4PVCA

Crystal structure of yeast methylglyoxal/ isovaleraldehyde reductase gre2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
b'MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvcA00
1WW8A 2BGMA 4NMHA 5DNAA 4LSMA 2O48X 4O59O 2B37A 4AJIA 2Q4EA 1QLHA 7MDHA 5L7TA 3LT2A 3GNQA 3U4CA 5U4QA 3I3OA 4JBGA 3QWHA 3S1LA 5A06A 4KDEA 3SC6A 1I3NA 4OXKA 4QUKA 4MO2A 1U5CA 3T7EA 4FFNA 4HUJA 2X58A 2FRDA 3G79A 2WE7A 4J91A 6ADHA 2EKLA 3MJSA 5CPFA 1RM4A 3MOGA 4YXFA 1SEVA 1MFPA 2ZTVA 1N7HA 4XZ3A 4BNUA 2GD1O 3F6YA 3NRCA 4ZQEA 2BFPA 4YAIA 3O03A 2Q2VA 4CV3A 4GL4A 1BVUA 3RCBA 3M2TA 1Z45A 1EVIA 4E2XA 3K9QO 1PL6A 3OJLA 2AXQA 1VSVA 5F1KA 2J5RA 5U9CA 3QIVA 4WCFB 1M6HA 2YHUA 2GERA 3KBOA 4YAJA 2EG9A 1Y8QB 4F46A 1DJQA 1AXGA 2FSVA 4E2WA 3DBLA 3DZFA 2C7GA 3B6ZA 2XXBA 4LVUA 2NVBA 1X14A 4CLRA 2CDBA 3PZRA 5I9MA 3AY7A 5L45A 2OBYA 4IXTA 3CUKA 4AJEA 5CAEA 3DXFA 1SB8A 3QVXA 3RUEA 1H6DA 1NPDA 3FRJA 3R6DA 5EQFA 4ZQBA 4YRAA 3ETDA 1SMKA 3KYCB 4GWGA 4WOKA 4Z9FA 3VVCA 1PQWA 4WJZA 3AI1A 1MX3A 1P77A 2PY6A 3U4DA 3ZV3A 3UW3A 1H93A 5A04A 5L95A 3QJ5A 3QQPA 1VKNA 4LMPA 3D1LA 4OO3A 4CM9A 4HNHA 1IYZA 1FK8A 2IZZA 1YH3A 1X7GA 3JQBC 2IYOA 3W1VA 3QWAA 5FI3A 3K5PA 3GNSA 2HRBA 3ICPA 4CMGA 4DYDA 4BB6A 1QYXA 1GZ4A 1B0AA 3C1AA 1YJQA 3L6DA 3WGGA 5CDYA 2CVZA 4XJTA 3KEOA 4BNWA 2RBEA 4I1IA 4NNJA 1MA0A 3ANLA 1O95A 1U28A 5TC4A 4ZRNA 2GN4A 4MIEA 3AFNA 1YXMA 2O3UA 4BGIA 3SJ7A 1DC3A 5JAQA 3S2GA 5TIIA 4XQCA 4IZIA 1LJ8A 3DTYA 5T67A 4AJ1A 3H9UA 5K6AA 2NWQA 4BMNA 3AK4A 2WM3A 2D4AA 3PWKA 3AM5A 3FD8A 4MIYA 3GC6A 2VUSA 5COAA 5JYEA 3TWOA 4K9DA 2BELA 3OQ1A 4URFA 3TN7A 3E6AA 4R54A 1YS4A 3GH3A 5ILGA 1Y5MA 5LC1A 4BKPA 5TJ9A 1VPDA 4HXYA 3LSYA 4AJ4A 3WDSA 1I24A 4J9UE 3KHUA 3ONFA 2OMEA 2XXJA 1E5QA 1KEWA 1NQ5A 4DBVO 2BI7A 4IDAA 5CDUA 2X4GA 1C0IA 4E5NA 5CPBA 1E1MA 3WYEA 4YJFB 1NWHA 3NDJA 4BNHA 3JQ8B 3C7DB 4DBZA 1P1HA 3L6EA 3IL2A 4LVCA 4CPDA 5IZCC 3WS7A 2CDCA 3WBFA 2RAFA 2HUNA 4I5FA 4NU6A 4R51A 3LT1A 3JYQA 3H9GA 2XAAA 3DBRA 1DB3A 3I1JA 5T57A 1B7GO 3PFFA 4QSMA 4W7HA 3HB4X 4YJGB 4YPOA 3SVTA 1PQPA 4RPHA 2AEJA 3JQAA 3DMTA 4LCJA 1NX6A 2F1KA 3VKUA 3I9LA 3ZWXA 4GX1A 5JSFA 3DOOA 3TOXA 4CODB 5EJ2A 4XKJA 3PJGA 3ENKA 3ETEA 5KKCA 4R5MA 3D4PA 2VTEA 5JXWA 1DFIA 3JQ7A 1PGJA 4NK5A 4A73A 2Y67A 1GUZA 1D7OA 3E9NA 4J0EA 4U5QA 3ZCXA 4R69A 2DM6A 4DLAA 1I33A 3HN7A 1KVTA 2Q1WA 1B3RA 3NJ4A 2Z1NA 4ZU3A 3ZNOA 5CEEA 4NBWA 1IZ9A 2NNLD 4R1NA 4CLDA 1WZIA 4R3NA 3WGYA 2HRZA 2ZK7A 2NACA 4ZD6A 1R66A 3ABIA 3QWIA 3G1TA 1ZXLA 1JW9B 1YL6A 2OXIA 3TL3A 4HBGA 1Q1NA 4FSHA 2C59A 