4PV9A

Crystal structure of h2kb-q600v complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
277
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural and functional correlates of enhanced antiviral immunity generated by heteroclitic CD8 T cell epitopes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 277
sequence length 278
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pv9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pv9A01
4NHCL 4RRPG 5JXEA 3I2CH 4LVNC 4NKDA 1GC1C 3RRQA 3C2SA 4Q0XH 3RWEB 5IEKB 2X44D 1L0QA 3PF2A 4U0RB 3BXNA 3GEWB 1V7NH 4LSPL 4ZTPH 5HYJE 5I66B 3F6LA 4YR6B 3S96A 4LLVB 1KYOK 4IIQB 4O5LL 2HVKB 4LNRA 1DCLA 4D0DA 4X7CC 3KPTA 1HH6A 1MHHA 2X2YA 3REWA 3G5VA 3RZCD 1DFBH 2V5TA 2XFXA 5BZDA 4OLWH 4S1RL 1KTDB 7CGTA 4NRXB 1CL7L 2NR6C 2CR3A 3BZ4A 3FHAA 5D1XC 4Z7QF 32C2A 2A9MH 3GMRB 5DD1L 2GJ6A 4DOHE 4L8CA 1SYVB 3LH2H 5AZEH 1A7OL 4NSKA 5E2WH 1GRWA 1XZ0B 3U2SA 2YPVH 2J4WL 1JZ3A 2P7TA 5C0BA 1INDL 4TSAH 4R90H 4KQ4L 4MJ2A 3WHXA 3C60B 1IKFL 4LCWB 2E7BA 5FOJA 3K46A 3SKMA 1CLYH 4KKNA 5IB3B 3KLAB 4JG1L 4GRLD 4H26A 4Y19E 3B43A 4JGUA 2W65B 3MRLA 1R5WA 4ODUA 5B3JE 5K9KB 3CSYA 3F12A 4KK5C 4JPVL 2J6EA 4YFLF 1T66D 5EDXA 4HWZB 4NBYB 5A2JH 4UOW1 4OD1L 1VFMA 3VXMB 1YA5A 5I16A 5DFVD 2GYSA 1WV7T 2OL3L 2NY6C 1AKJD 3B83A 3CXDH 3I6LE 1CBVL 5CEZD 3D2UA 1F11A 4K8RH 1VSCA 1P9MC 1KPRB 2BVPB 4OM0L 4LQ1A 2FECL 3UTPD 1OF2A 2CUMA 5ESAB 2V5RA 1U93B 1CD0A 3U1SL 1A7NH 4I3GA 4KJQD 5H37H 1ZT1B 2X1OA 3F8UB 3HNSL 4Q2ZA 5GZNC 4PJFF 2CLRB 4YK4C 1RVFL 4JZJA 3MROB 4LCUA 1F3JA 4JFFA 4P2RE 1F3DJ 4NZTH 1M71A 5MENB 3IFLL 2D3VA 3PP4H 4JRYD 4ZFZA 3TYGH 1CGYA 2R4SL 4JN1H 25C8L 2Y5TB 5FKPB 3UC0L 3G5ZB 4EDXB 1EGJH 1Q38A 2Q7NA 4LARH 4C83B 1EXUA 4YHLH 3BP4B 5GGTL 2P8LB 2EO1A 3QUXC 3GDBA 1A4JB 4IMLB 1NDGA 3OTTA 3RWFB 4NO2A 1MOEA 2JB5H 1MQKL 3RVVC 1UB5A 3MREB 5EU3A 3NAAL 5IG7B 1IBGL 2H2PD 3NFSH 4ZTOH 3QXDA 3UZQA 4PJ9B 1AHWC 4LLAA 1MPAH 4YHNA 1BQLL 4M6OL 4KZDH 5C70A 1F90H 2F54D 5DF0A 5JR1L 4CVZA 2WNGA 5KVEL 4P2QA 5KN5B 3ULUL 1IGTA 2VAAA 1KGCD 1TZIA 3JTSB 2HMID 4P4KD 1ACZA 2R56L 1M1SA 2FHFA 4X8JB 1MFAH 1C12A 4M1DL 4PJDE 4PJEB 4U6TA 4HBQA 1U42A 3JV4A 4P5MA 3G9VA 2O5XL 1Z3GH 3RVWC 2XWTA 4FQXC 2ZUSA 3BIAX 2PW1B 3O8XB 3IS1X 4LLWB 2DD8L 5JHDE 5F89A 1JYWA 1S8DA 3VFGH 5MEPA 4NKIH 3LKQA 2FX9L 3QEGL 2IJ0C 3RWCB 1T5WB 4WFFD 1SBSH 3TBTA 4YHZL 4QCIA 4V1DE 3E2HB 4XMKH 5TDNB 3NA4A 5TJWK 4P59H 1OTUC 1LO0H 3AY4C 3PWNB 3B6SA 3EOTH 1BD2D 4Z8FL 5D1ZA 3MX0A 5C0FA 5FIEA 2VZ1A 4UQ3A 3WS6C 3JBG7 1JHLL 1KUMA 2FGWH 1A1NA 2JJTA 1MCDA 4JFQA 4WV1B 2GY7B 4MS8D 5F1SA 1HHGB 5BZWB 3C5SB 4QWWD 1PLGL 5I73C 2VXSH 3H9SA 4FTVD 1BFVH 4HH9A 2XXCB 1ND0B 5F8QC 5DJAB 4NQDA 4AH2B 4R26H 4M02A 5I1KH 1P4BL 3U30B 1QFUL 4XWGL 3D6GA 3GBMH 2VLKD 3UJIH 2F74B 5CGTA 4N9GB 3QI9A 1KV3A 3E0GA 1P4LB 3BN9C 5F9JB 2MPAL 4I4WA 4JG0L 3KPQA 3HZKB 5C2UB 2F15A 2DQGL 3BPLB 4F7MB 1DANU 1MI5D 1LP9E 3DV6A 5TPWH 2XKNB 2O93L 3UP1A 3S6CA 2W0FB 3HE6D 1X5IA 1G6RH 4MVBA 3ARQA 1WAAE 3CUPB 2Q86B 1ERNA 4F15C 1EZVY 4XVSH 3GNMH 4WVRA 4I8DA 2NXYD 4ALAH 5A3ID 3SDDC 2A6KB 2CIIA 1OWRM 2VWEE 4WTWA 1NMCC 2DWEB 2WW8A 1N7ML 1DLFL 3VGDA 3WNOA 4O2CB 3L1OL 4S1QH 5DHVB 5SWQA 3WSQL 4CU8A 2E9JA 2AS5M 4Q6IA 4XZUA 2D03H 1C7TA 1IC1A 1TCMA 4N0FA 3LIZH 3C5ZA 5HYJB 1ZLUH 4ZPVB 3MRPA 4JLRB 2DM4A 4XVUC 4RBPH 5DVLA 1QZ1A 1T22B 3UTTE 4GXVH 1UQSA 5EBMB 1EAJA 3GIVB 1S9WB 5DQ9B 4WW1A 3O4LA 4QT5A 5FGCB 4HF5L 4AY0A 4F33B 1MAKA 4J6RL 4MA3A 4WY7L 3VXTB 1LE9A 5L0QB 4XH2A 5D70L 3DMMB 3FO1A 4GRLA 2F5BL 4Z7WE 5BV7B 3DO3A 3WE6A 3IU4H 5TF0A 1UYWL 2XPGA 2V2TB 3QIWD 1OAZH 4GH7B 2OJEB 1DSFL 1O5DT 2F53E 3TFKC 3WN5C 4FFYH 4F9LA 5D5ME 1B3JA 4X98B 3U0TA 1YY9C 1JN6A 4FNLH 4LGRB 4U6HB 4YDLC 2H32B 4HKZA 4XCFH 1AKJA 4MQXD 3OAUL 8CGTA 4KK8D 4QTIL 4JDTL 4XNUL 4L4VD 4LSVL 4MJ4A 5E03A 1N8ZB 3TF7C 1TCRA 3H9HA 3MZTA 1RI8A 2Z31D 3ARXA 4K94L 5K33A 4PJIE 5FYJD 1XT5A 4JANA 4EI5A 3TO4B 4GKZA 1FE8L 3OXRA 4Z7OE 4PJ5D 4TULL 5HHVH 2NY5L 5IW6B 1JFMA 1OSPL 1SY6H 2FBJH 4HC1H 4KGLA 4HKXB 4M7JH 4X80L 5IP4A 2CDEA 1MJUL 3BP5A 4MX7B 1OM3H 5DXWA 3GSVA 2DQIH 4F37F 2DKSA 1JFQL 1K4CA 3NCCB 2DYPD 4TUOB 4JRYA 1J8HA 4OD3L 4NZUL 4L8SC 3RGVC 1NCNA 4OFYD 4WHCA 5C0RH 2MHAB 1EEZA 1ZVYA 4M3KB 2BVEA 2DN7A 3U9PH 3ZE2E 2IQAA 2EXYC 5EOCJ 3MBXH 3TT3L 5BVJB 5GRVL 1T21B 3OAYH 4MJ5B 4WWKC 1EUUA 3QZWG 4U3CA 4A2MA 2SEBA 3RWIB 2VO5A 5BVPL 1HWHB 3O3EB 1ZGLB 2HJFB 1A3LH 4JZNA 1HXMA 3RVXD 3N1MC 1NANI 4HUKB 1EO8H 2AQ3A 1P53A 1CLCA 5CJOH 2NY7H 3CZFB 2H41A 4HQQH 2F54A 4B41A 4P2RB 5D9SB 4RFNB 3PABA 1C7SA 3CFBB 3LN9A 3QNYA 3DIFA 4Z0BH 3RX8A 2ICCA 4IEFB 2E7LC 4LBEB 4P4KA 4I77L 5EOQH 2ARJB 1C5BH 1MCOH 3OHXA 1UM4L 4X4XB 1TVBA 5DLML 3L3DA 1KJ3H 1MY5A 2PETA 4XGZA 4O02H 3VWJB 2M1KA 3CK0H 3QIBA 1F8TL 2VABB 2LFGA 3RTQB 4N0YH 5K93A 1CG9A 4RWHA 1BLNB 2UZXB 4KMTH 2Q8BL 4FG6C 1H3GA 4N90E 5DFTA 4HULB 3B9KB 1FNGA 1HHIB 3CVHB 3U82B 4HWEH 4LF3A 1WTGT 2ZCLH 5GS1B 1LD9A 2KH2B 1JRHH 2R2EA 4XC3H 1TFHA 5HJ3A 3V4VL 3TPUE 2UV3A 2AJZA 1NUNB 5HGAB 5BJTA 3K81A 2YRPA 5A16A 3IDJB 3FO0H 2EYSA 1VADA 4PJDB 4NC2B 1VPOH 1ORQA 4MA1B 5TF1L 1BD2A 