4PUZA

Crystal structure of spleen tyrosine kinase (syk) in complex with gs-9973
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GS-9973, a Selective and Orally Efficacious Inhibitor of Spleen Tyrosine Kinase.
pubmed doi rcsb
molecule keywords Tyrosine-protein kinase SYK
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 83
structure length 263
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4puzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4puzA01
3DA6A 3R22A 3FLQA 3D94A 1W0XC 2QO7A 4EHGA 3LQ5A 4DGMA 4FKJA 3GU4A 5ETAA 5FM3A 4DGGA 4ZY5A 2OK1A 2UZBA 1OL1A 2BTSA 5C27A 3IKAA 4BZDA 2UZDA 2VTMA 2ONLA 4PL3A 5CX9A 4TNDA 3NVKI 3ACJA 4ZEGA 2GCDA 1UNHA 3M11A 3F5GA 1JKKA 1OKZA 3UOHA 2IW8A 4BDKA 3EQCA 3GCVA 5LARA 3R7YA 2DS1A 4UMUA 3CPCA 1ZMWA 4RJ7A 5TE0A 4BZOA 2J0MB 3BQRA 2DWBA 3PYYA 2YN8A 1AGWA 1UU8A 4HPTE 5M09A 2XK3A 4LUEA 3ORKA 2YJSA 4FT7A 3RZBA 3KULB 3NUXA 3E7OA 3QTWA 5CVGA 4MHAA 3LFDA 3QGWA 3FPMA 5AUTA 1J1CA 2WTIA 5JZJA 3UZTA 4RWJA 4FV9A 1PRYA 4U41A 4RSSA 5IEVA 1OIYA 2V0DA 4YPDA 4BDAA 5AP0A 4QPMA 5KMOA 4K8AA 4J1RA 3ZFMA 1QPCA 4IX3A 3SRVA 4AUAA 3ZCLA 4TYIA 1U54B 4Y72A 2C0OA 2Z7LA 4LOPA 5B0XA 4JNWA 4I5CA 2ZOQA 4O0RA 4AT5A 3HVCA 3IOKA 3Q9ZA 4ZTLA 3VW6A 4DFXE 3SX9A 5JFWA 3CGFA 4W9XA 1UKIA 5AP5A 3E7VA 4ERWA 2O0UA 3V8TA 2OSCA 3SRVB 1SM2A 3PZEA 1GIJA 1I44A 3C0IA 3DLSA 5E8VA 4YTCA 3R8UA 3F82A 1W7HA 2ZV8A 1UNGA 4MH7A 4YURA 2QR8A 3EMGA 5KUPA 4MX9A 2J5FA 4G9CA 4ZLZA 3GC0A 4YZNA 1MQBA 3UNZA 4QMWA 2X9FA 1SMHA 4QP6A 4U45A 5HHWA 2ITNA 2WQNA 3SOCA 1FOTA 3NS9A 4YLLA 4GEOA 4IANA 4RJ8A 4JOAA 1OB3A 3H9RA 5IA2A 5JK3A 1BLXA 2FA2A 2PVYA 3WILA 2ZM1A 3AC3A 2XRUA 3TZ9A 2YM7A 3UIUA 5AUYA 4GU9A 2P55A 2CNQA 4FV3A 1GZNA 4FZFB 4AA0A 1PXOA 3PWYA 3FI2A 3A7JA 3EIDA 3SXSA 3EN5A 3ORIA 2GS2A 4U9AA 4BKYA 4FZAB 2QLQA 1ZXEA 4A4OA 4O38A 1H00A 4ALWA 2XRWA 1OKYA 4DAWA 4HZSA 4O7RA 3GU6A 4FGBA 3FZRA 4LRMA 3NLBA 4K33A 4UALA 5IEXA 1WBNA 1OECA 2R5TA 4ARKA 3H9FA 3PRFA 5JRSA 4JDIA 3PJCA 4ACCA 3QTSA 2WIPA 4NZWB 2CHLA 4ZSGA 1PMNA 4HNFA 1H4LA 2O2UA 4JT3A 3RWQA 3LXPA 4D4RA 3KN5A 4RC3A 5H9BA 3QBNA 3M1SA 5J79A 4ACDA 4KAOA 4PDYA 2ZDTA 3IONA 4DFLA 1U59A 1YWRA 2GNIA 4GVJA 3FMNA 1U46A 4UWBA 3T9TA 2B52A 3BU6A 4GFGA 2QLUA 2UZEA 4NM0A 3T3VA 3ZUUA 4WT6A 4FK3A 3Q5IA 5K0KA 4B9DA 2C4GA 3D2IA 5ANDA 2B7AA 1KE5A 3LFBA 4QYEA 4XV2A 5HNBA 4HCTA 5AR7A 2ZV9A 5LMAA 2HW7A 3P9JA 1JSTA 1O6YA 2ZJWA 5M51A 1OPLA 5A3XA 2UW0A 2PSQA 3D7TA 2VRXA 2A4LA 4XG7A 4YP8A 3VS7A 1IA9A 4FVPA 3VBYA 5M4FA 1A9UA 5HG5A 5A4EA 4FIIA 4ASXA 3AT4A 1G8AA 3DB8A 3N4VA 4V01A 2VO0A 2FSTX 3ZXTA 1Q61A 4ANSA 5CEPA 5CQUA 4FEVA 1H1SA 2JC6A 1YDSE 1FVRA 1UVRA 2YDJA 2YZAA 3F3WA 4CCBA 4FZDB 1RJBA 2C3LA 4XOYA 5HBJA 4DEHA 4N70A 4FV4A 3LFNA 1WAKA 4IX4A 2X6EA 2XNGA 1HOWA 3PFQA 3TUBA 4GIIA 5KBRA 1YWVA 2PTKA 1SVHA 3QZFA 4IH8A 5CALA 4QYYA 1PXNA 5FEQA 4U3YA 5BVKA 5HVYA 3FC1X 5AV4A 3R01A 3B8QA 2X4ZA 1Q8YA 3L9LA 3LW0A 1VJYA 4BWKA 2WMUA 3VBTA 4XX9A 3QTZA 3L1SA 3MVJA 4QYFA 5IA5A 5M55A 5DPVA 4B8LA 3D5UA 3E92A 1OGUA 4RX7A 4F0IA 4FIGA 3B2TA 3TXOA 3WZJA 3VN9A 3ZM9A 1PKDA 3PJ2A 1LP4A 4DCAA 3RPRA 2YCSA 2ZDUA 3MFSA 3ZONA 4W4YA 4O21A 2PZYA 4TZRA 3E8EA 2XIZA 3GU7A 2E9OA 3A7IA 4NU1A 4UWYA 4EBVA 5M56A 4QYHA 3QTXA 3VF8A 4RQVA 4DT8A 3D14A 4XCUA 4QOXA 3ZFYA 1YKRA 3HAMA 5JH6A 1KE7A 1XWSA 3L9MA 3MV5A 1LEWA 4PV0A 3F5PA 4RJ4A 1PY5A 3ZC6A 5I3OA 2CMWA 2J0LA 1ZYSA 2PUIA 1M7QA 4OTQA 2EUFB 5HKMA 4NKAA 2BUJA 3MW1A 4TYJA 3R7UA 4XBUA 1HCKA 2BDJA 4ENXA 4A9TA 4EOSA 2ITOA 3FLSA 3I0QA 4L68A 2BRMA 4DFUA 2XJ1A 4FTMA 3JVRA 4AOIA 2JD5A 4KRDA 3E88A 2AC5A 4BIDA 3OBGA 4AN2A 4X0MA 4G31A 1KE9A 4AOJA 4JRNA 1ZARA 3Q52A 5HESA 1NVRA 5EM5A 4O7NA 4NM5A 2VTQA 5DRBA 5A14A 3UMWA 5BUEA 4DITA 3QD2B 4DTBA 4D58A 5CWZA 4W9WA 3NUYA 4L3LA 3R02A 3ZDUA 1WVXA 1PXJA 2BFYA 1Y6AA 4Q5EA 3ZLWA 3KKVA 5D12A 5AUXA 5EQYA 4M68A 3AC2A 4ACMA 2BRGA 1S9JA 4F6UA 4X3FA 1JKLA 3KVWA 2F2CB 5KZIA 3UJGA 3M2WA 3A61A 3DBCA 3WF9A 4BCHA 2QU6A 3NDMA 4ANQA 4E7WA 4K18A 4F1TA 4S32A 3MJ1A 5AADA 5FDPA 4XJ0A 3G6GA 3F7WA 1G5SA 3KRWA 3O7LB 4RC4A 3MY1A 3UE4A 3ORPA 4UWCA 4F7JA 4D2WA 5K5XA 4EC8A 4EOMA 3W2PA 5BYYA 2G2HA 3MY0A 3RPOA 3C5IA 3D2KA 1YHWA 2JDTA 5HO6A 4EHEA 1YRPA 2Y8OA 5HO8A 2OIBA 3PY3A 4GRBA 4A07A 5B7VA 2OXDA 5HX6A 2E9UA 5LOHA 2Y4PA 3GENA 5F20A 4YGAA 2WTDA 2LAVA 4ALUA 3PXYA 4LFIA 5GIPE 4O22A 4HGTA 4CVAA 2W17A 5LJJA 2QG7A 4ZTMA 3A7GA 2BZIB 1LR4A 5M4UA 2A0CX 1YXXA 3PY0A 4EUTA 2YFXA 4AU8A 3ZOSA 3POZA 3SW4A 1NT2A 3N4TA 1MRVA 2QOHA 3NYVA 4IWQA 4Y5HA 5CU2A 3JVSA 4XP0A 5IQBA 3D4QA 1UU9A 2BHEA 4QNYA 4HVDA 2WPAA 4MQ2A 4QMUA 4AW1A 4XV9A 4HVSA 1OL7A 3VIDA 2R3JA 3O8UA 4KKEA 5B2LA 3VJOA 3QQUA 4QQTA 1JWHA 4IVAA 5HBEA 4TT7A 3WBLA 1Q3WA 3RPSA 4ITJA 5ACKA 4J96A 2EU9A 4D9UA 4ITHA 3MA3A 5LVOA 5JSMA 4IC8A 2Y7JA 4LI5A 4BIBA 5HX8A 5JT2A 4QTEA 2VWIA 5AX9A 4FTUA 1CTPE 2KULA 4FIFA 3A2CA 4Y73A 5A6NA 3FZTA 4J99A 2PVRA 4LM5A 4RFZA 4V04A 3U51A 5I3RA 3RMFA 2UUEA 3E3BX 3GP0A 4IM0A 4FYNA 4MD9E 2PVFA 5A6OA 3UYTA 3NNUA 3VULA 3PJ3A 4WA9A 3ATTA 4ERKA 3O96A 2OWBA 3G9NA 2YM3A 3BCEA 3CSVA 2QHNA 5BVDA 4QMYA 3UPXA 2B53A 3VVHA 3A4OX 3KMWA 2X2MA 4EZ3A 4FTCA 4HCVA 3MSSA 