4TVBA 2BKAA 2JD1A 3A9WA 5DP1A 2C2YA 4BQPA 1O9BA 4CMIB 4P8RA 4DPKA 5LDHA 2B5WA 1P1RA 1U3UA 1HE3A 2CFCA 3R1IA 1EDOA 1S6YA 3GGGA 1PJ4A 3ZU2A 5CHEA 2NU7A 4FFPA 4BGUA 2OO5A 4AJOA 4BL5A 1YDWA 3LF2A 2OP1A 4GVLA 2VYVA 5I8ZA 4BB5A 4RZHA 1AGNA 3AJRA 1TT5B 4L8VA 5G0VA 1DIGA 3GN2A 1IULA 4BS9A 3Q3CA 2WJPA 1HL3A 2I76A 1DC5A 2GZ3A 3AW9A 1PS0A 5JNLA 2OZPA 5H83A 4YQZA 1LLUA 2X9GA 4PLVA 4XB2A 2DFDA 4MIOA 1PZGA 3V8BA 3GZNA 1BSVA 1LLCA 1UUFA 5DBGA 1W4ZA 4MVJG 4DYVA 1AE1A 2UUOA 3AWDA 1QRRA 3DHNA 3SX2A 4HADA 1EZ4A 2HMUA 4ALNA 4L4XA 2O23A 4IDGA 1OC4A 3GPDG 3LYLA 1ISHA 3ZHYA 3BHJA 3VTZA 3LT4A 2PH3A 2NLOA 3VTFA 4C4OA 1HDCA 4DLLA 4HFJA 3U4IA 3CSDA 3BMOA 2IXAA 3W4KA 3AUTA 2Q2QA 2Q46A 2HJRA 2VRBA 3PDUA 2B36A 1ISIA 3PHGA 2QG4A 4JJIA 2EKPA 2VOJA 1DIHA 3A4VA 1V6AA 4HNGA 4BO7A 2UDPA 2PKQO 2H63A 4FFRA 1GV1A 3RC2A 3TDKA 1V3UA 3MWDB 4IY1A 4W7IA 3ZGYA 2Y66A 2ILTA 4PG5A 5I9NA 3RQSA 4ROSA 4GI2A 2YFHA 1UAYA 2Y0CA 1A71A 4WE3A 5JMPA 1ZVMA 3ZWWA 4RPKA 3C8MA 1LDGA 1F17A 4RF5A 3OEWA 3L77A 1TA4A 4H16A 1G0NA 4NU5A 1BW9B 1WZEA 1IPEA 1NR1A 2EXXA 4L74A 1LLQA 2O3RA 2NVUA 3CZRA 4IDBA 3ZWBA 3PI7A 1YQGA 1QR6A 3RU7A 4OXYA 3OBBA 1PZEA 2PZJA 2DLDA 4IQ0A 1GD1O 1Z7EA 3L4BC 4TRJA 5JAMA 3FHLA 3JD1A 3UXYA 2Q1TA 5TT0A 4HX5A 4GKVA 1N1EA 3CZMA 2Y68A 4MVJA 3WYCA 2D1YA 1XEAA 1HDGO 4GKBA 3VZSA 2X0JA 1NTOA 4CM4A 4IINA 4DQXA 3QVWA 4P38A 4Z6KA 4XDZA 5DF1A 2CVQA 3JYNA 3C3XA 2VRCD 4TZTA 3X2FA 4C7KA 3S2EA 1HE2A 2BF7A 2PV7A 2YV2A 4E31A 1ADBA 4PLPA 4R01A 5EQDA 3S2IA 3ZWPA 1PEDA 4Z3KA 2JL1A 1NXQA 3HJAA 4WASA 3F46A 2DPHA 1NVMB 1A9ZA 1D8AA 5KWEA 2NV6A 5JY1A 4D3DA 1GUYA 5BR7A 1I8TA 2O3SA 3RAJA 2ET6A 5BSGA 3JQGA 3M1AA 5B12A 4PG6A 2V6FA 2LDBA 3BMQB 3D4OA 4F45A 3K92A 2G82A 4DRYA 1NM5A 2C2XA 4B79A 1B8VA 2HJSA 1HZZA 4HP8A 3WWYA 5DULA 4U6SA 1XQ6A 1RM3A 2YYYA 2VTDA 1PU2A 1ZSYA 3NT5A 2W2LA 3ICCA 3PYMA 1Y8RB 3G49A 1U9JA 4YAKA 1Y9AA 2YQ5A 4WEQA 3FPLA 5TLSA 2PK3A 4M89A 3ON5A 3JYLA 5JMWA 1DJNA 1LUAA 4XDYA 3L0DA 4F3YA 3U3XA 3TPCA 2P5YA 1C0LA 4D45A 3SJUA 1KY4A 3TJRA 1DHRA 2B0JA 4B3JA 3OJEA 4K6CA 1I3LA 2E82A 3RD5A 1UDBA 3AUSA 4FGSA 1R4MA 3WIEA 3KTDA 1X15A 2X0NA 8LDHA 1R4NA 4C7JA 4CLOA 3PQFA 1HRDA 2W98A 5DBFA 3WIDA 1GR0A 4NBRA 3RU9A 5A03A 4ID9A 3PVZA 4KZPA 1NHGA 2YHIB 1VLLA 1ZK0A 1LDMA 1BXKA 2EJVA 1XIVA 1LC0A 2Y1DA 1BRMA 1E7WA 1FDUA 4RQUA 4B4VA 1RJWA 1VL0A 1H2BA 1ZCJA 3JCZA 2PZMA 4IBOA 4IPTA 4QXMA 4W6ZA 5LCXA 3LK7A 3ENNA 1JU9A 3SLGA 5B4TA 2VYND 4KQXA 5EINA 5JDCC 1J5PA 1DEHA 5JCJD 2X22A 1WNTA 1XSEA 2WEKA 3TF5A 5GY7A 5JY6A 2G76A 1AHHA 1D3AA 2V7PA 4IDCA 