4O2EA 5DT1L 5C3LD 3MLYH 3C8HA 3MRDA 4RSVA 4UILH 3GO1L 4PREA 1GC1H 1AO7E 3MJ7B 3O2DH 3WO4C 1HHJA 3MRKB 2DLGA 3V0VB 4F8TA 1MCSA 5HTSA 5HI3D 3X14B 4RNRB 1AD9A 3KPNA 2FJHB 1HK6A 5DA0B 5I1DA 4TPRH 5JHDB 4Q9RL 2HYMA 1EHLL 1MH5A 4XP6H 4LHJB 2NLJB 3EDDA 4CL7A 1Z6JT 5IV2A 1HH9B 1KIPA 4FTVA 4LSQL 2KDGA 2VERN 3MV7D 4I5BA 4V1DB 5DI8B 3TZVB 3VH8A 3U6RB 2YKLL 2ZJSH 4PY8I 3O11B 3P9WB 3AREB 4XPBH 2X9WA 5DUBB 2GFBA 4WUUA 5E70A 4YIQB 5IBUB 2VMFA 5HY9A 4UTAH 2R2HA 1DDHA 1F4YH 1OGAD 2GAZB 4WEBL 2NPLX 3FTGB 5CHNB 1CXKA 1H8OA 3LKOB 4WTXA 2HN7B 2XRAH 3BDBA 2CRZA 3L3JB 2FZ3A 3HE6A 5CEXB 2FIKB 4X6CA 4QEGA 4RMUA 1GZQA 1WGOA 1W2KT 4PJAF 1RIHH 3PWPD 1VENA 1F00I 1MJJB 4IJ3C 1OW0C 3RPIA 1I8LC 3TC9A 1R5IB 1MCIA 3QCTH 4KVCL 1TQCB 3W39B 3P3YA 1QSZA 2YPLE 1WCQA 3GGWB 4D9RE 4JFHE 4NZRL 2CPCA 2VR5A 1IC7H 2PYEE 4YDIL 5MERB 1OTTC 3JUYA 3KPPB 5AZ2H 3C08L 4EUPA 1LP9B 4Q9QH 5I76B 2ITCA 4UNUA 1DQDH 2ZZUT 1S7SB 5C2BL 2XOTA 1LK3L 1V7MH 5ISZE 4WFGD 3H3KA 5DEGB 4LPCA 1LK2A 4P2OD 2HJLA 1ITCA 4WO4A 2X7LB 3PWLA 1CFTB 3QDJD 3MA7B 3EYUL 1RUQL 5DZOA 1YMHB 4XPFH 4XCYA 5FHAH 3H3PL 4UOW0 5H2BB 5I0ZA 1JGUH 1D6VL 1KPUB 4XVJH 2VSCA 4RGMB 4Y4FA 3WUWB 4HSQA 4Y2OA 3AU1A 5A1AA 2Q20A 3OKKA 3UTTB 4DKAA 4CU7A 4G6JL 4JFEE 4NO5A 1XF5B 3ZKNC 3DXAD 4PRPD 4XC1H 3EO0A 3LY6A 2PTTA 5EUKA 4L4VA 4LIQH 3CFKA 4HX1A 2GY5A 4O5LH 4Z7QE 3GMPB 1RHHA 1ZOXA 1ADQL 1DVFC 4DGIL 3IJYA 5DO2C 5J57B 1WCBB 3ECBB 1EDQA 2XWBA 4U1MA 4PD4J 4Z7WB 4N68A 1CU4L 2NY1C 4PJ5A 1KJVB 4OFVA 4JFDD 3WD5H 3D85B 1JI1A 2R29L 4KJPC 3MLSL 5E8OB 2F53B 2DYPA 4F8QA 4IRSB 4PLJD 4P2CG 5D5MB 1ZHLA 3Q5TA 1NDMA 3BH8A 5T3ZL 2FYYA 1FNSH 1CDJA 1R24A 1JGVL 4M00A 3WO3B 4L3ED 5IVOA 2NY3B 4X6DA 2Q7YA 1II4E 3J8F7 3VG9B 4N8PA 1Y6KR 5BO1H 1P1ZA 2DTML 4PJIB 2EDLA 3DUSA 4S11A 3O6FB 2BVOB 4GMTL 3ESVF 3MPCA 3K1DA 3OKDA 1OP9A 4X5XA 5DEFA 4POZC 3C09C 3K4ZA 3QO0B 1FYTE 4ONFH 1FNFA 1HYSC 4AEFA 2VXTL 2WZPD 2BRRH 3NIFF 4HIIB 4HH8A 2FX8H 1R3HA 1HDMB 4ISVA 4GW1B 4EDWL 5J12B 3MBED 3F7VB 1B88A 1JV5A 3G6JA 4I0PB 2AJ3A 1I3RA 4JPIB 5I18H 2WWMC 1JZ4A 3RUGA 4Z6AT 5E08H 3FB8A 4N0UE 4TRPH 2FEDC 1D5XB 5E2UH 3MXVL 4XBGA 3QEQE 1HILA 1CBVH 1YYLH 4PJFE 1A02N 1WT5C 4LRIC 1DBKL 3VFUB 2B2XL 3WUZA 1I7RB 1IGCH 3QH3A 2HFEA 3E3QC 1FO0H 4LLDA 1IEBB 3R06B 5CBEB 1WUNT 2W07A 1F6LL 3DVFA 5L2JB 3BH9A 4OZIA 1A22B 3W0WB 1JPFB 1RVFH 2YWYA 3OL2A 1R5VA 4HIJB 3E8UL 4JAMA 2CDFB 3IVKB 1MVUA 1NPUA 5JOFA 3RHWF 1I9JH 4I3RH 4OIBA 3SCMD 3FT4A 3L5WA 4P23C 3UC0H 2VQTA 1X44A 5LGJB 3IXTB 3SGEH 1U8OA 1NFDA 1N5AA 2ZOKB 5F71A 3CFCL 3QWOB 1WC7A 2H8PB 5GGTH 1AY1H 4MDIA 3SN6N 1T2JA 1A2YA 3H3BC 1CFQB 3RJQB 4M93B 2W9LA 1OQOA 3MV7A 5IHZA 1Q0YH 2A83B 3T65B 3IFPB 3NAAH 3AB0C 1FG9C 2DQEL 3FZUD 3MLWL 4W6WB 5I1EL 5KS9A 2VZVA 1DE4B 5CAYB 3TA3C 3QUML 4MA7L 5J1AA 5LVEA 1CICB 2Z93A 4LCYA 5IMMB 1OGAA 3DGGA 2C1OB 3SDAC 1AO7B 4EN3A 3WDIA 4R4NC 5C09E 2R56H 4MAYB 4ZS7L 5DJZA 4XPHH 1L7TH 2EIEA 4U1SB 4OLZL 3FOMB 4L3CA 2O5XH 1WTLA 3UX9B 1AFVH 1U91B 1A1MB 4YHOH 5KANI 4IRJB 1INQA 3NGBC 3NH7H 3HR5A 3PWPA 4ONHA 2D9CA 4GW5B 5I74C 3T2NH 4L1HA 3SEPA 1KN4L 3SGJC 1UCBH 3QUYD 3OJ2C 3UCRA 3LSOB 3QEGH 3QFDB 2OJZH 4HKJB 5C0CD 2YXMA 1RUKH 3H42H 4YHZH 1BF2A 2H26B 5I1LB 3QWRD 1CLZH 1ZXQA 5EN2B 1GH7A 4XCNA 1RURL 4UT9L 3FB5B 4NQTA 2BZDA 1NEZB 2VDKL 3F7QA 4ODTH 3WJJA 1TVHB 2X09A 3GMQA 4FFZH 3KXFE 4BH8B 5L8KB 1EH9A 3MODL 4GOSA 4LSTL 2HAZA 3MJ9A 4YDKL 1KELL 1HSBB 1VGKA 3KYNB 4QHKI 1V5JA 4OZFA 2IFFL 4UDTA 5I30H 4P2OA 1WWCA 3DETD 3WL9B 3RDTC 4PJBE 4YXHL 2GSGB 3NFPA 4HGWA 5J6GB 4RFOL 2OTPA 3MRIB 3ROLB 2V2XA 3EOAB 4FHBD 3HE7D 4KK9D 5ICZB 4U7KA 3V4UL 1FFNB 2D0GA 1J0KA 2YPLB 5JORB 5IJKA 5EC1A 1QRKA 2PYEB 1CF8H 3MRBA 1G6RB 3T0EC 4XWGH 4UIMB 4XNXL 4YDVB 5B3NA 5DGRA 3HLAA 4XAWL 2HFGH 5D96B 4Y8DC 5ISZB 3BQUA 4UV7H 3WFHB 3RVUD 4JPKL 1JUFA 2UVEA 4H8WC 1KSRA 3EFFA 3QDME 5E0QA 1EHXA 1NCCL 1A7RH 4ETQB 3SOBH 1KTLB 3AFLA 4OV5A 4CDGC 3QYCA 3CXHK 3DUUB 3LS5H 4GG8A 3QUZA 4FQ1H 3VFNA 3VXRD 2VXVH 2MQCA 4MQSB 3P4LA 4B53A 3FT3A 4JFDA 9CGTA 2PR4H 1FDLL 1I3VA 3MRJA 5DJCA 4V3DB 4N9OB 5KBNC 4XVTL 2C26A 4BFEA 1PY9A 5MI0C 5FOBB 2FIRT 2OBGA 2NW3B 1KCSL 5HGGS 4E41A 4LIQE 2WQRA 3EYQD 1E4KA 4L3EA 5BXFA 4HUVB 2J12B 4HS8H 1U8IB 4LKCB 4KKCD 1MIEL 4Y2DD 5E6YA 3K74B 5ID1B 4NN5C 2D31B 4R7DA 3QHZL 5I6XB 1T89C 2LE9A 2W92A 1ORSB 5I8EA 5JLZA 4D2NA 4MSWB 1FORH 2BOCB 3EO1A 1S9VB 5DQJB 1INEL 4P46C 1RZIB 1UJ3B 3DSFL 4WY7H 4XTRD 3TJHD 1PYWB 1ZMYA 2DRUA 4CUCA 3VE0A 1FCGA 3LD8C 5BW7C 1BAFL 2XYCA 4NQED 2GUOA 1E4XH 1BGXL 1P7QB 2OXHA 3QG7H 4KY1L 2VN4A 1BBJB 2AXFB 3HB3C 5JDSB 4OLUL 4LU5L 5JO5B 4FQ2H 3VGBA 4ZOAA 4R7NB 4HS6A 1UEYA 3VXNB 1I1AB 4JDZA 5KZCB 4GS7B 3Q2CA 2YD6A 3HMXH 5IFAL 4FQHA 1S7TB 4JM2B 1FJ1B 4M62H 4JN2A 2VR4A 2MQ0A 4JDTH 1F2XK 3C6LA 4Y4KD 3SDXF 4LSVH 2G60L 4MQTB 2Q3AA 2IH3B 5INCB 4I2XE 2HKHH 4DFHA 1FYTB 1KCVL 2MCG1 2RCSL 3I85A 3SO3B 3VXOA 3WFEL 5J9PA 1A3RH 5IROA 2XICA 1FE8H 4OD2A 3BEVA 3HR6A 4NC0B 3S88L 3G6AA 1IJ9A 1H5BA 1NLDL 1QQDB 5IKCA 5L88L 5SX4H 1U8PB 4MNGE 2WINB 1U8JA 4J8RA 4N0UB 3ARDD 3IDNA 4LASL 4MCZB 4OD3H 3RY5A 3TNNA 4ZFGL 3QEQB 3IDGA 4PJFB 3HZMA 3FONB 3PE9A 1OSZB 3UTQB 