXVA 3MYGA 4AQKA 2Y9QA 4JXFA 3CE3A 3G0EA 3G15A 3A8WA 3V8SA 3F82A 4ZLZA 4BI2A 3EQGA 4C4EA 3LPBA 4QMXA 3UQGA 5E91A 3N4TA 5EHYA 2P2HA 1OI9A 4I93A 3ZRMA 2WMQA 3G0FA 2R3IA 4FKJA 3RWPA 1UKIA 3LFEA 3SRVB 2BFXA 3U6IA 3UPZA 3BGPA 3EQBA 4PPCA 3E8DA 2PU8A 5CAOA 2HW6A 2ZMCA 1YWNA 4XS2A 2R7IA 4AT5A 5IISA 4RVTA 5EW8A 3QKLA 1PMUA 3QRIA 4GW8A 4FTUA 3KXGA 4HGTA 1WBNA 5AUZA 5FWKK 5CEKA 5M4UA 3A8XA 4ZLOA 5IF1A 5L2QA 2JGZA 3V5WA 4AU8A 2A4LA 3ENHA 5J1WA 3FLQA 1JPAA 4X3FB 3LMHA 4L44A 3SG9A 3V5PA 4I94A 4R3CA 2GNFA 3COMA 3TI1A 2NPQA 3UIBA 5TF9A 1M17A 4C4GA 3LXPA 4D4SA 4F08A 3CSVA 5AA8A 1KE6A 1KV2A 4K9YA 5E7RA 5HIEA 5C4LA 4ZSLA 5BYYA 3JS2A 4BWPA 4YLKA 1PYXA 4EJNA 3HDMA 1OBDA 4E7WA 5LVNA 2W5AA 5K9IA 2C5XA 3KVXA 2BRHA 2HOGA 1OZ1A 4AG8A 5HORA 5IQGA 1YI6A 2UW3A 4ERWA 4AW2A 3DBDA 5HIDA 5EOBA 3VULA 2E9OA 3DK6A 4ZP5A 1WVXA 1OL2A 4O2ZA 1H00A 4AOTA 5HQ0A 4RA5A 3VVHA 5ICPA 4IMYA 5ACBC 4GUBA 3IPHA 4O7LA 2XCKA 3NW5A 1Q8YA 4MWHA 3BKBA 2O8YA 2RIOA 2OICA 3W2OA 5FXRA 1JAMA 2QO7A 1KOAA 3BHYA 4N6YA 3RGFA 4AA5A 4WUNA 3I4BA 4GU9A 5AUUA 4BVUA 4O7TA 4AFJA 5DA3A 3WILA 2V55A 3FUPA 4FV0A 4YGAA 2C47A 3RZBA 2J7TA 2CKEA 2R7BA 3NNUA 4CFFA 5AV2A 2PMNX 4YC8A 1OL7A 4EOIA 5HBEA 2XK3A 2ZM4A 3BCEA 1M2RA 3U4WA 3LQ3A 3OTUA 1P4FA 4EBWA 3N9XA 4YJTA 5CVHA 2QR8A 3KA0A 1WCCA 3NUYA 4L7FA 4DGOA 1UKHA 3MTFA 2XYUA 2OJJA 3K3IA 4FV7A 4O4CA 5M51A 4RZVA 1IAHA 2X0QA 4FNZA 2X4ZA 3O71A 4DG3E 3A7GA 1WZYA 1NW1A 2HY0A 1OBGA 1Q8UA 2C0OA 1YI4A 3QQHA 5A46A 4QOXA 3PJ3A 3FJQE 2VWVA 4QP8A 3TYKA 4U97A 3TNPC 3FZ1A 4L53A 5CAVA 1P4OA 2PVYA 2WTIA 3LM0A 4ID7A 2XAOA 2YIYA 1ZRZA 4QMSA 4AZSA 4WG3A 2Y6OA 2CKOA 1Q5KA 4J8MA 4F9AA 1I09A 3NUNA 3QRKA 4NFNA 4IM0A 4NW5A 4ZZMA 4L9IA 5ANOA 2LAVA 3R7OA 3WIGA 4CQGA 1M52A 4IWPA 1JVPP 