4PV9A

Crystal structure of h2kb-q600v complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
277
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural and functional correlates of enhanced antiviral immunity generated by heteroclitic CD8 T cell epitopes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 277
sequence length 278
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pv9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pv9A01
3NZHH 3KWWB 1JGVH 2NY4D 3OKMA 2F58H 1KIQA 4NUJA 4P9HH 4N8VB 4PJIB 5B21A 1NCUA 5C0ND 2FRGP 5KOMC 3SOBL 3RPIB 1BIIA 2DLIA 5EBLB 3RWGB 1ZWIB 3CFDA 5F7FA 1BOYA 2BMKB 1I4FA 1J0KA 4WNQB 4N0CD 3JV6B 2OTUB 1BJ1H 5DEZA 3EYOA 4Z8FH 5D7IB 1JNLH 1QVOB 2W9DL 3E3QC 3MRKB 4M7ZC 1EEZB 2V5RA 3MLXH 4OLEA 3DV6A 3MRPB 1D9KA 1CQKA 5E1AB 4XMKL 1MJJA 1UJ3B 2WIMA 2EZ0D 4ODSH 4JJ5B 4KFZC 4CN1A 4PGBA 1ZKAA 3RX5A 4XPBL 5GZNC 3IRPX 4PGJA 3IFOA 1KPVB 1ZLSL 2Y9RT 5FUZH 4GUPB 5HDOA 2XN9E 3TBTB 3RWIB 3DGGA 3E0GA 2ZSWA 2P4AB 5F6HJ 5IBLC 4JHAH 1N5AB 1T1YB 3IDNA 1Z0NA 4WTZG 4WEUD 4F2MB 4HWEH 1MAMH 4RSVA 1O7VA 3MOQA 4IBLT 3ARGA 3KYAA 4L8BB 3GO1L 3B83A 3EAKA 1AGFA 5TF1H 2GI7A 2Y07H 3C5SA 4M7KH 1JWSA 4IIQB 1HIML 4XHQA 2HN7A 2BXYA 5I0ZA 1BWWA 4YX2H 2ADIB 1J7VR 4TVSa 1UGNA 4EI5C 2KL6A 1ZHNA 4J3UA 3D48R 1SJHB 3O9WB 4IRSD 2N7AA 2L7UA 4OD1L 1ZLVH 4G43A 4JREC 1QEWB 2HRPL 3U4BL 1L7TH 2V7NA 2WM0A 4GH7B 4OZGB 1KF9B 1CF8H 1A9EB 4IMLA 5EULV 1KTDA 3VRLF 4QYOA 3TIEA 4QKXB 4G5ZL 2FX7H 3LSOA 4FP8H 5FO7A 4TOYH 1UWXH 2E7HA 4MQXD 2P7TA 2VDRL 5CJXC 1IAMA 3KDMA 3REWB 2FB4L 5D7IE 1V7MH 5EO9B 1MCQA 5KVFH 4O02L 1QFOA 5IMKB 4WU5B 4FS0A 3VD7A 5GJTL 3ARXA 3B5TA 3RVUD 4XP4H 4G8GB 5T1MA 4NO3B 4LGSB 1F4WH 1CBVL 2Q6WB 1DTUA 3VD9A 2AEQL 3C5JB 4G6AD 3O8XD 3PWJA 3BO8A 3BMWA 1BOGA 4N5UA 5C0EB 3CU7A 1HN1A 3O6LL 3QUKB 1NLBL 2DIBA 1WWAX 1S9KC 3WFZA 1MFAH 3RWJA 5CBEB 1MFNA 1NGYA 4JZOA 2CIIB 4OT1H 4AIZA 1IAIH 1WK0A 5CZXD 2V2XA 3MRJA 3E6FA 3TN0B 3RWDA 3KHQA 5BJTB 1JPST 4ZQKA 1JF1A 5JMRA 1KCKA 5TQ2H 4U7SA 5J0BA 4GMTL 1YMME 1U8IB 2IFFL 4X7FC 4I9WE 4XCYA 3S3JA 2EXYD 4F57H 43C9B 1MAKA 5C0BA 1OP3K 4K3DH 1LEKB 2QHLA 3P77A 5F7DA 3U30C 2C9AA 2X4SB 4ZPVA 1RAMA 3PXHA 4BFIA 5A2FA 3I75B 4ORGA 3KG5A 3S98A 4U1JA 3W82A 3L1OL 4OLWH 4HBCL 3MLYH 4NHCL 1J8HB 4N8CL 3ULVC 3BVNA 3T77A 4H0GA 4HEME 2ICES 4IOIB 5EA0L 1TZGH 3HE6C 3QIUB 4LCWA 3MRBA 1P7QA 1Q38A 5GRJH 2BNRD 3P4NB 1AD0B 3GFUA 3GIVA 3MODL 4LMQE 5GGSY 3BKCH 4P2OA 3UTPD 1KYOK 1ACYH 1TJGL 3EDEA 5EN2B 2OS7A 3R4DA 3O4OC 2HFGH 1A4JA 1N6QH 1TTFA 4DJMA 1ZT4A 4C58B 1QBML 2VKXA 4GAFB 2Z35B 3JTSB 3X17A 5GGSB 1YYLH 2VISA 2AJUH 4GS7C 1OF2B 1U9KA 1JRHI 3L5XH 4Y4FD 4X8JB 3O8XA 1H3VA 1MCHA 4EBQL 4YFDB 3SCMC 5DVOA 3UDWA 2Y7QA 3NBNA 3BE1L 4M62L 4W4OA 3ET9F 2NXZD 3JV4A 3QUYC 3QEHA 1KJ2A 1QOKA 4KAQL 4HKJA 3C60C 5I1AA 2B5IB 1C8PA 3MXWH 2IC2A 4PGDB 5C07D 1LO0H 1FAIL 3EUUA 4LSTL 1Z5LA 4KH2A 1AJ7L 1FYTD 2VLME 5F3HA 1F4AA 3LRSB 5F70A 4XVJH 1JZ4A 1JZ5A 3H8NA 3LD8C 4MAYB 1ZHKA 4CN6A 1H0DB 3R06B 3VFTA 1M7XA 3D1MC 1B0RB 1DBAL 3MCG1 4FFZH 1CU4H 2K7PA 3TO4D 4LP5A 1NH6A 1ES0A 2FYYA 2UWEB 4G8IA 3BOVA 1LEGB 4UT9L 5HDQH 4UBDD 1PD6A 3PHQB 2EDLA 2X1QA 3TPUB 3IYLW 1DEEA 3AS0A 5IB4B 2UY6A 4NKDA 4OV5B 2EEBA 4E5XA 1LP9A 4KY1H 4JZNB 5JA9A 1FDLH 1BFTA 3V7AE 3A6BH 1HKFA 4J4PA 5EG6C 3CXDL 3WFDH 1IM3B 4R7NB 1JNHB 4O9HH 1DVFC 2K1MA 1LQVA 1KC5H 1IC4H 4XNMA 4LHUG 3SEPA 2VWEC 1EEQA 4U3CA 4CJ1A 1MCSA 3FRUA 4IDLA 2JELH 3MRMB 1UQSA 5JLZB 4MXQC 1NC2A 1WC7B 3DRTA 4L8SC 3MOBL 4JO3L 5FM5O 5HY9B 3FQTB 2IAMA 4F3FB 1G7MB 1FN4B 2H2PC 1HEZA 1AI1H 4XP5H 1J1PH 2VLRB 4ERSL 4F8QA 5C0CB 1FNEB 1BREA 1HK6A 2YKLH 1LDPH 1G9ML 3DROB 4X5XB 3C87A 4PJHB 1EMTL 4XXCA 5E8EB 2HLFC 2X4OA 3UTSD 4ZOAA 3GSOA 3VWKA 1QSEB 2ITDB 3GSNB 3VA6A 2YBRA 2EDFA 1VENA 2CRZA 2DMKA 3EYVB 4OGYL 3QDJB 3L5WB 2NYYD 3S34L 1MRCL 2CUIA 4Q6IA 5D1XC 3V6OC 1AD9A 4R4NC 4YDJA 1OAKL 2QV2A 2HJLA 4FXGB 3WS3A 3P9LA 1ZEAH 4KJPD 5H94A 1BFVL 2NY2B 2UWEE 3O45A 3S8WA 2DTSA 5BQ7B 4L9LC 3MV9B 3BH9B 4J1UA 1NDMA 1C1EL 4F7PB 1E27B 4I0PA 2ZOLA 4NQXA 4TYUA 1I9JH 1NFKA 4PJ9B 5I8OH 4JM4L 2NY1B 4GJTB 1F4YH 4MCYA 4U6YA 2PCPA 5C0AD 4P2QD 5DS8B 1LP9F 1J0IA 4R7DB 1U8NA 5CSBA 5DHVH 4NQUA 2CLRB 2YS4A 3UTQA 2CXGA 5IB3B 2YMXL 3TZVA 4Y5XC 1D3CA 1RULL 3V52L 3QDMA 2A9NL 4M4RA 3RWFA 5HJ3B 3IU4L 1M7DB 2WBJD 4WFHE 1FC2D 2B1AH 4FFWC 1URLA 1XCTB 4OZFB 2H6PB 4HEPG 4XRCA 2OYPA 3IAQA 5DRZB 2JJTC 2GW5A 3EYQC 5INDA 4ELKB 4M8QA 5FB8A 4JKLA 5D2NC 3QCVH 1MIMH 2VLRE 4Y16C 5C0CE 4JVPA 5EH1A 1YN7A 2NY6D 1BZ9A 4MDJA 3UTZB 3MLTB 3SKMB 3DX8A 3FQXA 3WN5A 4PJHE 3RKDC 1FLRL 3OBAA 1YQ2A 4G8EB 5B39B 1K3IA 1ORQB 4GQ9H 1QSEE 4N0YL 3NABL 4GRMA 5L2KA 4YHMH 5HGAA 3T4AA 4PG2A 3QDJE 5HGDA 3CFCL 3DIFA 2M1KA 1HSBA 4FQJH 2D0FA 3WHXA 2Y5TA 3RVTD 5EU3A 2Z31A 4DEPB 4AH2B 5ICYB 4BFBD 1S7SA 1YQVH 4K8RH 4RAHA 4NFBA 1T80A 4M1GH 3LKSB 4GW4A 5HHQA 2VUYA 2VDNH 4LSUH 3FQRA 3MV9E 4P2RA 4FG6D 2EDHA 5L9DH 2NLJB 2YHGA 3GJEA 4JHBA 2Q86A 2NY4C 5GZOD 3KPLB 1SJXA 4LU5L 4MJIA 5C0NC 3JTTB 2BVYA 3VXTB 5D5MA 1KCVH 3AY4A 1DQML 5JPNB 1B0GA 2YD7A 3EO1B 5FYJU 1A7OH 2CMRH 4XCFH 3KYNB 2FX9L 2J8HA 