2YK1L 3TT3H 1BEYH 2Q76A 5IVXF 1HXYB 1S9KC 2YUVA 4KDWA 1D5MB 4PJXA 2P49B 1CR9H 2AAVA 2X4PA 1P7KA 1QRND 4TVPL 4MXVE 1Z9MA 3PGDB 1Y0LB 1YUHA 2GK0B 1KN2L 4PJ7F 5BRZD 1AXSB 1UZ6F 4M6NL 3NA9L 1XIWB 5D7LE 4YBLC 5D2LB 5HGDA 1JGDB 2Y06L 4OCXH 4NRZA 5JXEC 1YEIL 1KLGA 5C0JA 5IK3A 1FFOA 4JO3L 1WZKA 1WIOA 2NY4D 2X5PA 5FYKL 3RL2A 4JFPA 4X99A 3GRWH 1UM4H 5DD6A 5T5FL 5GGVY 2R23A 5DJXA 1NAMH 5HI4D 5E5MB 5TGBB 2CSPA 3AS1A 2DQHL 4JHWH 3FRPG 3JWDL 2DQFB 2ATKA 5MP6H 1WBZB 5DRNB 1JTPA 1YMMD 3V5DB 4G6MH 2XN9B 4NO3A 4WHYH 2Q8BH 3VFWA 1P84J 1D5BB 4ZNCD 3T3MF 3U9UB 3QUYA 4LVNB 4H88H 3IDMB 2ORBH 3LKSB 5C0CA 4RQQA 4HK3N 3C8KA 1C5CL 1UH4A 4H1LG 4GG6E 3V4VH 4BJLA 5C09B 3WFBH 3O3DA 4KHTL 5IMLA 3ZYOA 1T1XA 3QNZA 3RNQB 5TF1H 5DT1H 4PY7B 3VRJB 5ESVA 5EU6E 4ZUUB 3ULVC 2W1NA 2P8MA 3QZWB 5D1XB 4K55A 4BFIA 3W9DA 1UM5H 3F65A 1S3KL 2ZPKL 5JQ6L 1YN7B 3T0WA 4KHXL 3T4AB 1N3NA 4RDQG 3B2UD 4Y16A 1S7WA 1XCTA 3KHOA 3QIUD 3UJTH 1BFOB 3KXFB 1IAKB 3TJEH 4PY8J 4HGMA 4BK5A 5EOCL 5F9AC 2H9GA 3MLVH 3MRGA 3V5KA 4U6YB 4WEBH 1E27B 3AM8A 4PJAE 2VLJE 3HZVB 1MHCB 5MEQB 1J05B 4ZOEA 1UENA 1IVLA 4PIRF 1MCLA 3BISA 3HI6H 1JL8A 2PTVA 2QL1A 4XPGL 4ZXBD 1CN4A 4IOIA 1I1YB 4PJBB 4OQTA 4LHUG 4Y8AA 2QEJA 1WZ1L 3MCLL 2BJML 5HD8C 3GSNL 4DN4L 3VXRA 3QG6B 1LEIB 4TUJA 4ELMF 1ZK9A 2NXZC 3MR9A 4F7CA 5HHOD 3OPZH 4P99A 4JZJC 1TMCB 4ZUSB 4QRTB 1CYGA 1I8KB 4LCIL 1A9BB 3TIEA 1JWMB 4ZD3L 1S7UB 4GAJH 4LSSL 1U8QA 2HFTA 3GI9H 5GRWA 4A6YH 2R1XB 4DFIA 3TNMA 3ETBF 2ZNWA 4OZHA 5EZIL 1TJGL 3U4AA 3QDMB 4R8WH 3D0LA 4XXDB 5K9OA 1DUYA 5E8DL 5E9DD 3TBYB 4V3EB 3JWOL 4XCCH 1G0YR 3EOYG 3JWDC 2UZYB 2E9IA 4NPYA 5E6ID 2HTKC 5JA8B 3VDBA 3OQ3B 2P42B 2XY1A 4OBRA 4TSBL 5CJ5A 3SE9H 4DGYL 2E7LE 3TJHA 5DJ2B 2OM5A 1MFCL 4TTDC 2H3NB 1NGPL 3ZLQC 4JM4H 4NQEA 4YDJA 3R4DA 4G8GE 2EICA 3KPRE 3X12B 4XRCB 3QUXB 4FZEH 1AR1D 3RKPA 1P4IL 5EBGA 1S9YB 12E8L 3A6CH 4MNHA 1J0ZA 1LO4L 4Z0XB 1QFOA 2DM2A 1AHWB 4GKSB 2PW2A 1I8IA 3DBXA 1E4WL 2J5LC 3FMGL 3WFDL 3BIKA 1NUFA 5E2JA 2IPKA 3ZDYF 4Y4KA 4ZOBA 3D3VE 1ADQH 4JHZA 4U49A 3L5IA 1CGSH 1CU4H 2I26N 3X11A 1EMTH 2HG5B 2P5EE 1F13A 4PRNA 4Z7UF 4YGVA 3D39E 4G59A 3HRZA 3VXSE 3QP3A 3STLB 2Z4QB 5HPMB 2EXWD 2GT9B 3MLSH 4FQXB 4X4ZA 3ARDA 2QADC 1FL5A 4HXBL 5D1ZC 5GGVH 5T3ZH 4UT7L 4Z77A 1HQ4B 4DCQA 1JGVH 1YEJL 1BZ7A 2XKSA 2JJTC 5CEZL 4N1CA 4LLUB 3S36H 1BX2A 2AV1A 4NJAH 5GPRA 4I2XB 3JV6B 1RZGA 1VGEL 2NNAA 3OKYA 2IMNA 2DTMH 4MXWL 1KEMH 1M7DB 1KCUL 5TDPB 5I19H 3NIFE 4ERSH 1X5ZA 3ZYZA 3ZDXE 1P5VA 3V5HB 1KYOJ 2W60A 3FQNB 3GKWL 1BFSA 4GBXD 2EYTA 5BRZA 2D0HA 1G7JA 3CFEA 3TEUA 1QSFE 4Y89A 1FC2D 5JPMA 5JIKA 4GKOA 1GGTA 2G9HA 1KJMB 4MNGB 1GVIA 1AP2B 1G9NL 3QI9C 1LHZA 4PRHA 2BRQA 1FG2B 5I73B 1UZ8B 4EDWH 1SJXA 5D1QD 3X3GL 2YRZA 1FO0B 4JY4B 2ENSA 2C3VB 4ORGA 4ZUTB 5MHSD 4Y4HB 5T1KB 5ICYB 1SEBA 1G7LB 3WV0A 2RR3A 1F58L 3FRUB 5SWSE 4RX4D 4MVBC 1A6PA 4PRDA 5I1HL 5GGQH 4X0KB 4QRPB 1DBKH 5EZOL 3Q6FA 2V5YA 1DQJA 3LN5B 1NKRA 1S7QB 4MD0B 4DWHA 2IBZX 2KQNA 3QJHA 1Q8MA 2BHZA 5AWNL 3UTSE 2JIXD 3BWAA 3F5WA 3ILPB 5EU4B 4I48B 5D7LB 4Y5XA 1G7PA 2QR0B 4OCYH 5IB5B 4HHAA 4DN3L 2E6QA 1YEFL 4ONGH 4W4OA 2WBWB 3U7YH 1IC4L 4NQUA 4FOMA 2EC8A 4Q6IC 5KJRL 1XF2B 3X17A 1MLBB 3C5ZC 4UUJA 4F15B 3O6ML 2R0ZH 1FL6A 1AXTH 2IPUG 3QUKA 4UB0H 1ZHKA 3VGAC 4ZFOB 3SDDB 3D0VB 4YAQA 2R1WB 4XAKE 3O41B 4H8WH 5EORL 3VFVA 4G7YH 5FO7A 3QR2A 1GAFH 1NCAH 3QHFH 3ES6B 3T3PF 2BP3A 2BSED 4JGMA 2NTFA 4LCCA 2DDQL 2YD2A 1DN0A 5IJVB 2N56A 3I6KB 3D87B 5L9DL 4XPAL 1YJDC 4GG6B 1U8LA 4GRLC 4JVUA 2DQEH 4UBDD 1WZMA 3V52L 1ONQA 1RIVH 3QUMH 4MWFB 1B0GA 4XP4L 1LDPH 4XMPL 4J3SA 4NM4L 3T2QA 2F19H 4HK0B 3OXSA 3PUCA 1PQZA 4F9LC 1OD9A 2ADIB 5FCUH 4CMMB 5DFVC 3M8OL 5JIPA 3WNNA 1A6TB 1QNZL 3OR7A 4ZS7H 2AV7B 5DYOA 1ZS8B 1T3FB 4HAGA 1GIGL 3MNZA 4ZXBA 4FZ8H 5ILTH 3LZFL 5CZXD 2EDEA 3KG5A 4DUVA 1JWUA 3QQ3B 3P11L 4EI5C 3MRHA 4O4YL 1GPOH 2G5BB 2EIDA 4KJQC 3DHMA 4ZSOA 3WN5B 1JNJA 4FQJH 1GZPB 1KN4H 2BOBB 4G9FE 4Y5YA 2NW2A 5HHOA 3V0WH 5A43C 4YDLB 2FJGA 2ZKHH 4DQOL 2I9LA 1G9NC 1QUNA 1U36A 4KRMB 4ZPTB 2VLJB 1W0WB 1IC5H 2E6PA 1RURH 3HG1D 2VDKH 1RFDL 2AXGB 3FN0L 1AI1L 4RMRA 4S2SB 1I7UA 2XY2A 3BI9X 4J12A 4QGYA 5JTWA 2CKBH 3L7EA 4YHPB 1FYHB 4R96A 5E8EB 2CO7B 4NCC2 4ZNEA 5B39G 5E6IA 3OX8A 1JHKL 1NC4A 1IQDB 1KBGH 4QHKJ 2AABL 2WIMA 4RFOH 1F3DH 4L8SB 1IAIM 4UZGA 3RGVB 4PTTA 2AJVL 2IADA 2EEDA 2OYPA 3UJJL 3D9AH 5DJYB 3WLWC 2K3TA 3GUTA 1BIIB 2DWDA 5I15L 4P4KC 2GJZB 4WWKB 4I3SL 1VACB 2DQUH 1K4DB 3ZT6A 2VIRA 4MLIA 3IDIB 3OKOA 4XP5H 1ODAA 2DLEA 5CINL 3C9NA 1YPZA 1G7MB 3EYOA 1I9IL 4NBXB 3SKNB 3OF6D 2GTWA 2AI0H 3QIBC 3E3QE 3C60D 1CDYA 1ZLUK 1CDBA 2ZG2A 2EDTA 4MB5A 4RBPK 4AIXA 1SBBA 3M1BB 5T33L 2Y25A 4HEPG 2ERJC 5IVZB 3GSUA 1XGTA 3EDJA 3LVEA 5BMFH 2GTZB 3GSQA 2A73A 4H20L 1HHHA 1OCWL 4M48L 1A14L 3MJ8A 1RJZA 1G7HB 4G8GB 3RWJA 5C9KA 1UXWA 2VITA 3BUTA 1CTOA 2B1AL 3OBAA 4BK4A 1QHPA 3VFOB 3MCKB 5IQ9A 4AMKH 5GGRA 3VXMD 1UVQA 3CDGB 4XP9L 2CIKA 1YNKL 4PLNC 4W81A 1MRFL 2CRMA 1RZ8B 2QSCL 4UV4L 1JPTL 1YDPB 4FQQA 4JKPH 1MIEH 3TPKA 3D3VB 1KG0B 4QWWC 4XWOD 5IIEB 5C0EA 4Z5RA 4AQOA 3EDFA 4MQ7A 4HCRA 3S3PA 5FYJL 2X1PA 2P5EB 1NFIB 