4PV9A

Crystal structure of h2kb-q600v complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
277
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural and functional correlates of enhanced antiviral immunity generated by heteroclitic CD8 T cell epitopes.
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 277
sequence length 278
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pv9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pv9A01
4OLUL 5HPMA 4LF3B 3HR5A 3VG0H 1S7TB 1H5BB 3EOBB 3D85A 3LKQA 1RUKH 4HLZG 4U1SA 1RJYA 2ESVA 1NCAL 3TCLA 1YJDH 3NIDF 5IWLC 4O58H 2Y5TA 3NFSL 2HRPH 3K8LA 3E0GA 2FWOA 3MACH 3RNQB 5TPWH 1AD0A 1G6VK 4LARH 1FJ1A 2PW2A 4YR6B 1IBGH 4GSDL 4HT1H 3PGCA 4Z76B 1ZVSA 3DIFA 3V52H 1J1XL 3PL6D 3WO4B 4PRHB 5I75B 4KXZI 5K9QI 4P5KA 4QTIL 3BUYA 4DAGH 4HIIA 1UB5A 2IPUK 3VDBA 2Y1VA 2W0FA 5FCSH 3AS3A 1NANH 2GUOB 3WBDA 3W0WD 4GMSH 4IRZH 4H0GA 1TJGH 2ZNWA 4WJ5A 4PRID 1R5WB 3LPWA 5IMKB 2J8UB 3C5SB 4MNQA 1F3JA 4LHUG 5T3XH 3BEWB 2GFBA 3KPRA 5E1AB 2HFFB 4CVUA 1XF4B 3VH8G 3O6KH 4TNWK 3ARDA 4HJ0C 2J4WH 5I1EH 4JPIA 3LDBB 4K3EH 2OZ4H 4JRYB 5I1KL 4PJEE 3WNKA 1QSEA 4I0PB 4JKLA 3NTCH 5IBTL 5C6WH 5M94B 4IRJD 1LO0H 3NA9H 1YEHL 3H3BC 4XCFL 4QF1B 4ELKA 1INDL 1J0HA 4J3XA 4NBZB 1TTUA 2ZSVA 3S97C 2ITCB 2HJKA 3ARVA 3FN3A 2DL9A 4PJ9D 2OL3B 1HHGB 3QI9B 4FA8A 5HXMA 1PQZA 2O93L 3H8NA 1OQOA 2XWJA 1PSKL 1KJMB 4P5MB 5D4QA 5C2BH 5T5NG 5L2KA 3CH8A 1FNGA 5E2WL 3CX5K 5F9DC 1BIHA 3GM0A 2DQTH 2J1KA 5HHOE 4TSBL 4DVRH 1RAMA 5A3IC 3LN4B 1D6EB 1A7QH 4R90L 1OSZA 3UROR 5BXFA 1NGQH 5C70A 5CHNA 5B38G 3GJFH 1A6ZA 1T2JA 3B2UC 2Z4QB 2E27L 3FO1A 2DLFL 1FG9C 2Q86A 4N0UE 1MWAB 3FCTA 5F96L 1DVFD 5I8OL 2ZUYA 4PRAB 4K7PX 5HYJD 1P69B 3QXWA 4FQQB 3WL9A 3O8XD 5FYLD 4G6FB 5T1KA 1CU4L 2AJ3A 4H88H 1QG3A 1AI1L 2VLJD 5F1SA 4Z7NE 1OAUL 2LU4A 4JQXC 4MDIB 3V9FA 3H9HA 4L29A 3MV7B 2VLME 1OL0A 2OS7A 4I18C 2IBBA 4XP1L 1OVZA 1IC1A 3BQUB 4YK4B 4QRPA 1ITBB 3B9AA 4XT1C 3SDXE 4FQ1H 5MEPB 1KB5L 2APVA 5ADOL 4DWHA 2UWEF 4HFWB 1UA6L 1KTLA 1V3JA 4HPYH 3QHFL 1U8NB 3R06B 5FOJA 4CU6A 3FZUC 1OF2A 4M48H 4N5ED 1JPTH 3EFDL 2XYCA 4QRQA 4U1LA 3QWRA 4TYUA 2GI7A 3MNZA 4Z7VF 3ZYJA 4P9HH 3JSSA 1KN2H 3PGDA 1AE6H 1YMMA 3ULUD 5J6GB 4LCIH 2JELH 2YN5A 2QQNH 2D7TH 3L1OH 5JZ7D 5IF0A 2J8HA 1PKQB 3K4AA 4NZJA 3TPUB 1AO7D 3T3PF 5GHWL 1JWUB 1F3DJ 1NCDH 3GSUA 3VXME 4PGEA 4WI5A 4Y19D 1I7UB 1PAMA 4DVBB 1PZ5A 3WCYA 5CJ8A 5DWUH 3IXTA 5I1LB 4R7DB 3QO1B 2E8YA 1DE4A 2R56L 4IOFD 5DQJB 5J8OA 1Z9OA 3FAXA 5IR1A 3H42L 2P5WA 4NUJA 4Y4FD 3T3ME 2E5EA 1R3LB 4M5YL 1JHKH 1OT2A 4QHUB 1JRHI 1WTGT 1YPZE 1P1ZA 2H6PA 5DJ0B 1J05A 2CDEB 5I0ZA 2DTML 3QG7L 4NCC1 4BFIB 2FEDC 3KPSE 4JM2F 3QNZB 3NGBC 4YQXL 4JO1L 3WD5L 4PGBB 3O6FD 4NC2B 2F19L 2VDPL 4OKVA 2H32H 4E41E 3GSNA 1GHFH 3NACH 3MQIA 5JLZA 1RU9L 4KPHL 2Z8WC 2VLLA 3MRBB 4UUJB 3STLB 5AZEH 5JQ6L 5D1ZC 5ITFB 1IEBB 1Z0MA 1KNOA 2GJ6E 4S1DC 3BXNA 3N06B 4MJIA 1NGWA 3CXHJ 3GB7B 1UEMA 3H6JA 3V5HB 5GZOD 4Y4HD 4FG6D 4Y5YC 4BUGA 3NA4A 3KYAA 4PDCE 1F2XK 1EUTA 2VIRA 1TMCA 3BWAB 3QXAB 2DWEB 5FV2A 5I16A 4Z0XA 4FQPA 4FTVA 4GKNB 1WWWX 1CVSC 2C9AA 4KK5C 4FZEL 2ENYA 3T0WA 1N8ZB 5SWQA 1ZWIB 1AGDA 3KLAA 3VGAC 5EUOA 3SCMD 3KS0H 1RI8A 2B5IC 2QSVA 3MO1A 4AENB 3ARWA 3FHQA 3I3DA 4QT5B 4G8GE 5TE7L 1F4WH 3LH2H 4OQTL 4RIRA 1LO5B 4JFHD 1R24A 4HK0B 1CR9H 4UDTB 5C71A 2Y25A 1IGFH 1U91B 3O2WL 4G7YL 2LFGA 1FLRL 5KZCD 5GGSA 3BH9B 4M93C 4URTB 2YRZA 4PJEB 3QDGA 4W6XB 1TTFA 5I66A 2J2ZA 1QLFA 4A6YH 4S10A 1I9JH 3QPXL 5IG7B 4NQEA 5J9PB 4XMPH 2YC1A 5BS0E 3S4SB 2ORBH 4GMTL 4HUWB 4J3OC 5ANMB 1XIWC 3CDCA 3HMWL 4JFZH 5ICYA 4XWGL 2BRRH 3U79A 1B88A 4KTDL 5D5MA 2KQNA 3DECA 5F6HJ 1BD2D 1KB5B 3KWWB 1RZKH 5HHOB 4ZNEA 4WFFE 5GJSH 5HDQL 1B6DA 2YOCA 1FL3B 1ZLWK 1UJ3C 1LQVA 2VJXA 5BZDB 1DJSA 4BJLA 1INQB 1T20B 2CDFB 1MFEH 3FO0H 3ARBD 1KB9J 2JJWA 1B90A 2A74A 1JWSA 2BXZA 3KR3L 3C6LC 3CFKB 4N0UB 1GGBH 1EZVX 2A73A 4MMXC 1KJ2L 1UWXK 3OKDB 4XGZB 5AD0B 3O3BA 3GMPB 1CFQB 1YA5A 3AMLA 3LB6C 2OXGA 1H3WM 4KKCC 2X9WA 3L3HB 1CGVA 1RVFH 2FBJL 2OI9C 1J10A 3HZKA 1D9KA 3FFCE 1N5AB 2HTKC 2QKIA 4F7EA 3AC0A 4OIAA 1G7QB 3UTSE 2AEPH 4I18B 3EYSH 5B4MD 5K59F 3WKNA 4S0TD 3BP4A 5E8EB 3DVNB 4HIXL 1JK8A 2AJYH 4OLWH 2YN3A 3IKCB 3SJVA 3VXRD 2VQTA 2BNRA 4RGOL 1JPFA 4KV5E 3ZE0E 1BVLB 1VGEH 3IYLW 5EZLB 2CR6A 5HHVH 5L88L 5JPNA 1Y18A 4LP5A 3RVWD 3M07A 2M1KA 3LMJL 3BAEL 4HKJA 1U8HB 2CRZA 4IDLA 5EOTA 3SDDD 3KPNA 3DGGA 1DQDH 1DDHB 5E2UH 1PY4A 1MELA 3QDJA 4G9DA 2AQ1A 2V2WB 4NNXB 1I7RB 3VXMB 1IAKA 4MWFA 4JZJA 4JKKA 2K1MA 1K9TA 5EU4A 2FYYA 3HG1D 1P4BL 2EDLA 2Z92A 4WHDA 1MCJA 4TUOA 4YNYB 4HWBA 1GGCH 4PBXA 1S78D 1UYWH 4ONGH 4YPGA 5C0EA 1CXIA 4OIIL 3CUPB 3QG6B 5ICZA 2VXQH 4P5TA 2JK5A 3CAFA 1VADB 1KPRA 2GK0A 1XF5B 5H2BA 4PY8I 4GG6F 4WUKL 4LNVA 3KPSB 1BEYH 2VLKE 3KPRE 1WZMA 3CFEB 4F7PB 1DN0B 4OBRA 3NGBB 3GMOA 4AZ8A 5GZND 5IT2L 3LV3B 2IF7A 4P3DB 4PPTA 2YRLA 4GRWH 4MX7A 3OXRA 4JHWH 3QEUB 1QSEE 5H94A 3TP4A 4AT6B 3MZTA 1S9VA 1J86A 4RAVB 5ECJE 2VXVL 3JVGA 5CILL 4MLSA 2AV7B 4PTTA 4Z77B 3IFLH 3TIEA 1YY8A 5B8CB 3HC3L 4OZHF 4JCMA 3QUMA 5EU5A 2G60H 4Y5YB 5L6YL 1LP9F 1MEXH 