4FZEH 4X7TA 3SDCB 1JP5A 1A9BB 1UH3A 5JQ6H 5KW9L 4PGEB 3V0VB 1KFAL 4M6MH 5SX5H 5E6IB 5F9WB 1IEAB 4WW2B 4NQVA 3VGHA 4G8FA 1IGJA 1MCKA 2O26U 2QKIA 3TFKD 1RVFL 2B4CH 3CFJA 2CDFA 3WXVH 3GMPB 1LEIB 2SEBB 4P23D 3V4VH 1T0NB 1U8HA 5JW4M 3WNNA 1H9VA 3CX5K 3FO1A 2X4NB 3DRQA 1EHLL 1QFWL 4TSAH 4L5FH 1A6UH 3W2DL 4LCIH 5HHVH 3P30L 1S7XB 1I1YB 3CC5B 1X5IA 2BVOA 5E2VL 5DMIH 1YUHB 1PZUB 4NO2A 5I8CB 3F62A 5E00B 2VJXA 5EO1A 4ZO9A 4NC2B 1FP5A 3RDTA 3RX7A 4DUWA 1TCRA 4I18A 4R26L 4ZFZB 4U6TA 2YWZA 1RUKH 2NQCA 5C70A 4LDLB 1PG7H 1NCDL 3GRWH 2BJML 4Y4HA 3TBVB 1F3JA 1LK2A 4TSBL 1Q72H 1HXYA 1A0QH 3MLUL 4FOMA 4XAWL 1EZVX 1N64H 2AI0H 5MP6L 5CJOL 1Q0XH 5I1GH 1FCGA 2VQ1B 4ISVB 5DT1L 2GITB 5T1LB 1RUPL 4IRSC 3VFGH 2OR9L 5KS9E 4LSDA 3T2OA 3ZE0F 2N7BA 4BUGA 2P5WB 4MXWL 4OLZL 4PJ5B 5I30L 1IC7L 3VXMB 5LGJB 3PP3H 4ZNCD 5I8EA 3OL2A 5ESQB 4U0RC 4GRLA 1AHWC 2HKHL 4HDIA 4D8PA 5JUEH 4YHPB 4HUNB 4YC2C 5HHOD 15C8H 4PJFE 3HZKB 4Z78B 4KDTA 3CH1A 4RMQA 1A7NL 2BRRL 2VZ1A 4WHTB 1OSPH 3TCLA 1DCLA 4R4BA 4MMZC 3HMWH 4QT5A 2BCKA 2VH5L 4BSWB 1F3RB 2R0ZH 3BIKA 3NCJL 1JWUB 1G7LB 4YXKL 4GBXA 4GLRH 5D2LF 5JTWA 3TFKA 5FM4A 3RVUC 4KVNL 5HI5D 4NC0B 3SQBA 2OQJA 3HG1D 3IDIA 3REVA 3ZTNL 3MRCA 5LKNA 3NZ8B 5IB1B 1FGNL 2D7QA 4FQIH 3F65A 4QXTA 3ARUA 1NAMH 1KLGB 2WW8A 4S1SL 4OUUA 4X6BA 2ZG3A 4ZSOA 5I1CL 4R4FL 5CSZB 4JRWA 2ESVB 1K3ZA 3FQUA 3G08A 4Y2DD 5ILTH 3KR3L 1NCAL 1OHQA 1OWWA 1LD9B 3S37X 1FG2A 5CZXC 3H9HA 3MRDA 2CRMA 4ZFOB 3NCBB 4WWKA 2GFBA 5ENWA 3QUMH 2DS4A 3EFDL 4WGVB 1NEZA 1TETH 2WUCL 3H3BC 4PJGA 2EXYC 1I3RB 3L6FA 1E4JA 4NZRH 5AYQA 3GZKA 5CD5D 4X7SH 4ESKA 1QFHA 1XF5A 3VFWB 3MO1A 5I18H 3O2WL 5EU7E 2JIXB 4XBGA 2O5XL 4PJ5E 3ROLA 4KTEL 1I7TB 1GIGL 4PR5B 4ZXBD 4HJ0C 3RWEA 3VXME 1J8KA 4NUGH 3IT8D 1KJMB 5DJAA 2BNQB 4ZTPL 4QRPD 3QDGA 2GJ6B 1BVZA 1ZT7B 4ZUTA 1U8JB 3LHPL 5BRZB 1GC1L 4M61B 3K7UA 1KCRL 3GGWB 4YHOL 4A6YB 5IJVA 3O2VH 1C7SA 2V9RA 3I3EA 4ODHH 5E9DA 3IDJA 5F7EH 4QHLB 3GIZH 4GW1B 4QXUL 1LO5B 2ADJB 3IU3A 2ZSVA 4JRXD 3HC4H 3WIFA 3RX8A 4OGAD 4AM0B 4MS8A 1EGJL 4MNGB 1UM4L 5C0RL 3H9SD 1T7VA 3QFDA 1BF8A 1JPGB 1MLCB 2CK0L 2FECL 3HZMB 4K7PX 2DTMH 3VWJC 1H3PL 3MRGA 4ALAH 3GBNH 5JW5A 4L8DA 3T2PA 4XC1H 1IILE 1GHFL 3BN9C 1DUZA 1YNTB 3OJDA 3LKRA 5JOFB 4GFTB 3UJTL 1Y18A 2JK5A 3OPZH 2VIRB 4X7EC 5B8CB 4KPHH 5KANI 3FCTA 5FGCB 4Z7VA 4H26A 3L3IB 2MHAB 1QKZL 4J8RA 5T3ZL 3FONB 3K4AA 4Y5VB 1MFCH 3E2HC 3UZVB 1KN4L 4JFDB 2YPVL 2K9UA 2EEAA 1VFBA 2A83A 4NRYB 1A3RH 5GSRB 3T65B 3AREA 4XVSH 1U36A 4HJGB 3FOLA 4JDVA 3SO3B 1CE6B 4L4VD 5E8DL 2BNQE 5IMMA 2GJ6E 3B9KD 4CMMA 5BS0B 3MQIA 3O6FB 4U1GC 4LSSL 1H3WM 1T20B 3AM8A 1W72B 3TO4C 1KPUA 2EYTB 3O2DL 2VTFA 5EC1B 4MQ7B 1KJ2L 3ZL4H 4RIRB 3STZA 3T0WA 1MQKL 4JFQB 3SE8L 4OIAA 4UBDC 5CZVL 3IFPA 3CFKB 1HZHH 1ZT1A 1QLEL 3BWUC 4S0UC 4F9PA 2B1HL 4R0LC 4AG4H 4NQEB 2YUZA 1U3HD 3WJLC 3CVHB 4JRXA 1UT9A 4G6MH 3I6KA 3DTXB 1E4XH 2VDMH 3IJYA 2HVJB 4MNGE 4OCSH 2MWCA 3CFEB 2DQDH 1M6OB 2F54A 5KAQF 3KS0H 4JANB 3NIFF 3SKJH 2X1OA 1NMCB 5KVGL 4NO0B 3QXAB 3EJYD 4QHNA 3CSGA 4OKVB 1NUNB 4PTUB 1T5WA 3NFNA 3S36H 1WIPA 4PB9H 5I19H 2DYPD 4WUUB 5FGCE 2VL4A 3AMKA 1RQ5A 4ZTOH 4PJEA 2NMSA 3BD5A 2LQRA 2NX5D 5BV7H 1ONQA 3P4OA 2VDPH 1U92A 4FXKB 1Z6JT 3GHEL 5JO5B 5EWIH 3D9AH 2R1XA 4OTXH 2ITCB 4L9DA 4NRZB 8FABB 2X7LB 1ROWA 1HHHA 3VCLA 2AQ1A 3SY0B 3OKEB 5BS0E 4P4KD 5D72L 5ETUB 4KJPC 5DHXB 1S7UB 2R4SH 1HHIB 4G9FE 3MJ6A 4HIHA 4LAQL 3LDBC 3AVEA 5F9AC 4NO5A 5DUBA 2A0LD 1CFNA 1GGCL 3FB7A 4FMKA 5FHAH 4XX1E 3HE7C 2P46B 1N4XL 3LZFL 5JHLL 1RZ7H 4OCWH 3HR6A 5DK2A 3BYTA 3DXAD 3MA7B 1P7KA 3IXAB 1WCBA 3PWPA 4FFYL 1WFTA 4NQEE 1OGTA 2EYSA 1JF6A 2GK0A 1S7TB 2MNUA 3QDHA 4J12A 5KANG 1E28B 5DJ8A 2CR6A 4ODUB 1T4KB 1XR9B 1D6VL 2C7UB 2HJKA 3GRWA 4YDVA 4F37F 1AQDB 5D7KE 2ZKHH 3Q6FB 4NN6C 5I16B 2A77L 3FN0H 5CEZH 1GZPB 3B2VH 5GRUL 3DBXA 3SDAD 4N0FB 4MDIA 4OFVA 4DAGH 5DJYA 3UBXI 1SEBA 2H26B 2UYLA 2NY6C 4ZUSB 2VNCA 4X6DB 3NH7L 4HUMB 3LKNB 3SPVA 4PPTA 4NJ9L 4HHAA 3WKMH 5GHWH 1KEML 5L2JA 1MRFH 2P49B 1JPSL 4KTDL 1YEEH 1X5KA 2C5DC 1BBDH 3VFNA 4HIIA 3RVTC 4RAVA 1JWMA 4M7ZB 5GIRB 3ES6B 2NY3D 1DN2A 4XCEB 3ZE2F 4DTGL 1MREH 3T0BA 2W0FA 4FG6C 5IT2L 4FABL 2F8XC 1IJ9A 5GZOC 2W92A 2QQNL 5DJCB 1OARH 3GSWB 1RZJL 4DN3H 5JHDA 1KBGL 3WLWD 1NAMA 4QHMA 4CW1B 4XVUD 2HT4D 3CSPA 2IAND 3WYRA 4I3GA 2Y06H 3L95B 3MRLB 5C6PB 2VXUL 4R2GC 1I1FB 3ULUC 1K8IB 2IPTH 4KKLC 3LQZA 5CLTA 5C0GB 5E2UL 2JCCF 1MCWM 1OVZA 5H8DA 3VFVA 5KVEL 5ERWA 5I1LA 2EIEA 1HDMB 3QUMA 3ULSB 4KV5F 5GGTH 4WO4A 3WUWG 4G42B 1WISA 2GQHA 4EI5B 4P23C 1H8SA 3A67H 3JZ7A 2Z93A 1SVCP 1CICD 5EOCH 4Y5YB 2VZSA 2R2EB 1WLHA 2NTSP 4HH8A 4LHQB 4YQXL 3KPSA 4ZYKB 1QSFB 3BDYH 2XZAL 4JREB 2DQCH 4X6DE 1CZ8H 5SWZD 4Y8DC 1Y0LB 1BD2D 3G6JF 4UAOC 5BCAA 5A3IC 5AYUH 1QLFA 3PHOB 4X9BA 2AKRA 2IH3B 1KB5B 2VLJA 3TV3H 1WUNT 2R9HD 4NC1C 2B39A 1QFUL 4Q9BA 4LRNL 5HVWA 3E3QE 5F7HA 2YR3A 3OHXA 5CGYD 5EFIB 3LEVL 4QCIB 5KVMC 4DGVH 3Q5YA 3MCLL 1F58H 1OGAD 4JPWH 4J3XA 4XP6H 2NW2B 4ZO8A 5EO0B 4TVPH 4JJHA 4OSUH 3X14B 3AAZB 1XGTB 4HCRL 4LFHG 2P5EE 3P0YH 1GOGA 5IHZA 3RGVA 4PJFF 4Y2OA 2W60B 4LVOC 2DLFL 4S1RH 1FFNA 2E9WA 2Z4QB 1TQCC 