1OI9A 2Z7SA 3LCOA 2PMLX 3KXGA 4I0SA 4X7QA 3BX5A 4FKGA 4AF3A 4PMSA 2C6MA 2HOGA 3HRCA 3HLLA 4C8BA 4IW0A 5DH3A 5HOAA 4D9TA 4ZMEA 3TIYA 3ENMA 4DG0E 1FBNA 3RTPA 5AM7A 1BYGA 2HY0A 3V8WA 3EQHA 3ODYX 4E4XA 5TOZA 2YISA 1O6KA 4IADA 2ITPA 3EQIA 4YNEA 4BB4A 5LVPA 2CPKE 3QUPA 4XP2A 5L6OA 3G5DA 4IJ9A 3KU2A 1K9AA 1OIQA 4Q2AA 3OUKA 3DAKA 4RFYA 3S1HA 2QVSE 1XH4A 3UG2A 5CSHA 4DCEA 2W1CA 4L6QA 2WOTA 4ZSLA 3CS9A 2V5QA 3OCTA 3EN7A 3PIXA 4FC0A 3R2YA 4XG4A 3R63A 4NWMA 3LFFA 2CKPA 3RAKA 3NYNA 5DBXA 3WZKA 1GOLA 4L7FA 4D5KA 5CAQA 5EG3A 2IVTA 4YHJA 3ELJA 4S34A 3FYKX 3PUPA 3FI4A 4HYHA 4OBQA 2ZM3A 3RCDA 4YSMA 5HG7A 2W9ZB 4MTAA 3U87A 4NTTA 5A4TA 3PA5A 5AP7A 3Q2JA 5ETCA 4NL0A 4FV1A 1KV1A 5IQEA 4TXCA 4E4LA 1GY3A 3R8ZA 3BGZA 5AA9A 4GK4A 2E9PA 5IQAA 4Q9ZA 5K0XA 2JLDA 2Y9QA 3HA6A 4QMPA 4XBRA 4CFWA 5A54A 4DEAA 1R39A 4XS2A 4UZHA 5KHWA 1XKKA 4ZSJA 2WEIA 5GJFA 2NPQA 3QCXA 4OT5A 2ZB1A 2GQRA 3FZ1A 3T9IA 3VBXA 4E5BA 2WMSA 3FEGA 4EQCA 3HDMA 2R3IA 4FSMA 4ZK5A 5ITAA 2PVLA 2RL5A 4PMTA 4QMZA 4ZJJA 5DG5A 3NIEA 4YC8A 4YJPA 5CEKA 5IH4A 3H3CA 4OTPA 2RIOA 3ALNA 5B2KA 2B9JA 4QYGA 4B7TA 2YLFA 3O17A 2YZLA 3E8DA 5J95A 2QHMA 3BWFA 3I0OA 4FUYA 2EB2A 5GZ9A 1ZAOA 5I9XA 4M15A 4ACGA 4E1ZA 4EK6A 2WU7A 4BBEA 3DAEA 4E6AA 4BCJA 2Q0BA 5EOLA 2J5EA 3DY7A 4RX5A 2O8YA 2A1AB 5FP5A 2XEZA 3THBA 2QOKA 1DI9A 4HGLA 3GT8A 3AGMA 3DKCA 3ID6C 2IPXA 3R8LA 3VJNA 4CMOA 4PDOA 5JQ5A 3MH1A 3RAIA 4MYGA 2PE0A 2CLXA 5DLSA 1OMWA 3R2BA 4ASDA 4KWPA 4UMPA 4AW2A 1BX6A 3CJFA 4ORKA 4FT5A 2CKQA 2EXCX 3MJ2A 3JS2A 2AYPA 3MVHA 2W4JA 1XH5A 1Z57A 4C4GA 1M14A 3EJ1A 3F6XA 1YHSA 3VO3A 2QNJA 2XNPA 3TEIA 3S00A 2XJ0A 4FL3A 4C7TA 2C3KA 3BYOA 1DS5A 3IPHA 2PZRA 5CNNA 2CN8A 2C30A 2W1FA 3W2RA 4GT5A 2PWLA 5JFVA 3E8CA 2JIUA 5BX0A 4FTIA 2IO6A 3IW8A 3O23A 3WF7A 5CANA 1L8TA 3PXRA 1IEPA 3PSBA 3IW5A 4FVRA 3UNKA 4DFNA 3DFCB 5HE0A 2C3JA 3C0GA 5FBOA 3AXWA 3AOXA 3DTCA 4IACA 4U43A 2ERKA 3RHXA 4RIYA 3VS4A 4A9SA 5DIAA 3CPBA 5CU3A 2JBOA 4IDTA 3ZFXA 5CF5A 3DB6A 2Z7RA 3FY0A 3MPTA 4GVAA 4DH8A 4EJNA 3F88A 3R9OA 4LRJA 4EYMA 3UQCA 3FSKA 4UXLA 4EYJA 3FYJX 4AA4A 3U9NA 5EH0A 3LKMA 4E73A 2WMWA 2XNEA 2C5YA 5TO8A 5IH6A 2IWIA 3ZO1A 2X8IA 2VGPA 2CLQA 2R3RA 3NCGA 3BGPA 4I0TA 4NIFB 4IE9A 2BAQA 4I41A 4P5QA 4A06A 5G6VA 3WARA 1WBSA 3UOJA 2XKFA 2WOUA 5IUHA 5J7BA 5EOBA 4MVFA 4OR5A 2HAKA 4X2JA 2PUNA 5C9CA 3BYMA 1U5RA 1YXSA 2QC6A 4IZ7A 5IEYA 3ZRKA 1CKPA 2YAAA 5L4QA 5CENA 2H9VA 4FKWA 2QKRA 3FC2A 5E7RA 4AG8A 4W4XA 5AUZA 3OD6X 1Y6BA 4EZ5A 4F4PA 1H1RA 4RPVA 4C62A 2OXXA 2YIQA 3C13A 4RLLA 4DT9A 1WZYA 3ZXZA 3SXRA 4IX6A 2W5BA 4JIKA 2QODA 2VV9A 5HE1A 3OWJA 4FG7A 4O2PA 4XMOA 3V51A 4ANLA 5LMKA 4MBLA 2G1TA 4M97A 4TYGA 4PDSA 4ZSAA 2YIWA 3SQQA 3TTJA 3CE3A 4RLKA 1PKGA 4BCIA 4BKJA 4EQUA 3BBTB 4BHNA 3FZOA 2C6DA 5LWNA 3W2QA 4QP8A 2X2LA 5A9UA 5FM2A 5FTGA 2VO6A 2YWPA 3MH0A 3FLYA 3ZH8A 5AJQA 3A60A 4H1JA 1Q62A 2WMQA 3HMIA 4S2ZA 5HLWA 4CCUA 5HEZA 2QD9A 4FTKA 3LJ0A 3QWKA 2CCIA 3U4UA 1H26A 3D7ZA 2GFSA 4FV6A 4KBAA 3DNEA 3PZHA 4U5JA 4D2VA 3EL8A 3QL8A 2YWVA 3NYOA 4KB8A 5CTPA 5BUIA 4UMTA 5HD7A 4EK3A 2J0JA 2GMXA 3HUCA 4XRJA 4JBQA 4BDFA 3NSZA 4P5ZA 3BEAA 2XIKA 3UVQA 3FKLA 2HY81 3BEGA 4KIQA 2ZV7A 3ORZA 2WMTA 4J8NA 2JFLA 3AG9A 1JKSA 5ANKA 4YJUA 2ZVAA 3BGQA 4RA5A 4RIXA 4DA5A 5CU6A 4HVHA 4FT9A 4BGHA 5M4CA 3FV8A 2BCJA 4PNKA 3KRXA 3WE8A 3HGKA 4H39A 4RVTA 4P4CA 2XK4A 5LCJA 4FNWA 3OCSA 4APPA 3Q32A 4XG8A 5AR5A 1XBBA 4KSQA 3VUMA 2QOQA 2V55A 1OZ1A 1WVWA 5HNGA 4BCOA 5HCYA 3FXWA 4CT1A 3RKBA 4KUJA 5A46A 2JAMA 2VTOA 3C7QA 3HL7A 3LXNA 5EW3A 2QOFA 4FKUA 4JR7A 5BNJA 1E1XA 4MD7E 4Z9LA 3LE6A 3SC1A 3E8NA 4FICA 3OOGA 1NY3A 4HYUA 1ZYJA 4JLCA 4E26A 3A99A 5C8NA 3KXMA 4LGDA 4WSQA 1CSNA 1RQQA 2Y4IC 4HYIA 4C2WA 4KIKB 4BDEA 3ANRA 3AT2A 1BI7A 3C4EA 3V01A 3Q6UA 2FSLX 3OMVA 3PXKA 5EM8A 2VAGA 3QCYA 3FQEA 3LFAA 2RFEA 3DFAA 3RNIA 4J52A 3SW7A 4F1MA 3LM5A 3QGYA 1B6CB 5EKOA 4C4FA 4AZEA 4O0VA 4R1VA 2PHKA 4FBXA 4ALVA 5AAEA 3V5QA 2VWWA 5E4HA 4CLJA 2PMIA 4UB7A 4CYIA 4XEYA 2XUUA 3GQIA 4E6CA 2R64A 4OAVB 4ID7A 5HNIX 4EL9A 3KXZA 3CXWA 4F0GA 1ZYCA 2ONLC 5AEPA 2R3GA 5IMEA 4G16A 4O91A 3NUUA 4V0GB 3PTGA 3IECA 3K5UA 5BYZA 2YDKA 4BICA 2P0CA 5FRIA 4CD0A 4MXXA 3OTUA 4NJ3A 3CGOA 3WZDA 3UPZA 5CEIA 3FLZA 3GNIB 5EW8A 1KE6A 1MRYA 2Y6OA 4GMYA 4IIRA 4BDCA 3ZC5A 1YOMA 3WIGA 4H36A 3S3IA 2PMOX 5IQFA 4JDJA 2BZKB 1JKTA 3C51A 2B1PA 4JS8A 4FT0A 5CQWA 1YXUA 5EDQA 5TR6A 3UQGA 3DXQA 3QZIA 2WEVA 2UVXA 4K6ZA 3VW8A 4AT3A 3LZBA 3OUNB 5HU3A 4H3BA 4I6BA 4P90A 3R8MA 4EK5A 4O0TA 3COHA 4ZZOA 1FINA 1K3AA 1M52A 3VUGA 4DG3E 2ZAZA 3CY2A 4JX3A 1IR3A 3P78A 4IWDA 3KF7A 5AV1A 4BDBA 4C57A 1J91A 5D7AA 3HA8A 4CYJA 3UP2A 4N6YA 2JKOA 2PZPA 3QD0A 3UP7A 1R3CA 2JEDA 4MQ1A 3R9DA 2R3OA 1V0PA 3S4QA 5IISA 4BKZA 2WMAA 3E87A 4EOQA 2PMNX 3AC5A 3KULA 3Q4TA 3DXNA 4RJ3A 2E2BA 4U97A 3VBQA 4MCVA 5AUWA 4B99A 4FE2A 4PTEA 3SVVA 3DAJA 2QCSA 4AGUA 1KOBA 4A4XA 1Y8GA 3QAME 1W98A 4HYSA 4FA2A 4BGQA 3OCGA 5DT4A 3LMHA 3G15A 2H8HA 4UBAA 4NYEA 1U54A 3OWPA 2OU7A 2R9SA 2GPHA 4QP4A 3GUBA 1H1WA 3R7OA 3PRIA 4EHVA 2P4IA 3FY2A 4R3CA 3AD6A 3C5UA 5CY3A 1XHAA 4HW7A 4UX9A 2OW3A 3L8SA 1IAHA 3JXWA 3Q2MA 3R9HA 2VUWA 3F3ZA 3L8XA 3HUBA 