4HGWB 4L4TB 4OV5B 1D5ZA 4BSWA 3WO3B 1U93B 2IFFL 2B1HL 1BFOA 1F00I 3RHWK 5I8KH 3WS3B 5IHZA 3QULA 3D69B 4XWOD 5T1DL 2NY0D 1E4WL 4XHJD 5DDHA 2NTFB 3NVQA 3VGAB 1S7VB 4BKLA 1G9NC 4I2XA 1QZ1A 4J3VA 2JJSA 2B5IB 4G8GB 1GCFA 2ED8A 3V6OA 1AXTH 3H9SD 1XH3B 2IH3B 2EDJA 4EBQL 3ZDYE 2R4SH 1LNUB 4DGVL 4POZD 1QLRA 3QEQD 4LP4A 1KJ2B 1MQKH 4LCWE 4JFPB 3O3DB 1XGUB 4NKDA 4OKDA 5I17A 4M93B 3WFHB 4LMQE 3B2VL 4ZFFA 2Z31D 3HPJA 2IPUG 4WW2C 1V3LA 3BT2L 4X7SL 4CU8A 1A4KB 1E0OB 4GFTB 3IFOB 2C5DC 2VDLH 3E2HA 1NUFA 3TVMD 1K8DA 4U33A 3OJ2C 1XIWB 2IH1B 3AMKA 1U8OB 1ETZA 3QIWA 2BCKA 1BAFL 4IRSC 1F97A 1A9EB 3E6FA 2VITA 2XWBB 5DEZA 1HSBA 5E00B 1G9NL 2YWZA 3ROLB 3CJJA 5CSBA 1S7UB 4JPVL 1QEWA 2EIZB 5DJDB 1UJ3B 2WIIA 5I1GH 4JFOA 1M05B 5T1MA 5GIRB 2HYMA 3AFLA 3WIHA 4PBWD 5TF1H 4JAMA 5IESH 3BZEB 3C6LB 1KCVH 1DL7H 1YN6B 4WCYL 1A2YB 1HINH 1KN4L 4ALAH 2DQJL 4HKXB 4TUJA 4JM2D 1A3QA 4DEPC 1MPAL 5D6CA 3HLAA 5FKPA 4NWUH 3OG6B 4LSRH 2OI9B 3U7YH 1UM6L 4R8WH 2E9IA 4K3HA 3UTSB 1QRNA 4ZPVA 3SGKC 5D1QC 3S88L 1BQLL 2IGFL 3PHQA 1JZ5A 1S7SA 3QRFM 5TE4L 3PXJA 1A14H 1IKNC 2W60B 2EO9A 4WVRA 4JM4L 1MRDH 3DPBA 4A2MA 3MV9A 1IAIL 1SVZA 4HUUA 4RFNC 4HUNB 3O9WD 4Q2ZB 3FL7A 1LO3H 4R7NB 2Z35B 4ODUB 1T22B 4H1LH 4CL7A 4MAUL 2VNCA 1F4AA 5GGTL 2ZP0T 2P49B 3PL6C 4P2QD 3CCHB 2GTWB 4W81A 4QHMB 3S96A 3TJEH 3MLZL 3T65A 3WJLC 1T1XA 5DO2D 2VXUH 1MVUB 1Z5LB 2YEZB 2AS5M 3OR6B 3OKOA 1PG7H 3V5DA 2X4QB 2WUCH 4I3RH 4Y7MA 4ZFGH 4KZDH 4XPBL 2YD5A 5D6DA 5HYQA 3VRLE 1W0VA 1KIQA 2CK0H 5GGQH 4YXHH 5CCKL 4TSAL 4HIEA 2R1WA 1V7ML 5MI0C 5HJ3A 2BVUA 4X6EA 4MXVE 4JPKL 3GRWH 3NZ8B 1GZQB 5LGKA 1DQTA 4NFCA 5D2LF 1MREL 1BZ7B 5L2JA 3O41B 3RI5F 2RBLA 3KXFE 4IRJC 1FP5A 2ICWA 2AERT 2EEAA 1DBKH 2KPNA 3VRIA 1V7NH 5E99H 1KBGH 4LSSL 2X4TB 4WU7B 2YD2A 3CXDH 3VXQA 5F7FA 1FNSH 5I8CA 1JPSL 4YHKH 2R8SL 1HHJA 1QFPA 4FFYL 1BGXH 1FVEA 4OCXH 3TN0A 5FF6A 4HXAL 3OPZH 3EZ8A 2VDNL 4R0LA 5JNYA 1NEZB 2X4UB 5ESAA 2OXHA 4RZCB 1ND0A 4X99B 2VKXA 4JG1H 5D7LB 3UPAA 3CFCH 4ZMAT 5D72L 1YYLH 5TDNB 4PB9L 4YHPB 4ZS7L 1Z9MA 4YZFF 3CPLB 5FUCC 4U6XB 1AC6A 3U1SL 4PJAB 4OF3A 3O8XC 3IFPB 1A1NB 1JN6A 1NGZA 5D5ME 1MVFA 4FS0A 3EHBD 4FXLA 3MUGA 4ZNEE 1MJ8H 1RZGB 3WXWL 3R1GH 3MA7B 5DRZB 1Q9LA 4AM0A 5HVHC 1FDLH 1CGXA 5EC2B 3TESA 2ZOKB 1S7XA 5KVGH 2ITDB 4PJ5E 3KPLA 3QNXA 4QEGA 1AKJD 3SQBA 3HI6L 4HLJA 5IFJA 2F53A 1QFUH 1F6FB 4D0DA 1A6AA 3WLBA 1OAYL 3E3QC 1R3KA 5E9DD 4G8FB 1RMFL 4AEEA 3PWPA 2GEEA 3IT8D 5T5NF 4LCWB 4YEFA 1L9MA 1CE1H 4S1SH 3C2AL 4OGXH 1ZLVK 3MV8B 5DK2A 3L3IA 4LU5H 1S5IH 3JZ7A 4ZS6D 2ZCLL 3AB0C 5FHAH 3MROA 3RVTC 5IQ7L 1Z6JT 3QFDB 2Y07L 3I85A 4WW2B 1KC5H 5JW4N 4Z7UA 1LQSR 1ZVHA 5FYLL 1YEJL 3RL1B 2DWDA 2GJ6D 3ZKND 3CLFL 4XNYH 5FDYA 5KSBF 3MOQA 1AGFB 4JVWA 3SJVE 1JFQH 1RIHH 5CBEB 2FECI 4U1IA 4LRIC 4UQ2B 5E5UB 3MJ7A 1T5XA 5F9WC 5FO7A 4CJ1A 4QY8B 4AY0A 1D3CA 2FH6A 2B1AL 4JZNB 2NNAB 4F58H 1BBJA 4RFEA 5JOPE 3ULVE 1YYML 1N7ML 3GK8H 1F11A 4AG4H 1JZ2A 1HNGA 1PG7W 1V3KA 1CFVH 1KLGA 1S9XA 3QDJE 2A0LC 1BJ1H 1S8DB 3RNKB 1WBZA 2AV1B 3OGCB 1NBZA 3PDOA 4POYA 1C7TA 2YK1L 1XAUA 5ICXA 4DEPB 5JXEA 2AVGA 3LSOB 2NMSA 3CXHK 3DRQA 2IPTL 4G6KL 3VXPA 3O6FC 1HXYA 5D1QB 5TQ2L 2D7MA 3QJFB 4I4WA 2VDRL 5DZNA 4OSUH 5BS0D 1WC7B 3VE0A 5EWIL 2FSEB 3AM8A 3AY4A 5EUOF 3U4BL 3VD5A 4JO2H 1QBMH 1LO2L 4HHAB 4PTUB 1PBYA 4RFNB 1X9QA 5KTEL 1NGPL 4ZSOA 1QBBA 2OQJA 4Q6IC 3SPVB 4WWKA 1SY6H 3W39A 2O5XL 3PL6B 1FZMB 4JANA 3MLRL 4ELME 2GSGB 3V7AE 1EGJA 5EPMB 2GITB 2YD4A 1KJ3L 3MJGX 5E08H 3H3KA 2CXKA 3MLUH 3NZHL 3X12A 3W0WB 4YPJA 1KXVC 1X5FA 4U7SA 4W68A 1OGTA 1IGTA 2HTLD 4PRIB 5T1LD 2DM7A 3UYOD 3O45B 4WO4D 4JFXA 2UY6A 1J1OL 2O61A 1TCMA 3TBSA 2ZUWA 2OP4H 1HH6B 4YHNA 2DLIA 1EJOH 2IBZY 1KGCD 3MNVA 3IGAA 3REWB 3RZCA 1XF3A 3Q1SH 4Z18A 5SX4I 3HRPA 5MI0B 1KELL 4XP4H 3HA0A 5ALBL 1IC4L 1K3IA 1U58A 4JDVA 4ZUVA 1TPXC 2RAMA 3QBTB 4X5LA 4IRJB 4MD0B 5A2LH 3D2UA 4HWZA 4CMMB 5SWZD 3RVUC 1LO4L 4YHML 1EEZA 1KB9K 4PLKD 3G5XA 1S5HA 4L3EE 1KV3A 4TOYL 3FT3B 4HBQA 1Z3GH 3HZMB 5DZLA 5SX5H 3D85D 3K4ZA 4LLMA 4XI5C 2ESVD 2WW8A 1IAII 4JY6B 3GIZH 1CL7H 5C09A 2BSRA 3JV4A 5IP4A 4QRSB 1I8LA 4K8RH 5HD8D 2CLRA 4NBXB 3S35X 1ERNA 4HBCH 4YHYC 3VJ6B 4NN6C 4M1CC 2Q7YA 5IGXL 4B7LA 4E5XA 4PLNC 3RFZC 1RZIA 4LGSB 1RUPH 3QXUA 1DP0A 1QSFE 4PRDB 1YUHA 4DKAA 3SKJH 1YNTA 2X05A 5EOCJ 5DUMH 2R1YB 3V4UH 1I9RL 2WK2A 1K4DA 1J5OH 2YD7A 3O8XB 3QQ3B 3LKSB 3PQYA 4BQ6A 5MEOB 3VFRA 1ZHBB 2VLJB 1GH7A 4PLJD 1FGVH 1T6VN 4J8RA 4XH2A 3NIDE 2BVQB 5FUZH 5HVHB 3PXHA 4XP5L 4PJ5B 5MENE 5ESQA 4XPGH 4HC1L 5IB1B 3LEYL 3KYKL 3TBYA 1P7QA 2W9LA 4MNQD 3MJ9L 4KRMB 3G6JF 2FLRT 2G9HA 4YDJB 1JTTA 2AJUL 3PHOA 2LABA 4CNIA 4LKXB 2AJXH 3KPRD 1Q94B 4X7EC 3PWNA 4G42A 1ZLUK 2YBRA 4GKOA 4R26L 1FNAA 1KJVA 3RVWC 2YMXL 2PNDA 3AB0B 5E94B 1C1EL 4RMTA 3V95A 2DLTA 4J4PC 12E8L 5EBMA 4Z7WB 3AXLB 4KRPC 2DLHA 4HJJH 1FHGA 2A6DA 5EIIB 5IFAH 5HHME 1FFNA 3UDWA 4TUKL 4QNPF 2AQ2A 1YNLL 2D31B 4P46A 1RIVH 3MV9E 1P53A 2DQEH 4NQSB 3OKKA 3IRZA 5L2KD 5F9WB 3WFCL 2OZ4A 4LPVA 2H1PL 2A83B 1HSAB 1HEZA 3OKLB 4OF7A 4AEIL 4I48B 1JNLL 4N90D 4NO2A 5EULV 2ICCA 5JIHA 4L9LA 4WFGE 1S78C 3BZFA 4HIHA 2PW1A 4ZAKC 