2FJFB 1JE6A 1A6AA 1JYVA 1B0WA 4D9RD 5FCUL 2A6KA 2XA3A 3TVMD 5LXGL 4LQFH 5FYKU 4BKLA 3ERYA 3UBXG 4NQCB 2KUTA 1QLRA 2AJZB 5EUOA 1X9QA 4DKDC 4YWGL 1S7VB 4DZ8A 4GW5B 2CR3A 5L0QC 1ZA6B 3QUXA 5H2BB 3ARDC 2VLKB 4X6CB 5ITFB 1IGFL 2HJFA 3FO9A 3N1GC 4PJAB 3UJIL 5HI5C 2BY1A 4KJYB 4U33A 5TQ0H 1T1ZA 3GB7B 4ZAKD 1MJ8L 5FM8A 1RJYA 4HPOL 5B38A 5HDBF 4Q9QL 3WSQH 4LCUB 4F37K 3F7RA 5K9OA 3TWCH 5E08L 1CN4A 5FYLH 1QSFE 3IS1X 3RUGB 4KMTH 3RNQB 1G7PA 3AU1A 1BFOB 3TBSA 1XEDA 2VDLL 5DYOA 5IV2A 1KT2B 3QNYA 5IQ7H 4U6HB 1FPTL 4HD9A 1PKQB 2DM3A 4HK3N 5DQ9A 3VDAA 3HE6B 5IHLB 1JPFB 1K2DB 4ODXB 4RQQB 2NZIA 2OZ4H 5I1DA 4KZDH 4XH2A 5E5UB 1QNZL 3O4OB 2EXWC 1DBBH 4MD0A 2YRPA 4WUKL 1NFDF 4KROC 1P4LB 4NQDA 3VFOA 2RJMA 3KPRA 1MCPH 1T22B 3CCHA 4MNQD 4S1QL 4IMKA 5CILH 5GISH 5CD5C 1QQDA 2FZ3B 4NM4L 2Y23A 2QSTA 4CN4A 3WD5L 5BVJB 4UINH 5IROA 2CO6B 2ERJC 1XGPA 4GS7B 1R5IA 4D9LL 1KCSH 1ADQL 1UYWL 4EUPB 4IS6A 4Q74A 1WZ1H 2ZUXA 5HHMD 2IPUG 4HC1L 3D69B 4LQ1A 2XA8H 3U9PL 2YC1A 1NUDA 3QUYB 4NQCE 5F89B 5CEZD 1WWCA 4F58H 4JZJC 4YO0B 4G3YL 1IKFH 5CZKA 4PJDF 2ORBH 3C60B 1JTOA 1YDPA 3KPOA 4ZD3L 3JBG7 3Q48A 5GS0C 2VLKE 1RUMH 2XG4A 4X6CE 2DF3A 3VXUB 1IVLA 4RX4A 1AE6H 1U2CA 4PJAE 3CX2A 3MV8B 5AAMA 5BZWA 1PLGL 5JW3L 3RA7L 1ZE3C 3D39D 3FO2B 3OB8A 5GS1A 5MENB 5EIIB 4JFFD 4X80L 3LD8B 5CJQH 3D18A 1FO0A 4OGAC 2ZCHL 4ZPTA 3TA3A 1TJIL 2A9ML 3G5YA 1KGCD 5DVNA 4AT6A 3ULVE 1QRKA 1UEYA 2NPLX 3C5ZB 3MJ9H 5FA3B 3OAUL 3VXRB 3VGAB 5KSAD 3MJ7B 3D2UD 4LLYB 1XF4B 1XGYH 2BSSA 3U48A 3P9WB 5CS7A 12E8H 2XQBH 1N6VA 1ITBB 3MLZH 3OKOB 1MCBA 4L3EA 4LSPH 4JM2B 5J89A 1T1XA 4LASL 1RUQL 2FEEI 4MNQA 2FDBP 3UEZA 5B3JF 5KSVB 2R0LH 5EU4B 3U82B 1B4JL 5IIEA 3H42H 3RBSA 1OAUH 1L9NA 3T4YB 1U2HA 4BQCA 3B9KC 4NM8L 2BDNL 4M48H 3FB6B 5TH2A 4Z18A 1UM5H 5FDWB 4DVBB 4L8SB 3OKKB 4LEXH 4NHUB 3WKNA 3IJSA 4D0CA 3L3HB 3C6LA 4XP1H 1OW0C 3M8OH 4HKBB 5FK9B 3QRGH 5I1IL 3MA9H 4JAMB 3QIWC 3WV0A 3X12A 3OZ9H 1AC0A 3VXQA 5T3ZD 2I07B 4HKZB 1AO7D 2YA1A 1U3HC 3BZFA 1OY3B 5IUSA 4JFFA 3GSXB 3MLSL 2VR9A 3QWRD 2J8UB 5D1XB 5E7BA 4XNZC 1BGXH 1VADB 3EHBD 2Y36H 1Z3GL 1T89C 2QL1A 2XQYK 2F53D 3C8KA 1VACA 3VXRE 1I1AD 1YEFL 4UU9A 1Q9OB 3S6CA 3BXNA 1BMGA 2D03L 1EO5A 3MV7E 5F71A 3EJYC 2DQEH 4J3SA 2IEPA 4Z5RA 5HVFB 3KNBB 4L9LB 3CK0H 4GRWB 1WSST 2X05A 1DUYB 3G6AB 3S37L 1RIUL 5ISZB 4NKMB 4ONHA 2FBOJ 4PJBA 2KKQA 1MHEA 3HPLB 1T1WB 4U1NB 4UIMB 5DMKB 1BM3L 4CMHC 4ZNEA 3DX6B 3QIBA 3CGTA 3PWVA 3QH3A 1ZGLB 1G7IA 1OB1A 2X2YA 2BHUA 1IE5A 1MJ7H 2FSEA 3N06B 2VWEE 4E42A 5IM7A 3MBEC 3L3DA 4JB9H 4P4KC 4UQ2B 4KRPB 1ODAA 5DMYA 4MVBA 5GXBB 5GGTA 5EZJA 4RRPA 4NHUE 2BSTA 2XKNA 1KIRA 2IG2H 3KLSA 1MUJB 1PX3A 5JNYA 2G60L 1V7NH 5D2NB 3WLBA 2A0LC 3PWLB 2PXYD 5CD3A 32C2A 4Y16B 2VXTL 3BPNC 3DUHA 4NOFA 1P2CB 5FYJE 4AYFA 4GG6A 3TO2A 5F9OL 3ARYA 5IVXE 3R1GH 5E2JA 3NCEB 4LCCC 3OAYH 2HG5A 4XPFH 5GGRA 5HHXH 3S5LA 1A7RH 1T3FA 2A1WL 3QWRA 1LDSA 3V6OE 4DWHA 1FE8L 4HIJA 1AFVL 4JDTL 2GT9A 2VC2L 4PRNB 5ALCL 1IQWL 1I1AA 1NGQL 2YPKB 4K7PL 1IFHH 2X4UA 5E5MA 4GRWE 1ZHLB 1IGIL 1MIEL 5E94B 2X41A 2NY4B 5ISZE 4HWBH 4Z0BH 1DANU 1HHJA 2EE3A 1QRND 3I84A 1AGBB 1A6WL 4ODWB 1KLUA 4M7LT 4QRSB 1A1MA 3O6ML 3K2UL 2AV7A 1DDHB 4X7DC 2VZUA 3PDDA 2IGFL 2VAAB 1FG9C 4P0DA 3LVEA 2BFVH 3KJ4C 4DKEL 1ZVYA 3O3DB 1FZJA 1TQBC 4K3HA 3VD5A 2WINA 2PYFA 3D3VA 3NTCL 4X4XB 4J6RH 1DLHB 4WEBH 3SGKA 3V4UL 4TQEH 1J5OH 3O11A 3BP4A 4U0QB 4I2XA 4JR9L 1CIUA 1LK3L 2APTA 3IDUA 4NNXB 5T3XL 5ICZB 4QHUA 5CCKH 2JJSC 2DIAA 4APQC 4QOKE 4G9DA 5FKAA 1OAQL 2DQIH 4B5EA 1U8QA 1OCWL 1CGTA 3SGDI 2E3VA 1QYGH 1XGRA 5D2NE 1ZA3B 5FDYA 2H9GB 3EW3B 3WLWC 2CK2A 3WS6A 3O6KL 3L3KA 4XVUC 2XFXB 2X1WL 2OTWB 3KXFA 3PP4H 3LIZL 4TULL 1MHHB 1RD6A 3JV5A 3QQ3A 3UO1H 1RZIA 5IBUB 4JKMA 5TDPA 1CLYL 3RL2A 3RP1A 1D6EB 1KTKE 2VMFA 2OZ4A 5KN5A 1MQ8A 3OKLA 2XWBB 3IFNL 4S2SA 3R0MA 1FL3A 1P1ZB 1OTSD 3HNTL 3PWUA 5C0FA 5DA4A 5C0IB 4NJAH 3VGEA 3RI5F 3BP5A 4IRSB 3KYMB 4KRLB 3V5KB 3WFEH 1KJ3H 1RJZB 1CICC 2XN9D 2YRLA 4PY7B 5B3NA 4F8TA 4WY7L 3I9GL 1E6JL 4PRBB 1TNMA 4HKXB 3HI6L 4MA3B 4U0RB 2PYEA 4PV8B 1AHWB 2ICWI 3WXWH 1CWVA 5DHYA 4YC2B 5HYEA 3OXRA 4YBQC 1VPOL 1X5JA 1WCQA 1HWHB 1W0VB 1CR9H 3FZUC 4DQOH 5CGYC 2AJVL 1YN6A 4OF5A 3ZLQC 4H88L 1FBIH 4FQ1L 3BWAA 5CP7A 1X4YA 3DX7A 1UVQA 1A6TB 1MRDL 1KJVB 2I9LB 1T7WA 3QEUB 2OI9A 1NAKH 2XY2A 1JNNH 1YEJH 4ZS7H 4QXWA 4HPYH 2VOTA 3TPKA 1YEKH 1KV3A 4HMDA 5DRXA 4W6WB 2OL3L 3I6LE 5DD5H 5J6GB 4LL9A 3MJ9A 1JV5A 5MEPA 1U6AH 3TVMC 3MRFA 3DMMD 1A22B 1S9WA 3MMEB 4DGYL 5BXFB 1M7IA 4Y0GA 2WAHA 4WFFD 3JWDL 4P5MB 4F7TA 1SEQH 4X6EA 1MI5B 2FO4B 4HXBH 4KKBC 2G9HA 5J1AA 2PN5A 4H8WL 1VSCA 1QO3A 1YNKH 1I8MA 4HLZG 1D9KC 4ZAKC 1OAZH 3OX8B 4MAUH 1CVRA 1KNOB 3TESA 3MJ8A 1L7IH 3B43A 1U93A 4GKSB 4ONOA 3S4SB 4MHHG 1JGEA 4ONFH 3ALWA 5ICXA 1JHKH 2E7CA 3QHFH 5DURB 4JQIH 1OD9A 3MX0A 4GAYB 1INEH 1FNSH 5E8PB 1I75A 1DBJL 3CPLA 1A4KB 1EJOH 1C5BL 5EOQL 3QG7H 4OCXL 1Z9OA 3ARGC 2MSPA 2MOVA 2BVTA 2C3HA 1YMMD 3ZE1F 4I9WD 1OQOA 3DVNB 3O9WD 1XGUA 3BZEA 3ZYZA 5GPRA 1OAYH 3KWWA 2IBZX 5HVHC 2Y6SC 3QO1B 2LFGA 4N8VA 4PJIA 1KTLB 3EO9L 5J1TC 3EYFB 4Y4FB 3BKMH 3RPIA 5IEKB 5EBLA 3RWGA 