3D39B 4GBXA 3B3IA 5L2KE 1FSKB 5EO0A 1DL7H 2YS4A 3DSFH 5EC2A 5T3ZE 2V5MA 3WO4B 4ENEC 1U92A 5F7MC 1KNOB 3K8KA 1MCFA 1ZVSA 2CK2A 3L7FB 3S5LG 4QRQB 5JOPD 1NMBH 2IBBA 4QRRE 4Z76A 5E2TH 1LEKA 3SDXE 3T77B 3W5MA 3OGCB 1XH3A 3GIZL 5F3HA 5LJYH 2UYLA 4OZ4A 3CFIC 1IGJA 5KANG 3HC4L 3HE6C 5H35A 4RX4A 3ULVH 1ZA6A 1X6LA 4YHMH 1R3LA 5KSUA 5AYUL 3KPSE 1B0RA 2ITDB 4PJ9D 2X4TB 1U3JA 5IMKA 4HT1H 3OAYK 2NXYC 1QSFB 5HYSA 2BK8A 4LKXB 4QGTA 3O6KL 3BZDA 3V6OA 1EJ6A 1ACYH 5L6YL 5JW5A 1T4KA 1WIPA 5F6IC 1R0AH 3HC3H 5L88H 1NCDL 2E7HA 4DUXA 2J6EH 1MAJA 1YECH 3EOBB 5F7DA 1RD6A 1J7VR 4WI8A 3MJGX 2ADGA 5IGXH 2IAMA 4IJ3B 5SWSB 1FAIL 5FFLA 1B90A 5HGBB 4M4RA 1T7WA 4QXUH 3JTTB 1E6OL 4P3DA 4GO6B 1IKNA 1JF1A 3DROB 3QCVL 2VLMD 1UZ6E 1BP3B 4NUJA 2AGJL 4MXQD 4TTGA 2V9TA 4PB9L 4ZAKD 4U1LB 4WO4C 2P45B 4PJGE 5B8CA 3WNMA 2AXHA 2WWKT 4TNWF 2DQDL 3T0EE 2RJMA 2A2QT 3KNBA 3P4NA 3KYOB 2VH5L 1YEEH 4NP4H 1NAMB 1VKXB 1J10A 3NZ8A 3O3AB 4I0CC 2IEPA 1JK8B 1MELA 4LVEA 3LKRB 3VXUD 4C56E 2V7NB 5GSRA 2I60H 3TCLA 4DKEL 3T04D 4Y4FC 3OGOE 4YHIB 2E27L 4RIRA 4F57H 1D6EB 3SY0B 2NX5E 1YNTA 4JO3H 3X3FL 3CC5B 4HJGB 4HV8B 4EQ3A 1HIML 4LAQL 5T1LB 4N8VA 4KK8C 5ID0A 3P0YL 4I13B 3CLEH 1QFWM 5IOPA 4MD4A 3F58L 3IJHA 3BP6A 4R4BA 3JWDH 3FFCE 2ESVE 3CSPA 2FR4A 4H5SA 5C6TL 2EH7L 2XIDA 35C8L 1R3JB 2Y36H 2AK4E 4WFEE 4LPVA 3VMNA 4HS3B 5JHLH 2XV6B 1DN2A 3WLBA 1A6VH 5IEKA 4S1SL 4WI4A 3HG1A 4JO2L 5F7LB 4YHKH 2E5EA 1RZKC 5DHXB 3X13B 4ZOCA 5CJQL 1DVFB 3UPAA 3AMKA 4GQ9L 1NGWB 5I1JL 2GCYB 5HGHA 2NY1B 1QP1A 2CRYA 4A2LA 1KCRL 5C6PB 2R9HD 2YC1B 2DM7A 3EGSB 4MMZC 4FQIL 3GSOB 5I8CB 5E8PB 5GSVA 1QVOB 2ZPKH 3ZKMC 4HIEA 4ODVL 2VDMH 1YEKL 5SX5H 5ALCH 4ODSH 1CFSA 5HHME 2EIZB 3S37X 1WIUA 1EJOL 1EHAA 3LPFA 1NL0L 4NUGL 2LTQC 3F7YA 4OIAA 4ODHL 3VRIB 1U3HB 4MJIA 1AXIB 1FAKT 4ELME 4IS6A 1WFOA 2FATH 3OF6A 3MJ9L 3WDHA 1ETZB 3C09B 3BX7C 4QHMA 1S7VA 3D18B 5LXGL 4NYLB 2XNAB 5CILH 5IB3A 1RIUH 5I8OH 5LKNA 4X6CF 2VZOA 4DN4H 1AJ7L 4A6YB 3WEXA 4AQ1B 2BVQB 2W65A 2V5SA 4U6XA 1OP5H 1ZHNB 4E5XA 4MB4A 3TP4A 4F7EA 3U46A 5K9KA 5I2IA 3QDAA 4KKBC 3P77B 3RU8H 1IM3B 4Y1AB 15C8L 1NLBH 4FABH 1JTTA 3FO2B 4EXPX 3EJYD 1PSKL 5IFJA 1LEGA 2VZUA 4K7PX 1ZGLM 4JKLA 4AZ8A 4P57B 2XT1B 2WIIB 2BVPA 4XHJC 5HI3C 3FO9B 1TJGH 4D0CB 5IMOA 5F1NB 5E8DH 3AC0A 3KS0H 5ACZB 3TO4D 5CD3B 2AEIT 3F6IA 5C6WH 1ZT1A 3IGAA 5CZVL 2K1MA 3OKNA 4JR9L 2CLRA 3I9GL 1T2XA 4ODWB 2QKIA 5D72L 3ARFA 1X5FA 5I1IL 4G9DB 4JFZL 4P23B 5DRZB 1MFCH 3FCTA 4F3FA 2IQ9H 3K2UH 5FKPA 2Y5TA 3G5ZA 5F9WC 1PX3A 2WUBL 1ROWA 4EN3C 2J88H 3PNWA 2JTDA 2X4QB 5HHXL 3QPQD 2Q6WB 2P8LA 4ZO9A 1JGLL 3C2AL 4OUUB 5I8KL 1RU9H 2B1HH 1JPSL 4CMHC 3AB0B 5CS7A 3RWFA 4HIHB 3BUYB 5LBSH 2AJYL 4LHUB 4O51B 43C9A 5C08D 3TA3B 3L3IB 2FRGP 5IG7A 1AGDB 5HYFA 1R3IL 2DBLH 1PBYA 4ETYA 3HKFA 3B4NA 4JHAH 4YX2L 5L2KB 4PJ9A 4NQCA 3SDAB 1LDSA 1DQLL 2GJ6E 2EE9A 1FIGL 2PCPB 1B6UA 5D6CA 1EVUA 1JGEA 3WCYA 1S7RB 1YJDH 3V7MA 4QRRB 1XGRA 1NJ9B 4PG9A 3JTSA 2VKXA 3SDXB 4G8IA 3FQUB 3WJJC 4G8FB 4M6ML 3ULVE 5C0BE 3NGBB 3TBWA 5JPNB 4AG4L 1GGYA 5F21B 4F37K 3VWJD 5I74B 1J11A 5E94A 5CEYB 4UT7H 3RTQD 5ERWB 2PW1A 2AXJA 5IEHA 5DZLA 4M7LL 1HI6B 4P2OC 3ARRA 4MXQA 3RWCA 5FA3A 3B9KD 4ZAKA 1AGFB 3VGHA 4MZ3A 3PL6D 4K3GA 4HZLB 1T1YA 4MXWH 4X7EC 1RUML 1KCUH 3CIQA 4YUEH 5DDHA 1MAMH 4HIXL 4G6KL 5IJKC 4RWYH 2GITA 5GS0C 2VDQL 5CGMA 3VXUA 1JYXA 2JJVA 3PWNA 1IGFH 4NM8H 2OL3A 4YQXL 1AIFA 3IU3B 1FZKA 1M6OA 5ITFA 3PGCB 2DI7A 4ELKA 4PP2A 3UBXB 1U58B 1LILA 3RDTB 3QA3B 2GIYA 3BQUC 3QXAB 2CJUL 3WFZA 2ZOLB 4QHNB 3G6JF 1PW3A 1DQMH 3LB6D 5JHDD 3RUGF 4WTZA 1CTNA 2MSPA 2P5WE 3GSXB 1HKFA 4W6YB 4PJGB 1F58H 1VFAA 1ND0A 2BDNL 4V1DD 3TZVD 3T0EB 3WHE1 4Q6YA 4NBZB 3MYJA 3CH1B 3QUZC 4AH2A 3ARED 4RAVA 3BWUC 2QQKL 5E7BA 2FB4L 5TFSL 5B38A 2FX7L 4C56B 1JJUA 1ZT4B 4N9GA 3PXHA 3N85L 1CVRA 1CCZA 4JRXB 1XGUB 2V2WA 3LEYL 5DD5H 2VL5A 5IR1B 4BQBA 1K85A 1TITA 2GI7A 1YEFH 4OZIF 3LQZA 2EKSA 5J13C 1MFBH 3LEVL 2DB8A 3T3PE 2XA3A 1U2HA 1MLCB 2PYFB 3EFDH 4BQCA 1QEWB 1WITA 3CUPA 3FFCB 1NFDF 2ESVB 3NPSC 5A2FA 2LAAA 1T7YA 3OJVC 1A9EA 3HAEG 5MI0B 3KWWB 1GGCH 3LS4H 2AK4B 2IPTL 4NQSB 1WK0A 2GSIB 4CNIB 1EBAA 1QLFA 4YXLH 3UTOA 4P2QE 2R69H 2CMRH 4XPAH 1CXEA 1MJ8L 3QDGD 5SWZB 1Q1JL 5KS9F 4NN5B 4ZUVA 5HHNB 1YC7A 2DBJA 3FT2A 4JLRA 2J2ZA 3VU2A 3MRMA 1BJ1H 1T22A 3L95B 4GW4B 4NM4H 2X4RA 2BY0A 4P46B 3M8OH 4LPXA 4OKVB 5FUZH 2A6DB 4F33A 4X7TB 1RK1A 2B7DT 3LD8B 1X6NA 3KDMA 3VXTA 1WWAX 3C6LC 2BSTB 3T0XA 4JFOA 1KIUA 5CJXA 2MJWA 3I02B 4V2BA 2D4DA 5IROC 8FABB 4LSRL 5IB2B 5ADOH 5HBBA 1VFOA 2CKBB 2CUHA 1QKZH 5KAQF 1H5BC 2OJEA 4N0RA 5EO1B 5C0IA 1HZHL 4P3CH 1FGNL 3WXVL 4ELMB 1XF3A 3I6GB 4NNXB 3FN0H 3O3UN 4X6EB 3PWVA 1FV1A 4NN7C 4KKLC 1N2RB 4KI1A 1T5XB 2D7OA 2ZWLT 1F4WH 2HRLA 1MREL 2DIAA 2XTLA 4OQTL 4MDJA 5ETUB 4NQDE 3HCVB 1IGYB 4LRNH 1ED3B 4NWTH 1JHKH 5IF0B 1RZJL 4HKXA 3AS2A 2Q3ZA 1IAMA 3HUJA 4G7VH 3FZUC 4JKKA 2NQCA 3TYFB 4M8QA 3C87A 2F53D 2RFXB 3LKPB 4WFHE 3UJJH 3DRQA 3BRGC 2MHAA 1YEDA 3CPLA 4L8BB 2Z35B 3GHBL 3TWCL 4X9BA 5HYQB 5DWUH 4HUUA 5F1KC 2D2OA 4RMQA 4EUPH 4KQ3L 4LFHD 4MJ5A 4FMKA 5CINH 2AEQL 3HNTL 1PZ5B 1TZHA 4Y7MA 2ATPB 3O6FD 