4PJHA 2CMRH 2R0ZH 3N1PC 4M7JH 3VGEA 4Q7DA 1F5WA 5IROC 3IU4L 2V9TA 1I1AD 2BC4B 4N8CL 1G6RL 2ARJA 1S9WB 3U0PA 2APXA 3TC9A 1CCZA 1CGWA 5F3BA 4UILH 1LD9A 4YDVB 1MFDH 2R15A 3ARTA 3STZA 1WVZA 3T2NH 4KUZL 1QFHA 5GZNC 3O6FB 4PGZA 1SM3L 3OGOE 5A2JH 3SGEI 4BK5A 2WWKO 1G0DA 3HI5H 4IDJL 4X4YB 1BZ9B 1IGYA 1T5WB 4LCCA 4QRPD 3MRLA 3BPCA 5IOPA 4H8WC 4IMKC 5D7IA 1NLBH 2X09A 4K07A 1OP5H 1MIML 4GRMA 3V6ZA 1MCIA 4R96B 1CGSL 1U42A 4V1DA 3VXNB 1QFWL 5GRYA 4PRNA 1PYWA 1D5IH 3A6BL 1NAMH 4I3SH 4ELMB 3QCTL 3N85H 2HT4C 3NPZB 4HUXA 1FORH 3FQXA 1YMMD 3M1BB 1MAML 4N9GB 4NRYB 1IGML 3RWGB 8FABB 3MRHA 4U6HA 3K7UA 1ZLWH 2VSDA 1FAIL 3MLYL 3TJHA 3LKOB 2D4FA 1EV2E 1SBSH 3F7QA 3P77B 5BRZA 3S5LA 3GSVA 4HIJB 5DF0A 3V5KA 2NW3A 2APFA 1JMXA 1YN7B 1I1FA 1X5LA 1G7IB 2G2RA 1UH3A 3L5IA 2W0PA 2F5AH 3ECBB 3IS0X 3VXOA 4H8WL 4OF8A 4LPWA 2P5WD 4LLYA 2I26N 4GT7A 1XMWA 2N56A 1WWCA 3QCVH 2EDXA 2X42A 2Z31C 5I1JL 5DS8B 3O3EB 1TPXB 3HMXA 4PJGF 3BD4A 3TF7C 1U95A 5GGVH 3T3PE 4PUBH 1N64H 4MZ2A 5HYEA 2F53E 3PWJA 3LRSA 4L3EB 4GKSA 4N0FA 3V0VA 1JWMB 4K7FA 3O3AB 1T0NA 3QZWG 2L7UA 2AK4A 4JY5H 4S1RL 3MRDA 5EOQL 3U6RA 3FQWA 3P3YA 5FYKE 4XVTL 4YO0A 2H26A 1U3HA 3FFDB 4MB3A 5DHVA 5EA0L 4DGYL 2NY5H 1T1WA 1EFXA 1ZLSH 4UIKH 5FO9A 4NUGH 1CBVL 4PGCB 4Z7UE 4YHYB 4NN6B 4P2CG 4F9PA 3QA3A 4TULL 2Y06L 3N1GC 1C16B 4I77H 4MJID 4CN4A 2E6PA 2FBOJ 3EO0B 1K6QL 4JREC 2H32A 1I1YB 1CYGA 4KXZH 3QEGH 3JV6B 4Z6AT 5CFHA 4PJ7A 1NGXB 1YC8A 4HPOL 1IAOA 4FTVD 4P23C 1UXSA 4U1NA 3BDYH 1WITA 2BOBB 1NGYA 4GAJH 1QSVA 4IIQA 3P9WB 5MENB 4G7VH 2C4XA 3E1F1 4M6MH 5DJZA 1RUQL 2NW2B 2OTWA 4NFDA 3T77A 1YC7A 3RL2A 2V2XA 1JYXA 1RK1B 1KLUA 2CIIB 1U6AL 2AXHA 4NOBA 5IVNA 1P2CB 1T3FB 3GIVA 3RY5A 1I7TA 4U2ZA 5BJTB 3PJSB 2A6KB 2QHRH 4K2UH 4NQUA 2XTLA 4GBXA 3O2DL 1R5IB 2WP3T 1A1MB 3B9KA 4HQQL 4GXVL 3ESVF 1CE6A 3QDME 1G6RB 1X7QA 5CJXC 3EOAA 4TNWF 1X5KA 3L3OA 4X0KA 4OZFA 3QDGD 4NZUL 4XPAL 1UJTA 4KRPB 4NQED 4PJFE 2RFXA 1TITA 4AMKL 3WEXB 3AU1B 1GOHA 4X7DC 5IJKA 2GTZA 5CGMA 3ZHDA 4LPYA 2CSPA 5DO2C 4QCIA 1RHHA 3WHXA 1GL4B 2CKBA 1NCCH 4YFDB 4ODHL 2FD6L 2JCCA 4OTXL 4XCCH 5T5FH 5DJAB 4WUUA 1EO8L 1Z0NA 3S36L 3UZEA 1G9MH 2VZSA 1XR9B 1JMZA 3W2DL 4YX2H 1K2DB 1QNZL 3T1FB 3VXTB 3W9DB 1D5XB 3REVB 1CIDA 4OQ1A 4MCYB 4ZAKB 3O81A 5DRWA 3F58L 2VQ1A 3VGGA 5HY9B 1KUMA 3V79C 1NLDH 4U1MA 3GKWH 3WNMA 5MHSE 1Z9SA 2ZJSH 1FE8H 4P99A 2DN7A 2V6HA 3G04B 2OR7A 4K3GA 2R2BA 1EK3A 2VB5A 2VDQL 1FN4B 5K9JL 1D9KD 2ADIA 4HCRL 1A5FH 1T2QL 4V2CB 3CMOH 1ZTXL 5D7JC 2EXYC 5ACMA 3KPPB 1H3PH 2OTUB 4Y0GA 5HGBA 3MNWA 5IJVB 3HUJF 4HGMA 3WIIH 1UXWA 4NKMB 2BNRD 2OJEA 3TBTB 2IAMC 2WNGA 3VRJB 1CG9A 2VAAB 4X6DF 5JOPD 3ULVD 1IGIH 4H0IA 1A6VH 3MFGB 5HHQB 5MERA 4PP2A 8CGTA 3UJTL 4X4MA 1DQQA 2H41A 4NSKB 2EXWC 3P4OA 3SKMA 5C09E 4YDKL 2QR0B 3IDIA 4JPWL 4F33B 2X70A 3HI1B 4XZUA 1R0AH 3VWKC 4N8VB 3V4PL 4XNUH 3HCVB 1RK0A 3S6CA 3CSYB 2DMBA 4KI1A 2BOCA 2CPCA 3H9SB 4XNQB 5ERWB 1MLCA 5IKCA 5J7CC 1YJDC 2V17H 1EEUA 4NQDE 1FPTL 4MQ7A 1NFDF 1X5IA 1MIEH 3PQYE 5HHNA 1EXUA 3AUVA 4Z7VB 3AREA 5J89A 3CD4A 1QHPA 3RIAF 2ICEB 1I8MA 3C8KB 3JWOC 1EDQA 4RRPA 3SGJA 1JRHH 3GUTB 5J3HD 4JQIL 3QUYC 2Z31B 4JG0L 4JQVC 4G9FB 3I2CH 2AJVL 2BMKA 4P5TD 3MRJB 2X89A 1JGUH 5F7DA 5IB3B 4L3CB 4MXQC 4DKFL 2X10A 4DZ8B 4HULB 3OXSA 5C3LD 5E24E 4PY8J 4OZIA 1CWVA 4H26B 4XXCA 5DQ9B 2IQ9H 4BA8A 4KJPD 3RY4A 4E0RB 4NM4H 3SE3A 4J1UA 1OGAA 2HLAA 2EE9A 4F3FA 3Q5TA 3VG0L 5AAWA 2IC2A 4QXGH 2PO6A 1P4LA 1E6JH 3RDTA 3ZE2F 1T1YB 1ZA3A 4B7IA 3CSPA 3FB6A 3GMLB 4PRPA 4W4NA 4U1JB 2NY1D 1YJDL 1TJIH 1IKFH 5LGHL 5C0DA 4PJIF 4O58L 1QFWI 1ED3B 1F4XL 2IANB 2HRPL 3ZKMC 3MACL 2X1WL 3BEVA 4ZODA 2FJFA 5TPWL 1B0RA 4U2YA 4GG6E 4JREB 1GJIA 2HJFB 3JWOL 4J3WA 4IJ3C 3U0WL 1A4JA 3ARSA 4OLXL 4KZEL 3HRZB 4LARL 1XF2B 3AAZA 4LOUD 4HT1L 4DQOH 3L5HA 2Y7QB 3SOBH 5F7KC 5GGUB 3BKYH 3MREB 3BRGC 3GI9L 4OCSH 1F6LL 4XVJH 3LQAH 1QO3B 4ORZC 4DAGL 4ZUTA 4PJHE 4HKBB 4ZUWA 4WU5A 4GMSL 4M8VA 5C0CA 4WI6A 1TJGL 2YD3A 1CZ8H 4H25B 1CDIA 3HE6C 3EO1A 3O9WB 5C3TA 1LP9E 2W59A 2BSSA 5T3XL 3KPMA 2ZCKH 2WBKA 5FGBC 3QDMB 3THMH 4FFVD 3D18A 3HE7A 4UBDD 1BIIA 4OLUH 1WWBX 3CDFA 1WCBA 4P2QB 4K3EL 5FDWB 4PJFB 2N7BA 4MMZC 5ILTL 3BP7B 1LO0L 5DVLA 4NCDA 5AUMA 3O4LB 1AR1C 2HVJA 3NFSH 4EN3A 5HI4C 3C6SB 4APQC 2EDQA 3QIWD 3GNMH 1LE5B 4D9RD 3PNWB 4CW1B 1N59B 3NH7L 3NCJH 5C2BL 3MV11 2DQTL 4MCZB 2XQYK 4DVRL 4LSTH 4KKBC 5CSZA 5KVFL 1A7QL 1NGQL 4QTIH 2A38A 4F7TA 1LEIA 4L4VE 3D0VA 1GIGH 4P9HC 5J1AA 1BREA 2P7TA 5ID1A 5LQBL 2P8PA 1E27B 3CVIH 4H88L 5KSUB 4CDGC 3SKNB 5AG8A 4MSWA 1YEGH 1QRND 3GMRB 1ZANL 4LLVB 3RRQA 1C5DA 5INDB 1TNMA 4M1GH 4MA3B 2R4RH 4WTXA 5D7JB 3VMPA 3WIFB 5HD8C 4NHUB 5EUKB 3DTXA 4PREB 1JI1A 1KEML 2X1XR 4WTWA 1BVKB 3MV9D 2MWCA 3MRNB 5I1KH 4BFGA 1ZSDB 5IBTH 2FL5A 2IALA 1YEHH 4QHKJ 2XV6B 4XCFH 2FH8A 5E8DH 1OT1A 5DVMA 2IAMB 1INDH 4GAGL 1C12B 4HPYL 4ZD3H 4L8DB 4OGAC 4ONHA 3FRUA 2AK4E 4E42B 4YDIL 1KTRL 2EDRA 3IXAB 3OB8A 4M48L 4G8IB 1JPTL 1L7IH 4PLJC 3QDHA 3RWDB 4HMCA 4RNRA 3ISWA 3MRIB 4O2FB 2VL5A 4NOFA 5DTFA 4TSBH 3N0PB 3BRFA 3VWKB 2P47B 4R90H 5IIEA 2I24N 1ORSB 5E2VH 2QQNL 2D7TL 3L1OL 4NM8H 1RULL 4QRRA 3KHOA 