4QQCA 4DH8A 4RIYA 3W2QA 4RRVA 4JG7A 1GY3A 3VUMA 4D2SA 2CGUA 4W4VA 3OC1A 4XOYA 4QMNA 3AD4A 4G9RA 4I5PA 4XV3A 5AFVA 3F2RA 4W8DA 1LEZA 2XA4A 2BZHB 2C3IB 5HG7A 4D2WA 2Z02A 5CU2A 2P4IA 2REIA 1OITA 3R9NA 3U9NA 4AS0A 3PPKA 2CHLA 5AEPA 4RIWB 4KBCA 4XNEA 2BALA 5IQDA 5CSVA 2R3JA 1E1VA 5D1JA 3AC2A 3U9CA 2QOHA 4CFWA 3PXYA 3OUKA 3PIZA 2OXDA 2JIUA 3CBLA 3FXWA 3NNVA 3PTGA 4R3PA 4FJVA 4DDGA 3GCQA 3KF7A 4ITJA 3KULA 4FOCA 5IA0A 4W4XA 4S32A 3LMIA 1XH8A 4C3RA 2UW5A 4TRLA 3H10A 2UVYA 4RIOA 2YLEA 3UIXA 4NCTA 5D11A 4RGJA 5FXSA 3V6RA 3W1FA 1OMWA 3KMWA 4UMQA 3OWLA 3VBYA 3VS5A 3OOMA 5DRDA 5L4QA 4ZMEA 4RSSA 5CANA 3PXZA 4JQ8A 5E8XA 5CSPA 2OO8X 4A9SA 4XCUA 2UUEA 5CEQA 1ZLTA 2WTJA 4O6LA 2YZLA 2PY3A 2YZAA 3HA6A 4K2RA 3UVRA 2YABA 3K5VA 4DAWA 2UZUE 5A3XA 4AUAA 4DBNA 4QMLA 3HAVA 4ZSEA 3TNWA 1ZZLA 3TACA 4E3CA 4I3ZA 3FL4A 4DEBA 3IDCA 4ZTNA 4YLLA 4BB4A 3KB7A 2CLQA 5HOAA 2X0GA 5A4EA 3TNQB 2HW7A 1U59A 2VZ6A 4P5ZA 5AWMA 4FZDB 4CFMA 3FHIA 3ANRA 5C8MA 3MJ2A 3BEAA 3PJ2A 1GJOA 1UU3A 5CSWA 5JGBA 4BKYA 3Q9XA 5CS6A 2PVRA 2X81A 4RC4A 2DS1A 2ZDTA 3G51A 4I24A 4IH8A 1H25A 1MRUA 2JIVA 2B9HA 3QBNA 4EONA 1JNKA 1BI7A 3KULB 2J0MB 4ZTQA 3PJ8A 3N4UA 3QQLA 2ESMA 4DC2A 2JFLA 4O91A 2XK7A 4D2RA 2FVDA 2BVAA 2VTLA 4G3DA 1LUFA 3SGCA 3CCNA 2XB7A 4GRBA 3BU6A 2VWYA 4W9WA 5E8YA 4BDGA 5I9ZA 2CKPA 5C4KA 5HHWA 4XRJA 5J7HA 3AC5A 2BKKA 4YTCA 1T45A 3OUNB 5EKOA 1M7NA 3QC9A 5HTIA 3O23A 2HENA 3ZU7A 2BZKB 3VW8A 2J0JA 2YCFA 4FKPA 1J7LA 3Q96A 5KUPA 4DFUA 3PDTA 5DVRA 2OIBA 3D7TB 3LMGA 2UW9A 3I81A 3O8PA 3P7BA 5IA5A 4ALVA 3CIKA 3H3CA 3KK8A 3PA3A 2H34A 4D0XA 4E6CA 3QQUA 5JN2A 3R1YA 4JDIA 4DHFA 3RAKA 4G17A 5JSMA 2XNEA 3NYOA 3Q52A 4MUQA 4TXCA 4F1MA 5ANGA 2YWVA 3KREA 2GS2A 2WELA 3U6HA 2QODA 3SDJA 4LV5A 3DTWA 1WMKA 