1NSNH 5C08A 4D8PB 2FO4A 4O00A 3ZL4H 3VCLB 2HJFA 3NACH 4QOKA 2CKNA 1FL3A 3C5JB 4OLYH 5T33H 1YEGL 4OI7A 4OJFL 3VFMA 3QUYC 5EUOA 4NKDB 1MCPL 2FD6L 3EW3B 2B39A 1PKQA 4K8RD 3L5HA 4X6FA 5FYLH 2L4OA 1JPGA 4M48H 1KXVC 3VFSB 3BXNB 4XXCA 4PR5A 2ARJA 1DBBH 5DVMA 5FO9B 5HVGB 2YZ8A 3ZZ1A 4I0PD 1T0PB 4BUHA 1OWWA 3U79A 3E6HB 1FRGH 4D0DB 1MHHB 3O4LE 3REWB 2HT2D 4XP9H 3G5VB 4Q9BA 2XFXB 1YNKH 5FGBA 3JWNC 5BZDB 5KG9A 1H3PL 2Z91A 4KKAC 3IDXH 2QSCH 3BZ4B 5FHBH 1G1CA 5GJSH 4M7ZC 3ZMRA 4U1NA 3VD5A 32C2B 3B9KA 3BN3B 3CVHA 3PL6A 4WEUD 1N26A 3TGXA 1CFVH 1KIQB 2GJ6B 2WAHA 4MYWB 4K7FA 4MB3A 4NSKB 5ANMA 5FYJH 5JUEH 1QYGL 1KT2A 4Y16C 3U2SB 2D7MA 2HVJA 3W0WD 3O6LH 5HGAA 3IDJA 2P7TB 1NCWL 2BNQD 3GMOB 4L4TD 4WCYH 3U36A 5C0BB 1CQYA 4NIKB 3S34L 3MJ7A 3INUL 2I9TB 3WHXB 2I5YH 3AM8C 3MRKA 3P30H 7FABH 1RZKH 1IEHA 2FJHA 3SKMB 2AW2A 4N90D 5FUOL 1M05A 2NLJA 3MV11 1BQHA 1FP5A 3BKJH 4H26B 3MNVB 4J3TA 1WQVT 2YD8A 3HC4H 3MRLB 1NH6A 1R5WB 4ODUB 5DC9B 4J3UA 3CSYB 3F12B 5GRJH 3ROOA 1EVTC 5ENWA 3S4SG 1U3ZA 5AYUH 3MOAH 4YIQA 5GRVK 5AG9A 2X4OB 3FKUS 1A0QL 4JRYE 4AL8H 5I16B 1CICD 1J8HE 3O6KH 5IFHH 5GZOD 3D2UB 1F11B 4TVSa 5D7JA 3RWDB 3FTGA 2XKUA 1OF2B 3CDCA 2HN7A 5JW4R 4OI9A 2F8VA 2DLFL 4KKCC 2ADFH 5KVGL 3LMJH 5L7XH 2BNUA 2NXZB 2P5WB 5EFIB 3RHWK 4OZGB 3BSZH 4IRJD 1IAIH 1JNNL 4YFLI 4M1CD 1Q94A 4U3XA 2BC4B 4JZJB 4LCUB 4LPTA 1F3JB 1I1RA 3T0DA 2DF3A 2F54E 1CE1H 2R2BA 4DTGH 1AQKH 4ZFZB 1R5IA 4PJXF 4XTRC 2X6MA 3TJHC 3MTRA 4QXGH 4BA8A 2VDOL 3EDKA 4GUPA 4IOFD 4WENB 3QDGA 3WMSA 1DJSA 2UWEA 4RMVA 5MERA 3SGDH 1W0VA 1DLHA 1ULVA 3U0WL 5I76A 2X1WL 1NDGB 2C5DC 2E7MA 4L8DA 4DKEH 4R4FH 1I8MA 4KTEH 1QR1A 1VHPA 3A6BL 3PV7A 4OZFG 5F7HA 1UB5B 3T4YA 5FECA 5DEGA 4AENA 4EBQH 2C4FU 5F9OH 5CUSH 3UPRA 1U8MA 2YMXL 1NCBL 3QXDB 1HIMH 1N6UA 4LAQH 1QBAA 2LVEA 3QULB 3P0YH 4CVZB 4Y4KC 3B2VH 4LVHC 2B4CC 2VLLA 1B6DA 2VC2L 2Y72A 4P2QB 1P6FA 1IGTB 2VAAB 1TZIB 4Z7VB 1AE6H 1MJ7L 2YPLD 3WXWL 4GAGL 4D9RD 4JFHD 3AUVA 1C12B 2C9AA 2EH7H 5KVFL 2D4FA 3K80A 4CW1A 2AKRA 4P5MB 1BD2E 2VDLH 1NGXA 1FGVL 3TVMA 3MV8D 2F8OA 2QHRL 5FM8A 3RWHB 1FVEA 2J5LB 2XWTB 2Z8VC 5LCVL 2QBWA 1AGCA 1IQWL 1S9XA 5I75C 3ARDC 2WBJA 5F89B 1S8DB 1JRHI 5DK0A 5MEPB 5IBLD 3LKQB 3MMEB 4FTVE 3KYMA 3V6ZA 4GAFB 3GMPA 3TBTB 1LO2L 4RGNB 3WJLA 4NWUH 3MUHL 4UT6H 4HW6A 1UM6L 4XX1E 4HBCH 3QPXH 4WUUE 1ITBB 4TQEH 4S1DD 3ARGA 3B6SB 2GKIA 2QADB 2PN5A 3BO8A 2OMNA 3MLZL 5D1ZB 2MKLC 1AC0A 5CLTA 5C0FB 1YEKH 4UQ3B 5GGUB 2W0KA 2Y9RT 1AH1A 4CKVX 1A1NB 1QSEB 4JFQB 4N0CA 5DUPH 4AIZA 2YPKA 4DK6A 3IJSA 5J3HD 1FLTX 5CP7A 2NY4C 4XNQA 2FSEA 4K71C 4X6CE 1FVDA 5EO9A 5HDQH 4HH9B 5IB1A 1KCLA 5HI4C 4P4RA 3S35X 4NQDB 3O6FA 4K2UL 2VUYA 4D0BA 3I50H 1OTSC 3SKJL 1MRDH 4OZFH 4Z9KB 1JIBA 1FFPA 5LXGH 3QI9B 1HEZA 5C71A 5GGSA 3MA9L 5EPMA 1C16B 1QBLH 1NANH 4I4WB 1VA9A 1AJ7H 4JDVA 1WEJL 3KPQB 4RRPA 3Q6GH 1P7QD 4Y5XC 1D5ZB 4JVWA 4KK6D 4KV5F 3DV6B 1U2CA 2N7BA 2XZAH 2RAMA 4QY8A 4W4OC 4P5TA 5CMAA 4I0PA 5GS0H 1K3IA 4JPIA 4QXWA 3H6JA 1I1AD 1TXKA 1JWSA 1SQ2N 4JO1H 5KZCD 1PFCA 1JVKA 4KAQL 4L29A 4JM2D 3QXTA 1UA6H 4WNQA 5F96H 4L5FL 3IKKA 3OV6A 4IDLA 4OZHF 1OARH 2CIIB 2IANA 4M7KL 5FYLE 1GHFH 3BKML 2Y6SD 1MFEH 4G5ZH 2AJUL 1UWEL 4PB0H 1A5FL 1OY3B 2VUOA 1RY7B 5CBEA 3ARVA 5E7FA 3PHQB 4LCCC 4Q6IB 1NCUA 2DQTL 4N0FB 5J6HB 5EA0L 5LQBL 3W0WA 3C5ZB 4JR9H 3I9GH 2J1KA 4KDTA 1JYVA 4ACPA 3MRPB 5D72H 2CK0L 4OCRL 2BNQA 4WW2A 3IVKA 4EKXA 4L4TA 3VGAB 3ZSSA 1UQSB 2C3HA 2Z92A 3BE1L 4LSUH 1TDQA 4U2YA 4BKLA 1FIEA 4WW1B 3O4LB 4QT5B 2I07B 3QEQD 3MLRL 1N64H 1JNHA 4L4VE 2VXUH 4MA3B 5LAXA 2Q1EA 1TVDA 2JLLA 5EIIA 1NBZA 1FZOA 5FYJE 1LE9B 5E2VL 3WHE0 1A1OB 1CFQA 4ZXBC 1N5YH 2ZCKL 2KQMA 4PJ5E 3WE6B 2AJYH 1JMZA 2EDQA 1QD0A 3IFPA 2Y07L 2KPNA 5J11C 4DW2H 2IBZY 1JNLL 4R6UA 3ZTNH 4BELD 4YX2H 3S37L 2AEPL 3T2OA 3BMVA 4AEHL 4Y5YC 1EUTA 1CICA 1YY8A 4OIIL 3U0TB 5IMMA 2DI8A 1JN6B 4DVRL 3G5XA 1SM3L 4HKZB 1AKJB 1HOCB 2YD5A 4PJ8B 4ZODA 3IYLW 4NQXA 4X6DE 4YEFA 1LQVA 5C07D 4YBQD 3P4OA 3O2VH 2EDJA 2OSLA 3UDWA 3V7AE 3REVA 5LGHL 3LN4B 4PP1C 4EI5B 1H3VA 1EFXB 4GKZB 3VI3F 2RQ8A 3OXRB 3P9MB 5GIRA 4APQA 1A7QL 4LVOC 2CDEB 3DOSA 4KUZH 3VDCA 2XN9D 3GSVB 2MCPH 1K4CB 1PG7X 3QFDA 1T1ZA 3LHPL 4JRYB 4PJHA 1J8HB 5M94B 5D4QA 1NGQL 2H26A 1EEZB 2G75A 3JVGA 3G6JE 2IQAB 2QQLL 1OAQH 1LO3L 1MCKA 1AR1C 1FQ9C 1WF5A 2BFVH 2GHWB 3BJLA 2VSDA 3AS0A 2SEBB 1QFHA 4RZCA 1YYML 1KLUA 2NR6D 4XNMA 3S97C 4JZNB 1HXMB 2CJUH 4HJJL 4UTBL 5D1XD 4JZOA 1NMAH 1CLOH 4K3JH 1N6QH 1ES0B 3GHEL 3SQOH 5J6GA 3MRIA 3K1KC 2A9NL 4TSCH 3QNYB 3DIFB 4U31A 4XMLL 3HZYA 3HFML 5ICZA 2DQCL 1FPTH 2EDNA 4P4KB 3TT1L 1T1WA 2RIKA 5HHPB 5IBUG 2VZ3A 3OHXB 4GMSH 1TVBB 4YC2C 3KXFD 4E42A 2FHBA 3L3DB 4XGZB 1TJHH 4PGBA 1S78D 3TIDA 2DQJH 3MV8A 1KACB 4WWID 3GBNL 1QO3B 3QIBB 3KPOB 2YUXA 3TM6A 1NFDE 4PRBB 4LEXH 3BGMA 4Y0GA 1TZGL 2C4FT 5TQ2L 1U8KB 3VWKA 5K9QG 4JB9H 1AGBA 1VFUA 1T04B 3HC0A 4LF3B 1LD9B 1LMKA 3MV7E 4HXAL 1KTLA 3PGFH 4RISH 4PUBH 2R2EB 1W72L 4KGJA 4KK5D 5HJ3B 3W2DH 5KS9E 2AJZB 4PFEA 5BJTB 3MLTA 4G8EA 5A16B 2JB6B 4HFUH 2EYSB 1T7ZA 1ORQB 4GBXC 1UCTA 4TYUA 2WM0A 1OGAE 1BD2B 4O2EB 3SGEI 3MRDB 1E28B 3VI4E 4J23A 