2LE9A 5E9DB 1NCDL 1QYGH 2DLFH 4NQDB 5I8OH 6FABH 4YBQD 2YUWA 3O4OC 4PJ7E 5GS2H 3VFPB 4KMTH 2C3XA 3NCYP 1CU4H 5D1XC 4Y4KA 2J5LC 1AI1H 5KVMC 3QUYB 3UBXG 2CDGA 4PR5B 3RJQB 1I1CA 5E5RB 1TQBC 5TE6H 1MJUH 2DQHH 1EAJA 2ADJB 3OR7A 4OUOA 4KROD 4XP1H 4MNHB 1Y6MR 4OAWA 2CUMA 1KULA 3GRWA 1IAMA 2R2EB 4ODWA 5ADOH 4BQ9A 4W6YB 3D3VA 1UA6H 2NY3C 2HFEA 4MVBA 5DHXB 3ZE1F 3KYOB 4UNVA 3TN0D 4Q74A 1Q9KA 4OLZH 5GISL 2UYLA 3V6FA 3X14B 3EFDH 2QSCH 1DQJB 4O2CB 1ORQA 5CEZD 3OZ9H 3IDMA 3BP5B 3F65A 5C0AD 4DZBB 5AZEL 2VWEC 3GBLA 5D7IF 1I1AC 2VWEE 4GG6B 4OF0A 3TH4T 3C09C 1UZ6E 4IJ3B 3C5ZA 3EDDA 4HSQA 5GHWH 2XA8H 1CFSB 4DUXA 1TCRA 1B6UA 2X4RB 3VFWB 5EBWB 4I1NB 5IV2A 3M17B 3RHWF 4D0CB 4O51A 2P44B 2FX7H 4GQ9H 3H42H 1NC2A 1MFCH 1KCRL 3B6SA 4OZHB 2A9NH 4M5YH 5FYJD 2OLDA 3G08B 1LP9B 3HE6B 1F4WL 3LH2L 3PWPD 4OJFL 3GJFB 4N1HB 2A77L 1CR9L 3P4MA 4D9QE 3D9AH 4B53A 3UBXA 1SJXA 3QUKA 5IW3A 4YQXH 4V2BA 3WD5H 5DD1H 4AJ0A 1ZKAA 2VDPH 4FQXA 2BVYA 3Q6FA 1I9JL 5DJYA 2W38A 3MRPB 1RU9H 3DXAD 4WHTB 5T1LB 2CGRH 3MRRB 4XMPL 5DRNA 4APQB 4OLYH 5CD3B 5IB5B 5BO1H 4LSVL 3RVXC 5D9SB 3X17A 1CD1A 2F54E 4LHJB 5EIVA 1NDMA 2OSLB 3SBWC 1YEDA 5C0IA 1RJZA 4MHHG 4ZO9A 4CADB 2GT9B 2EDNA 5GJSL 5IHLB 3DUUB 1MQ8A 2XN9E 4X7TA 1GVIA 4YBLC 5ISZA 5F1IB 4O4YL 4RMWA 4X9BA 4FZEH 5HYSB 4L4VB 5I8EA 5KSBE 1GGBL 4NYLA 1Q1JH 3H3PH 2C7UA 5IVZA 2GJZB 1DANT 4FQJH 1P5VA 5JXED 1LEKB 4LSPL 5TE7H 1NDGA 1JP5A 1NANI 4LNRB 3RX5A 2JJTA 2HT3D 1F6AA 4OV6F 5C08E 1J8KA 2WINA 2MNUA 4G7YH 3X13A 1UM5H 3D1MC 2NY2D 1DSFH 2AEPL 1U8KB 3EYSL 3TT1H 5J56B 4HEPG 1AD0B 3GKZA 3MLTA 2AJYL 3FT2A 1AXIB 3QPXH 4OLWL 3EYFB 5IEHB 4Z7OF 2PW2B 1Q9WA 1RPQA 2YUVA 2BNUA 2RCSH 3HKFA 4OZIE 2KL6A 1MH5B 1IE5A 5HHVL 4HMDA 4XWGH 4YHIA 5D7KE 1UZ8B 1OGAE 3VXSE 4KTDH 1VFBA 4HIIB 3QFJA 1IM3A 2X5PA 5HDQH 2W0FB 4ONOA 1JGLL 2MCPL 5E2UL 2NR6C 3WV0A 4WJ5B 5CD5D 4JVPA 2PETA 3U4AA 5IB4B 3LQMA 4UTAL 4P4KA 5HYFA 3KR3H 3MGTA 1T2XA 2BVPA 1KJ2H 5B21A 3U46B 2GFBB 4GRWE 3NFNB 3RZCD 1OAQL 3O4OB 3I6GA 1FIEA 4MLIA 4FQHA 3K2UH 1V8HA 3L5XH 3N1MC 2EYTA 2YZ1A 3VA6A 4LLDB 1SQ2N 5D1XB 3ZKQD 2J5LB 1GGCL 5ETUA 2DIAA 1EHXA 2LAGB 1UYWL 4ONGL 2Z93A 5KSVB 4AH2A 1TQBB 2A6JB 3AS0A 3LQZA 2VR5A 3OAZH 3B5GA 3F7VA 3O11A 2W0LA 5GRVL 4TVPH 1CI5A 4RGOH 1Z2KA 2NY3B 1K8IB 3WDHA 5L88H 5D2LB 5C09D 1H3VA 5DURD 5CP3H 3HPLA 1CFTA 3WS6A 4M61A 3SE4A 1VKXA 3LMJH 1WQVT 3BAEH 1CFBA 4PYHA 4JHWL 5DJ6B 5F72S 3V2AR 1I1AB 1MCNA 1HYSC 5SWSA 1JGDB 4PRBA 4BZ1H 5CZVH 5KSAD 3IKKA 2EDTA 5FCUL 5K9KA 3C09B 1H0DA 3T0EA 1T83A 3B3IA 4WENB 3IJYA 2I25N 3L5JA 3LOWA 5D71H 2I07B 1MEXL 4K7PY 3P0VH 4MDJB 4M3KB 4N0CA 4G8EA 4OZGE 3RWHB 3ZSTA 3R8BB 3BHBA 3UTPE 2PYFB 5FB8B 2YZ8A 1HDMB 3DMMC 5I15H 2DLGA 1XGQB 2MHAA 2E6JA 4LHUB 2R29L 3MJ8A 1ZGLM 1KTLB 1NMAL 3DVFA 5EFIA 3VH8B 2W65B 2R4SL 1KTKE 3GSOA 1N5YH 1PFCA 2J6EH 4OF5A 2Y6SD 3DI2B 1A6TA 2AXFB 4E9LA 2P5EA 4G80B 1CLOH 4CGTA 3BESR 3D0LB 5IT2H 9CGTA 3LIZL 4WI7A 4U1HA 5ACZA 4PV8B 4P46D 4AEFA 3G6JE 2VDLL 4LEXH 2AJSH 1A6PA 2VTFA 1RFDH 1EBAA 2VXVH 3TV3L 3EFFA 4FP8H 3IVKA 2F54B 4X9IA 4F37K 3IDGA 1I75A 3BGFC 4NBYB 1NCNA 43C9B 4HJGB 5CP7A 1DE4B 2CUIA 2XTJE 3CFDB 1DQML 2DJSA 5EO9A 3LEXA 1KIRA 2P5WB 4QYOA 5B38B 3UX9B 3W11D 2XN9B 4QHLB 3EYOB 5I1GL 2IFFH 2SEBA 2B1HH 2ADGA 4YBLB 4WDIB 2GHWB 5TF1L 5KSBB 5E2TH 1HK6A 2R1XA 2A9ML 4OZ4A 1ONQB 1P1ZB 1DL7L 1TZHB 1ZT1A 5L7XH 3PWUA 3CFJA 3VFTB 4AYFA 3RKDC 1HINL 4YFLF 1UB6A 4UIMA 1ZHLA 2BP3A 4XPHL 4ZDHB 4PJXF 4KI5F 4NWUL 5C08B 4EBQH 2H3NB 4LSRL 4WTZG 2XKNB 2XQYG 32C2A 3RVVC 4QXTB 1SHMA 4R8WL 1KTDB 5JXAL 2NXYD 4JFYB 4C56E 5GQBA 4X7SH 1A14L 2VUOA 3UP1A 3WN5A 2DQCH 4PJBE 4PJDF 4NKOA 4NO3A 4V1DD 3TO4A 1LO3L 5FOBB 1CF8H 1U8LA 5CBAA 5CEXA 3VXSB 1NFKA 3RA7H 3GDBA 4QOKE 1I4FB 1FFPB 3I6KB 4TNVK 5EUOB 3VXUA 4QHNA 5I19L 3IAPA 3FO9B 4CUCA 3TJHD 1TVBB 4JFDA 2PYEE 2D2OA 3ARFA 3CVHH 2VAJA 5BRZD 1JBJA 3IETB 3NN8B 3C60A 3U4EB 5EZJA 1NAMA 2NZ9D 1TFHA 3G5VB 5EU6B 4OBSA 1OTTC 1Y6KR 5SX4H 3MRCA 2WUCL 1G0XA 1F2QA 3KPOA 4TTGA 2DQJH 4ZFGL 4L8SA 4KZDL 3EOTH 4X7CC 2CK0L 3LKPB 1CD8A 1PX3A 1CFNB 3RAJH 2Q6WB 5LCVH 1ZA6A 5AYQA 5F9JB 5EN2B 4Q9BA 3GBNL 3GSQB 2I9TA 5E6ID 2GW5A 3S88H 2IGFH 5B39G 1CICC 1DBKL 1IQDA 1C5CL 3TA3A 4JM4H 2JB5L 4O9HH 1N4XH 1V7NL 1KBGL 4JHAH 1IAIH 5F1NB 1VSCA 5HHPB 5F9OH 2V7HB 3UTQB 3NIGF 1FNSL 3H9YA 1S9YB 5CIPA 3ROOB 4HK3J 4PG9A 1AHWA 3U2SB 1BQHG 5I71C 1FZKA 4XC3H 4MAUH 4OCXL 4UDUB 1EFXD 3OPZL 5HSFA 1GYAA 4JG1L 1ULVA 4WGWB 3HC0B 1EVUA 1YYLL 3MLZH 4X6BA 5HDBF 3T0BA 1PVHA 3GMMB 3RUGF 5JHDA 3NBNA 3W9EB 2ADFH 4XNMA 3MPCA 4ODTH 2YKLL 3TWCL 3MCKA 4F7CB 1EZVY 5KG9A 1DUZB 4K7PL 5A43C 1D9KB 1I3RB 2PXYA 4F7EB 1UH2A 4OZGB 4XPBH 1A3LL 1XCTB 4HUKB 2VOTA 2APBA 1BOYA 2X1QA 2HWZH 3BP4B 5I1DB 3WFBH 4JJ5B 4TRPL 1CN4A 1FZJB 2D7PA 1S7WA 4Z8FL 1L4IA 4Y1AA 5DJ8B 3RTQA 3DGCR 4GBXD 3B9KD 1WUNT 3FAWA 3BMVA 3B83A 1MI5A 1PEWA 3DX9A 4LSSH 1LHZA 2ZKHL 4BSVA 1AGEA 4S1SL 3KPQB 4XRCB 2NY4C 1AQDA 3RWJB 1PLGH 4LU5L 3X11B 3IRPX 5FHAL 4FFYH 1G7JA 2MOVA 2EICA 4JFQA 4CU7A 1TZIA 4HXAH 4G9DB 3G6JB 1JTOA 3GSWA 3MGOA 1CGTA 3DV6B 3TO2A 1ZS8A 2I5YH 2QEJA 5D72H 4PB9H 1WBYB 1JFQL 1QFOA 1NC4B 