2DUWA 2FPIA 3PGJA 4CV1A 2ZTUA 4J4HA 1GCUA 1QYWA 4J3FA 4MVJH 3ZV6A 3OH8A 4BNKA 1B26A 1CDOA 3WSWA 2VN8A 2QRJA 2X5JO 3R0IA 1EVYA 4JBIA 1ZNQO 3NX4A 5TX7A 3RBZA 5A9SA 2IEDA 3WWZA 2NQTA 2GZ2A 2ZCVA 3GAZA 4BNXA 4E3ZA 4QX6A 2OUIA 2HKIA 3K31A 3K6JA 4CMJA 1U8XX 2B69A 4OIMA 2JFGA 1LLDA 1J0XO 4A5OA 1GYRA 1E1NA 2R00C 1PJ2A 2POQX 1I32A 1A4UA 4PCVA 4JBHA 3ITDA 4FQ8A 1YQXA 1YBVA 3GVXA 5BSEA 4RVHA 3BMCA 1P3DA 5EL0A 2X5OA 4N54A 3DHEA 1UXIA 1A27A 1P45A 4GX5A 3FR7A 3U5TA 3F4BA 1NVTA 2WD7A 3DZKA 1PJCA 3BTOA 3C85A 1QXSA 2AQ8A 3AUUA 1B2LA 3GZ4A 1H6AA 4Y6RA 2IYPA 2E49A 1CYDA 3ORFA 2VZ9A 4NK4A 4YJDA 3B70A 2JJYA 4TVOA 2EGGA 2C5AA 1P33A 1EUZA 3OIFA 3W8EA 5KJFA 4J0FA 4FJ2A 5JO0A 1K5HA 3EMKA 4DQUA 4EJMA 1JKIA 3NTQA 1WPQA 4I8XA 3RFTA 1NFRA 1Y7TA 1F12A 4PLHA 4I9HA 1IOLA 3D3WA 2X5KO 1QSGA 4OJNA 4BNMA 2NTNA 1B16A 1N8KA 3PTZA 3U09A 2VZ0A 2UUPA 3PHHA 2C0CA 3PJFA 5HWSA 3ANNA 1WDMA 5F3RA 1XYGA 3ZN2A 4UVHA 3F5SA 3MZ0A 1HDYA 1ISFA 3KLMX 1K3TA 3H4VA 2YV3A 2PA3A 2ZCUA 3JD3A 3DDNA 2J5KA 5EIOA 4UUPA 1XU9A 4E13A 1E3IA 1PJQA 3UH1A 5BNTA 3VZQA 4CL8A 4RGBA 1LQUA 4E2ZA 1ULUA 3RUAA 4CMHA 5KVSA 3VPFA 1X7HA 5A3JA 2Y1CA 3NT4A 4DMLA 4BO5A 4ZQHA 3BYZA 3OJFA 4PG7A 3WB9A 2P68A 2ZJ0A 4XQGA 4CM8B 1ZKMA 3PHIA 4OHUA 2UYYA 4GBJA 1BWSA 4YT8A 3JQCA 4ZJUA 4ZA2A 2ZJ1A 1WLYA 4EDFA 1NQAO 3RJ5A 1LSOA 4UUNA 1U7HA 3B1JA 1RYDA 4EGFA 1BG6A 1AN9A 1O5IA 3N58A 1X1EA 2VHVA 2RIRA 2BFOA 3OF2A 5KVQA 4RVSA 1ONNA 3PQEA 2PFGA 4ZQGA 4NJMB 5HRUA 2W2KB 2NU9A 4BMVA 2HMWA 2X7HA 8ADHA 4NG5A 1ZK2A 4RLHA 2Y1EA 3GGPA 5L51A 3W6ZA 3JQDA 2Y05A 4U6QA 4O63O 1FDVA 1RYEA 4XRRA 4CUJA 3Q11A 2Y93A 2AQHA 3IJRA 1F8FA 1GCOA 4ALIA 5IXSA 3F3SA 4FJ0A 2IRWA 2EHDA 4WLFA 4PGFA 4AICA 2HLPA 4E5PA 1K6JA 3OFSA 4TQGA 3GHYA 1LRKA 3COSA 3HN2A 3CE6A 4BNNA 4D7AA 4WNCA 1U3TA 9LDBA 4CR8A 2B4TO 3HNPA 4J7CA 1DIRA 3UN1A 1MXFA 2JFFA 4IS2A 3H2ZA 4AJPA 1IUKA 3KYDB 1PGOA 1A7KA 2D3TA 3Q6IA 3PLNA 3UCEA 2Q50A 5CP8A 3TFQA 4E5YA 1LX6A 3I6IA 4G65A 3DHYA 3IUPA 4QO8A 1GPJA 3ETGA 4LISA 3T4EA 4II3A 4S3MA 2H5LA 4R5HA 5IXYA 1JKJA 2BFAA 3G1UA 1T2DA 1H6CA 1HYGA 3GGOA 3FWZA 1RKXA 2O4UX 4IDDA 4M49A 1UAGA 3GUCA 4QTZA 1JVSA 3KVOA 4RJTA 1P9LA 5I9LA 1HYHA 4WOJA 2EW2A 4G2NA 4D3FA 1YB4A 1SOWA 1V0JA 1X13A 3DZGA 2J3KA 4TSKA 4B8ZA 4Z9XA 3E5MA 4J16A 5DDIP 1SO8A 3PFWO 5ICSA 1YGYA 4DMMA 1Q7CA 3V2GA 4XYGA 4IS3A 4NBVA 4AJLA 1KY5A 4B3IA 4EJ6A 4R1SA 4O0LA 2YDYA 5JW6A 2YFQA 3GEDA 3DMYA 5DCYA 5AOVA 3WTBA 4XIYA 2P91A 5L53A 2G5CA 5F5LA 5L40A 4B8WA 2QRKA 4FGWA 1T2EA 1E77A 1KVRA 2EP7A 4BNFA 2VZ8A 1GZ6A 5G0TA 2GPTA 