4LSVL 4KXZH 1DN0B 3T04D 4U1LA 3GSNH 4NWTL 4WNQA 3VXSB 4TNWF 3QR2A 3VWJB 2WWMD 2GTZB 4O58H 4WGWB 1T6VN 2NXZB 2OTUA 5EIVA 1WWBX 3BGAA 4P46D 4UB0L 1QVOA 5D7LA 3WFBH 1MI5E 1EEZA 2DQFA 3MRPA 5JW4N 2M26A 5C07B 3RWHB 3VG9C 1RURH 5E1AA 1UJ3A 4XXDB 1CQYA 1FYTB 5I1KL 5IGXH 5EU6B 2AEWA 3DO7B 4HK0B 2VZOA 5DJXB 1KPVA 2YRZA 2A6JB 1MHPH 4ETYA 2Y1VA 1XCQB 2XPGB 3TBTA 5HI3C 2WSKA 3RWIA 3ZKXB 4FZ8L 2NY0D 3B8SA 3FRPA 4HXAL 3WNOA 1S8DB 1RZKC 3RI5K 1T1YA 1IQDB 4XVTH 2W1NA 1YNLL 4F2MA 2X9WA 3FB8B 3TO4B 3WIIH 1TVBA 1LE9B 4L8BA 3WHE0 3EFFB 3NCFB 4IIQA 3HRZA 1MCCA 4LPTA 4RFNC 4UT7H 1GC1C 2P47B 2Z91B 4KQ4H 3CU1A 3ALXA 2ADIA 1J88A 4L4TB 4OZFH 1OM3H 2IADB 1E0OB 2HKFL 2VLMD 1MFDH 4M6OH 1SJHA 1AKJA 4R0LB 1MJUH 4NKIH 4PJIF 1N8ZB 2CKNA 4XPAL 1FO0L 5E7FA 1QEWA 4GAGH 3AUVA 1IAIM 3QZWB 4OZGA 1A9EA 5JORB 1MVUB 3GSRB 3VXSE 2DQJL 4JO2L 2E6QA 2WP3O 3T0AA 4OLVH 2ARWA 4UV4H 1DLFL 4RCAA 1NLDL 4G7VH 1IC5L 3THMH 4HWBA 5IMKA 4WU5A 4P2OC 3VW3L 1NBZB 1IGML 5CUSH 4G8GA 5TE6H 4NO3A 3LH2L 1IKNA 1FYTE 4XPHH 5A2KH 5EU6E 5KTEL 4FFVD 2VE6A 2Q6WA 3UTSB 2HTKD 5FF6A 2D9CA 4YZFF 2DKSA 3BESR 5C0EA 1UCTA 1RZ8B 5CJBA 3DSFH 5FV2A 1EAPB 4NZUH 5E4EB 1CDJA 3C6SB 1KG0B 4KHXH 4KUZH 2IJ0C 5CBEA 1FFOB 3ARFC 4JY4B 2FO1A 5DZOA 4PP1C 3SGJC 2Q20A 3UDWC 2MCPH 4GXUM 3LDBB 5HD8D 1GPOH 3TN0A 3ZT7A 3HMXA 3WE6B 2R2HB 3LS4H 4CVWA 3V79C 3QAZC 1U8IA 3HE7B 4L4TE 1R3IL 5C0AB 4P2QB 4JHWL 4MMXC 2AJSL 1LEKA 2W0PA 4L8CB 2X4SA 2GCYB 3PG2A 1E4KA 3U7WL 4UI2A 2CLVB 3E6HB 4MJ6B 5D71H 2O5YH 3DPBA 5IBTL 5GGQH 1UZ8A 1J8HA 4MQSB 4OZGF 4Z7NE 2WBJB 3QIUA 5SV4A 2J2ZA 1YEHH 1IGCL 4JO4H 1T6WA 4NZTL 3SGEH 1WV7T 4K3JL 3DUUA 5JIPA 2X4PB 3G6DH 5EN2A 1INDL 4RFOL 2GYSA 2PXYC 4Y89A 3KAAA 4TNWK 1TENA 5F8RC 2NY6B 4JPIA 2Q3AA 2FH6A 3G5XB 1CD1B 2Z35A 2EDWA 3JTSA 3UTSE 3U46B 5GGSA 5DJDA 1ZVSB 1OF2A 3IF1B 4M8VA 3I6GA 2ZG1A 4YHLH 1JRHL 4X8JA 5FO9B 3FT2A 1RU9H 4LLUB 4JN2B 1G6RL 4WFHD 1OSZB 1S78D 3RY6A 3L5JA 3QRFM 1JHLL 3AXLB 4S1DD 2IQ9L 2CPCA 1UENA 2LE9A 1FNAA 4GKNB 1SJEB 1HILB 5INCB 5DXWA 2H3NB 1R24B 1TFHA 3WFCL 1YJDH 4QWWC 5I75C 3INUL 3CSBA 4P4RB 5C0AE 4P2QE 1NCTA 3LRSA 4XI5D 4AQOA 4DCQA 2EE9A 1CE1H 3TJHA 3AS3A 3QI9D 4MAYA 5TE4L 3TC9A 2G75A 3QDJD 4R2GB 1BVLB 1H0DA 5D8JH 4CJ0A 3R06A 4LLVB 3OR6B 3OB0H 3O0RH 3VWKC 1B0RA 1U8PA 2EKJA 4JO1L 5JMOC 3U0WL 1N7ML 2YA2A 2UWEA 2VXVL 4OV6F 7FABH 3MV9D 1TDQA 4OI7A 4ZODA 1CD0A 4P23B 3ZDZE 1LEGA 1V3MA 4YHYC 4KQ3H 3PHQA 3TPUA 4PJ9D 43CAA 5C09B 3U6RB 3FT3B 3MUGB 5IKCA 4OLUH 4X8XA 4P5TD 3P9MA 5IB4A 2PTTA 3TJEL 2FEDD 4OV5A 2DDQH 5D7SH 2R15A 5F97E 2FATL 3PABB 4JZNA 3QCTH 1TTGA 4UAOB 4QF1B 5FYKE 3R8QA 5IFJB 2QHRH 4R7NA 5A16B 1EFQA 4KMLB 2O5ZH 3TZVC 3MRMA 4ENED 3FQNB 1A14L 2DL2A 3GMQB 5JLZA 3U0TA 1WC7A 3D6GA 2GSGB 5DDHB 2EDXA 5DSCB 3T0DA 4OQTL 3N85H 1CGSH 4JE4B 4ZFFB 5HY9A 3FQTA 1QTYT 4F3FA 1G7MA 5F1IB 3PGDA 1FN4A 2X5PA 1KUMA 1FORH 3W39B 2G5BA 4A6YH 2VLRA 5C0CA 1FNEA 2I5YL 3QXTA 4LVOB 1EK3A 3DROA 4EEEA 1TQCB 1RZJC 4H1LG 4PJHA 5E8EA 1HYSD 2D4DA 3TT1L 1QSEA 2ITDA 3GSNA 5ACZB 5HHOB 3ULUE 3EYVA 4XNQB 3QDJA 3L5WA 4CU7A 1UWEH 3QUZD 3GBML 4Z0XB 1QG3A 5L0QB 3H7LA 4PG2C 1DL7H 4N9OB 4FXGA 5L6YH 4RWYH 5D9SB 4KZDL 3ARDB 5DEFA 5ELIA 5CJ5A 1MFEL 1N5YL 1OLZA 1BVKB 3MTRA 3FFCB 4U05A 2Z31C 4N5ED 5BQ7A 3MV9A 3HG1B 5HYSB 4F7PA 5C3LD 2V17H 5ITBH 3UC0H 5C09E 4PJ9A 3T8XB 1M71B 5DS8A 2ZCKL 3SDYH 1GCFA 1CLOL 3LKQA 2VDQH 3AY4C 5J11C 4Y2DB 1XMWA 2CLRA 1UB5B 2BVQB 2R29H 3DMMC 3IS0X 3DI3B 3GDBA 4XAKE 5E6ID 1IT9L 1CFQB 4UV7H 4HK3J 3RIAF 1U8LB 1X5GA 3QCUH 2QSCH 4NC1E 3WIHH 2ZJSL 4I5BA 4KC3B 5HJ3A 2YN3A 5AAWA 2C4FT 2ED7A 1M7DA 3MLRL 5DRNB 2DKMA 1W72H 2GUOB 4ODVH 4GAJH 5EPMB 3S35X 3SKOA 1F2XK 3OTTA 4OZFA 4KROB 2H6PA 3MZTA 1UB6A 4JGUA 2Z9TA 1QHOA 4ELKA 2H8PB 1OAXH 2UZIL 5IG7B 2ERJB 4ZXBB 1NSNL 1CL7H 2D4FA 4U1MB 3UTZA 4M00A 3SKMA 1IAOA 5EUKA 3BQUD 2FIRT 5HYJB 5B39A 4G6JH 1F4XL 1ORQA 1R3KB 4N9GA 2HMID 3CVHH 5ID1B 3N1PC 1H8OA 1TJHL 4JQXA 4V2CB 3VE0B 2FJHB 3HC0A 4ELMB 2AXFB 1FNFA 3PGFH 3I85A 4JZJB 3MLVH 2GAZB 5ICYA 2DLHA 4CRPA 3BD3A 5IMOA 3LKSA 4JG0L 4PJXA 3RTQD 1JN6A 3CLEL 4PJ7B 2HWZH 3FFCE 3GMMB 4Y4HC 2XZCL 5F7MC 3LQMA 4RBPH 2VYRE 3TT3H 2NLJA 4AENB 3DVGB 4I4WA 3KPLA 3K81A 3VXMD 4QRQB 3JTTA 3VXTA 4Q0XL 4XMPH 3TYFA 3VA2C 2CDGB 3H9SB 5MEOB 5TFSH 4M7JH 3SDCA 5EBWB 4X9HA 1A9BA 1U3YA 3RZCD 5M7QA 3V0VA 5J3HD 5E8OB 1K4CB 5E6IA 1D5ZB 1IL1A 4WW2A 4HUKB 4P46C 1MEXL 4Z7WB 5I6XC 2APVA 1LO3L 3LS5L 1FRGL 5E2WH 1F90H 4KGLA 1W0WB 1UCBL 1LEIA 4AIOA 1AQKH 1JFQL 1T0NA 2AEPH 1BQHA 4RFEB 5E70A 5C9JA 2X4NA 4C56E 1KPRB 4P3DA 4WI6A 1JUFB 2NY0C 2YD3A 2HT3D 1I1YA 3F58L 3CC5A 3FAXA 3QXUA 5DEGB 3RVVD 5HYJE 3JUYA 2JJUA 5IW1B 3RU8L 3B9KB 4IRZH 5I8CA 4HS8L 5E00A 1YPZB 4UT6H 4UOW1 1CDUA 1HSAB 4ELME 4ZFZA 4K2UH 3V5DB 4I0KA 2QQLL 4R97C 1NMAH 4M7LL 3TBVA 4PJXF 1PGRB 4GXVL 2E5EA 4PJ7E 4JHZA 4I48B 2MQCA 3DOSA 4ISVA 4WWKC 2GITA 5T1LA 2NXYD 2R0WL 5TE7H 3K8MA 1Q0YH 1AGCA 4PRHB 3ILPB 2P5WA 1P4BL 1U3HB 4HJJL 5ALBL 4PJ5A 2MKWA 3JVGA 5LGJA 4UOW0 4NRXA 4XNYL 4TUKL 5ESQA 1CFTB 3H9SE 4I3RH 2WV3A 3KJ6H 4XNZB 2GJ6D 2EC8A 4YHPA 2CQVA 4YDKH 1EFXA 3L7FB 1YEIL 1FJ1B 3LOWA 3JWOL 