3PWVB 4WUUD 4KTEH 2YPLD 4KK8C 3BGFB 3RWCA 4Y5VA 3U1SH 3MYJB 2EYRA 3SEPA 1BQHA 4F58L 1UVQA 4DTGH 4P2OA 3QFJE 5C0EB 3IS1X 3SY0A 4KJWD 4H1LB 5DVOA 1A7RH 1NKRA 2XWTA 2CK2A 2DKUA 3QIBD 4X80H 4KROC 2DMKA 2GAZA 3F5WA 3RGVA 5KS9F 4WV1A 1SJVA 5F7NC 3VFNA 1OAYH 1AC0A 3SGEH 3DBXA 1MLBA 2WBJA 5JOEA 5L0QC 3JTTB 3JWNC 3NCCB 3ZDZF 5DFTA 4LF3A 4L8CB 4D94A 1S7TA 1H5BA 3EOBA 3I75B 4C56B 4FRWA 1KLFA 4MXWH 1M7IB 3IAGC 2Y07H 4PJBB 1QBML 2DYPB 2E9BA 2FEEL 4GXUM 5FYLH 5EU5B 4GW4B 4O2EB 5TF0A 3RNQA 2I9LB 5JOFB 5I9QC 4GH7B 1BM3H 1SY6L 1ZK9A 4WI2A 3V8CA 2DBJA 4YR6A 1MOEA 2B1AH 2PF6A 2Z8RA 1YYMH 4DN3H 4Z76A 1N7MH 5LWYL 4UT6H 1R3HB 2PYEB 5E08L 4EI5C 4D8PB 3HUJE 4PRHA 4HMEA 4NQCB 1MUJB 1KCUH 5F71A 4X9HA 4PJCA 4PP1C 5SWSE 3MBXL 1ADQL 2GUOA 4X6DE 3S8WA 4U3CA 2OP4L 4MQSB 1R5WA 3ARED 1EJOL 2YK1H 2J8UA 5CEZL 3C5SA 2UZIL 3ARUA 3Q1SL 5CINH 3ULUH 5JW5B 1SYSB 1DFBL 4OFYA 3BEWA 5E1AA 4XP4L 2HFFA 2C1PB 4G6KH 2EH7H 1TETH 1XF4A 3RQ3A 1T89C 3MBED 3P9LB 5BOPA 2VDRH 2H9GB 4QRUB 4JRYA 4I0PA 3U4BH 5JIKA 1LO2H 1MJJB 5DA0B 4QF1A 4FFEX 1S7RB 5DSCB 2ITCA 4M02A 1NGPH 1Z3GL 4PD4J 2PO6D 2OL3A 3VI3E 1HHGA 2WIIB 3MUJA 3QI9A 3VGDA 2AK1L 4KQ3H 1KJMA 5I71B 4PJGB 4PRPD 2O5XH 2FIKB 5FYJL 1W8NA 3IF1B 3SDCA 4LK4A 4CKVX 2CO7B 1O7SA 1CLYL 1UG9A 4GAYB 4HBCL 3LN4A 4F57L 1KJ3H 1KT2B 4IOSD 1G0YR 2RQ8A 4XVUD 1FLTX 2WUBL 1RUPL 1VENA 4U1KB 3VGBA 1JPST 4GRLA 1NCBL 2Z4QA 2E7LC 1J5OL 3DNKA 2E7LE 3DYOA 1MWAA 3TFKA 4PRAA 2VE6A 2ZZUT 4FQQA 3MLSH 3ZE2E 3EYUH 4WI3A 2C1OA 5IEKB 5FUZL 4PJIE 5C0CD 4MDIA 4J6RH 4XPGL 1IC4H 5E95B 5EO1B 3MV7A 4HDIB 3K8MA 4V3EB 3WFDH 3BQUA 4ENED 1T7XA 4QKXB 1QP1A 2AJXL 5MEPA 5C6PB 4XCEA 1FFRA 4MS8A 4HFWA 4TOYH 2NY4B 1U8NA 3R06A 4OT1H 4Y2DC 3WNOA 2F15A 3I6LD 5D70H 2DS4A 1T1XB 3QH3B 4HJJL 3MA9L 5IFAL 1JZ3A 2GIYA 3QPQD 3MMEB 1KCSL 5TGBB 3DHMA 5J6GA 3QXDB 3QXVA 5LVEA 1Q0YL 5IGXH 5GRUL 5MP6H 2DQEL 4W4OC 3T1WA 4HWNA 1PKQA 3TPUA 1I9RH 1JWUA 2VABB 1AFVH 3QSKB 1X6LA 4EJ1C 3DX6B 4X6CE 1MNUH 5I1LA 4D3CL 4UOJA 4R7DA 1HHIB 4PIRF 1FYTB 1NCUA 1WZLA 3UPCA 3QO1A 5DQJA 3QNYB 2R0ZL 4XBEL 4JFDE 3GGWB 4KROB 1A7NH 2VLRE 1U8MB 5FECB 3LEYH 3KYKH 1OW0A 4Y16C 2QSQA 3DUSB 1R3LA 1X5ZA 5I2IB 2BFVH 1X5YA 3TNMB 2OMNA 4M62H 1TDQA 3MRKB 3TLRA 5DJ0A 2CDEA 1MFDL 4OCWH 1U92B 3ZL4H 5L0QB 5K93A 3T2NL 4R26H 5JNYB 4BFIA 5IBLD 3CX2A 3QNZA 2YPKB 3HI5L 4PGBA 5C0AB 3GHEH 3L5WB 1FZOB 4Q0XH 4LVEA 2BY2A 5GGRB 3NPSC 5IWLA 5KSAC 3MRBA 3MODH 4UUJA 3STLA 5ITFA 1JN6B 3LS5L 2XTJD 1IEBA 1J11A 5I9QB 3OKNB 3GB7A 1FYHB 3WFCH 2H1PH 1D5IL 3V5HA 2FHFA 4I3SL 4CDHA 4NZRL 4AEIH 1I8IB 3TBWB 3QWOB 1OAKL 3HUJB 3QNXB 4EI5B 3BWAA 1WICA 2DWEA 4QRRD 5E1HB 4GKNA 5I1AB 4KK9D 2W9EH 1JHLL 1EEQA 1R3KB 4EDXB 1N8ZA 1ZWIA 3HB3C 4X6DB 1T66C 1JF1A 4QWWC 2NY5C 1SEQL 4JLRB 2ZOLB 3EJYC 4AENA 4QT5A 2XNAB 1NBQA 5IM7B 4NO5B 3L3IB 4QTHB 1ZT7B 4Y4KD 3MROB 1LO5A 4HK0A 1BFSA 2HH0H 4UDTA 3TEUA 4MJ5B 3EAKA 3VWJC 2OYPA 3AS1A 3DSFH 3BH9A 1CDBA 5GGVL 4G6AC 3ARGC 3DXAB 3OJMB 4PJEA 3RY6C 4PUBL 2G5BA 1N64L 4FHBD 1NFDB 4KHTL 3SDAD 1FH5H 5IG7A 3D3VD 5J9PA 4RA3A 4I5BB 4MVBD 4M3JA 5DEGB 3S4SA 4LLWB 1MI5E 4HUWA 3OF6A 4WWID 2NCMA 5ANMA 5JDSB 3EW3B 1CGSH 5TQ0L 1OCWH 4YFEA 1QFWH 2FEEI 3W11C 3ARRA 3D25B 3PV6B 3OKEB 5F8QC 3A6BH 2EE2A 1IQWL 1WBXB 1KB5A 1S9XB 2NY5L 3KWWA 5HHOA 4HEME 1IJ9A 4NUGL 1FL3A 2ICWI 5BZDA 2HRLA 2PCPB 1INQA 1WJ3A 1N2RB 1T20A 2CDFA 4I77L 1Y0LA 2F74B 2W07A 3KNBB 3C5ZD 1HHKB 1M4KA 2IADB 2P8LB 3CFKA 3NCEB 4N0UA 4L9DA 3QEGL 1DUYB 3OKDA 2VDML 3N50A 4XGZA 3VXPB 2NX5E 4KKAD 5AD0A 3GMPA 1CFQA 2J3SA 5FM8A 3BDYL 4H8WH 4PJIB 4GAJL 2NXZD 3L3HA 1NC2D 1B4RA 3P40A 4JQXA 2VXSH 4G7VL 4JFEE 4ZFOL 3T8XB 4M6ML 1N5AA 1G9MC 3K1DA 4M7KH 2UVEA 3VG9C 3GBMH 1G7QA 4I18A 5EO0B 4DOHB 5E8EA 3DVNA 3OV6A 4KTYA 4K2UL 4K23H 3IKCA 5DC4B 2LU3A 4F80A 2JLLA 5EZLA 4Y2DB 3CC5B 3OL2A 3RWEB 4XVTH 3QQ9C 4FQXD 1KPUB 1DLHB 1WAAF 2CJUL 2B7DT 1DBJL 4NKQB 1CBVH 1U8HA 3T2OA 4Y5XC 1IMHC 1DDHA 2EDEA 2Y06H 4LEOB 1AXSB 4X83A 4NNXA 2V2WA 5KN5A 1I7RA 3VXMA 4X7FC 2N4IA 4JHZA 1ACYH 4PG2C 5IUSA 3W5MA 1K85A 2D4DA 2IMMA 4OUUB 1G9ML 4X6CB 3OJDB 3O3UN 5BQ7B 5ISZD 1YY9D 3O6LH 4YNYA 3WO4C 5E6IC 3MYZA 5LGJB 1YMHB 2VLRB 1RUQH 3GKWL 1OSPH 4TPRH 3SE9L 2VH5L 3CUPA 4Y16B 3QG6A 2ZJSL 3ULUF 5C0BB 4PBVC 5DUPH 1YPZA 2LQRA 1VADA 4LLMB 1XF5A 4KK6C 2J8UE 5I0DA 1HH9B 4HQQH 3PIQB 3KLHD 3N9GH 5DURB 3KPSA 1K3ZA 5DFVC 2HJLA 4O5LH 3CFEA 4F7PA 3CMOL 2AGJL 2AI0H 1WT5C 3LV3A 4E41A 1M6OB 1H3PL 4E5XB 5BW7C 3S9DB 4P3DA 1DBBL 4OQTA 3B9DA 5FEBA 3SO5A 3VI4F 1DEEB 2HVKA 3WIIL 5ENWB 3NPSB 1BPVA 3TIDB 4JRYE 5IVXF 3QEUA 5KSAB 3HAEG 4ODVL 5D1ZA 4AT6A 4AL8H 4RAVA 4WRLA 3BN3B 1BF8A 2AV7A 5IBUG 2FD6H 2IQAB 5CKGA 5JW4R 4RBPK 4OTXH 1A6VL 4YDLC 2ZG3A 3QFJD 4PFEA 4ZXBD 3S36H 3QISA 3F6IA 3NCMA 3QAZB 5ESVB 4Y5YA 3PF2A 2ATKB 4HGWA 5LG1A 2AABL 1HOCB 4L4TA 4LASH 2PTTB 4OV5A 1U93A 1OD7A 2X4SB 4LBEB 1EMTH 1R0AL 3WS3A 3F58H 4P4KD 3D69A 4JN2B 4XNUL 5E70A 4Z7OE 2C4FT 3SGDH 2NTFA 3ARXA 3QIUC 5MEQB 1S7VA 3MFFB 4G8GA 5CMAB 4Z95L 4CAGA 1MIEL 1X5XA 1N6VA 1XH3A 2VDQH 2IH3A 5K9JH 2HG5B 1LNUA 4OGYL 2NY6C 3JV5A 2D7OA 1KJ2A 2NYYC 1NSNH 4JFPA 3VWJB 3O3DA 1XGUA 3I2CL 4KJQD 