4A03A 3D4NA 5G2OA 3I23A 3EZLA 1WWKA 1O6ZA 3NDRA 3JQ6A 1DRUA 1QORA 3NEPX 1YWGO 2DTEA 1ONOA 2ZYGA 1BDMA 3ROPA 2GN9A 1ZH8A 4AVYA 1GUFA 4KTVE 4BUCA 4ALLA 4NHEA 1I01A 1R37A 2BRUA 4ZQFA 2NVWA 2G0TA 2DU8A 4KOAA 4MPDA 2X0RA 2YW9A 3DAPA 3RFVA 1I3KA 1EK6A 3DO5A 3VDRA 1Y81A 5JCXA 1XHLA 1Q2XA 5KKAA 4D42A 3QE3A 4WCFA 4GPD1 4BVAA 4JX8A 5HTOA 2PNFA 1PJ3A 1Y8QA 1X1TA 3GNTA 3U9LA 4O5OA 4P22A 2HSDA 2NSDA 3GAFA 3EW7A 4BKRA 3QWBA 3BTSA 4RV9A 1PR3A 1LTHR 3PK0A 3WLFA 1I2ZA 4AJ2A 5IN5A 4GGPA 1PJSA 1NASA 3ZV4A 1LRJA 5FEUA 1ZSVA 3UICA 1NAIA 1V3TA 1W73A 3KYCA 4IJUA 3KSUA 2C7VA 1R0SA 4YTEA 4EUFA 3VDQA 2X9NA 2NQ8A 3AOEC 5KTKA 5KNLA 4L4RA 4ONEA 3RIHA 1VJTA 5GMOA 1KEUA 1V8BA 4BNYA 3DFZA 1N92A 4E30A 1U8FO 4J2OA 3PJDA 4L4SA 2FPPA 1EMDA 4RPGA 1KIFA 2V6MA 1F14A 3JQFC 4LK3A 1KOLA 3M6IA 4JROA 3ROQA 1YOVB 4KDFA 4CQMB 1QP8A 3EDMA 3DOCA 3JQ9C 2OOSA 4NFYA 3MWEB 2HAEA 3KYBA 3AU9A 3IOYA 5CDSA 3E8XA 2QZ9A 1MG5A 2IXBA 5HA5A 2FR8A 2J8ZA 1R6DA 3MTGA 1C1DA 4EUEA 2GRAA 2SCUA 3EHEA 1GTMA 1YBMA 5GZ3A 4YRBA 4PVCA 4MINA 2FWMX 2OP0A 4NH4A 2B4QA 1E1KA 5MDHA 4WLUA 1YL7A 2AW5A 5JDIC 3WX0A 5COQA 3OMLA 1D1SA 4K6FA 4DUPA 2FSSA 1Q0HA 4IMPA 2W4QA 4W9NA 5A9TA 4CMAA 1TEHA 4KP7A 2FP4A 4BQRA 4BO6A 2I5PO 1KS9A 5B37A 1GEEA 3CIFA 2JCVA 5IZCA 3GEGA 3BAZA 1U7TA 2ZB4A 2FN7A 3OSUA 4OM8A 1Y6JA 5G4KA 2WWRA 3N74A 2Q49A 1TT7A 3F9IA 1F8GA 4MOWA 4YJFA 2IEBA 4YA6A 4AJJA 1X0XA 3JQ8A 1P1KA 4OH1A 1Z74A 1JWBB 1MXHA 4N5MA 3VH1A 3VH4A 2VWQA 1FXSA 2XOXA 4HWKA 1J6UA 4JNKA 3ANMA 3GDFA 4GMFA 2VCYA 2DT5A 4BV9A 1ML3A 2PH5A 5K0ZA 1PWXA 3QV1A 1QYDA 4WLVA 4WK6A 1HLDA 4FW8A 4Q3DA 2XF8A 4J9VA 2FZWA 3CMCO 1Z7BA 4CM3A 3OECA 4B4OA 4J2HA 2WE8A 1HDRA 1GV0A 1Y5RA 1LDNA 3JD0A 2BH9A 3BHMA 1G1AA 5A02A 1PL8A 3NV9A 1IY8A 2AEFA 4BHTA 4D44A 4OMUA 1E3LA 4DIFA 1ENPA 2DBRA 4G5HA 1AXEA 2VRCA 4RF3A 4JQCA 3EK2A 1P1IA 3KSZO 2AA3A 4HFMA 1MUUA 1UZLA 4J90A 2VHXA 2I66A 4E6PA 1I36A 1H9AA 2GGSA 3D0OA 1YDEA 1DFHA 4XJSA 2Y0DA 4EUHA 2G1UA 1CERA 4IUYA 5C3MA 1JN0A 2EF1A 2OGUA 1KC3A 4R3WA 4CMIA 4ZHSA 5I7EA 1W8DA 1ORRA 3ZW9A 4PZDA 3ZWCA 1CF2O 3X2EA 1VI2A 5A05A 3LZ6A 2CUKA 7ADHA 1O0SA 3VC7A 4FS3A 3WQSB 4YDRA 4DC1A 4PLCA 3RKUA 2HO5A 5T8KC 1E6EA 3GZNB 1GFSA 2D0IA 3NTRA 2DTXA 1KVUA 3FI9A 3SC4A 3IC5A 1P1FA 2ZB3A 1TT5A 4E12A 1N7GA 1UP6A 3FPCA 4DLBA 1UXHA 1RM5A 2PGDA 3STHA 1SOVA 3QVSA 3G17A 2Y1GA 3W4JA 1HE4A 1ZXBA 3QP9A 3EC7A 3DBHA 4Q3NA 3IMFA 4ZN6A 3MJTA 4H7PA 5T6BA 4CQMD 2JKVA 4R4JA 2VHZA 2Y99A 2YQ4A 1HDZA 3M2PA 3RASA 2HK8A 3Q0EA 3O26A 1VE9A 1DRWA 3HWRA 4K1LA 3P19A 1VM6A 4GLLA 5EMHA 4IGFA 