2OJFE 5CQWA 3FZTA 2F7ZE 3KQ7A 3VS4A 5AV1A 2FB8A 3MB7A 2X39A 2J5FA 4FF8A 4I4EA 4WD5A 4QMWA 3EQRA 3IDPA 2YAAA 4F1TA 5FTQA 3ZO4A 5J5SA 2GHGA 3KCFA 3W16A 2WIHA 4BDEA 5A4CA 4TYGA 2PZ5A 4JDJA 3MY0A 4TZRA 3UO4A 1OPLA 2OJ9A 2UZTA 4FVPA 4IVCA 2A1AB 4YMJA 3QD3A 3D4QA 4DH3A 4GT4A 4LUDA 3FI8A 3F5GA 4K0YA 4M15A 4XG4A 3QCXA 3D5VA 4YC6A 3P0MA 3UO5A 3LXNA 2F2UA 5KHXA 4EKKA 2B4SB 2VTRA 4M13A 5GZ9A 2YJSA 3DBFA 4YNEA 3W32A 1W0XC 5HBJA 4AWIA 4PY1A 4D0WA 3HA8A 3HRCA 5I9VA 4QMQA 4WSYA 4RWKA 3BLRA 2PHKA 3ZXZA 4S34A 2RSVA 1BX6A 4NTTA 4E6AA 4ANLA 4FNXA 4ZSAA 3IONA 5J9ZA 3DAJA 4IACA 1L3RE 1PY5A 4XG7A 4PDSA 4BZDA 3ERKA 4Q5HA 3L1SA 1UU8A 3EHAA 3BX5A 3RKBA 4BDKA 4F6SA 5HU9A 3FI4A 4IM2A 1XBAA 5F9EA 3V8WA 4HYSA 1KE8A 4P4CA 4G34A 2PPQA 2VTSA 3BQCA 3OROA 4MXOA 3U8WA 4BCOA 4DEHA 3BRBA 4WNPA 3MSSA 1JKSA 1MUOA 5EHOA 5LJJA 3CQEA 3R9DA 4P90A 2IWIA 2XIRA 4RWIA 2AYPA 5FGKA 3DNDA 3F5PA 3I79A 2OIQA 1Y91A 2O0UA 4YC3A 3WZUA 3IECA 3MH3A 2JDTA 4JBOA 4ZTHA 5ETFA 4L3JA 3R73A 3FI3A 4OTPA 3SV0A 4RPVA 3NS9A 1H26A 4V05A 3W2RA 3GCPA 4E4MA 2QLUA 4BR3A 1PJKA 2GTNA 3BV2A 3HECA 5T6KA 4D2TA 1H27A 5EI8A 3DXQA 3AT4A 4MF1A 3OD6X 5HICA 1RDQE 5L2TA 1B39A 4F4PA 4TT7A 5L3AA 4HVHA 2UVZA 4BHZA 2BR1A 5FXQA 3PY1A 3VN9A 5I9XA 3M1SA 5BVEA 4FV5A 2Q0NA 3CTHA 4E5WA 4FSUA 4NK9A 4DLJA 2ITWA 3AMBA 3TTJA 4EC8A 1SNXA 2I0HA 2J0IA 5K5NA 3LFSA 4GJ2A 1M2QA 2XKFA 2XRUA 3GOPA 1H1QA 3ORLA 4G5JA 4WNKA 3MPMA 5FLFA 1UWJA 2I0VA 2I40A 3SAYA 5IH4A 2CLXA 5JGDA 2HWPA 4JIAA 4N4SA 5EI2A 2QHNA 1NXKA 4MF0A 1G8KA 2OH4A 3I6UA 4KIKA 3QRTA 4QMTA 1YOMA 4AOJA 5T3QA 2CN8A 3DXNA 2ZDUA 2W4OA 1SZMA 3DJ5A 3E3PA 3MFUA 3PG3A 5HVKA 4AZEA 3POZA 2G15A 3UJGA 4BJJB 2IF8A 4OGRA 3UNJA 3WF8A 4M67A 4EZ5A 4NUSA 3R8LA 1I44A 1OKVA 4IB0A 3P5JC 3TMOA 