3KPTA 4JFFE 1ZTXH 3WFHA 3ZYZA 2DM4A 2I27N 1HILB 2OK0H 3ARGB 3EJZD 1HXMB 1U41A 1A4KA 3EGSB 2XPGB 3IFOA 4YK4C 4PB0L 4ZOAA 3BSZH 3LQAC 1ZHNB 4ZFOB 1NBVL 4Z5RB 1IC5H 2IQ9L 3TZVC 1XIWA 2IH1A 4EUPH 1U8OA 4YAQB 1HI6B 5FM4A 1A9EA 2XWBA 5E00A 3UJTH 1BQUA 4BQBA 5EU7E 5LBSL 3ROLA 1S7UA 1TJIL 2YA2A 2EIZA 5DJDA 5GRJL 1UJ3A 5ITBH 1JYNA 1M05A 4ZUUB 5GIRA 2ARJB 3QIBC 1O7VA 3T0ED 1LD9B 3BZEA 3I02A 3C6LA 1BOGB 1PKQE 1YN6A 1N26A 4NQVB 3TPUE 2NX5B 1KXTB 1A2YA 2VR4A 4N0CD 5EC1A 5JA9A 3P30L 4HKXA 4RGNC 3JTSB 1IM9D 3LVEA 3OAUL 4OCSL 1T6WA 3A6CL 3LQAL 3FFCA 3BN9C 2C3WA 4O02H 4HV8A 4ZOCA 4EZMA 2OI9A 3TGXA 4YHZH 4LQFH 2AJVH 1YEIH 1XF1A 3UTSA 1MHHB 4YGVB 3VG9B 1WK0A 2XY1A 3ETBF 4PJCF 1NEZG 1RZ7L 1CZ8L 1KIPB 2W60A 2DQFB 4UINL 4F9LC 4V1DB 2CO6B 5HI5D 1RZ8A 2ZCKL 2CLVB 3EYQD 2P5ED 2VDKL 3THML 4HUXB 3GO1H 2HLFC 4R7NA 2Z35A 4ODUA 1T22A 5DMYA 5IHUH 3JBG7 3K4DA 4LKCB 2EH8H 3SDYL 3WLWC 1BLNB 3CCHA 2FNBA 3GMQB 3QO0B 4Y5XB 2GTWA 5LGHH 1A1OB 3V5KB 5C0GB 4OCRL 1F4XH 2Y23A 2V2TB 3TNNB 2D03H 4QHMA 3GNML 1A7PL 4XXDA 5GJTH 1MVUA 1Z5LA 2YEZA 3JWOH 3U0WH 4OLXH 2J8OA 1A7OH 4KZEH 3NCJL 2X4QA 1FRGH 4CN1A 4WNQB 3G5ZB 4C83B 4XAKD 4LSTL 4PD4K 4RMUA 5JPMB 3GI9H 5E6IB 4R2GC 3L6FB 3MBEC 1OTUC 1YZZA 3NZ8A 1GZQA 2BHUA 4PJ8C 1T7WA 2H2SD 1BZ7A 1WIUA 3O41A 1T0NB 2WZPD 3MLPA 1GIGL 4IS6A 4YE4L 3MRQB 1TLKA 2YD9A 1FQ9C 1W72L 4J12A 4YO0B 2H26B 2F8OA 3CVIL 3KS0J 4MAYC 2X4TA 2D9QB 2CH8A 2VLKA 4WU7A 4MA8H 5CUSH 1YEGL 5C0RL 1VCAA 4TVSa 1UGNA 4PY7B 2BY0A 4M1GL 2R4RL 5GRXG 1INEH 1P4IH 4P3CH 1GZPB 4I13B 5ILTH 1NEZA 2X4UA 3MRGB 4M8QB 4RZCA 3S35L 4X99A 1OWRM 4XCNB 1TXKA 4QXWA 3TO4D 4KI5C 5E8DL 4PJXE 5F7MC 1FL6B 5TDNA 4ZD3L 1F8TH 1IAOB 3CPLA 1BX2B 3NH7H 5ANME 4WFHD 3S7GA 4YDLB 1CDYA 2VN7A 4Z9KB 4PJAA 4ZUSB 1L7IL 3HC4L 3IFPA 1A1NA 4X4XB 2RJMA 3VXUD 3OB0K 1U3JA 2CLZB 4XBGB 4JFDD 3GEWB 3ARFD 3K46A 1WSST 3C60D 1RZGA 5KVFH 3MA7A 2HKHL 5DGRA 5DRZA 5E2VL 4PJDE 4DN4H 1QSZA 4NM8L 2Y36H 2FGWH 5EC2A 3QIUB 2ZOKA 3WFEL 2ITDA 2BSTB 2ZPKL 1QYGL 1P7KB 1UKSA 1UCBH 1HZHL 2H2PD 1J8HB 6FABL 5EH1A 3EOAB 4G8FA 5LQBH 3HAEH 3HZYB 4KMTL 3AROA 2NY6B 4LCWA 2YUXA 1Q8MA 5B3JE 4LIQL 1ZANH 3MV8A 4JFFB 4BUHA 1CVRA 5TE6L 4RAUB 4ETQB 2X9XA 1MJUL 3MX0A 3QFDA 2DQHL 3CFIC 3JXAA 4WW2A 4I0CC 1KEMH 5F7LB 2AXGA 3FRPA 4YGAB 3QZWB 3RL1A 3QP3A 1U8PB 2YPLB 4H5SA 1N0LA 3TZVB 4GAGH 1AGFA 5CBEA 1G7HB 4ZO7A 4UQ2A 4IRSA 4OLZL 4YDIH 4QY8A 1IGCH 2VQ1B 4JZNA 1FGNH 1NBYA 2QSCL 1U9KA 5ALCH 1S9KC 1XEDA 3OZ9L 4GKZB 5IQ9B 2M8XA 4NCC2 4NKIH 3QIBB 4HFUH 3VFMB 5JHDD 2EZ0C 2A1WL 4OB5H 2DBLL 1URLA 1AJ7L 4PGJA 1RULH 5GGTA 3RNKA 3BD3A 4JRXE 3C8DA 5IMMB 4KVCL 2AV1A 3NCYS 4GW1A 5FO8B 1VFUA 2XA8L 3OGCA 2PXYD 4ZYKB 4UAOC 2RGSA 1JVKA 4RGNB 4EVNB 4XNXH 5T33L 5IBLC 2C3VB 5DUBB 5A16B 3FB7B 1WTLA 5FHBL 3I3EA 3MXVH 2FX7L 4GQ9L 1UXWB 1MFCL 4Y1AD 4EOWH 3SGKA 1MHCB 5D1QA 3RTQD 2DRUA 4I9WE 3QJFA 4UZGA 2A9NL 4X6FB 2DIJA 3V0WL 3FO2B 3TYFB 1WC7A 1IKNA 1MI5D 2FSEA 1HHHB 2Q8AL 4HHAA 2D7NA 2X41A 5JW3H 4PTUA 5JO5B 1DQQB 3G9AB 5F70A 2VRAA 3D9AL 4JN1L 2HMIC 3SPVA 3OTTA 3WXVL 4CVXB 4R4NC 4UT7H 5GISH 1W72B 1FNHA 3PL6A 1FZMA 5DD1L 4HUVA 1RK0B 2WLYA 2GSGA 1X4ZA 2GITA 2XIDA 5IKCB 2CGRL 4PJEF 4GS7C 3W0WA 4OLYL 3WJLA 3QUZC 4MQ7B 4F37F 4G43B 4PRIA 5BO1L 3UEZA 2OJZH 1IAIM 5B8CC 3QEHB 1HH6A 3UCRA 4P2OD 4NC0B 5J6HB 3D39D 3PGFH 2BMKB 4L4TE 5ID0B 1FV1B 4R2GB 3MBEB 2ICES 4PJ8B 2YSSB 1Q1JL 4HLZH 3H3PL 3KXFA 3U9UB 2ZSWB 1KCRH 4IRJA 4MD0A 3SDAC 2QQLH 4BSJA 4FQJL 5DD6B 2DAVA 4KQ4H 3T04D 4CMMA 5DMIH 2WBJD 5E5MB 1OP3H 4OJFH 5EZOH 1TTGA 4JKMA 2YA1A 4MAYB 2KBGA 5GSRB 2A77H 1EAPB 2ZG2A 3FT3A 3HZMA 1UM5L 4Z7NF 3L95B 1A02N 1DSFL 4MJ6B 3TT1L 2YRPA 1O0VA 2X4NB 4QRSA 5DC0A 1QPPA 1TJHH 4DCQA 4PJXB 3H7BB 3VJ6A 2VISB 4YHLL 4KGLA 3SDXF 2RCSL 4L1HA 4PRDA 4LSVH 2R1YA 1HKFA 4KKAC 4HX1B 1PJ9A 4KUCF 3O8XA 3QQ3A 2BNQD 3LKSA 3MXWL 3NFPB 3I3BA 4CN6A 5MEOA 1ZHBA 2VLJA 4PRHD 4XX1G 1R5VB 2WQRA 5C0CB 5T3ZD 1UT9A 4JO4H 4PJDB 5DJ2B 2BVQA 4K3DH 4O4YH 2BVOB 4NNYB 4PJ5A 2DD8H 3IB4A 5IB1A 1G9EA 3ZHLA 4MQXD 5AAMA 5J11C 2L0DA 2RR3A 3UTTE 4NN7C 3KYMA 5INCB 3ILQD 4YDJA 3E3QA 1Q72L 4LSPH 4LKXA 4G3YH 3K2UL 3L5XL 4XC1L 1Q94A 1D7FA 1P5UA 3FB8B 4J3SA 1AGCB 4XP9L 2YUZA 3BE1H 5I30H 1UM4L 1CTNA 1MCQA 5E8NB 5E94A 2X1PA 5DMGC 3S3SA 4JRYD 5CJBA 5E4EC 1G1YA 4I0PD 3VFOB 1FL5B 4Z7WA 2Z9TA 3AXLA 5BVJB 2BY1A 4ODSH 3T3MF 5EIIA 4Z78B 3BPLC 3FTGB 4KDVA 5E8OB 2BDNH 3L3DB 3F7YB 4TVPL 3ELAT 1YPZF 2D31A 2WM0A 4BQ8A 3QI9D 1RUML 2KQMA 3DX8B 4NQSA 4LRIA 3OHXB 4YUEH 5E7FA 3SDCD 4U0QB 3OKLA 1HSAA 1Q0XH 5I76B 5DR5L 3QUXC 2Q87A 3KYNB 1WF5A 4I48A 4F7TB 4P57B 5BVPH 1JGLH 2MCPH 2DOCA 3EDJA 5CZXD 4GRLD 2P7TB 1JV5B 1D5BA 4BZ1L 4F7MB 4F15C 4JRXB 1IFHL 5CZVL 4UTAH 1RZFL 3TFKD 2AJZB 3ZT6A 2XI9A 5JW4M 2BC4A 3GSNH 4ZNCD 1FNFA 1S9WA 4UAOB 5D71L 1I7ZB 5IW6A 3DETC 1OAQH 3SE8H 3P0VL 4YDVA 1XGPB 2ZUUA 3O6FA 4OCMC 4PS4L 3MV7D 3RPIB 5I15L 1WFOA 3RX7A 3B9EA 3RUGB 4XVSL 5CGYD 5C0NC 3BQUD 1A0QL 4UTBL 4YFLI 4X4YA 1BZ9A 1T5WA 4MS8D 3SHSA 4GG8A 4PP8C 1N5YL 2J6EL 2FHCA 4X4ZA 1JNNH 3S34H 4ZXBC 5IMOB 1SJHB 4Q6IA 1I85C 5DTFB 3VXNA 1CLOL 3GJFK 2R69H 3BX7C 4ELMA 3C2SA 3EOYG 