4J6FA 3ZHXA 2QQ5A 3VH2A 1X0VA 2E6UX 3GR6A 1M67A 4A10A 1JVBA 3AFMA 4TRRA 1LQTA 4PZCA 1B15A 2PKQP 4F6CA 2P9CA 4RF2A 5JAZA 4FC6A 5EESA 1EVZA 3BA1A 3INGA 1I3MA 4LCEA 4CMKA 1PGQA 1E92A 4OKIA 3L07A 4MVJF 3Q1LA 1BGVA 1ZSNA 4XEHA 1O94A 5A3VA 3ZI0A 4FDAA 4D46A 5B1YA 4PFJA 3L4SO 4MDHA 2J6IA 1XA0A 3BHIA 3NT2A 1M66A 5DBIA 2J3JA 3ZU4A 2HMTA 1EQUA 4XQEA 5AQ1A 3K73O 3T7CA 4BNIA 3HFSA 3HZZA 5TQVA 4KTTE 1BXZA 4XYLA 2VYNA 2P9EA 2Z95A 2CD9A 5JCJA 4BNGA 4CM6A 1V35A 4NI5A 4R68A 3CPSA 1UXJA 4XQ9A 4E4YA 3G3EA 1H9BA 2E37A 2GLXA 2BI8A 4P4NA 4ZICA 1ZIDA 3U4HA 3VHRA 2EV9A 4CMEA 4MVJE 1BHSA 1Q0LA 2NU6A 5K9ZA 1XDWA 3H5NA 1DPGA 1YKFA 2CVOA 3L4BA 1BTOA 1ENZA 4KMSA 3GEMA 3WQRA 4YT5A 4Q3BA 5IDXA 4DVJA 4YEDA 1P1JA 2R2GA 3ONDA 3KB6A 4IJKA 3C24A 1BW9A 3DEYX 4GX0A 4TWRA 1HF3A 4WUVA 1EVJA 4CM4B 1B8UA 4YT4A 1PS9A 3P2YA 3LU1A 4J7XA 3KETA 4RVUA 4N7RA 1XQ1A 2ZTLA 2BGLA 5LDGA 2BHLA 1HTBA 1OFGA 4RORA 1KEPA 5F1OA 3NTOA 5L4LA 1GQQA 3DL2A 3E1KA 4EEZA 1MGOA 4I5DA 3I52A 4BKOA 4PG8A 2VQ3A 5DP2A 1YRLA 3RKRA 3GRKA 5ER6A 2AMFA 1GL3A 4YR9A 4GSLA 3UAGA 2E48A 3GVHA 3JQGB 2VUUA 1JTVA 2PKRA 4AJHA 5I7SA 5ITVA 4MVJM 4O1MA 1ZW1A 3F1KA 1OBFO 5FF9A 3U49A 3TFOA 2WDZA 2EGHA 2Y0EA 2ZQYA 5THQA 3AUAA 4W4TA 4GQAA 4QFCA 3PYXA 4DPMA 1U1IA 3ONEA 3AY3A 3TL2A 2JAHA 3GT0A 3JYPA 4IJWA 3QSGA 3K2BA 5CG2A 1JA9A 4J4TA 2QZZA 3RUFA 3VOSA 1T26A 2QHXA 3K8ZA 3BMQA 1DXYA 1ZUD1 4BMSA 3D3EA 1SC6A 2P9GA 3A1NA 1LSSA 4PG4A 3B1FA 1BXGB 3IP1A 4PLZA 4KWIA 5KJCA 1MV8A 5G0SA 4UULA 3DWFA 3QVOA 1ADGA 1LNQA 3IIEA 2ZQZA 4NZ9A 2QW8A 3VH3A 1MG0A 2OL4A 3F1LA 1AUPA 4UREA 4YJHB 4WLNA 3A06A 1OC2A 3HB5X 1RPNA 1M76A 1E3JA 5JPIA 3IJPA 4I5GA 1Q0QA 4JP2A 4UEJA 1GEGA 3TZKA 2JHGA 4MKXA 4I08A 2GCGA 3JSAA 1H94A 3UUWA 4BNVA 1GPDG 3FBTA 3H3JA 3C7CB 4UUMA 2EP5A 1ONPA 5TNXA 2X9VA 3DZJA 4FFMA 5JDCA 1NQTA 1M6WA 1PJTA 4FC7A 3WG9A 4CQLA 4MP3A 4U0JA 2UAGA 1Z82A 3K30A 2B5VA 4ITUA 1HT0A 4M1QA 1D4FA 2YHIA 3I4CA 4OOFA 4QT0A 2Z1MA 3WMWA 2PLAA 3AI3A 5CG1A 3QA9A 1TVEA 4U8GA 2JD0A 1QG6A 1TLTA 3PGXA 2GNAA 3HFGA 1DIAA 1J4AA 4QO7A 1ADFA 3ULKA 4CLXA 2B4RO 3RVDA 2DVMA 2P5UA 3GVPA 1EFLA 5C37A 1EBUA 3P7MA 5A9SB 1C1XB 1UP4A 3WJAA 4BO0A 4DWVA 4OAQA 4D3SA 1I2CA 4Y6SA 1ZFNA 4EI2A 1XGKA 2CMDA 4GX2A 1ADCA 4HFRA 2PR2A 3DZIA 1RM0A 2PGLA 1EQ2A 2R00A 4Z3DA 3ITKA 3WTCA 3LF1A 5TJHA 1DAOA 3I9MA 3BMCB 4RVGA 2A9FA 2EJWA 4L73A 4JIGA 2QYTA 1PZHA 1R0KA 5JO9A 3FCOA 4L76A 5I7FA 3AM4A 2WD7B 4R1UA 3ADOA 4P4LA 3JTMA 1XR3A 3S8MA 2EEZA 5A9RA 3I9OA 2O3JA 5BSHA 3H65A 1GZ3A 2HK7A 3WXBA 1U2GA 4XX0A 2B83A 5A5EA 2AG8A 