3HZKA 5CINL 1U95B 4LNRB 3C9NB 4WHTA 3STBA 4N0RA 2AERT 3PL6C 1J05B 4N8PA 4Z7WE 5ANME 1GGTA 1HINH 2MMXA 4BSWA 1E6OL 1G7LA 3Q2CA 2V5YA 3I3DA 3RGHA 3Q0HA 4CMHB 2EH8L 4BSJA 3QPQD 3HZYB 1I9IL 3NZ8A 4FFVC 3OMZA 5IB1A 2NX5B 3QPXL 3H9ZA 3RY4A 2J7LA 3MOAH 2WY3A 1W0YT 3SKNB 4XPFL 1MCOL 1KLGA 3UXFA 3VFPB 2NY7H 2E7BA 2WIIB 1D5XB 1PYWA 2X6MA 1JGUL 5CSZA 2ESVA 3DNKA 5D96C 1LVEA 4MLSA 3MBEB 4P4KB 1YPZE 2DMBA 2OLDA 1MNUH 3LPFA 4Z95L 1I9RH 1LD9A 3MUY1 2IBGA 5HD8C 3QXVA 3O3EA 4ZFOA 4TPRH 5DD3H 4X0KA 4YDIH 3BKYL 4BQ8A 5DVMA 1DSFH 4YE4H 5K9QI 3BPNB 1I3RA 5D7JD 4IEFB 5DTFB 5DD1L 3DXAB 3VFWA 4PRHE 2JIXA 4OM1H 2WUBL 5DUPL 4LCCB 1VESA 1I7TA 4I77L 2H1PH 4YHKL 3RJDA 3ZT5A 3MNWA 4M6AA 1KJMA 2XRAL 4YXHL 2BNQA 2GJ6A 1ZT7A 2WQ8A 5DZNA 1HNFA 1KB5H 1F6FB 4G9FD 4JPVH 2EDDA 5LCVL 3GI8H 5BRZA 2QLVB 2XT1B 1HH6B 5I1HH 2R2CA 3BKJL 2YK1L 2C3VB 3GGWA 1PX4A 4A6YA 4Q9CA 4KKCC 1YY9D 3HMXL 3GM0A 4KVCL 1FZOB 1YYML 4GW1A 2P8MB 2AK4D 4OIIL 4JPKH 5AZEH 2VN4A 4NQED 3GMNA 3KPPA 3S88L 2ADJA 4LHUD 4YAQB 4POYA 4RNRB 1TQBB 2EC9U 1RUAH 3BJLA 4AM0A 3SE3C 1IAII 4RA3A 4MNGA 4RGOL 1JPGA 3HZMA 4K07A 3RWCB 1MPAH 3LAFA 1S78C 5D7KD 4NO0D 2J6EL 3NA9H 4APQB 3WNPA 2ATKB 2HFFA 4XCCH 3UYRL 5JOFA 5DZLA 2ZUVA 5B8CA 2VIRA 1A5FL 1CFVH 4YEEA 5DQDL 2DQTL 3L3IA 2MHAA 3FONA 4Y5VA 5SWSA 2IANB 1EJ6A 3EOTH 2Q3ZA 4JFDA 3IDXL 4PS4L 4OZHA 3QI9C 4NRYA 4UTAL 3DURB 5FGRA 1IEBB 5GSRA 4HFWB 4JY5L 3T65A 3CFBB 4HUXB 4HJGA 1X5HA 2E9BA 4AEIL 2IPUK 3QFJD 2H2SD 3ULVH 2RFXB 5HHPB 3U4EB 5BS0A 3ZDZF 4M93C 3O6FA 1T20A 1W72A 2IH1B 1DQJB 5IVZB 2EYTA 2GJZB 5EC1A 5L8KB 2FCBA 1FV1B 3D85A 4RIRA 4QNPE 4WDIB 3ZDYE 4XC3L 3FO0L 1F45A 4JFQA 4KUCF 1DANT 3FOMB 3Q6GH 4I13B 4B7IA 1CICB 3CFKA 1J1OH 4GG8B 4P57B 3QNXB 1JFMA 4HLJA 4D0DA 3GNML 4P5TC 3RVWC 4LLDB 1LHZA 3MBXL 1BD2B 1BF2A 2W59A 1ZANH 4HF5H 4HT1H 4H0IA 4WCYH 5DLMH 3DTXA 2HFTA 2HVJA 1JK8B 3CFEA 4EUPH 3NAAH 2VQUA 1HQ4B 5K9QG 1M6OA 2ZP0T 3SDDA 4DKFL 3UTOA 5C08E 1EEYB 4BFEA 1ETZA 4ETQA 1GZQB 4ZFGL 1OGAB 4FTVB 1NCBH 2RBLA 4UIKH 4WFEE 2GHWB 4LLQB 4K94H 4OKVA 4PTUA 3X11B 4P3CH 2JB5H 1G7HB 3DV4B 3ARVA 4WUUA 1QPXA 1BBJA 2EDQA 2DQHL 3DHMA 2MCG1 5E99L 3G9AB 4GSDH 25C8L 2IANE 2ARJB 2X1PA 3S9DB 1MCIA 1HYSC 4OZHF 1IM9D 4K23H 2Z8WC 1ZV5A 2NCMA 1UH2A 4FXKA 3TVMB 2VDKL 4IDJH 1PY4A 4ONGL 3CFDB 4HUUA 5JO5A 1EXUB 2V2TB 1F42A 5GRVK 3QUZC 4BZ2H 8FABA 2ITCA 4NRZA 2X7LA 2N4IA 1PSKH 2HYMA 3OKEA 1F6LL 2Y72A 4OLYL 1S7UA 5IFHL 1U58B 1BHGA 5D4QA 2BNUB 4XPTL 2P5ED 2ZUSA 4ZAKB 3SBWC 5IESL 1LNUB 4FQCH 5E56A 5GS2H 3SQOH 3HCVA 2R69L 4YUEH 1KEGH 5A43C 3MA7A 3IXAA 2VXQL 2RCSL 3DGGB 5F7LB 2F19H 1S7TA 1XR8B 1S3KH 1CGXA 1E28A 4KI5F 3CSYB 4IHOB 4ODUA 4NPYB 4P9ML 1T4KA 4OCYL 4FQXD 1A6ZB 4P99A 4OGXL 3NFSH 2FHFA 1XR9A 4L3AA 4PG9A 3ARGB 4M6NH 1XIWA 1AQDA 1NBVH 4FTVE 2C3GA 3Q3GA 2ARJQ 1JWSB 3Q6FA 1JYNA 5I16A 3O4LD 1GZPA 3T0EC 5JXAH 2X4RB 2R0KH 5HVHB 1EX0A 4WO4C 3OGOE 3MGOB 3N1FC 1A8JH 1QSFD 3CMOL 3ROOB 3UJJL 4TTGA 2H26A 5DWUL 4ZUSA 4AJ0A 5FYJH 4HV8B 3BQUC 4D9RE 3HB3D 2Q7NA 3HI5L 5HHMB 5JR1L 4NQSB 2C3WA 3OAZH 4X4MA 5E6YA 4EOWH 2AK1H 4W4NA 3BP7B 2VQTA 1NL0L 2BSRA 4DN4L 1GGBL 1XAUA 4L29B 1N0XL 1LO2L 5J9PB 3VRLE 4V3EB 3JWDC 3E3QA 1L0QA 3ECBB 3ES6A 3TYGL 2X10A 3RTQC 4GKOA 3VG9B 3VXNB 3BPOC 4U4BA 4H8WC 4GRWH 3MRIB 1CS6A 4WHCA 5IMLB 1KENH 1RIVL 1Z2KA 3D39B 3GKWH 3BAEH 1BQLH 4XWGL 5T1MB 3NPZB 3KPMB 5DJCA 1WIOA 2OBGA 3X3FH 3GSWA 4QRRA 4XPGL 2HAZA 4F7EA 4D9QE 3TBWA 3CLFH 3GJFK 3MRLA 3SE4A 3WDIA 1U8MB 5DJ2A 1I1FA 1BOGB 1JIBA 1DBMH 3RZCC 1VEOA 5J3HC 1CLZL 3D2UB 4UZGA 5K9JH 5F96L 5FOJA 5C0GA 5IVOA 4KHTH 1FQ9C 2AQ2A 1NGYB 1HDMA 4AIZB 4RFNB 3OR7B 3ULSA 2V2XB 3MRJB 3E6FB 3QUXC 4C83B 3V5HB 4G42A 2W0LA 3RWDB 3C2AH 4EI5A 5LAXB 4ZQKB 2FD6L 1JF1B 3U7YH 3FAWA 4OFYD 3I2CH 2ZZUT 3PE9A 4PLNC 3HS0B 4Y5YA 2R2EA 3RPKA 4ZYKA 5HGGS 1QSFA 3P77B 5F7DB 1YECH 2KPNA 1NEZG 4BFIB 3ULVD 3RVVC 1Y0LA 2B0SH 5HHME 4LPWA 3QEGL 3PHOA 2IH3A 3FT4B 4B53A 2EH7L 3BVNB 1QFPA 4QLRA 4BZ1L 4I0CC 1FNLA 2DQUL 2R8SH 2OP4L 2QJDA 5EZIL 4LGPB 5EFIA 3BT2H 4QCIA 1S7RB 2FGWH 3ELAT 2NW2A 5EO0A 3X14A 3AAZA 1SM3H 3NACL 2WANA 5T1KB 3HN3A 2NXYC 4JFEB 5IF0B 1KELH 1S9YB 1AO7B 3RZWA 2V5TA 1TIUA 4IMKC 4DGIL 5FKPA 1IGYA 2W60A 5T33L 5KSBA 2FJFA 3F12B 4OF3A 3QXWA 4NWUH 5IROC 3SCMD 4ODTH 2RAMA 3QHZH 4KRNA 3GSVB 3QUYD 3ARFB 4NQCA 3TBYB 3IDYC 1BLNB 2AJZA 2NY5L 3C60D 3EYSH 3QJFB 2Y7QB 1S7VA 4GW5A 3HFMH 1ZA6A 4NP4H 1UACL 5K59F 5H2BA 2D7MA 1KJ2B 2VLKA 4X6CA 5ITFA 2V9TA 3QAZB 4HKJB 5C7XH 1ZTXL 4PJAA 4KJYA 4DW2H 3WCYA 3KLDA 3BP6A 3CXHK 3S35L 5JDJA 5GRVL 3T3PF 5LWYH 4KK6C 4XBEH 1K6QL 4R8WH 5C0BE 3QQ4B 3VFMB 5F3HB 5DR5L 3RUGA 4OD3H 5GS1C 3RNQA 5C2BL 1BFOA 4OJFH 2K7QA 3PV7A 5H35A 1A3LL 3TA3C 3VXRD 4HFUL 4U6HA 1IBGH 3H2WA 3BRGC 1PKQA 1V8HA 1KB9K 1RIHL 3HE6A 3PGCA 3MV7D 1I7RA 1JPFA 1A6PA 1K2DA 4ODXA 4YK4C 1QBLH 2D7NA 1A47A 4FQLL 4LCWE 2A2QT 4NZDA 5GQBA 4WW1B 5KBNC 2PXYB 5C2UB 2Y5EA 1A1OB 3T2NL 4U6VL 3GHBL 1T22A 2DBLL 1AXTL 4OFDA 1Q1JH 1EH9A 3NIDF 2AJYH 4LLWA 5T3ZE 4JFEE 2FZ3A 4M5YH 3N1QC 1AO7E 4RDQG 2P48B 5DJ6B 2CXKA 1DVFD 1LP9B 5KSBF 3VG0L 3B4NA 1TCMA 4EUPA 4MJ5A 5FFLA 3D69A 4O2CB 4GLRI 1OLLA 