3WE4A 2VU3A 2BMCA 2F7EE 4YLJA 3HKOA 3Q53A 2IZSA 2ITXA 2J90A 2H96A 4F9BA 5DVRA 3V04A 4DEBA 4A4LA 1B38A 4FIHA 1U4DA 5C4KA 4DH5A 2NRYA 3NRMA 1XBCA 4YO4A 4AGWA 3CLYA 2Z60A 3A8XA 2BFXA 4IJPA 4LV8A 5D10A 4FGRA 4ZTNA 4TTHB 1M2QA 2JAVA 3ZDIA 1RDQE 5KE0A 4YMJA 2VN9A 4O7TA 2HZIA 4PNIA 2UW8A 4USEA 3EYGA 3QLFA 5IQDA 4RWIA 3AMYA 5IQHA 2VWZA 3ENHA 4CFUA 2VX1A 4MF0A 3JY0A 3V5JA 2GNGA 3COKA 3ZO3A 1QCFA 2RFSA 3TV4A 4AWIA 2IZRA 1J1BA 3MFRA 2XKEA 4GFMA 4BWPA 5FTOA 1V0OA 4C02A 1OL6A 4EQMA 4DG2E 4FV5A 2W5HA 2GHLA 1YW2A 2F7XE 4UZDA 5GINE 5E92A 1Y8YA 2YM8A 5AR4A 4HOKA 4I92A 3ZTXA 4ONAA 4RVKA 4HVIA 3U6HA 1Q97A 3QC4A 3GOKA 2GTNA 5HGIA 3IS5A 4JG7A 4I6QA 5CSPA 3PLSA 3FJQE 4FV7A 5JRQA 1VR2A 3E62A 3COIA 1ND4A 2J51A 4QTDA 3HNGA 5AR3A 3UC3A 4EEVA 4C0TA 5BVOA 2UW3A 2OKRA 3RP9A 3MBLA 4TYEA 4WUAA 4FIEA 3VF9A 3VS0A 3LHJA 4ANBA 3DCVA 3QTUA 3FLNC 4GJ3A 4BCKA 3LFSA 2RG6A 1PJKA 4CG8A 4WSYA 4ANOA 4FSUA 3OOMA 2ZB0A 2C6OA 3NWWA 3MH2A 2OI4X 1J3HA 2YA9A 3P7AA 5IPJA 3TDVA 3BV2A 4L43A 4K2RA 1SZMA 1KWPA 3CQUA 4J8MA 5DOSA 3R1QA 4WNOA 5JQ8A 3EB0A 4WO5A 2HELA 3PIZA 2HXQA 4C4JA 1CKJA 2O64A 3UO5A 4X2NA 3V6RA 3RAHA 3QHRA 4PL5A 4BCPA 4E20A 5I0BA 2JDSA 3BE9A 3BHUA 3UNJA 4W4VA 1GJOA 1REJA 2OBJA 5L2SA 2C5XA 1KE8A 2X8DA 3E64A 2WTCA 1NXKA 2HZNA 2X39A 3FZSA 5CZHA 4WKQA 3FMKA 2C6KA 3AMBA 3FBVA 4II5A 1NVQA 3L8PA 4M8TA 4I24A 2AUHA 2EXMA 3EYHA 3SKCA 3FKOA 4FNYA 4JIAA 3FE3A 2JGZA 3SA0A 5HIDA 5IQIA 5C03A 3HV7A 4R1YA 3LPBA 4R3RA 3HRBA 4LYNA 4F9WA 5F4NA 4O81A 2WZJA 3HMOA 3KK9A 4QP7A 4EWQA 4QMNA 5EYKA 4GKIA 4C58A 1NW1A 4QD6A 2Q83A 4DEGA 2ETRA 4HGSA 2J6MA 3GB2A 4YBKA 2XBAA 2XK6A 4FOCA 3OF0A 3ZSGA 5I5ZA 4F7SA 5KBQA 4JDHA 4WOVA 1O6LA 3NUPA 1A06A 3D15A 4BCGA 3R9NA 3CD8A 4FIJA 3TACA 3BHVA 4FSNA 3WYYA 1MRUA 4BCNA 4BCMA 5E8UA 4D1ZA 5HTBA 3VUKA 4CKJA 4IAIA 2VTHA 4YPSA 3C4FA 5CYIA 2PPQA 1BUHA 2G01A 4BTFA 2VTTA 3PE2A 3RM6A 3TN8A 4F7NA 4WG4A 4BCFA 4JAJA 5IQCA 3Q04A 4PPCA 2W1ZA 3PG1A 1Y57A 5T6KA 4DGNA 3O8TA 4EH6A 3LCTA 2JDOA 4H1MA 4FOBA 3V5WA 2XIRA 3ALOA 1WCCA 3DK3A 3NMUF 5L8JA 3SLSA 3Q9WA 2W7XA 1WMKA 1H25A 2GSFA 4H05A 4R8QA 4MF1A 2BRBA 5KKRC 1QPJA 3DXPA 4X2FA 4DFZE 4UN0C 4YC3A 4IC7A 4W4WA 1M17A 1DM2A 3QD4A 1UWJA 4G5PA 1RW8A 2C68A 4PMMA 1W84A 4CEGA 4CTCA 3I1AA 4TYHB 5IU2A 2FH9A 5IF1A 3K3JA 2RKUA 3OZ6A 4AS0A 5IUGA 3P4KA 5J87A 4L00A 3BI6A 3R04A 3TKUA 5B2MA 2JITA 4CV9A 3TDWA 1HCLA 1R0EA 1CM8A 3P23A 5EYMA 4RG0A 4DH3A 4U81A 4BN1A 4V05A 2YERA 3ITZA 2RFDA 4F9CA 5CEMA 4GUBA 3DDPA 5BVFA 3NW7A 4IAAA 4BTJA 2X0GA 4RMZA 5ACBC 5IA3A 2YCRA 1Y91A 5E9EA 3PP0A 3HAVA 3VC4A 4I0RA 2XYUA 4I21A 4BBFA 3OXZA 4KABA 1J7UA 3FQHA 2BROA 4FKVA 3RK5A 3COMA 5AP1A 1MP8A 1JLUE 3ORXA 4P2KA 3GXLA 4PY1A 2VTRA 2V7OA 4R77A 3KF4A 3OT8A 3Q96A 2R4BA 2VO3A 1WBWA 2PL0A 2CKEA 5JZNA 2G15A 4AZWA 3Q4ZA 2B9FA 4TWCA 3QKLA 3FHIA 5DI1A 2OJFE 3RINA 5FXRA 4IAFA 5AFVA 5C8KA 4E6QA 2RG5A 4ASZA 3PSDA 3TV7A 2X2KA 4BI1A 1ZYLA 2R3NA 4EC9A 4UMRA 3DT1A 5E8SA 4NFMA 5I9VA 2WMRA 3CIKA 4R7HA 3UODA 2XB7A 3KA0A 4G3EA 5ANJA 5HI2A 3QKKA 4PL4A 1JAMA 2PVHA 4IAKA 4RWKA 3LXKA 1PXKA 3OW3A 3NYXA 5HICA 2HYYA 3KGAA 1YI4A 4D0WA 1F0QA 5E91A 4GSBA 5KHXA 4FUXA 3R21A 5LVNA 3M42A 4G3DA 2HIWA 4XV3A 3W16A 4F08A 4XLIA 4NW6A 3O71A 4EH8A 1M2RA 3R1SA 5TT7A 3EQDA 1Q8WA 3TNWA 4FEQA 2R3FA 4KIPA 4RZVA 2IVVA 2BKZA 3ET7A 3CY3A 3CKXA 5HIBA 3GFWA 4YZDA 3OCBA 3PG3A 5IUIA 2UZLA 4FG8A 2C6EA 4F1OA 3W1FA 5GZ8A 4O0YA 4RGJA 4IVCA 2W1IA 4QTBA 3VS2A 3UG1A 4JX7A 4G34A 5KKRB 4BHZA 2WO6A 2VZ6A 4MAOA 2YACA 3PJ8A 4NH1A 1OUKA 4OLIA 1QL6A 2ITVA 3VAPA 2GS7A 4IM3A 5DE2A 2P2HA 5FXQA 2BIKB 4PMPA 5T68A 4LGHA 3ZMMA 4WG3A 2UZWE 4KINA 4EHZA 4O7WA 3RAWA 5TF9A 4IM2A 1TVOA 2ESMA 4FODA 5AA8A 4R7BA 2QR7A 5FP6A 1Z5MA 3QXPA 2F49A 3TI1A 1PMVA 4M7IA 1E9HA 4J95A 2W96B 3I6UA 3KRLA 4YR8A 5CF4A 4CFNA 1PHKA 3BYUA 2BZJA 2XS0A 5FBNC 4Q9SA 4DBXA 3CJGA 2E9NA 2XH5A 2YM4A 4I23A 4KA3A 4EUUA 2BDWA 5JFXA 2YITA 5L3AA 5AIKA 4CT2A 2BAKA 2OXYA 3C9WA 2OH0E 4YJNA 4QP1A 4R7IA 3ZRMA 2XK9A 3TZ7A 1CKIA 3C1XA 3LCDA 4QMQA 3NGAA 3UZPA 3DJ6A 5GNKA 1S9IA 4WNPA 2XYNA 4RX9A 4EK4A 4FV8A 3PVWA 4JQEA 5CXHA 2FUMA 2X81A 4G9RA 4YJVA 5GHVA 4CKIA 3QRTA 2PVKA 2PZ5A 2R3KA 4GU6A 4Z55A 2VX3A 5AR8A 3IDBA 2I0VA 3QQGA 3V5LA 4EZ7A 5DT3A 5FUTA 4JQ7A 3D5XA 2BR1A 4AT4A 2B55A 2OFVA 3W18A 4IEBA 3ZZWA 4KSPA 3DTWA 2DYLA 4IB5A 5KZ0A 1UU7A 1ZMUA 2XA4A 4FSYA 3MTLA 2R0UA 5CI7A 4BDDA 1SVGA 4CQGA 3HV5A 4MNFA 4DTKA 3Q4UA 3O7LD 2BVAA 3R6XA 1PXMA 2ITZA 3FL4A 4I93A 3TNIA 3JY9A 3OWKA 4ZTHA 5FTQA 4D2RA 4DF3A 5M4IA 4O2ZA 4O0XA 2R3PA 3CTQA 3KCKA 3O0GA 5M53A 2YHVA 2W0JA 2WTJA 3UO4A 4MXZA 4LOOA 3RM7A 1R1WA 1OVEA 4ZXTA 2UZUE 5HE2A 2UZVA 3R7VA 4E6DA 5K5NA 1R78A 2OJJA 1VYWA 2KTYA 4BDJA 3QZHA 4QRCA 3TM0A 4M0YA 2HW6A 4ZTQA 1PF8A 1YWNA 3EKNA 4M67A 2YCQA 3PDTA 3OW4A 5JN2A 2GNHA 4M12A 5JMSA 1IRKA 1H07A 2FYSA 3FMHA 3MA6A 5L6WL 1APME 4ZSEA 3ZO2A 4YUQA 3FXXA 3FAAA 3OC1A 4PP7A 4L46A 5L6PA 1ZYDA 3QRKA 4OTRA 4ZJIA 4D28A 1F3MC 2UW7A 3ZO4A 3LCKA 4EKLA 4GK3A 1JOWB 1VYZA 4TWPA 2C3IB 4FF8A 2B54A 3DZOA 3F69A 4GL9A 2WXVA 4I6FA 2HWOA 4JDKA 4OTDA 4X2KA 2PULA 4GYGA 3F2AA 2A27A 4IB0A 4CFFA 5BMMA 4EH3A 3GCQA 3RJCA 1AD5A 4QNAA 