5HTCA 3EJ1A 1H0WA 3RCJA 4H36A 4HYIA 3QTRA 3FKNA 3KXZA 4BYIA 3SG8A 2UZEA 4UB7A 5DYJA 2Z7QA 1BMKA 5CEIA 3ZFXA 3ZH8A 3TJDA 4NW6A 4CVAA 2WFYA 3O7LD 2EVAA 2PUUA 3E62A 3BZ3A 2CJMA 3IW4A 4PDOA 5L2SA 4KKEA 4DLIA 3ZMMA 4YBKA 2VTAA 2Z7LA 3FPQA 3V6SA 4JDKA 4KUJA 1UA2A 2F7EE 2OZAA 3QA8A 3CQUA 3TNIA 4EBVA 3R9RA 4U5JA 2P0CA 4U80A 4P5QA 4X7QA 2PUNA 2R3QA 3VBQA 5JFVA 2E9PA 5AP2A 4AGWA 4R1YA 3C5UA 1YXUA 1YXSA 2CGVA 3I0OA 3BIZA 1J7UA 4RC3A 4PUZA 4DEIA 4O0XA 4GG7A 3EN7A 5H3QA 5ACKA 5CEMA 1DAYA 3ZONA 1CM8A 3FSKA 5B2KA 1NA7A 5AP5A 4RJ5A 2ETMA 3WYYA 2C30A 5IQEA 1OGYA 4UWYA 1JKLA 1U5RA 4ZLYA 3ZC5A 4D55A 5F1ZA 2JAMA 3QWJA 3MH1A 3PVBA 4FTAA 2J50A 5TT7A 1YXTA 4MXCA 4O27B 3LHJA 3DDPA 5M53A 3QUPA 4N6ZA 4DH7A 2QOQA 2I0YA 2X1NA 1AGWA 1CSNA 3AMAA 2VTMA 2YDKA 2EUFB 2OIDA 3PRFA 4ZTLA 4C37A 3AQVA 2F4JA 4PNIA 3GU7A 4HZRA 4Z9LA 3SXRA 5M44A 2RFNA 3K54A 5BV3A 1DI9A 3JVSA 4FL3A 3S00A 4J71A 4HGEA 5AUTA 5C01A 3KXNA 4B7TA 4JBPA 4YPDA 4LRKA 3W8QA 3AC4A 4W4YA 5IZFA 5JQ5A 2FSTX 4KBKA 3TXOA 2FH9A 2W1GA 4TWPA 2ZV9A 2WMTA 3LAUA 4E8AA 4EH9A 2YA9A 4CLJA 3NX8A 4MHAA 3BV3A 4EYMA 2R2PA 1UWHA 5AP6A 4AXEA 3KL8A 4DT9A 4BKJA 4G16A 1MQ4A 4FKVA 4LM5A 3VNTA 4AW1A 5KO1A 5DI1A 3RP9A 4ZTRA 3ZO1A 3M2WA 1YVJA 3QQGA 5HE2A 5EDPA 3U51A 1SYKA 3HZTA 3ZFYA 3A7HA 3ORKA 2QONA 3KCKA 3NW6A 2ERZE 3PP1A 4J52A 4FSRA 5HVJA 4CD0A 4O7ZA 4PF4A 4GFGA 4GV1A 3R2YA 4C35A 4DGNA 3RPOA 4TYJA 3P9JA 3QD4A 3QTWA 4AGUA 2IW8A 3AKJA 3L9PA 4JI9A 5E8WA 3BYSA 2KULA 3KXHA 5I9UA 1PXNA 2FO0A 4DITA 5IQAA 4B99A 4DGLC 5C8NA 3A61A 3ANQA 2OWBA 3DKOA 4IAAA 2GSFA 4GH2A 3AC1A 4Q9SA 4KINA 3VWAA 4U3ZA 3ZHPC 3OXIA 4QTAA 4NWMA 3KGAA 1SM2A 4IDVA 1ZYCA 4RX8A 4GT3A 5LMAA 3G9LX 3NYXA 1XH6A 2WMBA 3PXQA 4W4WA 5CLPA 4ZY4A 4U0IA 4PRJA 2X7FA 