2I65A 1K6IA 2DKNA 3I9NA 4QEDA 4XB1A 2J3IA 1VJ1A 5L7YA 1SB9A 5IFLA 3ZHBA 3HDQA 2Q3EA 1G0OA 3D64A 2Q1SA 4UEOA 4J1TA 4I9NA 1UH5A 2CSUA 1GYPA 1GU7A 2JHFA 4LRSB 4JP3A 4FFLA 1T4BA 2VWGA 1E7YA 4INAA 2JFHA 1N9GA 2E4AA 3UCXA 2I67A 3RUCA 4FN4A 4F6LA 3QHAA 3INTA 4KUGA 4FCCA 4ND2A 4XWYA 1UZNA 5TS3A 3AU8A 3RC1A 2YUTA 3HHPA 1E3WB 4A26A 4Y67A 1F06A 3DR3A 3IUSA 1XCBA 1E3SA 5L4NA 3WSVA 5GZ1A 5B4UA 5JYDA 1ENYA 5ER9A 4IIUA 2X1HA 4DXHA 1O89A 4ND4A 1Z6ZA 4J1NA 3I83A 4QFDA 1R15A 3RUIA 3O38A 5G4LA 1KETA 1KEVA 2PTGA 2HCTA 3B20A 5CFZA 5L3ZA 4BKUA 1MC4A 2P4QA 2HMSA 1IHXA 3QVTA 1T24A 4Q3CA 4BNTA 4BV8A 1YONA 2WSBA 4OSOA 4WNIA 3VAZA 5DCUA 1WXDA 5KJ6A 3FTPA 3GN1A 3OHSX 4CUKA 4XCVA 5JAIA 3GRPA 2O7SA 3CMMA 3WFJA 3ZH2A 1PX0A 3E18A 3F47A 4W82A 4BO3A 1PQUA 3DZBA 3RC7A 4E5KA 2QYSA 3BMNB 4NDNE 3NKLA 4YAEA 3E82A 4KWHA 4M86A 4WPGA 4DIBA 3RSHA 1MP0A 3IP3A 2X8LA 3LVFO 4YQYA 4ND5A 2C54A 4NJMA 2BGKA 2GYYA 2W2KA 1PR9A 5C7IO 3WICA 3JQEA 3PWZA 2O2YA 5IDWA 1GQ2A 3P5SA 4WEOA 3IKVA 4RVFA 1L7EA 2ZB8A 3TZHA 4ZGWA 1E1LA 4OKNA 3O8QB 5DOZA 3WGIA 5TF4A 5DN9A 3S2FA 2IE0A 4PLWA 1CIVA 1PGPA 4XYMA 2AQKA 3RROA 4R41A 4XGKA 3OETA 4ESOA 1N5DA 1U4SA 4TKLA 1ISMA 4P4GA 3ZWMA 3OA0A 4RQTA 1LEHA 4Z0HO 2YJZA 2IODA 3IAHA 1PJLA 1E5LA 2ZTMA 4CLEA 2OHXA 1NP3A 1OAAA 5DT9A 4JN6B 1ZEJA 2NU8A 5CEJA 3MTJA 3PJEA 4XYEA 3TZ6A 4DTIA 3FTNA 5IDQA 4JGBA 3FNGA 3DONA 3LLSA 1B14A 3OEYA 3KOUA 4M87A 4ND1A 3T4XA 1A7AA 3V1YA 4IGEA 1XWFA 4S1VA 2BLLA 1SBYA 3U62A 3OQBA 3WGHA 3HSKA 4B3HA 1VRWA 3ZHZA 1DO8A 3NYWA 2O4CA 3LC1O 4NBTA 4B7CA 1NHWA 3UVEA 1H5QA 1I5RA 3UF0A 2FZEA 3RFXA 1K6XA 5ITWA 2Q1UA 1M2WA 1ZK1A 3E5RA 4OOEA 1B8PA 3UGKA 4B4UA 4JXKA 4PLYA 2UV8A 1NWCA 1I0ZA 1VC2A 5IJZA 5ILOA 5TSDA 3MJVA 2A94A 2AQIA 5KIAA 1O8CA 4UVIA 4MKRA 1LC3A 3KLPX 1XELA 2VOEA 1XLTA 3GY0A 4FPXA 4IIVA 4RZIA 3WGZA 4AJNA 2OORA 4II2A 1CWUA 2NADA 4BOYA 4KUHA 2V65A 3FR8A 4J7UA 5F21A 3H6KA 4A7PA 3PXXA 4BO4A 1KYQA 3DBLB 3JD4A 3E48A 3NAQA 1ZZEA 2GZ1A 3Q9UA 5ENDA 3KRTA 4CLRB 5DZSA 3A14A 1JKFA 4A2CA 1NAHA 1OI7A 2WD8A 3E9MA 3H7AA 3LC2O 1QMGA 4MJLA 5COBA 4B7UA 5BNFA 4YB8A 3UOGA 2NTVA 2DUUA 2NM0A 4TMFA 3IS3A 1UXGA 1GY8A 1K0UA 1CRWG 3OP4A 1E7QA 1YO6A 3D5QA 2AE1A 2VT2A 4Q39A 4E32A 3L9WA 4AJKA 5C5IA 4BO1A 4FD3A 3C7AA 2NUAA 1VJ0A 1E6UA 1YJ8A 4PZEA 4NJOA 4OSPA 4Z0PA 4CMCA 1H0KA 1R16A 3MJEA 3FSRA 3WGOA 3WGQA 1CJCA 4WCFC 3MJCA 1ENOA 2HDHA 3EGOA 4DGSA 1M75A 1XG5A 3P2OA 3SEFA 3JQBA 3ASUA 4KQWA 3ZW8A 2GO1A 1DHTA 1IB6A 5A5FA 1VKOA 2VHYA 3TRIA 4GH5A 2GR9A 4PIVA 4OYRA 3AOEA 1PL7A 1DFGA 3L6OO 2ZYDA 3NGLA 