1V0BA 2QO9A 3BLQA 3LVPA 4JI9A 2WKMA 2BALA 2BTRA 5T3QA 4YJSA 5FEEA 1Q5KA 3C0HA 3QLGA 3KXXA 3PXFA 5AMNA 4OW8A 4CFXA 4G3FA 3ZLYA 3QCSA 4A9YA 3QRJA 3NNXA 2DUVA 4YSJA 2HWPA 3O51A 4L3PA 5HQ0A 4O7ZA 2UW6A 3GC7A 3CTHA 1Q4LA 3IGGA 1SNUA 4ZLYA 2XCKA 5ETIA 1ATPE 4BYIA 3KN6A 4XUFA 2ZM4A 3BHHA 5CS6A 3W2OA 4P7EA 3UGCA 2IVUA 2XF0A 3EFJA 4BC6A 4J97A 4MXOA 4NT4A 3MB6A 3EQRA 4LMUA 5L8KA 3ULIA 3ZBFA 5I9ZA 3NZ0A 2W4KA 3SV0A 4LG4A 4NIFA 4AX8A 1OBGA 4FKTA 3AC1A 1F5QA 3QKMA 1WBPA 4AFJA 4CGAA 4L01A 2YM5A 2EVAA 1V1KA 3VUTA 5HTCA 5DEYA 4O7LA 3FWQA 2G9XA 4GS6A 4NK9A 5D41A 2W1DA 3HYHA 3ETAA 3ORMA 3AT3A 3N4UA 4FG9A 5A4LA 2HK5A 4WBOA 4DEDA 4GIHA 3H0YA 4MEDA 4U44A 2OJGA 1H8FA 4TPTA 2I40A 5H2UA 3II5A 4LQMA 5AP3A 4I4EA 4K1BA 2QG5A 5CEOA 5L2WA 1JBPE 1H1PA 4BDIA 3UDBA 1YVJA 2QKWB 2CNUA 1L3RE 5DN3A 2J9MA 2V7AA 4TW9A 3HV3A 2IZTA 4PRJA 2CDZA 3NUSA 4B4LA 2EWAA 4FV2A 2WELA 3PPKA 4ZS4A 4E3CA 5CASA 2JKQA 2BIYA 4EOLA 5CI6A 3DKGA 3IK3A 1UKHA 3TG1A 3ZZEA 5F1ZA 3E3PA 4O0WA 4I94A 3NEWA 3EL7A 4E5WA 5AM6A 4PTGA 1FMOE 2X1NA 4I1ZA 1NA7A 2C5VA 4TWNA 3EFWA 3TKIA 3U6JA 3GFEA 4DLJA 2NNWB 4FR4A 4IZAA 4J71A 2XNMA 5IZFA 3IW4A 3LMIA 3UZRA 3G33A 4EBWA 3KRJA 4CFMA 5IMXA 2CGVA 2OGVA 2YIXA 3F3UA 4O96A 2W05A 2HENA 3AC8A 5KMLA 2C69A 1JSUA 5BVEA 4KIOA 2JKMA 3EOCA 5E90A 3ROYA 3NVMB 3HX4A 4IBMA 4WNMA 1UV5A 1PXPA 1XQZA 3C4ZA 1GIHA 3ROCA 3F5UA 3F9NA 5EI8A 5H8EA 5DR6A 3R7EA 2XVDA 5CT0A 4X3JA 4A9RA 3L8VA 4NCTC 5H8GA 3PA3A 4DFBA 4FEXA 5DMZA 2QOLA 1ZRZA 5CU4A 5FDXA 3H10A 5EYCA 5KMNA 3ORNA 4FX3A 3CKWA 2C1BA 4BYJA 2VTSA 3V6SA 1ZOEA 4LMNA 4PPBA 4FEWA 2X7OA 4BTMA 5I9UA 4YTIA 4EOKA 2V22A 3TCPA 1H27A 5EM6A 1LEZA 3KMUA 2OZAB 5LCKA 2PY3A 3BYVA 2O63A 4F09A 5HLNA 2OLCA 1YOLA 1OITA 3OHTA 4RA4A 3RI1A 2R7BA 4ZS0A 2FSOX 5BVNA 4KS7A 4MK0A 1REKA 4YZBA 3CQWA 5HE3A 3QXOA 4Z7HA 1XH7A 4KIKA 5HBHA 2WB8A 3ZLXA 4W8EA 5EHLA 3RGFA 3MY5A 3DK7A 1JNKA 5E8TA 4ANNA 3MVMA 3HMPA 3W55A 4I5MA 3BHTA 2I0EA 2OICA 4OBOA 2J50A 3D83A 3MFTA 5C01A 5K4IA 3U6IA 4E4NA 4V0GA 4XG3A 4USFA 4L52A 5CEQA 2QI8A 3MS9A 4PTCA 1FGKA 1AQ1A 3PXQA 1OL2A 3T8OA 1W83A 4L67A 3QYWA 4IVBA 4QQCA 4KRCA 1XJDA 2UW9A 5AV3A 4XNEA 5EK7A 4OTGA 4S31A 4GT4A 5HCZA 3TUCA 4QT1A 1XR1A 4CRSA 4Y5QA 5HG9A 3ZEPA 4O6EA 2BRHA 4CLIA 1Q8UA 4AZSA 2VTLA 5L2QA 1Q24A 1QPEA 2RGPA 4UY9A 5CZIA 2BHHA 4NJDA 1UA2A 2W06A 1OKVA 1Z9XA 1PYXA 3CCNA 4I3ZA 2NO3A 5HTIA 2QQ7A 2XKCA 3NUNA 4L53A 3CEKA 3PIYA 3DKFA 1YDRE 2GNLA 4OBPA 4M14A 3R8PA 3A7HA 2HZ0A 5IDNA 1H01A 5EYDA 2ITYA 4R6VA 5K4JA 4NTSA 4WD5A 3LAUA 2VNWA 3FI3A 3FMEA 3ZM4A 3H0ZA 3DQXA 1XH8A 2X6DA 1RE8A 4C3RA 1ZLTA 3LIJA 3ZBXA 4ZZNA 2R3LA 5HO7A 1ZY5A 4IHPA 4U3ZA 1VZOA 4XLVA 4CZUA 4EJ7A 5AX3A 5AIRA 2VTJA 1CMKE 2RFNA 4EK8A 5AP2A 1DAWA 2GU8A 3MH3A 4OTFA 2VWBA 2QOBA 4U0IA 3BRBA 4MWIA 4M3QA 5BQ0A 5IA0A 3V5PA 1OPJA 3NW5A 4G3CA 3P86A 3KXNA 3LXLA 3VRYA 4G2FA 2WGJA 3PVBA 3D9VA 4QMSA 2W99B 3VS5A 2ZV2A 4FSZA 3ZUTA 3HRFA 2G2IA 4KBCA 4C4EA 2BPMA 3RZFA 4FSWA 4D4VA 2FSMX 4O6LA 2QOCA 3TNHA 4C59A 2WAJA 5JGDA 5JFSA 4O1OA 5D9HA 1PMEA 2VGOA 3NCZA 3QTRA 5EHYA 4LUDA 4GW8A 3QUDA 3TIZA 3LQ3A 3KY2A 4AACA 5AUUA 2Y4IB 5KO1A 1H1QA 3FUPA 2BKKA 2CN5A 1DAYA 1URCA 4JR3A 3UTOA 5C4LA 5KX8A 3F61A 2CGWA 3UYSA 4DLIA 4BTKA 4CXAA 1QPDA 4DGOA 4N0SA 4ZJVA 4BI0A 3Q60A 3DOGA 4QMOA 5HVJA 4QP3A 3W2SA 5AAGA 3UBDA 2XK7A 2PUPA 1PXIA 4W8DA 2C1AA 1YI6A 3WZUA 4DH1A 1M2PA 4S33A 3VUHA 4Y8DA 2IW9A 1FGIA 2YLEA 3JPVA 1OIUA 4M69A 2PYWA 3E63A 4ZP5A 3GBZA 3EKKA 2ITWA 2O5KA 3PJ1A 3QA8A 3F2RA 3FMMA 2JIVA 3P5KA 4FTAA 3TT0A 4IDVA 4K0YA 4N4SA 3L9NA 3Q9XA 5G1XA 4CQEA 4S30A 3SG9A 2OJ9A 4AE9A 3ORLA 4M69B 1JPAA 4MBJA 5J9YA 1IAJA 2XIYA 3QQJA 4BGGA 3QZGA 4M84A 4AA5A 4Z3VA 4IXPA 1ERKA 4ITIA 2XCHA 3DBFA 3NIZA 1FPUA 4OGRA 3SG8A 4JL9A 1YI3A 4F99A 4F65A 4BFMA 5EI2A 2W9FB 2VTNA 3G9LX 3HMNA 2JBPA 3DK6A 1P5EA 3O50A 3W33A 1EH4A 3QQHA 3MYGA 4LL0A 2OZOA 3QHWA 4IAYA 2XM8A 3LCSA 5DFPA 1UU3A 5E8ZA 3QU0A 5AV0A 5H8BA 4AW0A 4BI2A 4U6RA 4Q5HA 4HVGA 4BCQA 3R71A 3GOPA 1M7NA 2YAKA 3HDNA 2I6LA 2R3MA 3EQPA 3ZUVA 4D2TA 2XMYA 3ZS5A 4B8MA 3R73A 5CXZA 3MI9A 4R5YA 3BU3A 3DLZA 4QPAA 3SGCA 4G3GA 2WMXA 4G5JA 3U8WA 4Z7GA 3N51A 3BQCA 4KD1A 2I0YA 4BBMA 4WRGA 3DKOA 3TV6A 4BRXA 4C61A 5HD4A 3OXTA 3VS6A 3U4WA 3WZEA 4GFOA 5KMIA 4FTQA 5IG1A 4FTLA 4AN3A 4C34A 5DYJA 4FKRA 4IMYA 4L8MA 5M08A 2JDRA 2WNTA 3DU8A 3L9PA 4IWOA 5ANEA 2Z2WA 3NW6A 2FGIA 3P7BA 4DEIA 5HORA 3PVGA 3BIZA 4JAIA 4UXQA 1KV2A 4C38A 2WD1A 2YM6A 4ACHA 4QMVA 2F9GA 2WQBA 4EORA 3EQBA 4FEUA 4AXAA 3ODZX 5HIEA 2I0HA 3VBVA 4ZY6A 4AGDA 5EM7A 2J0IA 1ZOHA 2DQ7X 3FZPA 3JR1A 2XJ2A 4FYOA 3KL8A 3O2MA 2GDOA 5L8LA 1KUTA 5LMBA 4DH7A 1H0WA 2P2IA 5HCXA 3R7GA 3AC4A 3DDQA 2VTPA 5J5TA 3QQLA 2WQOA 3K3IA 1CDKA 4MXYA 4O1PA 1K2PA 2C5OA 3EZRA 4AP7A 3U54A 3P0MA 4EH7A 4YJOA 4AOTA 4E8AA 1BL6A 1ZWSA 4RFMA 2CCHA 4D5HA 3ZEWA 4X6QC 3FLWA 3LM0A 4UMQA 4ZMFA 5FG8A 3HZTA 2PU8A 1T45A 3R8VA 4XG6A 3SXFA 4GYIA 3HEGA 4KNBA 2BDFA 4O83A 3MESA 2X9EA 4RT7A 5E8YA 2GS6A 3AMAA 1BI8A 3FXZA 4PUZA 2SRCA 3CR0A 3CP9A 4AZTA 2QONA 3MN3A 3QQFA 3D7TB 5D1JA 4F7LA 4BZNA 3QC9A 1TKIA 3SAYA 4G1WA 3U9CA 4DBNA 5BUJA 2C6IA 3EHAA 2EXEA 4WHZA 2R2PA 4GG7A 4PX6A 4EKKA 