4PREB 1KB5H 5FOBA 5LWYL 3P0VH 1CGWA 1HHJB 4KZEL 5MEOA 2EKJA 2VOTA 1AD9B 3KPNB 3L6FA 5I1DB 1ZTXH 4IOSD 3SGKC 2EZ0C 3N06B 1UWXH 2XACC 5IV2B 1KIPB 4FTVB 2D31A 3M17A 3VFTB 4Z78A 4P9HL 1FNEA 4I5BB 3PWPE 3VH8B 1ORSA 3MRQA 1FFQA 4GLRH 5J56B 2GFBB 4WUUB 3ISWA 2HWZL 2ED9A 1CIDA 2R2HB 1EEYA 1DDHB 3LRSB 5D7IF 3D25A 5F6HI 4BM7A 3PJSB 3V6BR 3BPCA 3V6OC 4RGOL 1F4XL 5EH1A 3WUWG 1CQKA 2XTJB 4KU1A 4G80B 1B2WH 1EHNA 4NC1C 5FUCC 2FZ3B 3HE6B 3RVVD 1L9MA 3VXNA 3BT2L 1I1AA 4X6CB 4UIKH 2YN5A 1HZHH 4HEME 3UZVB 1FGNH 3WXVH 4AIOA 4JM2A 2AQ1A 3BDYL 2YA2A 2IAMC 4AEEA 3LOWA 1X4ZA 2NXYB 2HA1A 3OSKA 5EU5A 3RPIB 2R0LL 1NQBA 3A6OA 1IKNC 2NYYD 4QRUB 2VDRL 4EOWH 1PVHA 4QRSB 5T1DL 4OQTH 3VG0L 5F6IB 4UAOC 5B8CC 3RQ3A 5FA4B 3TN0D 3U4BL 4EUPB 4OCWH 1BVKA 4OQ1A 4R2GD 2AK1H 1IT9H 1OAKL 3WIHL 4UBDC 2ICWI 2PXYD 2AEWA 4FQXD 1RPQA 1NUGA 4K3DH 4P2YA 5HVFB 1URLA 1LE5A 3GM0A 1LK2B 1L8JA 4FXLA 5CSGA 2HJKA 4YZFF 3KLHC 1V3LA 5D7KD 1G9MC 1OSZA 3GHBH 4WO4B 5F1IA 3UTQA 3PWLB 5I1CL 2CLZB 1CZ8L 3O9WA 4NO0B 4KQ3H 5GHWL 1Q0XH 1D5MA 5TQ0H 1B4JL 4XCYB 1YPZF 4NNPH 5CZXC 1ZV5A 5IW1B 4JFDE 1OTUD 1BOYA 3ARPA 4ZYKB 3FQXB 1W0YT 1Y0LA 4Y4FB 4DZ8A 4OJFH 1HKLL 3MGOA 5GRXG 5HYEA 4EIZC 4E41E 4NO5B 5D2LA 1TETH 4YE4L 1JGDA 3K4DA 4IDJL 3JUZA 5GJTL 3EO0B 4L3EE 2PTTB 1GCFA 5EZLA 4L4VB 5C07A 3CFKB 5H37G 4HX1B 3TBSA 1RHHB 4Y4HD 5T1KD 4URTB 1O0VA 2XWBB 4YPGB 4U1MB 2N1KA 4O9HL 1RUAH 3U0PA 4PJ5B 1H3PH 2EC9U 1A6WH 4QRPD 5DRNA 4Z7UA 4FQLL 3V5DA 2XN9A 3R0MA 5EBLA 1BZ9A 3U9UA 2P1YA 5KVDH 4R97C 2W9EH 2Y7QA 2CQVA 3BN9D 2B4CH 1ZHLB 5FM5O 1NDMB 4LP5A 3PXJA 2BMKA 1R24B 4OB5H 3MFGB 1QYGH 3DVGA 4NOBA 2ZCHL 1BF8A 4X6DB 2Q7YB 4JQXA 1PY4A 1IGMH 3IAGC 1VFBA 3RNQA 4D9LH 1TNNA 5DMIL 3S34H 4NT6A 5C0AA 3MXWH 3SDDD 2FHCA 4IHOA 1ZHBA 3OKDB 1E4XI 5ADPH 5IT2L 3ARBB 4X5XB 3NIDF 2O26U 2LU7A 3BKCH 1FHGA 4C59B 4MAUL 3RX5A 3LQAL 1C5DA 1R3HB 2LTQB 4ISVB 1X5JA 4XVUD 2Y5EA 1JV5B 3G6JB 1I3RB 2XZZA 1BFOA 1IAKA 2AJSL 3FB8B 4OSUL 2XZCL 3ZKQD 1A0QH 2AVGA 2ADJB 4Z18A 5F7YC 2ZG1A 1QLRA 3GJFH 4XBGB 1HILB 1BHGA 3HZVA 1RMFL 1MCNA 1XGYH 4YGAB 4JVPA 4DAGL 2ZUQC 5GISL 4YBHA 5GGRY 3QH3B 2HFEB 1I1YA 4PJBA 4D3CL 1NBYA 4LLDB 4PJXE 1UACL 3L5JA 3GSWB 3TH3T 4FXKA 5SX4I 3UEZA 4XWOC 4FP8L 3FFDA 2ID5A 3HI1B 1OT2A 4JAMB 1MVUB 3UO1L 2JELL 5JOFB 5DJDA 3T8XA 3VW3H 1MCEA 1YY9D 3FT4B 1FNAA 3ARFC 1WBXB 1RZ7L 4G3YH 1SHMA 4ZUSA 5EZJA 3L5WB 2YWZA 3SDCA 1NEZG 3BYTA 4WI6A 1I8KA 1Q9KA 5CKGA 5IHLB 1JWMA 2VLJD 1U8OB 1NFDB 1N5AB 4X7FC 4R9HA 4OLVH 1WC7B 2CGRH 4JJHA 4MDIB 1XCQB 1J8KA 2YD9A 1A2YB 1TTGA 3U7WL 5JXAL 3L3OB 3MV7B 1UB6A 3I84A 5IHZB 1MNUH 3DTXA 4OT1H 5DURB 2F9BT 4FFWC 5KS9B 1XR8A 2C3GA 3O2WL 4CVWA 5E95B 2PNDA 1IILE 1FBIH 5C0CE 2Z93B 4LCYB 3VXQB 3S4SB 1OGAB 4PJ9C 3OZ9H 2DMBA 5F9WB 1QFWL 3DGGB 3RAJL 4JY5H 1XF4B 4EN3B 2VC2H 4F7TB 2QQNL 1REIA 5IHUL 3DX7A 1QPXA 3L5XL 2VXQH 5DJZB 4U6VL 4X6BB 3G04A 2LV4A 3GK8L 4CMHB 5ICXA 5HYIA 3I75A 3BOVA 4L3CB 2XQBH 1NAKH 1U3YA 5SX5K 1BBDL 3BPNC 5IVNA 2IF7A 1DUZA 2UY6A 4K7PY 3HR5B 4YWGH 4KRPC 3PWPB 3IDYC 4ONHB 4AEIH 2UZIH 4FQCH 4GKSA 5TE6L 4HKBA 3T1FA 5FO8A 2B0SH 2APXA 1LO2H 3BAEL 4MXQC 4ZAKC 3IFOB 4EIGB 5DMKA 1OLZA 4PS4H 4X4MA 3LQAC 1HQRA 3TN0A 4G8GD 1UM6H 3LCYA 5BV7L 3GMQB 2VDPL 1G0XA 4KVNL 5E56A 3STLA 1K2DA 3MLXH 4K23L 2PXYA 3ZE1F 1EV2E 3GZKA 5BQ7A 2HP4A 2MTPA 1J1PH 4FG6D 1OP5K 4OZFB 4UDTB 1HQ4A 1QR4A 4P2OB 3MRNA 2O5ZL 3T2PA 2EH8L 4LLUA 5DD0H 3WS3A 3NCYS 3NFPB 1UKQA 2A0LD 4HGWB 4NRYA 4NN6B 3DX6A 2V2XB 3GSNA 3D3VD 1IAOA 2D7TL 5D2NA 4YFDB 4FMFA 2FH8A 1M7DA 5TDPA 4U1IA 4MNQB 4KV5E 5EC1B 1OAXL 3V5HA 2L0DA 3MRBB 3AMLA 3D39D 3IF1A 5B22A 2HFFA 4CDHA 5ALBL 1V05A 1Q9OA 3U30C 1NFKA 1KJMA 3PIQA 4U1JA 3BQUB 3VFPA 2Z8WC 4OZHE 1UZ8A 3EFFB 5CP3H 2J7LA 1FO0A 2FWOB 4YXKH 4OCNC 4Y4HA 5ICYA 1CDUA 4OV5B 4HPOH 4PLKD 5CKAA 1U8NA 3VFNB 2A1WL 3QUZB 5DUMH 1SEQL 4FXGB 3GI8L 5IBTL 6FABH 2VN7A 3RZCA 1Z2KA 4JFDB 4QRPA 3MRJB 5DJCB 1CDGA 4YH6A 4BSWA 1Y18B 1CXIA 2QLVB 3LN5A 5FCSH 4PV9A 3HS0B 1FVCB 1L7IH 4NQEE 3ILPA 2L7UA 4JE4B 1EPFA 4OLEA 4MA8H 4E41B 5J13B 3Q3GA 1T83C 1AQDA 3R1GL 2Z0BA 3ULUC 1UT9A 3P2TA 1UXSA 1WBYA 4L3EB 1MF2L 4BZ2H 1I9RL 4NZJA 5BXFB 5EOTB 4OCRH 3EAKA 1XF2A 4PDCE 2C3XA 4R7DB 3NTCL 4U1HA 5F44A 5I8EB 2WY3A 5D7SL 1I3GH 4M1GL 3K8LA 1GGBL 2BXZA 3EO9L 2HKFL 1I7ZA 2EC9T 1RUPH 2R39A 5E2VH 3VE0B 1XGPA 3GM8A 2EO9A 2ZCKH 2XA8H 3CVHL 3HHRB 3THML 4DOHB 5L0QC 4R3SA 4GG6A 1K5NB 2Y07H 5CJXC 4HCRH 4MD5B 4XNYL 3S37H 4HS6B 2AJXL 4RA0C 5FK9A 3DI3B 4JDZB 4FFVC 3VI3E 4DVRH 1LNUA 1LO5A 1SM3H 4FQHB 1MUJA 5IESH 3H9ZA 1ZT7B 4OCSH 1J87A 1NBQA 2ADIA 3EJYC 4JN2B 5FB8A 1D5IL 1X5HA 3C6LB 3S35L 1T3FA 2OK0L 5J9PB 4O58L 4TUKL 2WK2A 3RY6A 2H1PL 3KPMA 1VEOA 4OD2B 3CU7A 3BEVB 4JJ5A 4I9WE 4Y19B 1NKOA 2IFGA 3G6AB 2G5BA 1H5BB 5BRZE 5KW9L 1OT1A 3CMOL 3LAFA 5IKCB 1FZJB 3IKCA 3QFJD 2RBLA 3WBDA 3LHPH 4BH7B 4FS0A 1YQVL 1K6QH 4J8RB 3UYOD 5JNYA 2ICWA 4PRHE 3IDNB 3TNNB 3ZKND 3QEHB 2WUCL 3IDGB 1W0WA 3HZMB 3C6SA 2FCBA 3SE8L 4U1KB 2AXGA 1MIMH 4FN0A 3TF7A 1DVFD 3OB8A 4BQ6A 4M5ZH 4K7PH 5T3XH 2Q76B 5ELIA 1C1EH 3EYVA 3QPQC 5FKAA 1PKOA 5CGYC 4PJXB 3HRPA 2NY1D 4NFDA 1FN4A 4WUKL 5IB4A 