1W6UA 1L1FA 3VKVA 1FJHA 2DBQA 3OIDA 1JAXA 3PPIA 4O6VA 3BIOA 1T2FA 3GHHA 5DCWA 4DREA 4FB5A 4N5NA 1WMAA 3DAFA 1YE3A 4MP6A 4NIMA 5B4VA 1QYVA 4YRDA 1GADO 2AE2A 1X7DA 3RUHA 5BQFA 3E03A 1ZMTA 5F5NA 1VSUA 3GF4A 3H9QA 4XD2A 5ENVA 3JQFA 4E21A 3EYWA 2AEMA 4D79A 1Z75A 1OMOA 1GYQA 5EERA 4PLFA 3JQ9A 4I5EA 1NFQA 5KOIA 2O3TA 1C14A 4XGIA 4A0SA 4OGWA 5KVCA 3HDJA 1T2CA 3ROMA 3GFGA 1C1DB 4B7XA 5MGBA 1E7RA 1NBOA 3OIGA 1Y1PA 4MVJP 4Y98A 5TGDA 5K6AC 1T2AA 3CXRA 4DPLA 4LGVA 4U0KA 5KJEA 4XRGA 4E2YA 1ZK4A 1YOVA 4CQMA 1H2HA 1HETA 5AXBA 5GZ6A 5JDIA 1NFFA 4DC0A 2R6JA 2W90A 4XGNA 3H5RA 1FF9A 3PQDA 4HV4A 1PGNA 3IQDB 4GGOA 3UFXA 1P44A 3KXDA 1XU7A 2ZIZA 4NFHA 3D7LA 4YAGA 3CEAA 1G6KA 3NUGA 4JLWA 4CLHA 3TZQA 4B4WA 2GDZA 1ISGA 4L9RA 3SXPA 3RBVA 3WJ7A 3WNVA 3W6UA 3ROKA 1NPTO 3DBRB 3VPXA 3ADPA 3OJOA 4GVXA 5G4KB 1KBZA 3CKYA 3DTTA 3JQAB 4DA9A 3DFUA 3LQFA 4W9NC 2Q2WA 1SAYA 5L9AA 2WYUA 5AXAA 1R12A 1VL8A 3DBVO 4RF4A 4GAEA 4CV2A 1C0PA 2JCXA 3TOZA 2VNSA 5THKA 1ULSA 1HDOA 3JQ7B 4Y9DA 3WFIA 2JAPA 3N7UA 1E3EA 3BZUA 1NVGA 4UVDA 1LI4A 4FIZA 3L9XA 4YJGA 2A4KA 3PIDA 1NPYA 1TB4A 3PYLA 3DMTC 4IDEA 3FNFA 4IQ8A 5FYDA 1IE3A 2D5CA 3ZWAA 1HDXA 2O50A 3EUWA 3GDGA 4WLOA 1EE2A 3ZNQA 4Y8VA 2I9PA 2TMGA 1A5ZA 2BFMA 4YWJA 4BO2A 4RO0A 4CL3A 3DZHA 3V5NA 3ZWYA 2C82A 3Q9NA 4CMBA 1T25A 4CUZA 4YVFA 1YL5A 4IZHA 2EERA 4BGEA 4RVDA 1XKQA 1I30A 3H9JA 2I6TA 4IMRA 4JK3A 3UCFA 3EVNA 3KUXA 4ZVVA 1V3VA 2CNBA 1F0YA 4ALMA 1EBFA 3ASVA 1LSUA 1UXKA 4J4BA 2ZKLA 1DDOA 2X23A 4RLSA 4Z9YA 1LDBA 3HQ4O 1DLJA 3R3SA 2OFPA 3HADA 2O7QA 1P0CA 4EW6A 3TQHA 3GUYA 5ES3A 5I7VA 4XYBA 3WMXA 4J1QA 3V2UA 3U0BA 3H8VA 2X0IA 3VZPA 3OQ6A 4CM9D 1DLIA 2WYVA 4DIOA 5ADHA 1JLLA 3WBBA 1MB4A 4BGVA 1ISJA 4BO9A 1H6BA 2DBVO 3Q2KA 4CR6A 5J23A 3ZV5A 2D59A 2Y1OA 3RJ9A 4L0QA 1CEQA 4OXNA 3GA0A 1AHIA 2J3HA 4R9RA 3OM9A 2PWZA 5T8KA 2DBZA 5F1PA 1HE5A 5FI5A 4J43A 3PHJA 4RCVA 1LDYA 2RH8A 3PEFA 2P4HX 3OA2A 2Z5LA 3O9ZA 4HKTA 4QQRA 1HSOA 4NBUA 3DBHB 4D0SA 4UVGA 1FDTA 2O3QA 4YBZA 1N2SA 3RUDA 5C7LO 1BDBA 2TMDA 3I9KA 3GMSA 3BMOB 5C7OO 5KCZA 2IZ0A 2WMDA 1KVQA 2A92A 4D41A 5G0WA 1W0CA 5KJ1A 1PZFA 3FWNA 1Y9EA 1ZO8A 3KEQA 3CTMA 3VPGA 1U4OA 3KV3O 5A4DA 4BO8A 1EE9A 4N5LA 1MLDA 1CQIA 1WVGA 2CDAA 2GSDA 4KUEA 2H9IA 1L7DA 1P31A 1IL0A 3VVBA 2RCYA 3PIIA 4NR0A 2I3GA 3BTVA 1WP4A 2EW8A 2H6EA 1K2WA 2H1SA 2WYWA 1GDHA 5BSFA 2XPCA 4DQVA 1R0LA 3C1OA 1YQDA 3JV7A 2V6GA 1ZJZA 4PVDA 1DC4A 1E6WA 1ID1A 2CY0A 5IDYA 3GMDA 3GDOA 3ZWNA 1NNUA 2VWHA 4RDHA 4WLEA 2NVUB 3JQAD 4RL6A 1E0DA 2HQ1A 2C20A 1QV7A 2PGJA 1P0FA 2B35A 5ICMA 