4FSRA 3NAXA 3OTVA 5IA4A 3VS3A 3W10A 4X3FC 1SVEA 3A4PA 3IDPA 3VWAA 3DBDA 4YNOA 3QALE 4E93A 5CAPA 4MD8E 5FQDC 4DC2A 3BPRA 3HP5A 2CSNA 3HV6A 4HPUE 2IG7A 3T3UA 3N9XA 3G90X 4FTTA 3D0EA 2HXLA 4TY1A 4TYHA 2JDVA 3W8QA 1GIIA 5I9YA 3IO7A 2I7QA 5EDPA 3SHEA 2F57A 2OJIA 2WIHA 5M57A 4X2GA 3S2PA 5IDPA 1GZOA 1GZ8A 2VTIA 3QD3A 3GI3A 4F6WA 2R7IA 4FZ6A 4EOOA 3C50A 3KREA 3K54A 2R3QA 1BL7A 2ITTA 4PDPA 1LUFA 4YO6A 3GC8A 3K2LA 1WFCA 2JIIA 2UVYA 3F3TA 3H9OA 5FXSA 3KFAA 2A19B 2WQMA 4D1XA 4FV0A 5FD2A 2F4JA 2VNYA 4QMTA 1PYEA 3BLRA 4O0SA 4QMMA 3I60A 2GHGA 3TNQB 2NP8A 1Q99A 4CG9A 4EOJA 4RWLA 4PQNA 5IA1A 1W82A 3S0OA 4BVUA 5EDRA 3DBQA 3IQ7A 3QTIA 5HU9A 3ZYAA 3VHKA 4OTHA 4MXCA 5KCVA 3AD5A 4UEUA 3TKHA 3A7FA 4UYNA 5CVFA 2GHMA 5CSWA 5JGBA 4HJOA 4RIOA 4KKGA 2XBJA 3GCSA 2OF2A 5J7HA 1LPUA 2NRUA 1P4FA 2VWUA 2UV2A 4LV5A 4MWHA 4BIEA 4K77A 3KRRA 1NVSA 4LGGA 2EB3A 4BDGA 4C37A 3OWLA 3FHRA 3QRIA 4CZTA 4Y83A 5EQPA 4F70A 5LVLA 4XRLA 2UZOA 1MQ4A 1OUYA 5F94A 5K9IA 4U8ZA 3KVXA 2E9VA 4HZRA 1P2AA 3JYAA 4GV1A 4L9IA 3FMDA 4D4SA 2OIQA 4YBJA 4U79A 3PPZA 5CAVA 2Y6MA 5GZAA 3OT3A 2W1EA 4FNZA 4CRLA 2C0TA 4RVLA 3OROA 4YHTA 3UIMA 4AGCA 5J1WA 5CF8A 3WF5A 3C4WA 3IW7A 4HNIA 4EOPA 2X7FA 4CTBA 2X4FA 1H24A 4ZZMA 2ACXA 2PE1A 4GJ2A 4JXFA 5FEDA 3RVGA 4EOIA 5JEBA 4U80A 3UVRA 4FKIA 3LOKA 3Q3BA 1ZZLA 2B9HA 4AQCA 5J9LA 3QX4A 4X3FB 3LLAA 4GT3A 2O65A 3F66A 3PSCA 3EFLA 3BLHA 4FL2A 4USDA 4FZ7A 4H58A 3MTFA 3EFKA 3QYZA 1J7IA 2OG8A 5D7VA 2C5NA 4EH2A 3KMMA 4FI1A 5AUVA 2WFYA 4XHKB 3QRUA 3A62A 4YZCA 3UQFA 4BWXA 3KC3A 3QUEA 4TL0A 5AP6A 1QMZA 4F63A 4DTAA 1TQMA 3QQKA 3I5NA 3UVPA 1ZY4A 4JG8A 5CF6A 4C35A 2CJMA 1FMKA 1SNXA 1XO2B 3DZQA 4MXAA 4XYFA 3MDYA 4C3FA 4GKHA 4PP9A 1WBOA 2WTVA 4JBOA 4L44A 1PXLA 2CGUA 4FKSA 4H3PA 4JRVA 5FGKA 3ZLSA 5CNOA 3G6HA 2JKKA 3OEZA 4NM7A 3PLAE 4IQ6A 4L42A 3E93A 3QF9A 4J53A 3OS3A 3RHKA 4TNBA 5I4NA 5D11A 3UOLA 1MUOA 4FKLA 4N57A 3MVLA 2GNJA 4JBPA 3VHEA 4Z16A 4XG9A 3I7CA 2B9IA 5IH5A 2VWXA 3RPYA 1ZZ2A 4AFEA 1ZOGA 3UO6A 4Y85A 4FTJA 2BZHB 4NW5A 4WRSA 3BU5A 4I20A 3ZSHA 3EZVA 4O86A 2Z7QA 4QQJA 1FVVA 3HECA 2YIRA 4IAZA 4DHFA 2YEXA 5CSVA 4DYMA 2B0QA 2C6TA 3DBEA 1YXVA 3RNYA 3TJCA 4YZ9A 3DJ5A 5CAOA 1OPKA 4RJ6A 4X6RA 3LQ8A 4EONA 1ZMVA 5EHOA 4FL1A 1P4OA 4O7YA 3F5XA 4U42A 3R0TA 4IX5A 4FNXA 4TKSA 4RC2A 3HMMA 5C26A 2VD5A 2GFCA 3QWJA 4FT3A 4PWNA 2QURA 4EI4A 5AP4A 2QO2A 3LJ1A 5JGAA 4XOZA 5HG8A 4KS8A 4NSTA 4QO9A 2BAJA 2ETMA 2CKOA 3D5VA 4ANMA 1YDTE 4HGEA 4YTFA 3TUDA 2C0IA 4FVQA 2ITUA 3QA0A 4EWHA 5TKDA 4L3JA 5CSXA 3G51A 4IWPA 3V5TA 4F9YA 3KB7A 5L2TA 2WHBA 3B8RA 4TRLA 4A7CA 4U7ZA 5IQGA 4J7BA 4RJ5A 3TNPC 1IG1A 3CBLA 3P79A 3WIKA 3W2CA 5M06A 1WVYA 2ZYBA 3LLTA 3I5ZA 4DEEA 3NUAA 3V3VA 3OG7A 2IZUA 2X8EA 5DR9A 4XV1A 2JFMA 1KOAA 4ZOGA 2XK8A 3TWJA 1SYKA 4JQ8A 4OTIA 2WQEA 3G0EA 1W8CA 4XH6A 5I9WA 4RRVA 1PMUA 2QOOA 3AD4A 1YXTA 2C6LA 3EN4A 4QPSA 4ZY4A 4CKRA 3D5WA 3DQWA 3I79A 4MBIA 1GAGA 2WMVA 3EWHA 3KQ7A 2PVJA 4I6HA 4U40A 5K3YA 3Q6WA 3W8LA 2WTKC 4YC6A 1BMKA 3REPA 2X7GA 4N6ZA 4BF2A 2UZNA 3ERKA 3NPCA 4E4MA 2VO7A 4C36A 1STCE 4NKSA 3POOA 3QX2A 3QTQA 2PUUA 3Q5ZA 2UW4A 2B4SB 3JUHA 3G2FA 4QP9A 2GQSA 3WF8A 2R0IA 4I5HA 3IDCA 4DN5A 4YJTA 4FSTA 3CQEA 4K9YA 3BV3A 3EH9A 5DEWA 2P33A 3PWDA 3C4XA 3GU8A 1PW2A 3OXIA 3DPKA 2IJMA 2BRNA 2OF4A 4CMUA 1UNLA 2ZMCA 2XM9A 4CMTA 4NEUA 1H28A 2VTAA 4YZMA 3ZU7A 5KMMA 3MWUA 4QMLA 3AGLA 2WMBA 1YQJA 1H08A 4R3PA 4FK6A 5E8WA 2IW6A 4LOQA 4TWOA 5GJDA 5DHJA 1A48A 3PP1A 3RCJA 3FDNA 4R5SA 5HLPA 2PK9A 5DGZA 3ZHPC 3ULZA 3TJDA 3CD3A 4GG5A 5AWMA 1IA8A 2A2AA 5EFQA 5GJGA 4C33A 2XZSA 4WIHA 3VUDA 3QFVA 5H3QA 1J7LA 4GUEA 4APCA 1XH6A 4B6LA 3G0FA 1WBVA 3RK7A 4CNHA 5CT7A 3MIYA 3NR9A 4ZTSA 5ETFA 2J7TA 1O9UA 4WNKA 5LMKC 4EH4A 1FVTA 3I4BA 5CU0A 4J98A 3GCUA 3SOAA 3HP2A 2Z8CA 4G6NA 3FMLA 2VX0A 3NAYA 1URWA 3MPMA 4I4FA 4ZTRA 4R78A 2F2UA 2YABA 2V62A 4JG6A 5BMSA 4RVMA 4XG2A 2YJRA 5CLPA 1G8SA 3NNWA 4PF4A 4K11A 3LFCA 3GCPA 2IN6A 4LRKA 4C2VA 5HVKA 3VUIA 2PVMA 3PXZA 4FKOA 3RBWA 3EQGA 1IASA 3I81A 1JVPP 3BWJA 2O3PA 3BELA 2HZ4A 3PVUA 3BE2A 1P14A 3OEFX 2QOIA 3PA4A 4FTNA 3OP5A 3R00A 2G2FA 5DWRA 4F6SA 5LVMA 5BVWA 1B39A 3NX8A 3SDJA 4D0XA 1JQHA 5JKGA 2XIXA 2FO0A 2ETKA 3CC6A 5DR2A 3FI8A 2WTKB 3DV3A 5ANOA 4A9UA 1Q41A 4ZAUA 3R1NA 4GH2A 4IVDA 3S95A 4ENYA 2J0KA 3R28A 5EI6A 4OAUC 5ANGA 3U55A 2XNOA 3OY3A 1I09A 4RIYB 5M44A 4F9AA 3FMJA 3GGFA 4JVGA 1DI8A 2Z02A 2PVNA 4M66A 3HV4A 3AQVA 4RX8A 3EQFA 3R83A 3LFEA 1OM1A 4RIWA 4I22A 3RPVA 1TQPA 3F2NA 3ZRLA 5J9ZA 2OO8X 4IB3A 2YIYA 3I6WA 4JJRA 4BL1A 2W4OA 2XNNA 4IZYA 3UIXA 2XP2A 2J4ZA 2F7ZE 4M0ZA 4WBBB 3B2WA 1H0VA 2W5AA 1OIRA 3NNVA 4Y46A 4D2PA 2BILB 4D2SA 4AAAA 4QP2A 3PY1A 2UW5A 4OUCA 1UWHA 3H30A 3LMGA 4RIWB 3TZMA 4AN9A 5EKNA 2YCFA 4NUSA 3SD0A 3VQUA 4B0GA 3BZ3A 4FKQA 3GQLA 2RSVA 3KK8A 1TQIA 4O0UA 5E1SA 2ZMDA 3MFUA 3UC4A 2WTWA 4IB1A 1OKWA 3R7IA 3EN9A 2PZIA 2UVZA 4O82A 3DJ7A 5L2IA 5FWKK 2OZAA 2LGCA 2REIA 1YOJA 2J2IB 4H3QA 1VEBA 4AW5A 4FSQA 2WU6A 5J5SA 5LQFA 4MNEA 1OL5A 1Q3DA 4O27B 4QQ5A 5F9EA 4ZIMA 4CFVA 3FQSA 3MIAA 4RBLA 5HZNA 3CTJA 3PPJA 4O7SA 1U5QA 5KMKA 4RQKA 4UV0A 2W1HA 3VRZA 4IFGA 5E8XA 4ASEA 4DINA 5C1QB 4RZWA 