2YCQA 3IQ7A 3PVWA 1PXLA 1XH9A 2XJ0A 4L67A 4PL4A 3WF5A 4A9TA 4BBMA 1OGUA 4EOMA 3QLFA 5IQIA 2B9JA 4F6UA 5H8EA 2WMVA 3ZDIA 5AP0A 5FEEA 2NP8A 1R39A 2PMIA 3LQ5A 1REJA 5KX8A 2XK8A 5L8KA 3D2KA 4ANBA 4O96A 2UZVA 3HRBA 3RNYA 1RJBA 2WIPA 3L9NA 2IZTA 1FBNA 1NVRA 3VW6A 4GCJA 3SLSA 3NUAA 2OJIA 1FINA 3FZRA 4G9CA 2OU7A 3B2TA 4UZDA 4NKSA 2PVJA 4RQVA 2VWIA 1W83A 4GSBA 5B0XA 3LOKA 5HX8A 4UWCA 3DY7A 2UW7A 3P79A 3NDMA 4ANOA 1XHAA 4EHEA 1V0PA 4JOAA 3GP0A 3GU5A 4DA5A 1HCLA 4MXAA 4CMOA 4C02A 4CCBA 4TNBA 3E63A 4OTGA 2C68A 4BDIA 2WKMA 4CMTA 3DLSA 2AQXA 2VAGA 3C0HA 4FTQA 4ASZA 4R7BA 3BE2A 5E9EA 4CEGA 4YJRA 2G9XA 4FG7A 4TL0A 5JRQA 4RBLA 4EK8A 3AD5A 3IW5A 3FKOA 3LJ1A 4BGHA 4LGHA 4AAYA 4Z7HA 3Q6WA 4PTGA 4AOIA 4HVIA 4QNAA 4AXDA 1ND4A 2R3NA 3ATTA 1R0PA 3PZHA 1LR4A 5E8UA 4O7NA 4ITIA 3ZLYA 4BYJA 2J6MA 4BDBA 3GXLA 5AX3A 4DHJA 4L7SA 4UWBA 5KMOA 3W2PA 3R7GA 4YZDA 4WHZA 4H58A 3RPSA 3R8PA 4F9YA 1V0OA 4NH1A 4IZYA 2XJ1A 2NYAA 3VF9A 1MRYA 4FTTA 3AT3A 2JDVA 4U3YA 3ORIA 4HCVA 4PX6A 3MDYA 2XS0A 3O50A 4WG5A 4B8MA 2QOOA 3BU3A 3LXKA 4YLJA 2GS7A 4L68A 5LWNA 4JG8A 1XO2B 4EUUA 1ZMUA 4WG4A 1YWRA 4XG8A 4FSTA 5AV0A 2YITA 5AX9A 1R0EA 1SNUA 4FX3A 3FZOA 4BDHA 2H6DA 3MVLA 4U44A 3MFTA 3IOKA 3R1QA 1SVEA 3FEGA 3DFCB 5DT3A 2JBOA 3UDSA 2X2MA 4UXLA 2H8HA 5LCKA 3LCSA 3FMDA 4XEYA 4RLKA 4KIPA 4BTFA 2UZNA 4EH5A 3EIDA 4K77A 5J1VA 3PPZA 3K3JA 3VO3A 5KHWA 5DR2A 3W0RA 2J4ZA 3TL8A 4IFGA 2PVMA 3VS0A 5K5XA 3GC8A 4IAIA 2XARA 4LGGA 3R63A 2XVDA 1Q24A 3QRJA 4V0GA 5CI7A 3LLAA 4IHPA 2JDSA 2YHVA 4LOQA 4O0UA 3FYKX 5L2IA 3EQDA 5AP3A 1MP8A 4QT1A 3SXFA 2QKWB 3PE2A 3QRUA 3R21A 4NCTC 5CWZA 3QGWA 4U42A 5DEYA 4QP4A 1NY3A 1KV1A 4HNFA 3PIYA 3ZYAA 3R30A 5CT7A 2ITPA 2UVXA 4S33A 4JAIA 4E4XA 2EU9A 4OLIA 5IPJA 3NCGA 4L3PA 