2GYSA 2FECL 4RFOH 3M1BA 3DV4B 4N9GA 3L7EB 4NRYA 2GY7B 3RWGA 8FABA 4GS7B 4LEXL 2AJSL 5D7LE 1RFDL 3QUZB 4EXKA 4NO0B 1WZ1L 4FP8L 3LKOA 5GS0D 5HBBA 2JIXA 5FCUH 4HWEL 3P77A 5F89B 3CFBB 4HIJA 2R9HD 1BQSA 5FGSA 1YN7A 3U48A 1G7IA 4PJAE 4RMVA 4L5FL 4V3DB 5GRZA 5AYUL 3ECBA 1E28B 1L6XA 5DMKB 3BH8B 5CLTA 1MCCA 5E2TL 3L3KB 3PP3H 1JZ4A 5DS8A 3O3EA 4KGJA 3EJZC 2B0SH 5ACLA 5HI3D 1P9MC 3SDAB 5L7XL 2R29H 3FOMB 3D3VB 2AQ3A 4XP6L 5SV3A 1XFPA 3QRGL 1UENA 1NMAH 3C9NB 4OCYH 1E4XL 3BISA 4L3EA 1JWMA 4P2RB 3O3AA 1ZHKB 4HC1A 5F6HI 3RU8H 3G6AB 3MJ9A 3MV8E 4TQEH 1KG0B 3FFDA 5FK9B 2DM3A 3S37H 2PUQT 5DQDL 5KS9B 1AGBB 3LIZH 4HS3B 2DQCL 4PGCA 3B8YA 2RB8A 3C5JB 3LN5B 4EQ2A 1QSFA 1C16A 1JGEB 1CF8L 2CIKB 4X5WB 3TV3H 3EO0A 1RUAH 4KV5F 3RWIA 3ZE0F 3RA7L 2OR9H 1I1YA 3JV6A 2DLEA 1XZ0B 1DQMH 1NGXA 2NXZB 1EVTC 3Q6GH 3VCLB 3JV0A 2BOBA 3KHQA 3CVHL 5MENA 3ULVH 2A9MH 3RWFB 2NW2A 4ONFH 3UTTB 1RY7B 3V6BR 5J11B 2MQ0A 1RK1A 1SJEB 2CIIA 2W0KA 1GC1H 4NN7B 1P2CA 1T3FA 1TENA 1N3NB 5HI5C 5F97E 4XPHH 1BJ1J 5C07B 2YD6A 3PJSA 3UBXB 5BJTA 2A6KA 3EOTL 4RDQG 1ZEAL 1R5IA 1A1MA 2X7LB 4K71C 3RAJL 3LCYA 4XBPB 4KAQH 1U8JB 5FA3B 1ZT4B 5LCVL 1AP2B 3DROB 1EHLH 1FO0L 4HJ0D 2AEQL 1G6RA 1P84J 4JY4B 1NUDA 4EEEA 4W6WB 1XGRB 4HGKC 4J4PA 5E4EB 5F88B 5JXAH 5EDXA 4ZG1A 5DT1H 3FONB 5HHMA 3BPLB 4HWBH 1CD1B 3WEXA 4O9HL 3OF6D 1N4XL 4JHAL 1GOFA 5EBLB 1IGJB 5F9OL 3FKUS 4LLQB 2FJHA 2V7NB 3TCXA 1RZJC 3T0AA 2EKSB 4MD4B 5A2KH 3FB5B 2I60H 3IJHA 2VL4A 2Z91B 5DJAA 5HHOD 4XC3L 3QUXB 1W0WB 5K9OB 4RBPH 1XR9A 5A3ID 4U6TA 5FYJU 1K2DA 3T1FA 3VXTA 3W9DA 1FBIH 3OWEA 1D5XA 3REVA 4NGHL 4MCYA 5I19H 3IDYC 1X5HA 4ZAKA 3B2UD 2H2SC 1QOKA 5E6ZA 3N1FC 3O0RH 4F15B 5DJCB 5IROA 3W0WE 1JNHB 2ADFL 3FQRB 3BO8B 4ODTL 1GGYA 4PRIE 4XCYB 1QQDB 3B5TA 3X13B 1HCVA 1S7QB 5EIQA 4JJHA 2Y9RT 3G04A 1NMCC 1HQ4B 1FN4A 4LGRB 3FQNB 4HKZB 5BMFH 2HWZL 2MJWA 2VLMD 5FA4A 2EIEA 4S2SB 2BX5A 3L3JB 3QUMH 4U05A 3WFBL 3GBNH 5I74C 4DFIA 3WE6B 1RZJL 1VEOA 1MCFA 3KJ6L 4RMRA 2BNUB 2XZCL 2OTUA 4IMKA 5IJVA 1VERA 1C5CH 2GKIA 1KXQE 4NKMA 2Z8VC 1IL1B 2JB5H 4KUCD 4PJ9C 2ZUTA 3TBTA 4CVWA 3WJJC 3VD4A 1K4CB 4ZXBB 3VRJA 3ZDYF 2GK2A 2VAAA 1PLGL 3VFSB 3WHE1 4DUWA 3UJJL 4XB7A 5I1IL 4KKNA 4NSKA 3BMWA 5DRXB 3TBVB 2QR0A 1AY1H 1IT9H 4F33A 2I5YL 4WW2F 4P3WA 3VXMD 4N8VA 2LTQC 3BPOC 3HCVA 4KTEL 1DVFC 2H2PC 3CSYA 2J7LA 4FXGB 3H9SA 4XNQA 2YKLH 5FUCE 3TWCH 5ERWA 5HYJE 1NCWH 2WQ8A 4HH9B 4HH8A 2WMPA 4ZFZB 4K7PH 3UBXI 4FNLL 5FYLE 1KPVB 4DTGL 4Z7VA 1WAAE 1QFWM 1A3LH 3UJIH 2VLJE 4J3UA 2FLBT 3P73B 2ICEA 4MGXA 4RX4A 4HD9A 1HKLL 2XFXB 3C8KA 1EHNA 1NAKH 3PP4L 5D2NC 1MHPH 3GUTA 3F7VB 1A7RL 2Z31A 5E7BA 4X80L 4G9FA 1BZQK 3TF7A 4TRPH 4Z8FH 5IB3A 3INUL 3HZVA 4L3CA 3EJJX 2P24B 4LVOC 3CVHB 3E3QE 4C57C 5FGRA 2FR4B 3KPSD 3P11H 4H26A 5DQ9A 2ZKHH 1LDSA 4FQIH 4N5EC 4E0RA 3DUHA 4N9OB 4E41D 5ABDE 4MXWL 1T1YA 3ULSB 4EI6B 1Q9OB 3ULUC 3O2DA 4U1JA 5TDOB 5D1ZD 4Z7WE 3MRMA 5JZ7C 2D9CA 3T0EB 1FO0B 1ED3A 2IANA 4LDOB 3ALWA 1PX4A 3G5YB 1AO7E 4G6MH 2VZUA 2HJFA 2VO5A 5TH2B 1BM3L 3HRZA 4GW5B 3VMNA 1MCBA 1IM9B 4L4TD 1XF2A 2IFGA 4DN3L 2Y7QA 4UT6L 4IOFC 4P23A 1QBAA 3IDNB 2XACC 5CKAA 1I9IL 5GGUA 3MREA 1CDCA 2CRYA 5HTSA 4EQ3A 3KLDA 1KCUL 3UZVB 1QO3A 3BPNC 1OLZA 4DK3A 4Y4FC 3LKRB 4G8GD 2H8PB 1FVCB 1H9VA 3ZMRA 2UY7A 4H25A 2P5EB 2JE8A 1U8QB 2DKMA 5CINL 3ULUL 4MA1B 4K71B 3U0TB 2WY3A 3QDMA 3VRLF 3LZFL 3WUWG 1E4KC 2IWGA 5EOCL 5CJXA 2EH7L 1TETL 1S3KH 1E4XI 1U8IB 3A67H 4K94H 5H37G 2YHGA 2DMCA 4MXVF 5FDWA 4PJFA 2A2QT 1CIUA 3BP7A 4HCRA 4OD2B 3MLVL 2ED7A 3O4LA 1JF5A 1YDPB 4N1CA 3VFUB 4MHHI 3C6SA 3PABB 1KIRB 1LE5A 4QYOB 4NT6B 2HFGH 3PNWA 4CW1A 1N59A 1TVHB 5GZOC 4Y4HC 4FG6C 4JDZB 4WFFD 1CLCA 1RJLB 4KQ3L 1KIUA 3Q3GB 5FV1L 3R4DA 5LWYH 4MCZA 5KVDH 4ODXB 3OB0H 3IDYB 3C6LD 3SCMC 1ZHLB 4NP4H 5GSVB 1X5JA 3HR6A 3IJSB 3MBXH 1ADQH 4M7LH 2ZUXA 1RURL 1ES0B 4JR9H 5D7SH 5KJRH 3LB6D 1DQLH 3MLSL 5CEZH 4KKCD 3EYUL 1NMCB 2UZIH 1E27A 4JFHE 4P0DA 3FFCD 2DQUH 5D5MF 5KSUA 1DFBH 3BW9B 2HTKD 3LKNB 3SKNA 2Q20A 4YIQB 5J12C 4IOIB 1G7LA 3UTSD 4G59A 3GMRA 4LLVA 1BFTA 3ZYOA 1B0GB 5I74B 4J6RL 1EUUA 4NKOB 2ATPB 2FX9H 4MA3A 3ORJA 5D7JA 3WIFA 5IMLB 3HN3A 5EUKA 4AQ1B 4Q9QL 1MCOH 4PREA 4R4FL 1UEYA 3WFDL 1NFIB 1BVKA 3MRNA 1CXEA 4WW1B 1ZSDA 3OJVC 3WDJA 3ZHKA 2J12B 4PJ9B 5C7XH 3J8F7 4XTRD 2IAMA 4NDMB 1C12A 1QBLL 4L8DA 3IU3B 3L7FB 5H35B 4OT1L 3FQUB 3WUWA 4X8JB 4E42A 5L8KB 1PDKA 3IXAA 2AK1H 5D70L 1BD2E 4G8IA 1FVDB 3RWDA 5FYJH 3BKCL 3DJ9A 3MRIA 4FQLL 4O2FA 2F5BH 1CLYH 4M9OA 3ARBC 1HIMH 4LRNH 4F57H 4AIOA 1IEAB 3VWKA 4UB0L 5EB9A 2XZAL 1ORSA 5MP6L 2WUBH 2LTQB 2ZUVA 3BPOB 1DVFB 2Q76A 5HYJB 4HZAA 1VFAB 1NCBH 2V5MA 1BECA 3QCUL 3ES6B 1AFVL 3HNTH 4NQDA 2WP3O 3EDFA 3R8QA 1MNUL 1LE9B 3VFVB 4ZQKB 3VFPA 3QQ4B 4Q9CA 3ULVF 3ZDXF 5D2NB 3QUYA 1SYVB 4LLUB 4JQVA 2FO4B 4PR5A 5B4MC 1BP3B 5F3HB 1A7NL 1XR8B 4ODBD 4UQ3B 2ADJA 4MXQA 4LVOB 2BFVL 4MNHA 5CIPB 4M62L 1AHWB 3VXRE 2VLKD 5T3ZL 4OCWL 2O5YH 2R2EA 4RAHA 3ZL4L 4RMQA 3LS4H 1CXHA 3LRHA 5JORB 4GOSA 3ARDD 3KYOA 1DEDA 4S0SD 3G6DH 4U49A 3V4VL 5DK0B 1QSED 3MR9B 3SDDC 3X14A 4X6BB 4TTDD 2VC2L 2DJUA 1DQJA 3GHEL 4O2CA 3MA9H 4Q0XL 4OI9A 3CMGA 