3KCFA 4MKCA 2VWVA 3R30A 4YJQA 4MNEB 3FSFA 3IG7A 4DE4A 3O8PA 3Q9YA 4NM3A 5J1VA 2GQGA 2RF9A 4IFCA 1WBTA 3PE1A 5GIOE 3LFQA 5DT0A 2ERZE 4C3PA 5LWMA 1T46A 3UIBA 3GVUA 4AZVA 3QCQA 2YDIA 3P08A 4G6LA 3F7ZA 3EN6A 1G3NA 2ITQA 3GU5A 3DNDA 3IW6A 2HCKA 3A8WA 2GTMA 3ANQA 3IOPA 3UMXA 4IZ5A 3H4JA 4OTWA 3WYXA 2OFUA 3BHYA 2XEYA 4AZFA 1Q8ZA 5AV2A 3GC9A 3W32A 5A4CA 2XKDA 4QTCA 4CZYB 5A4QA 2AC3A 4KBKA 4I5PA 4BY9E 4M13A 4FTOA 5LXMA 1E1VA 3MB7A 4FMQA 5EW9A 5KNJA 3Q4CA 4E5AX 3FKNA 3RALA 3F3VA 4RIXB 4WG5A 4DGLC 1R0PA 1XH9A 2OIDA 4KKHA 5AR2A 5J8IA 4GK2A 3OFMA 5CAUA 4FTRA 3KXHA 3BKBA 4G17A 3GEQA 2R3HA 2QU5A 2IVSA 3K5VA 4GCJA 3DGKA 1GZKA 4L45A 4C4IA 2CNVA 2Q0NA 4D55A 3OBJA 1X8BA 4O84A 2I1MA 3IGOA 3OY1A 3C4CA 4YJRA 2GNFA 3ACKA 5BPYA 1YHVA 5DRDA 4O7VA 3LJ2A 4FKPA 5ANIA 4NCTA 4F0FA 4BR3A 3FL5A 4TN6A 3R9RA 2P3GX 2UZTA 1KSWA 3DS6A 3MGYA 3BBWA 2FB8A 3R1YA 4JBVA 4D1SA 3WF6A 4D4YA 4YU2A 2PE2A 3E5AA 4XP3A 1JSVA 3WI6A 4AE6A 3KEXA 4HCUA 3VBWA 3VS1A 4YTHA 1FQ1B 5EQEA 4ZLOA 4QMXA 4YHFA 3OVVA 2CGXA 3P1AA 4QTAA 5CVHA 4YLKA 5KMJA 5ICPA 1Q8TA 1BKXA 2W1GA 4PPAA 3ATSA 4CV8A 5C8MA 4C4HA 5AAFA 4CSVA 4OT6A 5E1EA 4F64A 4BDHA 2OH4A 2H6DA 3P7CA 4NFNA 4DFYA 2XNBA 2Y0AA 4LL5A 4UYAA 5DA3A 5DNRA 1XBAA 3MPAA 3RWPA 3TTIA 2FVDA 2VWYA 3V8SA 4X21A 3UOKA 1GNGA 1OBDA 4L7SA 3WOWA 3TZ8A 5BYLA 4WUNA 2C47A 5IKWA 3TL8A 4G6OA 5M07A 3RK9A 3VNTA 3VQHA 3I7BA 3ZSIA 2H34A 4Y95A 4EH9A 3ORTA 5F95A 3FPQA 3BYSA 4EH5A 5FLFA
chains in the Genus database with same CATH superfamily
3DA6A 3R22A 3FLQA 3D94A 1W0XC 2QO7A 4EHGA 3LQ5A 4DGMA 4FKJA 3GU4A 5ETAA 5FM3A 4DGGA 4ZY5A 2OK1A 2UZBA 1OL1A 2BTSA 5C27A 3IKAA 4BZDA 2UZDA 2VTMA 2ONLA 4PL3A 5CX9A 4TNDA 3NVKI 3ACJA 4ZEGA 2GCDA 1UNHA 3M11A 3F5GA 1JKKA 1OKZA 3UOHA 2IW8A 4BDKA 3EQCA 3GCVA 5LARA 3R7YA 2DS1A 4UMUA 3CPCA 1ST4A 1ZMWA 4RJ7A 5TE0A 4BZOA 2J0MB 3BQRA 2DWBA 3PYYA 2YN8A 1AGWA 1UU8A 4HPTE 5M09A 1W2DA 2XK3A 3ORKA 2YJSA 4FT7A 4LUEA 3RZBA 3KULB 3NUXA 3E7OA 3QTWA 5CVGA 4MHAA 3LFDA 3QGWA 3FPMA 5AUTA 1J1CA 2WTIA 5JZJA 3UZTA 4RWJA 4FV9A 1PRYA 4U41A 4RSSA 5IEVA 1OIYA 2V0DA 4YPDA 4BDAA 5AP0A 4QPMA 5KMOA 4K8AA 4J1RA 3ZFMA 1QPCA 4IX3A 3SRVA 4AUAA 3ZCLA 4TYIA 1U54B 4Y72A 2C0OA 2Z7LA 4LOPA 5B0XA 4JNWA 4I5CA 2ZOQA 4O0RA 4AT5A 3HVCA 3IOKA 3Q9ZA 4ZTLA 3VW6A 4DFXE 3SX9A 5JFWA 3CGFA 4W9XA 3VONA 1UKIA 5AP5A 3E7VA 4ERWA 2O0UA 3V8TA 2OSCA 3SRVB 1SM2A 3PZEA 1GIJA 1I44A 3C0IA 3DLSA 5E8VA 4YTCA 3R8UA 3F82A 1W7HA 2ZV8A 1UNGA 4MH7A 4YURA 2QR8A 3EMGA 5KUPA 4MX9A 2J5FA 4G9CA 4ZLZA 3GC0A 4YZNA 1MQBA 3UNZA 4QMWA 2X9FA 1SMHA 4QP6A 4U45A 5HHWA 2ITNA 2WQNA 3SOCA 1FOTA 3NS9A 4YLLA 4GEOA 4IANA 4RJ8A 4JOAA 1OB3A 3H9RA 5IA2A 5JK3A 1BLXA 2FA2A 2PVYA 3WILA 2ZM1A 3AC3A 2XRUA 2AEGA 3TZ9A 2YM7A 3UIUA 5AUYA 4GU9A 2P55A 2CNQA 4FV3A 1GZNA 4FZFB 4AA0A 1PXOA 3PWYA 3FI2A 3A7JA 3EIDA 3SXSA 3EN5A 3ORIA 2GS2A 4U9AA 4BKYA 4FZAB 2QLQA 1ZXEA 4A4OA 4O38A 1H00A 4ALWA 2XRWA 1OKYA 4DAWA 4HZSA 4O7RA 3GU6A 4FGBA 3FZRA 4LRMA 3NLBA 4K33A 4UALA 5IEXA 1WBNA 1OECA 2R5TA 4ARKA 3H9FA 3PRFA 5JRSA 4JDIA 3PJCA 4ACCA 3QTSA 2WIPA 4NZWB 2CHLA 4ZSGA 1PMNA 3BL7A 4HNFA 1H4LA 2O2UA 4JT3A 3RWQA 3LXPA 4D4RA 3KN5A 4RC3A 5H9BA 3QBNA 3M1SA 5J79A 4ACDA 4KAOA 4PDYA 2ZDTA 3IONA 4DFLA 1U59A 1YWRA 2GNIA 4GVJA 3FMNA 1U46A 4UWBA 3T9TA 2B52A 3BU6A 4GFGA 2QLUA 2UZEA 4NM0A 3T3VA 3ZUUA 4WT6A 4FK3A 3Q5IA 5K0KA 4B9DA 2C4GA 3D2IA 5ANDA 2B7AA 1KE5A 3LFBA 4QYEA 4XV2A 5HNBA 4HCTA 5AR7A 2ZV9A 5LMAA 2HW7A 3P9JA 1JSTA 1O6YA 2ZJWA 5M51A 1OPLA 5A3XA 2UW0A 2PSQA 3D7TA 2VRXA 2A4LA 4XG7A 4YP8A 3VS7A 1IA9A 4FVPA 3VBYA 5M4FA 1A9UA 5HG5A 5A4EA 4FIIA 4ASXA 3AT4A 1G8AA 3DB8A 3N4VA 4V01A 2VO0A 2FSTX 3ZXTA 1Q61A 4ANSA 5CEPA 5CQUA 4FEVA 1H1SA 2JC6A 1YDSE 1FVRA 1UVRA 2YDJA 2YZAA 3F3WA 4CCBA 4FZDB 1RJBA 2C3LA 4XOYA 5HBJA 4DEHA 4N70A 4FV4A 3LFNA 1WAKA 4IX4A 2X6EA 2XNGA 1HOWA 2IEWA 3PFQA 3TUBA 4GIIA 5KBRA 1YWVA 2PTKA 1SVHA 3QZFA 4IH8A 5CALA 4QYYA 1PXNA 5FEQA 4U3YA 3UDZA 5BVKA 5HVYA 3FC1X 4DHJA 5AV4A 3R01A 3B8QA 2X4ZA 1Q8YA 3L9LA 3LW0A 1VJYA 4BWKA 2WMUA 3VBTA 4XX9A 3QTZA 3L1SA 3MVJA 4QYFA 5IA5A 5M55A 5DPVA 4B8LA 3D5UA 3E92A 1OGUA 4RX7A 4F0IA 4FIGA 3B2TA 3TXOA 3WZJA 3VN9A 3ZM9A 1PKDA 3PJ2A 1LP4A 4DCAA 3RPRA 2YCSA 2ZDUA 3MFSA 2IF8A 3ZONA 4W4YA 4O21A 2PZYA 4TZRA 3E8EA 2XIZA 3GU7A 2E9OA 3A7IA 4NU1A 4UWYA 4EBVA 5M56A 4QYHA 3TMOA 3QTXA 4QDEA 3VF8A 4RQVA 4DT8A 3D14A 4XCUA 4QOXA 3ZFYA 1YKRA 3HAMA 5JH6A 1KE7A 1XWSA 3L9MA 3MV5A 1LEWA 4PV0A 3BL9A 3BLAA 3F5PA 4RJ4A 1PY5A 3ZC6A 5I3OA 2CMWA 2J0LA 1ZYSA 2PUIA 1M7QA 4OTQA 2EUFB 5HKMA 4NKAA 2BUJA 1G8KA 3MW1A 4TYJA 3R7UA 4XBUA 1HCKA 2BDJA 4ENXA 4A9TA 4EOSA 2ITOA 3FLSA 3I0QA 4L68A 2BRMA 4DFUA 2XJ1A 4FTMA 3JVRA 4AOIA 2JD5A 4KRDA 3E88A 2AC5A 4BIDA 3OBGA 4AN2A 4X0MA 4G31A 1KE9A 4AOJA 4JRNA 1ZARA 3Q52A 5HESA 1NVRA 5EM5A 4O7NA 4NM5A 2VTQA 5DRBA 5A14A 3P5JC 3UMWA 5BUEA 4DITA 3QD2B 4DTBA 4D58A 5CWZA 4W9WA 3NUYA 4L3LA 3R02A 3ZDUA 1WVXA 1PXJA 2BFYA 1Y6AA 4Q5EA 3ZLWA 3KKVA 5D12A 5AUXA 5EQYA 4M68A 3AC2A 4ACMA 2BRGA 1S9JA 4F6UA 4X3FA 1JKLA 3KVWA 2F2CB 5KZIA 3UJGA 3M2WA 3A61A 3DBCA 3WF9A 4BCHA 2QU6A 3NDMA 4ANQA 4E7WA 4K18A 4F1TA 4S32A 3MJ1A 5AADA 5FDPA 4XJ0A 