4XNXL 5AWNH 3WUZA 2R1YB 2OJZH 3CIQA 5F89A 3CZJA 4OBSA 3HC3H 2FGZA 4YO0A 5KJRL 2VDOL 2H2PD 4PFEA 3I50L 1OT1A 3DRTB 1F8TL 4Q2ZB 2ZPKL 3GK8H 1QRNB 3VXUA 3K8KA 2BC4B 5I75B 5EZLB 1KB9J 2KBGA 1HEZB 3MV8A 5I15L 1JPTH 1U0QA 3FO2A 5MENA 5EIIA 1T66D 4TSCL 1CK0L 5D1XD 4HH9B 2JJVA 2X4OB 4NBXB 1EO8L 4R4ND 1FNGB 5D70L 2X70B 1VGEL 3C5ZA 1D5IH 4RISL 4O5LL 2CUMA 3VXRA 5IB2B 1XF3B 1AD9B 1HHGB 4LLYA 2DL9A 3T09A 4I3SL 3WS3B 2EE2A 1AIFB 4DVRL 1BEYH 3O45B 3QJHB 3OKOA 5MHSD 3FQWA 4P59H 2FNBA 4JM2A 1NDMB 2R39A 1IRAY 4PJ8A 3K2MC 4PLOB 5FYKL 5KSVA 5AZ2H 2FEEL 4YHZH 1I8LA 4Z76B 3HUJA 5EU4A 4FQHB 3UZEA 4MCYB 3RAJH 1LP9E 4QTIH 5L88L 3GMOB 4OZIF 2XV6B 4CU8A 1HCFX 4PRPA 3TZVB 5C86A 1B6UA 4QOKD 4MXQA 5KSUB 3FB6A 5FDWA 3OKKA 1WEJH 4LKXB 3L3HA 1MY7A 3EYQD 5ADOH 4MVBC 4HKBA 2MPAL 5FK9A 4JG1L 1P6AB 4LARL 2VERN 4Y16D 2XN9B 3EGSB 1QRNE 2X89D 4PB0H 1B2WL 3ZTJG 4NN5C 5I1JH 4JAMA 2N56A 3RL1B 2UVEA 5INDB 1E4WH 5F1OB 3RKDD 1JZ3A 1MWAL 2D7TL 4HKZA 4TUOB 5KVDL 4YXLL 2EIBA 5I1EH 2E7LC 4PGCA 2J8UA 3V6OA 5HPOA 1ZLUK 1VADA 5L2KB 5DJ0A 1EIBA 5HGDB 4GXUN 2DQGH 1MF2H 4M5ZL 4XP9L 5EU3B 4JEGB 5F1KC 3KNBA 4L9LA 6FABL 2VXSL 1DUYA 1FZMB 1NC4D 2RGSA 3G6AA 5I66A 4Y4KD 5ISZA 2CKBL 3U79A 4NKMA 4JM2F 3HPLA 1DJSA 3ARWA 4UIMA 5DMKA 4Y1AD 4OCRL 3DX6A 1ZS8B 2CGRH 3H3KA 1LILA 1ZGLA 3VMOA 3HUJF 3V6ZB 1UM6L 3A6CH 5M95B 5J11B 3DMMB 5F7WC 5LBSH 3T0XA 1FVCA 4F7CB 3ARBA 2MFNA 4HMCA 4NBYB 4MCZB 3T1WA 4X7TB 1AY1H 5J8OA 4V3DB 1JI1A 4UQ2A 3SGKC 1IGJB 4GMSL 2D3VA 2OXHA 1OP5K 4WHYH 2JJTA 2PR4L 1MUJA 4K9EL 1OPGL 5D2LB 5D2NA 4XMLH 35C8L 2IMNA 2UUDH 2XACC 4KK9C 1U8HB 1E4XI 2X89A 1P2CA 3I6LD 3E8UH 3UZQA 1DQQB 2RR3A 5DMGD 5JOPD 3TNMB 5T5NG 2YXFA 2FL5B 3W9DB 2B2XL 4TRPH 2XQYG 2J8UF 5LGHL 1EA9C 2B20A 2CIKB 2F5AH 2VN7A 4FQXC 5L2KE 2UY7A 3VRJB 1KULA 1PVHA 4UTBL 5EO1B 5HBBA 1G0YR 3ARQA 4PRNA 3N9GH 3KHOA 1YMMB 3QWQB 5D1ZA 5F44A 2YWYA 1OD7A 3VU2A 2YPKA 1F90L 4AEHH 4NKOB 1MHCB 4Y4HB 4UOJA 5D1QD 3EYUL 1ZHLA 3DYOA 4AMKL 2EEDA 1YEGL 4P2RE 1AGBA 1DE4B 4MLIA 4QRSA 3SDXA 1H3TA 1VA9A 1DDHA 1HQRB 2CJUL 3ZE0E 4NCC1 4MJIE 5DC4B 2VAAA 3HB3C 3L7EB 5I8KH 1CT8A 3O3DA 4N0CA 4N1HB 4WFFE 1HOCB 3U1SL 1DLHA 1WFOA 2GY7B 3IXTB 2AXGB 2YEZA 3FKUS 4P46B 4OAWB 5E6ZA 3CH1B 3NGBC 4OF7A 2XWJB 4NNXA 1KCUH 5ICZA 1C12B 5JOEA 1LO4L 4YBLC 3G5ZB 1XZ0B 4QT5B 2BCKB 3BIKB 3PHSA 3VH8B 1TLKA 1TZHB 4JFXB 4OCLC 5D2LE 3FL7A 1ZA3A 2C1PB 3IDIB 2H9GA 1KXQE 2C1OA 4O00A 2HH0L 3REVB 5BO1H 2NY0B 2XFXA 2OI9C 2OTWA 1L0XA 3GSQB 1GXEA 1FL6A 2VRAA 2ED9A 4QXTB 5B38G 3C8DA 3MRRB 1RY7B 4Z7UA 1SBSL 1D6EA 3LEYL 4PDCE 3V4PH 5GS0L 3FQUB 4WJ5B 1MI5D 4R97B 2IBBA 4R90H 3FMGH 2XWBA 1I3GH 1FG2B 1RMFL 3J8F7 1P1ZA 2OR8A 3ZHDA 1REIA 1R3HB 4LLMB 3BEVA 2E8YA 5C0IA 4IRSA 4AL8L 2IQAA 3V5KA 1J1XL 1GSMA 2I60L 5IK3B 1RJZA 1NMBL 3LN4B 3HAEB 4HJ0D 4PRBA 3SDXF 3ZKNC 4HKXA 2JF1A 2FWOB 5DURD 4PV8A 1RFDL 4QHKI 1GGIH 5EORL 3PDOB 4BH7B 1X5LA 1U41A 5T1DH 3MNZB 1EZVY 2AABH 3PL6B 4QO1A 1W0VA 4CVZA 5CIPB 4LDEB 3U4AA 1R0AL 2C26A 3TNNB 2ICCA 1NCWH 5EZOL 1DBKL 3EO0B 1P4IL 5IJVB 1CD8A 1A6TA 3BHBB 4M43H 1KJVA 1G9NL 4KRMB 2I9LA 4X4YA 5I73C 3QEUA 4W68A 1G84A 1UWGL 4U1HB 3MXVH 4KJWC 2F15A 1RZFH 3IU3B 2P45B 2AGJL 2V6HA 5BOZG 1VDGA 5GSVB 3VXSD 5D96B 1MCWW 3VWJD 1K8DB 5DI8A 2OMBA 4YFLI 3ULUH 3MMEA 3QFDB 4Z7UF 5BXFA 5ADPH 2FECI 3DO3A 4ZSOE 3IFLH 4LSRH 4P5MA 3BN9D 4M1CC 3FB5A 2OCFD 1MI5A 4HMEA 4HQQL 1MFBL 3GI9H 3VFSB 2MTPA 1SY6A 1Y18B 5EU6D 1FH5H 4EDWL 2ZOKB 2PF6A 3JV0A 1UG9A 3OX8A 3KPNB 4H26B 1KYOJ 3OKNB 1KNOA 1UA6L 1ZLWK 2QQKL 4FNLL 1NPUA 2BY3A 5FCSH 4O2FB 2DIJA 2QADD 4G7YL 3S4SA 1H3XA 3MRNB 2Q8BL 1JYXA 1B6DA 4JGJA 1VFBB 1T83C 4ORZC 3SOBH 2RIKA 5DRWB 1T7ZA 1NGWB 5JIKA 1YZZA 3FOLB 4EN3D 2X9YA 4MA7L 2BNRA 5TGBB 3U2SB 5E8PA 3JWOC 3CFIC 3QDGE 3MACL 4QRUB 3ZYIA 1A4KA 3QWOA 1KPUB 4MJ2A 3NN8B 2W9DH 4HWZB 4L4TD 3LN5B 4LBEB 4X98B 4C54A 3DVNA 3S7GA 3QG6B 3IFPB 4XMKH 5E9DE 2OK0L 3QO1A 3GMRB 3LKOB 4XPBH 4YBHA 1KTLA 4N68A 1AGEB 4RGND 5JA8B 1ZLSH 2H41A 4Y4FA 5IEKA 1LE5B 2OMNA 5DO2C 1CFBA 1SYVB 2VITB 1DN0A 2CLZA 1Y6MR 3ETBF 4JFZL 1FYHB 2BP3A 2F54B 3NIGF 3CAFA 1MSPA 3NIFE 3UP1A 4W6YB 2WMPA 1FIGL 3MRQB 4HG4K 2IPKB 3GO1H 2F9BT 5E0QA 3UAJD 4QHNB 5C07A 1HIMH 4ZDHB 1PEZA 3VD3A 5DQJB 1FYTA 5EU6A 4AEFA 3DO7A 4HUWB 5DJXA 5IFAL 5EC2B 2A6JA 1T66C 3QI9B 3ZHKA 1XCQA 2XPGA 1CGYA 5F21B 4K7PY 3KLAB 4OD1H 4HAFA 2Q8AL 3P4OB 5FO8B 1IQDA 2AQ3A 2HRPH 4W81A 2E27L 3HI1A 3U4BH 4YH6A 1I7UB 1DFBL 3FB8A 2R1XB 3TO4A 4P5KB 3VCLB 4WI8A 4U2ZA 4G5ZH 2R4RL 3EFFA 2AEIT 4LPVA 4ZO7A 2VDRH 2FB4H 4PY8I 3IKKA 3HE7D 1F3DJ 2Z91A 4UILL 3HNVL 3U7AA 4O02H 4M3JA 4PUBL 1KN2L 1V3KA 2E8ZA 1U8OB 4P5TB 3OJVC 5GJTH 4RRPG 4R0LA 4CGTA 5CAYB 4PBXA 1R5VA 4NKQB 4U7KA 4HG4J 2F5BL 1CBVH 2EC9T 2DJ4A 1T03L 1FFPB 1GL4B 3I02B 3VI3F 1GGYA 1QBBA 2AEQH 1E4KC 4KDWA 2GK0B 3OWEA 3QZWA 2Q7YB 4R6UA 4NSKB 5JORA 1MVUA 3GSRA 4XNUL 3O6LH 4LRIA 1NLBH 2F54E 2JCCB 1UKQA 2X4QB 4HIXL 3S5LG 3MROB 5L7XL 5FHBL 3HPJB 1EHAA 4LIQL 5FEBA 1NBZA 4GMTH 4KUCD 2WBKA 4K71C 1GOHA 1BECA 2IFFH 5J6HA 2PNDA 1J87A 2UYLB 3UTSA 5FYKD 4DKAA 5LVEA 3QUZB 2BSED 2VABB 4HHAB 3G6JB 5I2IA 1RZ8A 3LEXB 3L1OH 1NCCL 