1YQVH 3BP5A 1KCSH 4MYWB 3MODL 4DZBA 4XPTL 2DI7A 1AO7B 1KCKA 2XOTA 4YXKL 1Q0YH 5GRUH 4GG6A 4Y19B 3S5LG 1OTSD 3U36A 3AGVA 1CFSA 5AZ2H 3MCLL 3HG1E 1CT8B 4U4BA 5E0QA 2X4RA 3VFWA 5EBWA 1YNKL 4D3CH 3M17A 2OL3L 5IVXB 4D0CA 4UI2A 2DDQH 3BPNB 1T21B 3RTQB 2W9EL 4Y4FB 4XBEH 3EYVB 1H8NA 4WI9A 4N0RA 2IEPA 3RIFF 3HNSH 1LEGB 1EGJH 1OB1B 4OZHA 5DFWH 3SO3C 1LP9A 2ARWA 3HE6A 5T1KD 5HGAB 4LCWD 3GJFA 3O2VH 4Z7QF 4B5EA 3MV8D 5FGBA 4TSCL 5DD3H 2GQHA 2HH0L 3BFOA 3GSWB 5B39B 2NY7H 3MGOB 4UU9B 2A6IB 1OM3L 2CR3A 3DSFL 3BKJH 1JZ6A 15C8L 1SMAA 3P9MB 1UKTA 4Y5VB 1FH5L 3MRPA 2DL2A 3SKOB 4WHTA 4BH7B 3MRRA 1VGKB 1BQHB 5BZWB 4APQA 1LDPH 1NH6A 4FABL 3LS5H 4IRSD 5CD3A 1T0MB 5IB5A 4Y4HB 4NRXB 3D39B 1OCWL 1RD6A 3QWRD 1MFAH 1YEKH 4DGIL 2OSLA 4NZRH 3T4AB 3GI8L 5TFSL 5LAXB 4CADA 2GT9A 1W2KT 3ERYA 5C0JB 1OAKH 4XWOC 2NY0C 2E9JA 4XHJC 4HF5H 1WWAX 5F1IA 3SCMB 3K8KA 2FJGB 7CGTA 1JHLH 5H37H 1VHPA 5HYSA 1XCQB 1CQKA 5I18L 4L4VA 2UWEE 3DBXB 3DURB 3L3GB 1CTOA 3IDJB 1SEQH 1A7BA 2EYSB 4R9HA 5HGDB 3H9SE 2GJZA 1D5MB 4QGYA 2P42B 1QD0A 1T7YA 4KJYB 1UWXH 1LEKA 1LILA 2VZTA 4POZC 4EIGB 4Z7VE 4LNRA 3QEQE 3Q0HA 2K9UA 5KZCB 5J12B 5GS0L 4R97B 4M6NL 2VXSL 5D1QD 5J1TC 4OZFG 3EDEA 3FJTA 1WCQA 4M7KL 4G9FE 3GBML 2DIBA 1U8KA 2V5SA 5DD5H 2B8OT 4U6VH 1M71B 3TVMC 2EC8A 4M5ZL 1MCPL 2EEDA 4KHTH 5IEHA 3EYFA 4K23L 3JTCA 1C08A 2KKQA 2BNQB 1MH5A 4GUPB 5TQ0H 1BD2B 7FABH 1UZ8A 2DM2A 1T03L 1NL0L 2DQDH 1IQWH 4PJCB 4GO6B 4QRTB 5IB2B 3ARBB 4XHQA 5FGCB 4F8TA 3LHPH 1PG7X 1TZGH 1P84K 2G75B 1EERB 5EZIH 2QV2A 2EDBA 2IANE 1XGTB 5IB4A 1ACYL 5J13C 3U46A 4JM2C 3WKMH 2VDMH 3NFNA 3I9GH 1WISA 4YXLL 3BZ4B 1C5BH 3O6LL 4LLDA 1F90L 5D1XA 4XMLL 3KXFD 2FGZA 2K7PA 3FN0L 3ILPB 4X98B 1OSPL 5KSVA 4M6OL 4TPRL 4LCUB 3Q48A 2A6JA 1A6WH 5DUPL 4Y2OA 1OARL 3VXRB 1A21A 4NHCH 2V5TA 3O9WC 5J06A 2APTA 3SDCB 2FB4L 3N9GL 1K8IA 4IHOB 4WGVB 4O5LL 3X3GH 5D2LA 3GSRB 3QHTC 3QQNA 2AI0L 1P6FA 3SDDB 3QJHB 5DHYB 4P2QE 2CJUH 1CGUA 4GRLB 1FFOA 1DBJH 5DJ6A 4OM1H 5K33A 2BHYA 4AL8L 2VE6B 1I1AA 1GPOL 3L9RB 4NRZB 1JGDA 3O4LE 1T4KB 2YXMA 1OPGL 1AIFB 1J9CT 4MJ2A 2C1OB 4RDQF 3HG1B 4XB8A 2ID5A 4A6YA 3BVNA 3F12B 5LXGL 2I07A 25C8L 2XZQH 4LASL 4MDJA 2X4OB 1MSPA 2C26A 4JKPL 4RRPG 1EMTL 4PJ5D 3RWHA 1JIBA 1YECL 4Q6YA 2WLZA 4XAWH 4KWUA 3VA2C 2PYFA 3BJ91 5FB8A 1HDMA 3P4NB 1JTPA 1XGQA 1EPFA 4XCEB 2VH5H 5SX5K 3SE9H 4LHUA 4X9FA 3SO3B 4M6AA 2COQA 3VH8A 2W65A 5DZOA 2HKFH 1VACB 2JF1A 3QR2A 1KF9B 3OMZA 3RVTD 1NSNL 2AXFA 2LU7A 2FZ3B 2FO1A 4G80A 1DBAH 1QVOB 2AGJH 1WEJH 3D0LA 2OK0L 1DBBH 4H20H 4NHUE 5C0FB 4MD5B 4PV8A 3SJVD 3BSZL 5BV7C 5I1CH 4ODVH 4EDWL 1IC5L 2C3GA 3HMXH 3OKMB 4RQQA 1JGVH 3EUUA 4CVZB 3T4YB 2F54A 3RP1A 4WHYG 3OG4B 43C9A 4HJGA 3EHBC 3CFDA 3SBWA 1IZJA 4MNGB 3RIAK 5B38A 1PEZA 2AABH 3ME0A 2XN9A 4QHLA 3EYOA 5IW1B 4BQCA 1CGYA 5ITBL 2NY0B 3QDJD 5K59E 4AEHH 2A0LD 3VMOA 4WDIA 4JB9L 4Z7UF 4NPYB 5KSBA 2UWEB 5DHVH 1M7DB 1UWGH 3MRFB 3D87B 1E6OH 1IC7H 1ONQA 2B2XH 1TZHA 5GS1C 2JJVA 1I1RA 4KDTC 3UTZB 4YC2C 5E9DE 4Z95H 3VFTA 5E8PB 5DLMH 2R23A 4ZDHA 4U7MA 1IRAY 3QEQB 1MAKA 4KU1A 4S1QH 3P0YL 4NJ9H 5C08A 1FC2D 2H3NA 3ZTNL 5TDPB 4ZS6C 4OGYH 5BV7L 2XKNA 4O02L 4UV7H 2J88H 4YHZL 4QXTA 5ELIA 1T04B 4HAGA 4LQFL 1EIBA 1YEIL 2M26A 2VDOH 4LDLB 1KTDA 3K1KC 4JFYA 4ZTPH 3ZKNC 3TVMB 4A2LA 3EO9H 3ZYIA 4PB0H 4CJ0A 1NBVH 4J3TA 5SV4A 3GO1L 1KACB 3NAAH 5FOBA 3T09A 4ESKA 3E6HA 1VEPA 3VXSA 3UZQA 5IHUL 3DRTB 3JWDH 2MTPA 1I4FA 1FFPA 2DI9A 2EH8L 3CNKA 3I6KA 5LBSH 4RMSA 1JF1B 5T3XE 5GRJH 1LK3H 1WIOA 3FO9A 4PJFF 1TVBA 5DYOB 2JIXD 4OZFH 2D03L 3IETA 3NN8A 3U4EA 1VDGA 3BP6B 5GJTL 5HVFB 5J13B 3G5VA 3ARYA 1A7OL 5EU6A 4JM2B 3QXTA 1FRGL 1NQBA 4NN5C 3F7RA 3P30H 1ZV5A 4PV9B 2VZVA 2CKBH 5FFLA 5C8JB 1NUNB 3GJEB 3LKPA 1CFNA 3OAUH 1MFNA 3A6CH 2Q6WA 2G5BB 1OP5K 1M7XA 2OTPA 5F9JA 1R6VA 5EN2A 4WFEE 3GSQA 3RVUD 2CRIA 3WNNA 4LPCA 2V9QA 4IEFB 4L3ED 4OZHE 1EO5A 5A40E 1RZ7H 4UINH 2NLJB 4AIZB 4XPFH 1A8JH 5D8JH 5F1NA 4XI5D 2VDKH 5HHPA 4MA8L 5CUSL 2V7HA 3UTQA 4LL9A 4X8XA 3RJDA 1S9YA 3ROOA 3U2SA 1INEL 2P8MA 4UDUA 1Y0LB 4D0BA 1P4IL 4P3CL 5FKAB 3MLXL 3SDYH 5DI8B 4M1CD 1K5NB 1QSFD 4UOW0 2HN7B 1LWRA 4OLVH 1JPGB 1IILE 2HTLC 1FG2B 4H1LG 4OCRH 1F4YL 3HC0A 4WO4C 1F8TL 1A7PH 3GMMA 3W9EA 4EIZC 4F7CA 4TN9A 1DUZA 1KGCE 2E7CA 1I3RA 3PG2A 3RPKA 3GSXB 1H15B 4K3JH 4OZGA 2FCBA 1XCTA 5MEND 4EUPB 5DEFB 5AWNH 1PGRB 5JR1H 3J7HA 4GLRI 1UACH 4DN4L 5I1DA 3SDXB 1EJ6A 2Y36L 2FGWL 3DMMA 4JJ5A 3MOBH 1NJ9B 1FZJA 1UCBL 5SWZE 4PLKC 5DJ8A 4YE4H 4JO3L 4XTRC 2OBGA 3ARPA 4DKEH 1W72H 1AR2A 2GCYB 4ISVB 3EKCA 3FOLB 1EHAA 4X5XB 1UFUA 1OOAA 3KPQA 2XICA 5C0RH 4XRCA 2ESVE 4P4RB 4J4PD 1U0QA 3RWJA 4OM0H 3X11A 3NCBB 1F3DH 3IAQA 1ZLVH 4KRPD 5HHMD 3DVGB 4BM7A 2X40A 3G6JA 5KN5B 3NMEA 2E7BA 3DV6A 4JZOB 5BV7B 3S35H 2UUDK 4ORGB 1CDGA 2B4CH 3CLEH 1H3UA 4OGZA 1WBYA 3PWVA 1NC4A 2ENSA 3FQTB 1IGCL 3MYJA 5HVGB 4WFGD 3HC4H 3HHRB 1FGNL 2DQGH 4ZAKD 5ALCL 3VD9A 3OX8B 4FXKB 1TQCC 2GSIB 3K0WA 4AIXA 4NKIL 2FX8L 4FQCH 4HFUL 2HKHH 3VU2A 1YPZB 2E3VA 4OB5L 1AKJB 4H1LA 3CZFB 3ARQA 3FHAA 1BF2A 3WFEH 5GS1B 4MNQE 3DO7B 4YC2B 2ZPKH 4G5ZL 2N1KA 3WSQL 1HZHH 4M4RA 1A9BB 2HJLB 4XNXL 3SGDI 4LCYB