3G6GA 3F7WA 1G5SA 3KRWA 3O7LB 4RC4A 3MY1A 3UE4A 3ORPA 4UWCA 4F7JA 4D2WA 5K5XA 4EC8A 4EOMA 3W2PA 5BYYA 2G2HA 3MY0A 3RPOA 3C5IA 3D2KA 1YHWA 2JDTA 5HO6A 4EHEA 1YRPA 2Y8OA 5HO8A 2OIBA 3PY3A 4GRBA 4A07A 5B7VA 2OXDA 5HX6A 2E9UA 5LOHA 2Y4PA 3GENA 5F20A 4YGAA 2WTDA 2LAVA 4ALUA 3PXYA 4LFIA 5GIPE 4O22A 4HGTA 4CVAA 2W17A 5LJJA 2QG7A 4ZTMA 3A7GA 2BZIB 1LR4A 5M4UA 2A0CX 1YXXA 3PY0A 4EUTA 2YFXA 4AU8A 3ZOSA 2XARA 3POZA 3SW4A 1NT2A 3N4TA 1MRVA 2QOHA 3NYVA 4IWQA 4Y5HA 5CU2A 3JVSA 4XP0A 5IQBA 3D4QA 1UU9A 2BHEA 4QNYA 4HVDA 2WPAA 4MQ2A 4QMUA 4AW1A 4XV9A 4HVSA 1OL7A 3VIDA 2R3JA 3O8UA 4KKEA 5B2LA 3VJOA 3QQUA 4QQTA 1JWHA 4IVAA 5HBEA 4TT7A 3WBLA 1Q3WA 3RPSA 4ITJA 5ACKA 4J96A 2EU9A 4D9UA 4ITHA 3MA3A 5LVOA 5JSMA 4IC8A 2Y7JA 4LI5A 4BIBA 5HX8A 5JT2A 4QTEA 4DDGA 2VWIA 5AX9A 1W2FA 4FTUA 1CTPE 2KULA 4FIFA 3A2CA 4Y73A 5A6NA 3FZTA 4J99A 2PVRA 4LM5A 4RFZA 4V04A 3U51A 5I3RA 3RMFA 2UUEA 3E3BX 3GP0A 4IM0A 4FYNA 4MD9E 2PVFA 5A6OA 3UYTA 3NNUA 3VULA 3PJ3A 4WA9A 3ATTA 4ERKA 3O96A 2OWBA 3G9NA 2YM3A 3BCEA 3CSVA 2QHNA 5BVDA 4QMYA 3UPXA 2B53A 3VVHA 4I6LA 3A4OX 3KMWA 2X2MA 4EZ3A 4FTCA 4HCVA 3MSSA 1OI9A 2Z7SA 3LCOA 2PMLX 3KXGA 4I0SA 4X7QA 3BX5A 4FKGA 4AF3A 1G8JA 4PMSA 2C6MA 2HOGA 3HRCA 3HLLA 4C8BA 2ZFYA 4IW0A 5DH3A 5HOAA 4D9TA 4ZMEA 3TIYA 3ENMA 4DG0E 1FBNA 3RTPA 5AM7A 1BYGA 2HY0A 3V8WA 3EQHA 3ODYX 4E4XA 5TOZA 2YISA 1O6KA 4IADA 2ITPA 3EQIA 4YNEA 4BB4A 5LVPA 2CPKE 3QUPA 4XP2A 5L6OA 3G5DA 4IJ9A 3KU2A 1K9AA 1OIQA 4Q2AA 3OUKA 2NYAA 3DAKA 4RFYA 3S1HA 2QVSE 1XH4A 3UG2A 5CSHA 4DCEA 2W1CA 4L6QA 2WOTA 4ZSLA 2V5QA 3CS9A 3OCTA 3EN7A 3PIXA 4FC0A 3R2YA 4XG4A 3R63A 4NWMA 3LFFA 2CKPA 3RAKA 3NYNA 5DBXA 3WZKA 1GOLA 4L7FA 4D5KA 5CAQA 5EG3A 2IVTA 4YHJA 3ELJA 4S34A 3FYKX 3PUPA 3FI4A 4HYHA 4OBQA 2ZM3A 3RCDA 4YSMA 5HG7A 2W9ZB 4MTAA 3U87A 4NTTA 5A4TA 3PA5A 5AP7A 3Q2JA 5ETCA 4NL0A 4FV1A 1KV1A 5IQEA 4TXCA 4E4LA 1GY3A 3R8ZA 3BGZA 5AA9A 4GK4A 2E9PA 5IQAA 4Q9ZA 5K0XA 2JLDA 2Y9QA 3HA6A 4QMPA 4XBRA 4CFWA 5A54A 4DEAA 1R39A 4XS2A 4UZHA 5KHWA 1XKKA 4ZSJA 2WEIA 5GJFA 2NPQA 3QCXA 4OT5A 2ZB1A 2GQRA 3FZ1A 3T9IA 3VBXA 4E5BA 2WMSA 3FEGA 4EQCA 3HDMA 2R3IA 4FSMA 4ZK5A 5ITAA 2PVLA 2RL5A 4PMTA 4QMZA 4ZJJA 5DG5A 3NIEA 4YC8A 4YJPA 5CEKA 5IH4A 3H3CA 4OTPA 2RIOA 3ALNA 5B2KA 2B9JA 4QYGA 4B7TA 2YLFA 3O17A 2YZLA 3E8DA 5J95A 2QHMA 3BWFA 3I0OA 4FUYA 2EB2A 5GZ9A 1ZAOA 5I9XA 4M15A 4ACGA 4E1ZA 4EK6A 2WU7A 4BBEA 3DAEA 4E6AA 4BCJA 2Q0BA 5EOLA 2J5EA 3DY7A 4RX5A 2O8YA 2A1AB 5FP5A 2XEZA 3THBA 2QOKA 1DI9A 4HGLA 3GT8A 3AGMA 3DKCA 3ID6C 2IPXA 3R8LA 3VJNA 4CMOA 4PDOA 5JQ5A 3MH1A 3RAIA 4MYGA 2PE0A 2CLXA 5DLSA 1OMWA 3R2BA 4ASDA 4KWPA 4UMPA 4AW2A 1BX6A 3CJFA 4ORKA 4FT5A 2CKQA 2EXCX 3MJ2A 3JS2A 2AYPA 3MVHA 2W4JA 1XH5A 1Z57A 4C4GA 1M14A 3EJ1A 3F6XA 1YHSA 3VO3A 2QNJA 2XNPA 3TEIA 3S00A 2XJ0A 4FL3A 4C7TA 2C3KA 3BYOA 1DS5A 3IPHA 2PZRA 5CNNA 2CN8A 2C30A 2W1FA 3W2RA 4GT5A 2PWLA 5JFVA 3E8CA 2JIUA 5BX0A 4FTIA 2IO6A 3IW8A 3O23A 3WF7A 5CANA 1L8TA 3PXRA 1IEPA 3PSBA 3IW5A 4FVRA 3UNKA 4DFNA 3DFCB 5HE0A 2C3JA 3C0GA 5FBOA 3AXWA 3AOXA 3DTCA 4IACA 4U43A 2ERKA 3RHXA 4RIYA 3VS4A 4A9SA 5DIAA 3CPBA 5CU3A 2JBOA 4IDTA 3ZFXA 5CF5A 3DB6A 2Z7RA 3FY0A 3MPTA 4GVAA 4DH8A 4EJNA 3F88A 3R9OA 4LRJA 4EYMA 3UQCA 3FSKA 4UXLA 4EYJA 3FYJX 4AA4A 3U9NA 5EH0A 3LKMA 4E73A 2WMWA 2XNEA 2C5YA 5TO8A 5IH6A 2IWIA 3ZO1A 2X8IA 2VGPA 2CLQA 2R3RA 3NCGA 3BGPA 4I0TA 4NIFB 4IE9A 2BAQA 4I41A 4P5QA 4A06A 5G6VA 3WARA 1WBSA 3UOJA 2XKFA 2WOUA 5IUHA 5J7BA 5EOBA 4MVFA 4OR5A 2HAKA 4X2JA 2PUNA 5C9CA 3BYMA 1U5RA 1YXSA 2QC6A 4IZ7A 5IEYA 3ZRKA 1CKPA 2YAAA 5L4QA 5CENA 2H9VA 4FKWA 2QKRA 3FC2A 5E7RA 4AG8A 4W4XA 5AUZA 3OD6X 1Y6BA 4EZ5A 4F4PA 1H1RA 4RPVA 4C62A 2OXXA 2YIQA 3C13A 4RLLA 4DT9A 1WZYA 3ZXZA 3SXRA 4IX6A 2W5BA 4JIKA 2QODA 2VV9A 5HE1A 3OWJA 4FG7A 4O2PA 4XMOA 3V51A 4ANLA 5LMKA 4MBLA 2G1TA 4M97A 4TYGA 4PDSA 4ZSAA 2YIWA 3SQQA 3TTJA 3CE3A 4RLKA 1PKGA 4BCIA 4BKJA 4EQUA 3BBTB 4BHNA 3KIOC 3FZOA 2C6DA 5LWNA 3W2QA 4QP8A 2X2LA 5A9UA 5FM2A 5FTGA 2VO6A 2YWPA 3MH0A 3FLYA 3ZH8A 5AJQA 3A60A 4H1JA 1Q62A 2WMQA 3HMIA 4S2ZA 5HLWA 4CCUA 5HEZA 2QD9A 4FTKA 3LJ0A 3QWKA 2CCIA 3U4UA 1H26A 3D7ZA 2GFSA 4FV6A 4KBAA 3DNEA 3PZHA 4U5JA 3PUFC 4D2VA 3EL8A 3QL8A 2YWVA 3NYOA 4KB8A 5CTPA 5BUIA 4UMTA 5HD7A 4EK3A 2J0JA 2GMXA 3HUCA 4XRJA 4JBQA 4BDFA 3NSZA 4P5ZA 3BEAA 2XIKA 3UVQA 3FKLA 2HY81 3BEGA 4KIQA 2ZV7A 3ORZA 2WMTA 4J8NA 2JFLA 3AG9A 1JKSA 5ANKA 4YJUA 2ZVAA 3BGQA 4RA5A 4RIXA 4DA5A 5CU6A 4HVHA 4FT9A 4BGHA 5M4CA 3FV8A 2BCJA 4PNKA 3KRXA 3WE8A 3HGKA 4H39A 4RVTA 4P4CA 2XK4A 5LCJA 4FNWA 3OCSA 4APPA 3Q32A 4XG8A 5AR5A 1XBBA 4KSQA 3VUMA 2QOQA 2V55A 1OZ1A 1WVWA 5HNGA 4BCOA 5HCYA 3FXWA 4CT1A 3RKBA 4KUJA 5A46A 2JAMA 2VTOA 3C7QA 3HL7A 3LXNA 5EW3A 2QOFA 4FKUA 4JR7A 5BNJA 1E1XA 4MD7E 4Z9LA 3LE6A 3SC1A 3E8NA 4FICA 3OOGA 1NY3A 4HYUA 1ZYJA 4JLCA 4E26A 3A99A 5C8NA 3KXMA 4LGDA 4WSQA 1CSNA 1RQQA 2Y4IC 4HYIA 4C2WA 4KIKB 4BDEA 3ANRA 3AT2A 1BI7A 3C4EA 3V01A 3Q6UA 2FSLX 3OMVA 3PXKA 5EM8A 2VAGA 3QCYA 3FQEA 3LFAA 2RFEA 3DFAA 3RNIA 4J52A 3SW7A 4F1MA 3LM5A 3QGYA 1B6CB 5EKOA 4C4FA 4AZEA 4O0VA 4R1VA 2PHKA 4FBXA 4ALVA 5AAEA 3V5QA 2VWWA 5E4HA 4CLJA 2PMIA 4UB7A 4CYIA 