1EAPA 4HBCH 3ARRA 4NHCH 1OTUC 1KG0A 2J5LB 3C6SA 4N8CH 5C0DB 4Q9RL 3LQAL 1FFOA 3MUHL 2AJXL 1GH7A 1JWMB 2W9EL 5EA0H 3SKUD 3RY6C 5KS9B 3MODH 3O3AB 1Q9LB 4RA0C 4Y4KC 3ZE2E 3WE6A 4EQ2A 2R2HA 3BPCB 1WJ3A 3SJVD 1TJGH 3CVIL 4QY8B 3HE7A 3B3IB 5C0AA 4P2QA 1ND0B 4GKZA 1DQDL 3MNVA 4OM0L 4ACPA 4L8CA 3V8CA 1QBMH 2GCYA 4PJFB 4PRID 4R2GD 5C3TA 3ULUD 3S96B 3G04A 2CLVA 4KKLD 3E6HA 4UDUB 3PWPE 2V5SA 3VGFA 3NOIA 3TJHC 4IOSD 3SE9L 1RZGB 5EBGA 2EO1A 2WBJA 1F11B 4PLJC 1K85A 4EBQH 4QXGL 4CVXB 4X99A 2APWA 2JCCE 1YEDB 2XI9A 5T3XE 3BE1H 3LY6A 5ERWB 3KYKL 3PXJA 4M62H 1A7QL 5T5FL 3WO4B 5I1LB 4JQVA 3T0EB 2X4PA 3LV3A 4KV5E 4KAQH 5C09D 2YUWA 5F9JB 1NGPL 3P11L 1FAIH 4LSTH 5F88B 3G5XA 1AJ7H 3BQUB 5DMGC 1BZQK 2GEEA 3U46A 5A3ID 1C5CL 1ZVSA 2OL3B 4XAKD 3IF1A 4H25B 4OLXL 2FLRT 1GAFL 3B5HA 5FO9A 5FUOL 3G6JE 4LLUA 4JN2A 1NGZB 4NNPL 5CBAB 1OSZA 3RTQB 1G9EA 3HR5B 1L4IA 1DBAH 3BPOB 1ZAGA 4YGVB 4D3CL 5D1QC 2XKUA 4GKNA 1SJEA 1HILA 5JXED 4V1DD 5INCA 1NFDB 4UT9H 5D5MF 3WNKA 1XT5A 3PV6B 4P4RA 3D0VB 3H3PL 3BMVA 3T1FB 3F7PC 5IHZB 3X3GL 1RPQA 1GGUA 1IGTB 5JHDE 1ORSB 3CX5J 1XH3B 4ZOCA 1BVLA 4NGHL 4OKDA 4LLVA 2XICA 3RZCB 1U8KA 3CXDH 2L0DA 2WK2A 2EDNA 1SVZA 3ARDD 4AK1A 1GRWA 3HLAB 3V95A 3FFCD 2I9TB 4PD4K 4PJDB 4IJ3B 3QUXB 3H0TB 5IB5B 4P23A 3T0EE 1WWWX 2NY2C 3MOBH 4JO3H 3FO9B 3JSSA 1AR2A 1H3UA 1MCEA 2BVEA 5C09A 5E8NA 4PLKC 5TPWL 3U6RA 3FT3A 3MUGA 2EE6A 4DUXA 2VZTA 1J0YA 4ERSH 5HDBE 1FGVL 5I74B 3PABA 3O41B 1G9MH 3KPSE 2NY1C 4MD4B 1EMTH 4LEOB 5IFJA 3TBSB 1S5IL 4I1NB 4L1DA 1JGDB 1WBZB 4OGYH 3CJJA 5DQ9B 3S34H 1MRCH 2L4OA 3GKZA 2PW1A 3C2SA 2EXWD 3FQNA 4PV9A 1OAKH 4KROD 5GGVL 3SO5A 2GSGA 4PRAB 5DDHA 5DSCA 4PTTB 4ZFFA 4MJ4A 1BFVH 5F1IA 4C56D 2E9JA 2NXYB 1EEUA 4XB8A 3W39A 3VFOB 1NFDE 3KPRB 3CCHB 1HH9B 4V2BA 2F74B 1C1EH 1RZKL 1ITCA 4O4YL 1FVDB 3V6BR 2ICEB 3C08L 4PD4J 5HYJD 4XBPB 4JM4H 1XGPB 4M1DL 1R5IB 1F00I 5HHOA 5ACZA 5HYQA 2ZNWA 3D25A 1C16A 5DD0L 4N8VG 4X6FB 4NCC2 3IDYB 2FBJL 2YMXH 4Z0XA 1RULH 4JQXC 3V52H 3ORJA 4H20L 2A9NH 5GS0D 3ARDA 2Z0BA 2O61B 1YMHA 4JN1L 2ADFL 1BVKA 3IU4H 3IAPA 2J4WL 4PJDE 1OP3H 4EKXA 3RFZC 3BUYB 3HG1A 1MOEA 5HYSA 4BK5A 4K3EL 4LSQL 4W70A 5IHUL 4F9LC 4S10A 1QSZA 3TCXA 5BZWB 5F1NB 1A6VL 1A7PL 3T8XA 1M71A 1AC6A 5K9KB 1BJ1J 5TDNB 5GS1B 2FX8L 5HPMB 1BP3B 4QTHB 3D18B 1FO0B 5GJSL 1ZLVK 3TA3B 1FLRH 1WFNA 4OB5L 3EOAB 1N59B 2XOTA 4WHDA 4Y2DA 1UB5A 1IAKB 1UFUA 2HT2C 3RJQB 4N0YH 3NABH 1CFQA 3QNZB 3SDCC 2YPLB 4POUB 2OJZL 3CFCH 3FRPG 5DRNA 5E2TL 5FOBA 5F9WC 2GUOA 4PJGF 1UWXK 5EPMA 1P53A 2R56L 2BSSB 3TF7A 2VAJA 2AVGA 1HXMB 5D7JB 4GT7A 4XGZB 5LQBL 5DHVA 2XZQL 3KPRE 4BSVB 1CG9B 4PP2A 4JKPL 2H8PA 5IG7A 1CGWA 3LMJL 4ZXBA 2QADC 5B3JE 3BSZL 4U1MA 1PG7X 1J9CT 4LU5H 5I76B 3IGAB 1S5HB 4QRPA 1DQMH 1R3KA 4BQ9A 4NCDA 4EN3C 3VE0A 2FJHA 2FX9H 4G9FB 4ELMA 3UTTB 5BVPL 4YDLC 4JZJA 3P2TA 5KW9H 3IAGC 2J12B 1KFAH 2NY5C 4IM8A 2FIKB 5BW7C 2XNAB 1F02I 4B41A 4R96B 4D0CB 1VFAB 1MCDA 3GMMA 3QIWD 2OJEB 1RVFH 2AK4B 5CP3H 1SY6L 1P9MC 4PRHD 3V0WL 3CDGA 3D87B 3DVGA 4LHUB 4AENA 4D94A 2V7HB 1BAFL 1JGLL 4QRQA 3MLWL 1EHLH 4P2YA 4RGNC 1QFWH 3M1BB 4I8DA 4ZG1A 2D7PA 2CDGA 4LNVA 2EIZA 3CZFB 3H9SA 4N0UB 4QTIL 3W2DH 4EI6B 5MEOA 3P30H 3JVGC 4MA8L 5BMFL 4IRJD 1SYSB 5EBWA 5E2VH 4X5WB 5E8OA 3HNSL 1EBPA 2YPLE 1HKLL 1EDQA 4JFHE 3VFUB 3OV6A 1TITA 2YUVA 2HVKB 1FL5B 4Z7VF 1R3LA 2BVPB 3DJ9A 3UAJC 1NCDH 1W0WA 2BJMH 3P0VL 4TSBH 3MLUH 4XAWH 5CWSB 1T2QL 1AGDA 1F6AB 5MP6H 2IWGA 5CJOH 4RFEA 5DUML 5C6TL 3QB7C 5DT1H 3MGTB 3Q1SL 1RUPH 2OR9H 4LPCA 4G6KL 1JUFA 1F4HA 4OLZH 4MXWH 3WJJC 2Z92B 2G2RA 1OB1B 5M94B 5I30H 1DR9A 2J88L 1RHHB 3Q5TA 1IC7H 3QFJB 2A73A 2V5MA 4L4VA 5DA0B 5DEGA 3MBED 2OXGA 5IW1A 2ATPB 1WAAA 3B9KA 2FSEB 2HKHH 1YPZA 3C8HA 1OP9A 4R3SB 1G6RB 2DD8L 1HSAA 4RMVA 2GIYA 3UTTE 4CUCA 3L3DB 1A7NH 2BRRH 1FNHA 4RDQF 1OW0A 5BOPA 3NZHL 4S11A 1JGVL 5EZJB 4ZMAT 2F58L 2VL5B 2XKNB 2VH5H 4P9HL 2PTUA 4I48A 4NN5B 3NCJH 3BGFC 4MWFB 2AK4E 4YXKH 5IOPB 3BRFA 4KXZI 5BZDB 4KVNH 1CVSC 5D6DC 1KLFA 4HGWA 3BGMB 4PRHA 2BVUA 3ZTNH 3M17A 1U3HA 2OSLB 3TO2B 1FGNH 3K8LA 2W91A 1CFTA 4N0UE 4Z8FL 1JZ6A 3OF6D 4J3WA 4S1SH 1JNLL 3WFHB 1T3FB 2I26N 4XCNB 3L7FA 4Z7OE 3MLXL 2XXMB 2YD4A 5I1CH 4R4FH 4LNRA 4HIJB 3C9NA 3A0OA 3H9YA 1R5WB 3IETB 3KR3H 4ODSL 1NCAH 4NFDA 1X5XA 2DYPA 2DOCA 4ZUVB 2X4UB 5E5MB 5FUZL 4MXVF 3F7VB 1A1NB 4PJEF 2EYRB 3EFDH 3HZYA 1HHJB 2WUCH 4FXLA 4JHAL 3VGBA 2NX5A 3SN6N 4LVNC 2HFEB 1IM9B 1WGOA 1ZXQA 2FHBA 4HWEL 1MAML 3SKNA 3O2WH 4Y19B 4DFHA 2O5XH 4KTEH 3VFPA 1GIGH 3QFJE 5CEYB 5TF1L 2WIIA 1D5XA 2Y07L 1WAAF 4M7KL 3ZO0A 2WINB 4BELD 1EV2E 1CDGA 3MBEA 5C08D 1WZKA 4P4KA 4APQD 4ZTPH 5SWQA 1J12A 2GTWB 4JLRB 4WFED 1ZHBB 4YX2L 4YHNB 2X4TB 2P5EB 4QHUB 5F7NC 2VZVA 4P2CG 3LHPH 4JDZA 4NIKB 1GC1H 5HGHB 1U8QB 2NW3B 5CGMA 1D7FA 1KCRH 4YHOH 5B8CC 2AV1B 1L7TL 5HI4C 5DTFA 1JTPA 3DXAA 1G7QB 1QSVA 4LP4A 4JY6A 4LCCA 1CF8L 3L3KB 4WEMB 4QXUH 5IQ9B 2E7LE 5GRXG 2FX7L 4FP8L 4TOYL 1LMKA 3QQ3B 1RZIB 5B4MC 5IW6B 4FQXB 1EGJH 1V7ML 1BX2A 1UM4H 5C0RH 5J12C 3RL2B 5KVFL 2PO6D 2CK0H 1EUUA 4IOFC 3O6FC 4XP4L 1H3PH 3O4LB 3OKLB 5H37H 3T3MF 1HH6A 4S2SB 1F4WL 3LPWA 2LAGB 3SDAA 