2YCSA 5B2MA 3BGZA 3GQIA 3BI6A 4JX7A 4L6QA 3VBWA 1URWA 4GK2A 5FEQA 4FT5A 3KIOC 4FVQA 3BYMA 4QYGA 2XKCA 3R7UA 4IEBA 4CZTA 3VBXA 5KCVA 4IM3A 4JR3A 4M7IA 5AADA 4FODA 3NR9A 5AUWA 2ZYBA 3TT0A 5M08A 2X7OA 5JFXA 5AP4A 3VBTA 2JKQA 2PZPA 3ULIA 3F2NA 4C38A 1UVRA 3KMMA 4Z16A 3RINA 5BVDA 4EHZA 1M14A 3AGMA 3RI1A 3P86A 5M06A 3NNXA 3BHUA 4L46A 2WTKC 1MQBA 4LFIA 4FE2A 1U46A 1O6YA 4QDVA 2FSMX 2GQGA 4FTIA 1OL5A 2B0QA 2GMXA 4RJ8A 4PDYA 4HPTE 4OTQA 5LXMA 4MNEB 1YHVA 5KMNA 1LP4A 2RG5A 3I5NA 1F0QA 1IA8A 4KRDA 5FP5A 3N51A 5CAQA 1FGKA 2BTSA 2C5NA 4ACCA 4BZOA 3MV5A 3NAXA 4R3RA 1UNLA 5DGZA 2QOCA 3F66A 1YHWA 4JS8A 3BYVA 4ENYA 1F5QA 1P14A 3G6GA 4BFMA 3KK9A 4ZXTA 2UW6A 3UZPA 3ZUVA 4NEUA 3ETAA 3VS2A 3MJ1A 4D5KA 1P5EA 2CGWA 2X0OA 3Q6UA 3QQKA 3QTIA 4TWNA 3PXRA 3BE9A 1VJYA 3W2CA 2ZV2A 3R7VA 3LM5A 1H07A 5F4NA 5IKWA 4C4FA 4FT9A 3AC8A 4GFOA 4TNDA 3UDBA 2W1FA 2V22A 1FGIA 3HEGA 3H9FA 3OCGA 2HY81 2WMAA 3PG1A 4U43A 4QMOA 5DE2A 2QR7A 3WZJA 3UOJA 3NW7A 2VO7A 2OK1A 3Q9WA 1J3HA 2R3HA 3IW8A 4LL5A 4NM3A 2R0IA 2WQNA 1PYEA 2BRMA 4EZ3A 2W1HA 3UZRA 2R4BA 5CZHA 2VGPA 3H0YA 3NSZA 2C0IA 3SC1A 4MH7A 4RX7A 3EFJA 2GU8A 3JY9A 3PY0A 2GPHA 4I0TA 1ZY4A 3ENMA 3TZ8A 1O6KA 3FMLA 2OLCA 1U5QA 4CTCA 1JSTA 4PMTA 4FIIA 3BLHA 4TWCA 3BL9A 4L52A 3ODYX 5HD4A 4O82A 2IVVA 4FV2A 4DE4A 4ZSGA 3WI6A 4BC6A 5AM6A 4AZTA 3CLYA 1RQQA 2I0EA 4D4YA 3D7ZA 4F70A 4ZTMA 3ZSGA 3MN3A 4DEAA 4MQ2A 4RJ7A 1UNHA 5DN3A 4X6QC 1S9JA 2BILB 4PQNA 4RJ6A 4YZNA 3HVCA 4WT6A 4JQEA 4YHJA 3VQUA 4BCMA 3ZC6A 1ST0A 3MGYA 4BIEA 3QZFA 3HLLA 5KKRC 3GUBA 3FLZA 4IDTA 2XH5A 3I6WA 3CY2A 3OWPA 5M56A 4D28A 1ERKA 1Q97A 4AXAA 4ANSA 4V01A 3QYWA 4XLIA 3C4FA 4I5CA 4OBPA 3S95A 4R7IA 3ORZA 3REPA 5LMKC 4FEWA 3COHA 4PPAA 3ROYA 3RAIA 1CKJA 2ZOQA 4DEGA 5JKGA