5CD5D 3AAZA 1P7KB 5TDOA 1YUHB 3ZT5A 1IGIH 5IW3A 4TNVF 4B5EA 4UDUB 4MCYB 5HGDB 2DQCH 1KLGB 5C0JB 3LRGA 1FFOB 3QRFM 2HRPL 5DJYA 2LU4A 3MGTB 1OPGL 5CIPA 3RZWA 3RL2B 4JFPB 4X99B 4XXCC 2BY3A 5T1MA 1SYSA 3BGAA 5DJXB 4BQ9A 3NCJH 4CN6A 1U3HD 2A77L 4K07A 3UBXI 4PTUB 4HPYH 2ATKB 3EYSL 1F6AA 5I9QC 4NJ9H 2P8PB 5ITBH 1JBJA 4NO3B 2F5AH 3UROR 3VFWB 3QEUA 5TQ2H 4HGKC 3N9GH 4KPHH 1G9MH 5FGBC 1MCWW 3QUYB 2DKMA 1KB5B 1IFHH 4GXUN 1HYSD 3NZHL 5C0CB 4RQQB 1G7IB 3I2CL 3RIAF 3C8KB 4Q0XL 4Y5VA 3BKYL 3PL6C 4JCMA 2XZQH 4G8GA 1MWAH 4JFYA 3QQ9C 2VDNL 1V7NL 3IFNL 4ZTPL 3KYAA 4KTDL 1H0DA 5IMLB 4X7SH 2FEDD 2E8YA 3QNZB 3MCKA 1F97A 5ESVB 1DBMH 4Y1AD 3Q48A 1OP3K 2F58H 5C7XH 3ULUF 3CDGA 3WIFA 3ARSA 1DFBL 2P8MB 4M7ZB 4OLWL 5SV4A 2JK5B 3LPGA 1RZ8A 4BFIB 4MS8A 3W9DB 1YDPA 3EYFA 3K3QA 3BJ91 2OS7A 1KG0A 4K94C 5IIEA 4XBEL 4Y16B 4WI2A 1PG7L 1S7WB 3A67L 3LH2L 5AZEL 3DX8B 5E2WL 3K7UA 4ZSOE 1XCTB 3DX9A 3F62A 2NY5C 5HHOE 5E1AA 1NFIA 4QTHB 2YPVL 3WNLA 2HWZH 3HMXA 2YD7A 3SQBA 2H9GB 2VLKA 1XR9B 4BZ1H 4JQIH 3NABL 4P23D 3V5KB 3L7FA 1D9KD 5HHQA 5J06A 4TSAL 4R90L 4RGOH 5F6HJ 3WNPA 5JZ7D 1F4XH 4YFEA 2DJ4A 4P9MH 4HWBH 3H7BA 5D7JC 2G2RA 1MI5A 3T77A 3BZFA 3OGCA 4IOIB 1G9EA 5E99H 4G6AC 3MRRB 1CLYL 1WFNA 5BOPA 1RK0A 1CDHA 1QBML 3FB7A 4ZNEE 4LHUD 3MCG1 2PTUA 4M5YH 3MR9B 5CFHA 1Q72H 3PDOB 2O5YH 3TV3H 5L2KD 1ZLWH 4HJ0D 1PJ9A 2BSRA 4OGYH 1IL1B 3TIEB 1CD1B 3CXDL 3VG0H 2BHUA 4YZFE 1U8QB 3ZYJA 4K8RL 3P9LA 4QRRD 3UYRH 5AG8A 3TNMB 4OZHB 3HUJF 3D0LB 4GAYA 1OAKH 5K9OB 1DUYB 1QACA 2H2SC 4QXTA 5ACLA 3ZYIA 4F9PA 3PWUA 1YPZE 2XXMB 1A7NL 5DTFB 2ICWJ 2C7UB 1B4RA 2MQ3A 3JTTA 3DROA 4NZTL 3CMGA 2HH0H 3GSRA 1MHPH 2BY2A 3BHBA 3TYGL 4NQEB 4YDJB 4JN1L 1MSPA 3NOIA 1EGJL 3FN3A 3GRWA 4LARL 4OLXL 2FDBP 1ZANL 1X9QA 1X7QA 4LEOA 3QIWA 3BD5A 1JK8A 4MNHB 5C92A 1CXFA 4TOYH 5EUOF 2YN3A 4NHCH 2JB5L 2KZ1B 3TVMC 1I8IB 3DBXB 4IDJH 1ZLSL 1I1FA 3P73A 1D6EA 3SY0A 3NFSL 2IPKB 5IM7A 4ZTOL 5FYJU 3CC5A 4HV8A 4Y4KB 4LSPH 3MOBL 4LVHB 1MPAL 2WBJC 4KZDL 1F90L 4KROC 2Z31A 3OJDA 3X11B 1IEAA 1MCHA 4YGVB 3T0ED 3UTZB 2OTWA 3HRZB 4L9LA 3WJLC 4NNYA 4S1RH 4FQLH 1MFAL 1EEQA 1CL7H 1H3WM 3QFJA 2E7CA 3ARGC 1JF5A 1CE6A 4PJCA 2X70A 5I75B 4JRXD 5DD1H 3UAJD 4DCQB 4OFYA 2LU3A 3H0TA 3QJFA 1A7OH 1BZ7B 5HI5D 1I7TA 1P6AB 3X13A 3VFGL 5MHSE 4N0CC 3NIDE 1BX2B 2AV1B 2J4WH 1SBSL 1RZGB 2EDXA 4J3XA 1CS6A 4O2FA 2NNAB 4X5WB 1NC2D 3I3EA 1INDH 2KZWA 4XMKL 4C4KO 2X89D 3HMWL 4KQ4H 3CX5K 2DOCA 4NHUA 1EK3A 4P59L 2ESVD 2EYTB 3O6FC 1QTYT 5J1TC 1IKFH 1G7JB 1SMAA 3CFEB 2VNCA 1LO0L 3GJFB 5JPMB 3R8QA 3EOTL 3SPVA 5H94A 2G9HB 3PWJA 3G6DL 3V6OE 5J8OA 1TIUA 3DJ9A 1K8IB 4JG1H 1XFPA 4PRHB 2ZP0T 2OQJB 2FGWL 4MAUH 5T3XE 3LQAH 4NC1E 2EIZA 5FUCE 1V8HA 2NY4B 5SWZD 3ARZA 4K71B 4M61A 4JPVH 1JTOA 4JCLA 2VXSL 1SEBB 1Q9LA 2V17L 4OSUH 2H6PA 2FLBT 4OD1H 4P5TC 1U3HA 1FFRA 4I0PC 1BFVL 4F58L 4PRDB 4HWNA 2OL3H 1RMFH 1UWGL 2VRAA 4P46D 1A21A 1TPXC 3FRPA 3DECA 3QJHB 4OM0H 3UJIL 2HTLD 1I4FB 3BWAB 3D18A 3F5WB 1S7XA 2UUDH 2XNAA 4Y5XB 1G7PB 3U1SH 4A6YA 3GKZA 3HB3D 5DC4B 1H3UA 3HNSH 3SE3A 1LQSR 3T09A 1L9NA 4H1LA 4NDMA 1GGIL 2JELH 3L3HA 4LLMA 4KDTC 4UUJB 4N1EA 1IM3A 5D93C 1G6RL 4Y1AA 1FL6B 4WW2C 4UOJA 3IFLH 1ZHKB 2R4SH 5JQHC 25C8H 3DHJA 4YAQB 2V7HA 4ZS6C 4XVSL 3GNML 2UWEF 3IRPX 3VFVB 5FO7B 3FO9A 4KUCD 4D0CA 1I75A 2NTFB 4LCCB 1DN0B 3PHSA 1MQKH 2D03L 1IBGH 1ONQB 3LIZL 1A6ZA 1NBVL 3TPUB 3ERYA 3ET9F 3MV9D 2CXKA 2XG5A 1ZA3A 3CLFL 1BQLH 4M6OH 1M7IA 5JR1H 3V4PL 4GXVL 3RAJH 3OXSB 1D9KA 1PQZB 5A2KH 5IWLA 3HG1E 2QQNH 5KVEH 3UPCA 2Z9TA 3OR7B 1BFTA 2YEZA 1MCJA 3ULUH 4DVBB 5DYOB 3LRHA 4U6VH 5KSAB 4ZXBB 4J4PD 4LDLB 2X4QA 4M1DH 1UFUA 2EDHA 4J3OC 4B50A 4G42A 5L8LB 1VESA 3UDWC 1BBDH 1J12A 1O7VA 4LHUA 3MRHB 4BUGA 3IU4L 4ZSOB 1CD9B 4APQC 5HHOB 1QLEL 2DD8H 5KSBA 1L0XA 4M1CC 2FJGB 2FX9H 4FFYL 5T5NF 1V3MA 3FB6A 1DQQB 2I9LB 4FNLL 2D9QB 4CGTA 2ENYA 4XCFL 5DQDL 2IG2L 3K4AA 1L4IA 3JVGC 1HHKA 4IOFC 4Q58C 1I7UB 4MJIE 2GQHA 4LVOB 3L7EB 4Z8FH 4WU5A 4R96B 1JHLH 5HHVL 3OX8B 4X9HA 1NC4B 1SY6L 4HC1L 2O5ZH 1OM3L 3G5YB 2EH8H 2DQIL 5A2LH 2NY2C 3MLUL 3QDJA 1PLGH 1A4KA 4QYOB 5CBAA 3BZEA 1A6UL 3S3JA 2FH6A 5C0RL 3GUTB 3U9PL 2DWDB 1P4BH 3MBXL 1QFUH 1P84K 5EWIL 4TN9A 4NKOB 1MCCA 3OKOB 4LGPB 5C0BD 3ULVD 4LMQE 3C9NB 1YPZB 3EYOB 1LWRA 1R3KA 4NKMA 1MCWM 5D96C 2MPAH 4JG0H 5HVHC 2GTWB 1RSFA 1A3LL 3DXAA 4PRPA 1F2QA 2DQGH 4QHUA 1BQHG 1EO8L 5CJOL 2ILLA 2NY7L 4HQQL 4WJ5B 4JY6A 3VWKC 1XGTB 1C8PA 2J8HA 2EIBA 3GSQB 4MJ6B 4Z0BL 1HHHB 1BVZA 1SEQH 3MJ8B 2WSKA 1WWBX 1UXWB 2W38A 5EOQL 3CH1A 4QKXB 4ONOA 1MCOL 2DKUA 1PGRB 4PGEA 5IQ9B 1KJ3L 3D1MC 4WI3A 2CXGA 4O02L 5JOPE 3KPLA 5GGRB 5EULV 1UVQB 1ZEAL 1N7MH 3CK0L 4JRXA 2CIKB 1DLFH 3L1OH 3PDGA 4JFEB 3WSQH 1I9RH 4FQQB 4WW2F 1O7SA 2VKWA 5J3HC 2ZCLL 3OG6B 5C0EB 4Z5RB 4MQ7B 5F70A 2NXZD 5FGSA 1JRHL 1NC2A 2P5WD 4XC3L 1A6AA 1S5HA 4GBXB 5I1AA 1NUDA 4HF5H 2BVTA 4NQCE 3O45A 5EO0B 3FO0L 2HKFH 5EC2B 4HWUA 4J6RH 1U92B 4NQSA 4HUWA 3MLYL 4UILL 3EDEA 3VFRA 1GC1L 5D70H 3O2DL 2F5BH 4Z76B 2OX5A 3VJ6A 3BRFA 1KPVA 5SWZA 1UYWH 2X4NB 3ALPA 1XH3B 3BVNA 3MBEA 2IH1A 3ALXA 43CAA 5GGSY 5F3HB 1C08B 2UYLB 1N59A 4KK6C 4XP6L 2CUIA 1AGEB 