4XEYA 2XUUA 3GQIA 4E6CA 2R64A 4OAVB 4ID7A 5HNIX 4EL9A 3KXZA 3CXWA 4F0GA 1ZYCA 2ONLC 5AEPA 2R3GA 5IMEA 4G16A 4O91A 3NUUA 4V0GB 3PTGA 3IECA 3K5UA 5BYZA 2YDKA 4BICA 2P0CA 5FRIA 4CD0A 4MXXA 3OTUA 4NJ3A 3CGOA 3WZDA 3UPZA 5CEIA 3FLZA 3GNIB 5EW8A 1KE6A 1MRYA 2Y6OA 4GMYA 4IIRA 4BDCA 3ZC5A 1YOMA 3WIGA 4H36A 3S3IA 2PMOX 5IQFA 4JDJA 2BZKB 1JKTA 3C51A 2B1PA 4JS8A 4FT0A 5CQWA 1YXUA 5EDQA 5TR6A 3UQGA 3DXQA 3QZIA 2WEVA 2UVXA 4K6ZA 3VW8A 4AT3A 3LZBA 3OUNB 5HU3A 4H3BA 4I6BA 4P90A 3R8MA 4EK5A 4O0TA 3COHA 4ZZOA 1FINA 1K3AA 1M52A 3VUGA 4AQKA 4DG3E 2ZAZA 3CY2A 4JX3A 1IR3A 3P78A 4IWDA 3KF7A 5AV1A 4BDBA 4C57A 1J91A 5D7AA 3HA8A 4CYJA 3UP2A 4N6YA 2JKOA 2PZPA 3QD0A 3UP7A 1R3CA 2JEDA 4MQ1A 3R9DA 2R3OA 1V0PA 3S4QA 5IISA 4BKZA 2WMAA 3E87A 4EOQA 2PMNX 3AC5A 3KULA 3Q4TA 3DXNA 4RJ3A 2E2BA 4U97A 3VBQA 4MCVA 5AUWA 4B99A 4FE2A 4PTEA 2AQXA 3SVVA 3DAJA 2QCSA 4AGUA 1KOBA 4A4XA 1Y8GA 3QAME 1W98A 4HYSA 4FA2A 4BGQA 3OCGA 5DT4A 3LMHA 3G15A 2H8HA 4UBAA 4NYEA 1U54A 3OWPA 2OU7A 2R9SA 2GPHA 4QP4A 3GUBA 1H1WA 3R7OA 3PRIA 4EHVA 2P4IA 3FY2A 4R3CA 3AD6A 3C5UA 5CY3A 1XHAA 4HW7A 4UX9A 2OW3A 3L8SA 1IAHA 3JXWA 3Q2MA 3R9HA 2VUWA 3F3ZA 3L8XA 3HUBA 3WE4A 2VU3A 2BMCA 3UDTA 2F7EE 4YLJA 3HKOA 3Q53A 2IZSA 2ITXA 2J90A 2H96A 4F9BA 5DVRA 3V04A 4DEBA 4A4LA 1B38A 4FIHA 1U4DA 5C4KA 4DH5A 2NRYA 3NRMA 1XBCA 4YO4A 4AGWA 3CLYA 2Z60A 3A8XA 2BFXA 4IJPA 4LV8A 5D10A 4FGRA 4ZTNA 4TTHB 1M2QA 2JAVA 3ZDIA 1RDQE 5KE0A 4YMJA 2VN9A 4O7TA 2HZIA 4PNIA 2UW8A 4USEA 3EYGA 3QLFA 5IQDA 4RWIA 3AMYA 5IQHA 2VWZA 3ENHA 4CFUA 2VX1A 4MF0A 3JY0A 3V5JA 2GNGA 3COKA 3ZO3A 1QCFA 2RFSA 3TV4A 4AWIA 2IZRA 1J1BA 3MFRA 2XKEA 4GFMA 4BWPA 5FTOA 1V0OA 4C02A 1OL6A 4EQMA 4DG2E 4FV5A 2W5HA 2GHLA 1YW2A 2F7XE 4UZDA 5GINE 5E92A 1Y8YA 2YM8A 5AR4A 4HOKA 4I92A 3ZTXA 4ONAA 4RVKA 4HVIA 3U6HA 1Q97A 3QC4A 3GOKA 2GTNA 5HGIA 3IS5A 4JG7A 4I6QA 5CSPA 3PLSA 3FJQE 4FV7A 5JRQA 1VR2A 3E62A 3COIA 1ND4A 2J51A 4QTDA 3HNGA 5AR3A 3UC3A 4EEVA 4C0TA 5BVOA 1OGYA 2UW3A 2OKRA 3RP9A 3MBLA 4TYEA 4WUAA 4FIEA 3VF9A 3VS0A 3LHJA 4ANBA 3DCVA 3QTUA 3FLNC 4GJ3A 4BCKA 3LFSA 2RG6A 1PJKA 4CG8A 4WSYA 4ANOA 4FSUA 3OOMA 2ZB0A 2C6OA 3NWWA 3MH2A 2OI4X 1J3HA 2YA9A 3P7AA 5IPJA 3TDVA 3BV2A 4L43A 4K2RA 1SZMA 1KWPA 3CQUA 4J8MA 5DOSA 3R1QA 4WNOA 5JQ8A 3EB0A 4WO5A 2HELA 3PIZA 2HXQA 4C4JA 1CKJA 2O64A 3UO5A 4X2NA 3V6RA 3RAHA 3QHRA 4PL5A 4BCPA 4E20A 5I0BA 2JDSA 3BE9A 3BHUA 3UNJA 2XANA 4W4VA 1GJOA 1REJA 2OBJA 5L2SA 2C5XA 1KE8A 2X8DA 3E64A 2WTCA 1NXKA 4DHIB 2HZNA 2X39A 3FZSA 5CZHA 4WKQA 3FMKA 2C6KA 3AMBA 3FBVA 4II5A 1NVQA 3L8PA 4M8TA 4I24A 2AUHA 2EXMA 3EYHA 3SKCA 3FKOA 4FNYA 4JIAA 3FE3A 2JGZA 3SA0A 5HIDA 5IQIA 5C03A 3HV7A 4R1YA 3LPBA 4R3RA 3HRBA 4LYNA 4F9WA 5F4NA 4O81A 2WZJA 3HMOA 3KK9A 4QP7A 4EWQA 4QMNA 5EYKA 4GKIA 4C58A 1NW1A 4QD6A 2Q83A 4DEGA 2ETRA 4HGSA 2J6MA 3GB2A 4YBKA 2XBAA 2XK6A 4FOCA 3OF0A 3ZSGA 5I5ZA 4F7SA 5KBQA 4JDHA 4WOVA 1O6LA 3NUPA 1A06A 3D15A 4BCGA 3R9NA 3CD8A 4FIJA 3TACA 3BHVA 4FSNA 3WYYA 1MRUA 4BCNA 4BCMA 5E8UA 4D1ZA 5HTBA 3VUKA 4CKJA 4IAIA 2VTHA 4YPSA 3C4FA 5CYIA 2PPQA 4AXDA 1BUHA 2G01A 4BTFA 2VTTA 3PE2A 3RM6A 3TN8A 4F7NA 4WG4A 4BCFA 4JAJA 5IQCA 3Q04A 4DHZA 4PPCA 2W1ZA 3PG1A 1Y57A 5T6KA 4DGNA 3O8TA 4EH6A 3LCTA 2JDOA 4H1MA 4FOBA 3V5WA 2XIRA 4QEBA 3ALOA 1WCCA 3DK3A 3NMUF 5L8JA 3SLSA 3Q9WA 2W7XA 1WMKA 1H25A 2GSFA 4H05A 4R8QA 4MF1A 2BRBA 5KKRC 1QPJA 3DXPA 4X2FA 4DFZE 4UN0C 4YC3A 4IC7A 4W4WA 1M17A 1DM2A 3QD4A 1UWJA 4G5PA 1RW8A 2C68A 4PMMA 1W84A 4CEGA 4CTCA 3I1AA 4TYHB 5IU2A 2FH9A 5IF1A 3K3JA 2RKUA 3OZ6A 4AS0A 5IUGA 3P4KA 3W0NA 5J87A 4L00A 3BI6A 3R04A 3TKUA 5B2MA 2JITA 4CV9A 3TDWA 1HCLA 1R0EA 1CM8A 3P23A 5EYMA 4RG0A 4DH3A 4U81A 4BN1A 4V05A 2YERA 3ITZA 2RFDA 4F9CA 5CEMA 4GUBA 3DDPA 5BVFA 3NW7A 4IAAA 4BTJA 2X0GA 4RMZA 5ACBC 5IA3A 2YCRA 1Y91A 5E9EA 3PP0A 3HAVA 3VC4A 4I0RA 2XYUA 4I21A 4BBFA 3OXZA 4KABA 1J7UA 3FQHA 4AXFA 2BROA 4FKVA 3RK5A 3COMA 5AP1A 1MP8A 1JLUE 3ORXA 4P2KA 3GXLA 4PY1A 2VTRA 2V7OA 4R77A 3KF4A 3OT8A 3Q96A 2R4BA 2XALA 2VO3A 1WBWA 2PL0A 2CKEA 5JZNA 2G15A 4AZWA 3Q4ZA 2B9FA 4TWCA 3QKLA 3FHIA 5DI1A 2OJFE 3RINA 5FXRA 4IAFA 5AFVA 5C8KA 4E6QA 2RG5A 4ASZA 3PSDA 3TV7A 2X2KA 4BI1A 1ZYLA 2R3NA 4EC9A 4UMRA 3O5AA 3DT1A 5E8SA 4NFMA 5I9VA 2WMRA 3CIKA 4R7HA 3UODA 2XB7A 3KA0A 4G3EA 5ANJA 5HI2A 3QKKA 4PL4A 1JAMA 2PVHA 4IAKA 4RWKA 3LXKA 1PXKA 3OW3A 3NYXA 5HICA 2HYYA 3KGAA 1YI4A 4D0WA 1F0QA 5E91A 4GSBA 5KHXA 4FUXA 3R21A 5LVNA 3M42A 4G3DA 2HIWA 4XV3A 3W16A 4F08A 4XLIA 4NW6A 3O71A 4EH8A 1M2RA 3R1SA 5TT7A 3EQDA 1Q8WA 3TNWA 4FEQA 2R3FA 4KIPA 4RZVA 2IVVA 2BKZA 3ET7A 3CY3A 3CKXA 5HIBA 3GFWA 4YZDA 3OCBA 3PG3A 5IUIA 2UZLA 4FG8A 2C6EA 4F1OA 3W1FA 5GZ8A 4O0YA 4RGJA 4IVCA 2W1IA 4QTBA 3VS2A 3UG1A 4JX7A 4G34A 5KKRB 4BHZA 2WO6A 2VZ6A 4MAOA 2YACA 3PJ8A 4NH1A 1OUKA 4OLIA 1QL6A 2ITVA 3VAPA 2GS7A 4IM3A 5DE2A 2P2HA 5FXQA 2BIKB 4PMPA 5T68A 4LGHA 3ZMMA 4WG3A 2UZWE 4KINA 4EHZA 4O7WA 3RAWA 5TF9A 4IM2A 1TVOA 2ESMA 4FODA 5AA8A 4R7BA 2QR7A 5FP6A 1Z5MA 3QXPA 2F49A 3TI1A 1PMVA 4M7IA 1E9HA 4J95A 2W96B 3I6UA 3KRLA 4YR8A 5CF4A 4CFNA 1PHKA 3BYUA 2BZJA 2XS0A 5FBNC 4Q9SA 4DBXA 3CJGA 2E9NA 2XH5A 2YM4A 4I23A 4KA3A 4EUUA 2BDWA