2C3VA 3ZKMC 1WICA 2BOBB 1GHFH 2A74B 3WNMA 3UJTH 2P8MA 3EJZC 1QKZH 5T3ZH 1N0LA 3WL9B 4U1IB 4YAQA 4YBQD 1KN4H 1QUNA 5J56B 2YPVH 1MFAL 4Y19E 3FJTA 3S36X 1WBYB 4OT1L 1IAIL 2KQNA 3B6SB 3FZUD 3LRHA 2C4FU 4GOSA 3D3VE 3RWCA 3NGBB 5JQHC 5E8DH 4KI5C 4FTVD 1T7YA 5TQ2L 4LF3B 3BD4A 5FV1L 4LSSH 5A2LH 3SDDC 1QHPA 2ATKA 4I2XE 4F57L 2LTQC 1YN6B 2J8OA 2Z8SA 4K3DL 3O2DH 5JXEC 1KJ2H 2MKLC 4K9EC 1MQKH 5CP7B 5CZVH 3SE8H 3BDXA 3MUJA 2IANA 4OLWL 2OI9B 4OUOA 3ILQD 3MLYL 1JTTA 2VR4A 5DJZB 5FYLE 1QLEH 4AEEA 2B1HH 3DURA 1F2QA 1TZGL 4HFWA 3OXSB 5GRJL 3CFBA 3SGEI 4HUXA 4WFGE 1UZ6F 3BKCL 4KKBD 1ACYL 2CDEB 1UXSA 2RFXA 4YIQB 3U4EA 5HHPA 2CH8A 1EHXA 4F7TB 2IH1A 2HFGL 1DQJA 5IVZA 1N6QL 4X6EB 5T5NF 1PZ5A 3O4LE 1D9KD 2G9HB 3LB6C 3P3YA 5KVGH 3U30B 5J1AB 4NFCA 4BYHA 4WDIA 1QO3B 4OF0A 1CICA 1NUGA 1YYLL 2AJUL 4GG8A 3QNXA 4NBZB 4D9QD 1I1CA 2G5RA 3L5XL 4O51B 4OZFG 4MNHB 4LLDA 5SWZA 5IEHB 1I8KB 2OR7A 1BD2A 1EERB 1JGEB 5AEAA 2V9QA 2VR5A 1JK8A 3GHEH 4E41B 2HA1A 1HQ4A 3ARGD 3F8UB 3VMPA 5B39G 2V2WA 1EEYA 3MXWL 4Z7QF 1EVUA 1LO0L 1OGAA 4FTVA 5SX5K 5DD6B 5D72H 4NDMB 3DI2B 4LLQA 2MQ3A 1KXTB 1XIWC 3X11A 4J2XA 5E5RB 2Y6SD 1G7HA 1S7QB 3ZE1E 4LVHC 4LAQH 4XVJL 5I73B 1UKSA 1RHFA 2HLAB 1GGCH 1EBAA 4D2NA 2ARJA 1N4XH 3LZFH 2E6PA 5JHLH 3SCMB 1S7WB 4D0BB 2XIDA 3VXOB 5F3BB 4FFZL 1CU4L 3DSNA 4FFYH 3TVMA 3BH8A 1EXUA 1FAKT 5EUOF 2V2TA 5FIEA 4U1LB 5HDQL 5ID0B 3B9DA 1D6VH 3ARZA 2P8PB 5D7LB 1U58A 2VKWA 4JFOB 2DQFB 2BNUA 5F8QC 4ZAKA 4KY1L 2A77H 1LNUA 1FDLL 3A6BL 3B9EA 5GRUH 5HI3D 1WFUA 1FCCA 3WFDL 1G0XA 5DVLA 4O9HL 3KGRA 4HGMA 1KC5L 1IC4L 2FJGB 2IALA 1BQHG 5CSGA 5CLWA 3NH7H 2JELL 1B88A 1PKOA 2OX5A 5FGBC 3PP3K 1XR8A 4HUVB 2CO7B 3MV7B 4NJ9H 3DX9B 3CSYA 4IHOA 5EBMA 3SE4C 4NPYA 4E41E 1A6ZA 1KEMH 4MX7A 3EDFA 1JPSH 2RHEA 4KTDH 4AIXA 2EDBA 1TVBB 1AI1L 4XP5L 1J1PL 1R3JB 2YKLL 3QYCA 3HRZB 1LDPL 3EOBB 4DTGH 2X4RA 3IDMA 4KDVA 5C0BD 5IT2H 4EDXB 1ZGLM 3MGOA 4NZJA 5CHNB 4FABH 3F6LA 3ROOA 1G9NC 1AKJB 1P5VA 1DVFB 5ESAB 2QQNH 1T21B 5TJWK 4Y5YC 1PEWA 1RZJH 1KBGH 4HV8A 4PJIE 5HHMA 4NQSA 3K46A 1ZEAL 2YZ8A 3KYOB 2VXUH 3BP7A 3HTLX 3IDGA 4LCWD 4L29A 1P7QD 1EVTC 5J9PA 4PJCA 2JLLA 4YHIA 5AD0B 3ECBA 2W9LA 4P2OD 5E2UH 1I9JL 3VRIB 2IBZY 2LABA 5KVEH 3VXNA 4MD5B 5D7LE 5I8OL 1FVEB 1F4YL 5T1KD 4N90E 2EECA 4JFED 3UYOD 3MRIA 5IMLA 5IVXB 1FFQA 3D39A 3KPMA 3ZYOA 3BZ4B 2ADGB 2VE6B 4YQXH 1T5XB 5FF6B 2CSPA 3VD4A 4YZFE 2XZAH 4PRDB 3OKYA 1M05B 4KU1A 4P48A 4IRJC 3L5HA 1AR1D 1U8MA 3ARFD 5KSAA 2B1AL 3EZ8A 4PP1D 3D2UA 1RSFA 3O3BB 1ZVHA 1N2RB 3BW9B 4LOUC 3ME0A 3EOYG 1WITA 5C8JB 3MREB 1QFUH 3QCVL 4LRNH 1MIML 3OR7A 4QRTB 5DC0A 5EOTB 1CL7I 3LEVH 1OQXA 2L7JA 3V5HA 4C83A 4XZUB 4BH8A 5LAXA 4JFPB 4WV1C 3MCLH 5ESVA 4UNVA 4X7CC 2D0HA 4M3KB 3PQYB 5CJ8A 4ZUUB 1BZ7B 3HS0A 1T04B 4GQ9L 4HCRH 1Q94B 4YHML 4Y5XB 4FQ2H 4RZCA 1QR1B 5HXMA 4FQJL 2A6IA 3MR9B 2DLFH 1EGJA 1YQVL 4K8RL 5CMAB 5GGUB 4M1GL 4QOKB 1WIUA 3FT4A 5FCUH 1UZ8B 2VDNL 4LSUL 4BK4A 4OZGE 5LXGH 4PJCF 1Z9MA 1ZMYA 2PETA 1LQSR 5L9DL 4YWGH 1S7RA 3DUUB 4POZD 5C1MB 1KCVL 1IGFH 5T1KA 3UJIH 4JFEA 4K71B 5IF0A 4F7MB 3V6FB 1A7OL 1S9YA 2CMRL 4XCFL 1AO7A 4G8GE 3L3JA 4JPIB 1MJ8H 2EIDA 4FZEL 4TUJB 3PJSA 4HPOH 3TH4T 4Z7OF 4Q9QH 5DGQA 1PG7W 5JQ6L 4J4PD 5E08H 3F12A 4M6ML 5DJDB 2F53A 3DVIA 3I6GB 3GSVA 2DWDB 2VDLH 3FT2B 2B4CL 2XWTB 3ARFA 5KOVC 1FPTH 3DYPA 3WXVL 2QR0A 3TBYA 3SGJA 1BLNA 3QJFA 4PYHA 1NC2D 5JZ7D 4JCMA 3V4VL 3P73B 4PJBF 4C57C 1NC4B 3O2DA 4Y4KB 4TSAL 4E0RB 2IAMD 5MHSE 4QWWD 4L5FL 1A6UL 1FSKC 1H5BC 4K94C 1SJVA 1D5BB 4LCIL 4Y1AB 5HHVL 1INQB 1QNZH 1PQZB 4ODBD 4WUKH 3PQYE 5DMIL 4S1QH 3X13B 2EKSB 4NM4H 3QQ4A 3VFMA 1NFIB 3WD5H 4DCQB 3VWKD 5LJYH 4D9LH 1RJLB 2G75B 3MRHB 1RUKL 5D6CB 1ADQH 2Q1EA 5E4IA 3CH8A 4CNIB 3PIQB 1PG7L 1UYWH 3GRWL 4YFLF 5JPMA 1G6VK 1Q72L 1A0QL 1I3UA 4WI3A 1CGVA 3ZYJA 4KK8C 1N64L 3KLHC 1J8HE 1PW3A 2AI0L 2R2BB 4HC1H 1U8PB 4QEGA 5C9KA 1Q0XL 3C5ZC 5I1GL 3U9PH 5EIQA 1XGQB 1JL8A 3G5VA 3VGAC 1D5MB 1CD9B 4WW1A 3VFGL 4HS3A 4G3YH 1I85C 2PXYA 4ZD3H 1BFSA 1A1OA 4I0PD 5FECB 4GG6F 43CAB 3HKFA 4JM2C 5JUEL 4PJ8C 1NBYB 5IKCB 5DK0B 1PLGH 3HAEH 3P9MB 15C8L 2PTTB 5JW3H 3RA7H 5KG9B 5DJ6A 1OWRM 1I8LC 2P8LB 4X80H 4XX1G 4O2EB 1OSPL 2UZYB 2ZCHH 3WUWB 1TJIH 3HMWL 3TZVD 2A9MH 1FLTX 2LU4A 2CRYA 3QDMD 2R0ZL 4O2CA 2PO6C 3RBGA 2R1YA 3OAUH 1I7ZA 2A6DB 3LQAC 4EIGB 1K5NB 1YY8A 5D1QB 3IVKB 5CIPH 3U0TB 4ZOEA 3ZDXF 3TLRA 4Q2ZA 1QRNA 4W6XB 2BC4A 4Y1AE 3PGDB 4FQIL 5EZLA 1NAML 4NT6B 2G5BB 3UCRA 1RK0B 4LASH 3KS0J 1RUQH 2VO5A 5IJKA 5ILTL 3QISA 4HH9A 1B4JH 1KIPB 3VI4F 5L2KD 5ECJE 1FNGA 4U6XA 2X70A 2RQ8A 2LVEA 3F7YB 5IB2A 2Z31D 3QUML 4BM7A 1XF3A 1HHGA 1TZIA 4NM8H 1TETL 2BDNH 5DEFB 3PUCA 1AIFA 3CNKA 3QULB 4NZRL 1A02N 1G7JB 3QJHA 4X7SL 4P2RD 5I18L 4LCYA 4HSQA 4RWHA 4NUGL 1CXKA 4MJID 5I1IH 3TPUE 3UBXB 6CGTA 3ILQC 4RMSA 5JOPE 4Z76A 3IRZA 4FQHA 3N1MC 3GUTA 2DWEB 3GMOA 3LKQB 3BJ91 3MLSH 3BYYA 3ARBC 2W65B 1Z3GH 1R6VA 3O2VL 4ODHL 5KSUA 4I5BB 4G80A 5F7EL 1YEFH 3GIZL 4LKXA 4KRPC 2D03H 4XTRC 3SKOB 3BI9X 4NYLB 2XN9A 3HC4L 1DQLH 3EGSA 3S37H 3RL1A 1RIUH 1UB6B 2A38A 1BM3H 1WVZA 4TUOA 1WF5A 9CGTA 3UPRB 2LVCA 2BOCA 2DTML 1IAOB 5EUKB 1CDBA