1DSFH 5KSVA 3IB4A 4WHYG 1IGJB 3SE4A 1P2CB 3EHBD 2HTKD 2GJJA 1I1AC 1ZA6B 2ZJSL 3OAUH 1P5UA 2BCKA 1R3LB 3MUGB 4XPBL 1K8DA 4QTIH 2WLYA 2VLME 4JM2C 2OZ4A 4TTDD 1EFQA 4XNUH 2OK0H 5D8JL 2BVYA 5HYSB 3L3KA 4UTAL 2BERA 1F4YL 4TUKH 5AUMA 5E8NA 4K94H 5JW5B 4QF1A 2Y6SC 1T4KB 2C1PA 4K3HA 3I02A 4P2QD 1HNGA 1KC5L 4NKQB 1BQUA 4TULH 2NY5H 3SJVD 3NVQA 1OSPH 4ZMAT 4X80H 3VXUE 2XRAL 1MJUH 3SCMA 1JFQH 4PJHF 2ADGB 2IAMB 1RIHL 4NZUH 3CD4A 2DTSA 1BJ8A 4P3DB 1JF1B 2VQ1B 1OOAA 4NUJB 1TQBC 3GMMA 4UAOB 5B8CB 3G08A 2YD3A 3F7RA 3N1QC 3QCTL 4RGND 3O9WC 4C4KT 2PF6A 5F88A 3P4NB 5BVPH 2VLRE 5AZ2L 3NZ8B 4Q9QL 4HUMB 4PGCA 3MV9A 5J4MA 5GSRB 3TCLB 1DQDL 1Q9WA 2QADD 4RIRB 1V7ML 2PO6B 1KEGL 3LKPA 5HDBF 1IM9D 3H8NA 2HRPH 1QSED 3W82A 5DRWA 4I77H 1T0NA 2R2CA 3KLSA 3RA7L 1XMWA 4J4PA 5HYQA 5IOPB 5DLMH 4YBQC 3IJHB 2BNRD 3CX2A 4R4BB 1MWAB 1OAYL 2M8XA 2A77H 4XPFL 5FHAL 4LLYA 3BIBX 1F8TH 2ATPA 2B5IC 4D8PA 2FR4B 1JGUL 2AERT 4XVJL 1NGZB 1YN6B 3HPLA 4WI7A 1DR9A 3C5JA 3NZHH 1UWXK 3QI9D 3WDJA 1QOKA 4KFZC 3ULUE 3WLBB 3QWRA 4WDIA 3BKYH 4R0LA 1T0MA 3HG1B 4WFHD 4XC1L 2YSSA 3VFSA 3QT2A 2VDNH 3IFNH 3RL1B 5KTEL 4G6FB 4JFXA 4KTDH 4LIQL 5FO9A 5FDWB 4DZBA 5HGHB 4JQXC 3E6HA 3TO2A 4MVBD 3IETA 3GO1H 5FGCE 4M3JA 3ME0A 3MRFA 4R97B 5GSVB 3WD5L 2P48B 1KB9J 4HIEB 5B39A 4Q9RH 1EHLH 4G43A 4I0KA 1CFSB 1KIQA 4XBEH 4LSQH 4FQPA 3HE7A 1PG7H 4CADA 1FNSL 4N5UA 3A67H 2BSSA 4KJYA 3Q1SL 2YKLH 2A6JB 3C5ZD 5CCKL 3F7YB 2ICEA 3VXPA 3GMOA 4LPUA 4M6AA 4MJIB 4V2CB 3NABH 4KI5C 5BO1L 1T6VN 2DJSA 4GXUM 4ZO8A 4IS6B 1S78C 3VRLF 3O4LD 2I9TA 1XF1A 4PGDA 1DP0A 1TNMA 4QHMB 1S7VB 3HPJA 2R4RL 3DWTA 1ZAGA 2J8UA 4X83A 4ONFL 5DK2B 3MUJA 3GB7A 1JCKA 1QBMH 3MNVA 1MEXL 3WEXB 3PHOB 3MRCB 2BRRL 4JM2F 2R1YA 4U6XB 3HA0A 4E5XB 2FX8L 4F7EB 3U46B 2OI9A 5I2IB 3HUJE 1EAPB 4EVNA 4ZFFB 5I18L 4B7IA 4NCDA 5E08L 2E3VA 1T7XA 2X4OA 2NY6B 4TRPL 4PRID 1UG9A 2ZUWA 2EDFA 5E2UL 1LEGB 2ZUQB 4KVCH 5IFJB 1YYLL 4PJ8D 5DD3L 1X5AA 4S0UC 4OF8A 3QWQB 3SDCC 4NZRH 3RWDA 5F7FA 4S10A 5CSZA 4OF0A 2JCCA 3S7GA 4YDIH 3T0BA 5IMOB 3C08H 3LEXA 3VGEA 4ZQKB 1IGCL 4Y2DA 5E00A 1FO0L 4EI5D 5C2BH 2P5WA 5EFIA 1LK3H 1EFXD 4OZGA 5C08E 2VE6B 4YK4B 3IGAB 4QOKE 3OKNB 3ZSTA 2BC4A 2QKIB 3ARFB 4UNTA 1DBJL 1I9JL 4X7DC 4I3RL 5EUOE 5DA4A 4NGHL 2FO1A 1PKQE 1ZLVH 3FCTB 4F3FB 2MWCA 1J8HD 3EYUH 1RUQH 3RVTC 4AJ0A 4NQVA 3RNKB 4OLXH 3KJ6L 3H3PH 3S5LA 1ZANH 5F9DC 3PNWB 1D6VH 1JPST 3IXAA 1AY1L 4HMCA 3RP1A 5BS0E 2A6IA 3UBXG 5D2LF 43C9B 1J0IA 1Q0YL 2EE3A 4G6JH 3RBSA 4U1GC 1ZLSH 2M2DA 1QA9A 3W9EB 5J0BA 4ZFOL 4P5KA 3MOBH 1GGUA 2IMMA 4NQCB 5B21A 4YHYC 4QHLB 3QULA 3ZE0F 1V3KA 3VGFA 3TH4T 4DGIH 3WLWD 2NYYC 4WGWB 5D6CB 1JGEB 5ANME 3RWGA 5F93C 1XGRB 5B4MD 4PG9B 5DJ0A 4Z7VA 2AP2A 3SJVA 1HE7A 4XPHL 4G8IB 1L7TL 3TN0C 3QISA 4UU9A 3STBA 2R29H 3FOLB 3BPNB 3PQYE 4R2GC 3TBWB 4CN1A 3OMZA 2W9DL 4KRPB 3DO7B 3V9FA 3IDYB 4XBPA 3PV6A 4OGAD 1AFVL 2PXYC 3FQRA 4YHOL 3RWHA 3QIBD 5E94B 5DVNA 1M7XA 4U05A 3NH7L 4M7LT 3DUHA 3GBLA 3CCHA 5IEHB 3OKLA 3RKDD 3T2NL 3T1WA 4PRAA 5J7CC 1UCBL 4LOUC 3MMEA 5FA3B 4ZAKB 5AD0A 2OJZL 3OR6B 3H42L 1RUKL 1T1YB 4NOFA 1CLZL 3GJFK 1HSAA 3HMWH 4GMTH 5D2NC 1YEHL 5DDHB 4J1UA 4ODTL 1QRNA 4FFZL 2GITB 3B9EA 3P4MA 3VXUB 1CFNA 3G6DH 4GKNB 2OL3B 1AIFB 1FC1A 1FZKB 1M6OB 5ITFB 4JPWL 5GGUA 4HUNB 4PP2B 4ELKB 4C57C 2FL5A 1IM9A 1BOGB 4LLQB 2VXTH 1QSEA 3KJ4C 5DHYA 5I30L 3MO1A 4HDIB 4EZMA 4F2MA 1RJLA 4KI5F 3NBNA 4JQVA 1H15A 2V17H 2BNRA 1VFAB 4F58H 4Y4HC 2DLTA 3JWOC 1CGUA 3MJ6A 1UWGH 3MXVH 2X41A 3MYJB 2LVCA 1BPVA 1YMMA 1CF8L 2VLRB 4RAVB 4IMKA 3RZCC 5DC0A 1OLLA 1QSVA 4PG2A 2B2XH 4WUUD 4ENED 5B38B 4D9QE 2BX5A 4PJBF 2HFGL 2CDGB 2V2WB 2ZSWA 2VL5B 2HT3D 4WU7B 5DRXA 1C16A 1GSMA 1H8SA 3BFOA 4UV7L 3QDGE 2OMBA 4MHHG 2UWEE 3LQZB 2EKSB 1F4AA 2MNUA 1D5ZA 3RI5F 4J7RA 2X1QA 1DEEB 2XTJD 1GGIH 1IAII 2ZSVA 4H25A 3E8UH 3SBWA 2WBKA 3MSPA 1A7RL 3SOBL 2XQYK 5C0GA 3LS5L 4FQ1L 4FFEX 3CFJA 2VXVL 3ZKSD 1A9EB 2PR4L 3O4OC 1NMCB 3LKNA 3CFCH 5E4EC 2N7AA 5GS2D 3MNWA 1IRAY 1QLFB 3SGDI 5HSFA 2VISA 1KCKA 3PHQA 4ZDHA 4ZUVB 5INDA 3STZA 5J6HA 3K2MC 3MLWH 5I1EH 1NBVH 3FT2B 4HS8L 5F3BA 3QIUA 4BSJA 3CLFH 4MA7H 4DKDC 3V6FA 3MRMB 1T66C 3EUUA 3GJEA 2X4RB 3V4PH 5F7UA 3VD3A 5EU6B 4X4YA 1Z5LB 2I07A 1FORL 2XWJB 3GMLA 3N1GC 5TH2A 4E0RA 1RK1B 4CN4A 2DMKA 4EQ2A 4WO4D 3KDMB 3QXUA 3KAAA 3NN8B 5FYLD 5ESQA 4NO0D 1QHOA 4JFOB 3ILQD 4OLZH 5D7IA 1A1OA 3W81A 1XGQA 4WHDA 3MLPA 1E4XL 3RY6C 3QG7L 4NZDA 3D48R 4F7PA 5DJ8A 1QLEH 2NY0D 2DAVA 3F7PC 4FQ2L 4Y4FD 3ARYA 5C0IB 3QNXA 4PRIA 3HMXL 3L9RA 5DS8A 3TESA 2OR7A 1ZWIB 1XF3B 1HOCA 4PJAB 4PJ8A 5DQDH 5GRUL 2G5RA 4M62L 4CVXA 4UT9H 3AXLA 2IG2H 1I3UA 5I71C 3PWVB 1FV1B 3BP7A 3ULSA 2HKHL 3DV4A 2FJFA 2OCFD 5E9DA 3LN4A 1A3RL 3MODH 4MDJB 4LSTH 1EFXA 5A40E 3P9MA 1U8HA 5AYQA 1AC6A 1KELH 4YDKH 2A38A 1AR2A 1KJ2A 2IFFH 3DURA 3HUJB 1N0XL 2H2PC 3MLUH 2BY1A 4M8QB 4YXHH 4UQ2A 1A6UH 3E6FA 1XAUA 2YD1A 3MV01 3V4UH 3DRQB 4HUXA 2YBRA 2MFNA 1YEDB 3CPLB 3GMNB 3WKML 4HUUB 2VYRE 1SJHA 1J9CT 2HMIC 5EWIH 5FV2A 1BEYL 4AT6B 4XNXH 4XAWH 1CR9L 3CDFA 3B5HA 1TZHB 4YO0A 5C08B 2FO4B 2GK2A 4D94A 4QOKB 2IANE 3ZKMD 4JPKH 1OGTA 5C9JA 1FL3B 4LCWD 3ARBD </