3H2SA 3LC7O 1ZEMA 1HEUA 2GUGA 5CDTA 3TSCA 3PZBA 3RI3A 2O2SA 5A1TA 5AXDA 3HG7A 1SNYA 3DC2A 4JJFA 3QWFA 5JC8A 4XR4A 3GVCA 6LDHA 4YYZA 5L7WA 3MCVA 1UDAA 2AHRA 2GASA 2RHCA 1ZMOA 3KSDO 4E0BA 1C3VA 3M1LA 1U3WA 4G81A 4J1SA 1YBAA 2YV1A 1WAMA 4LW8A 3JD2A 4CMEC 3I6QA 1UR5A 1I2BA 4H15A 2PD3A 3I5MA 3NDIA 4OQYA 2QIOA 5FFFA 1PWZA 1PSDA 4FOSA 4PLGA 3ZNPA 4PRKA 1SCUA 2DAPA 5L4SA 2JD2A 1PS8A 3DQPA 3DOJA 4LN1A 4ZRMA 1U5AA 4WKGA 5BT9A 5H82A 4K28A 3PP8A 1GAEO 4A27A 2D5AA 2FR1A 2C29D 4UEKA 2YZ7A 4RDIA 3S55A 3V2HA 2X6TA 4Q3EA 2CF5A 3V1UA 2WTBA 1P74A 2QX7A 3H3FA 5IF3A 1HKUA 1LA2A 1JWAB 2Y1FA 3AM3A 5DOVA 1T1RA 1JAYA 2DPGA 3MEQA 4U7WA 4CM5A 4ILKA 2VHWA 2VYVD 4WECA 9LDTA 3G0OA 1PIWA 2I99A 3GQVA 4M8SA 5EN4A 3SBOA 1A9YA 1FDWA 3WNQA 5T5QA 3WQQA 4UUOA 3WOHA 3MOIA 4LSWA 4MP8A 5IAAA 4LMRA 4EZBA 4TZKA 1RWBA 3F4LA 4H3VA 2BMAA 3ZU3A 3IKTA 3O4RA 3PDJA 1T1SA 4TROA 4ALKA 5H81A 3DAGA 2PD6A 4R9SA 1Q7BA 4WCDA 5BNIA 3AOGA 4E5MA 2DQ4A 3PLRA 1Y8RA 4FOOA 5JC1A 3E9QA 2X86A 1MC5A 4OL9A 2UVDA 1R4MB 3Q2IA 5JFOA 4IXWA 3C1TA 4R16A 1V9LA 1R4NB 5JE8A 4CLOB 4AFNA 4CM1A 2HK9A 3QRWA 3NJ8A 4E33A 5HS4A 4GLOA 1BXGA 2D2IA 3ZWOA 3INRA 4Z0TA 1KC1A 1E7SA 3A28A 1D1TA 1K89A 2EKQA 1QLJA 3K96A 1DC6A 2V6BA 4Q3AA 1CQJA 4UVEA 1WDKA 1NYTA 3EAGA 1PTJA 4CJXA 4YJHA 3BTUA 1NQOA 1EDZA 4AL4A 1E7MA 5G0UA 1SEPA 2CZCA 4WGGA 3KO8A 3W8FA 1DRVA 4CQLB 1EFKA 1B3BA 4AG3A 4XIJA 4EEXA 4TRMA 1BVRA 2DC1A 3FBGA 1KVSA 4HFNA 2GN6A 3F5QA 2FPGA 2RH4A 3EVTA 4FJ1A 3V1TC 1WDLA 1J49A 5JLAA 3GG9A 1QV6A 2GF2A 4XA8A 3CINA 3FN4A 2FOIA 5JS6A 3LT0A 3QY9A 3PHLA 5HS6A 4Q9NA 2Q99A 4CV0A 1ZK3A 4R1TA 2OBNA 4MKZA 2IDZA 4K26A 1WMBA 4RPJA 2FMUA 3CH6A 3W4IA 3WLEA 5CEFA 3UKOA 1A72A 3PRJA 1HXHA 2W8ZA 4N18A 2GN8A 1IPFA 2ZATA 2QRLA 3RBXA 5AVOA 4BKQA 5FWNA 1JQBA 1C1XA 3AY6A 4MVJD 1HYEA 3I9JA 1YB5A 1NR7A 2DFVA 5IZ4A 1DOHA 1ZBQA 3HDHA 1IHYA 3MJ4A 4FFOA 3VPSA 2D8AA 5IG2A 2PZKA 1N1GA 3GLQA 4L75A 1Z73A 4M55A 4D0RA 4IM7A 1S7CA 3VZRA 3HUDA 1LSJA 4GSKA 4NQZA 4FR5A 3WGTA 3IDSA 4HY3A 2Q45A 4TKMA 3SLKA 5HBRA 3D3WB 3WR5A 2YY7A 1SZJG 2P2SA 2YDXA 1YVEI 3LLVA 3QLJA 3ZDFA 1N9GB 1U3VA 3LDHA 4D43A 4YT2A 3BXXA 4IDFA 3WYBA 1UP7A 2IZ1A 2RHRA 3GFBA 2W2LD 1EEHA 3ZNNA 5AXCA 2F00A 2A35A 1FDSA 5HM8A 1LBEA 4PN3A 3TNLA 3HE3A 4CR7A 2FHSA 2C5EA 4QECA 1QKIA 4Y6PA 4BNJA 3FF4A 4I9UA 4YCAA 4UAGA 3AI2A 3GVIA 4PRLA 4PLTA 1DBVO 1DSSG 1DIBA 3DB2A 1VL6A 2AG5A 5AYVA 3FNHA 5IN4A 4JCOA 5JBIA 2J5QA 1E3WA 2HU2A 4W99A 4J49A 1TXGA 4YACA 5I8WA 3ZWVA 1LXCA 1SPXA 4XR9A 1KERA 3W8DA 4EITA 3VPHA 1HSZA 3OICA 1BMDA 2NTJA 1EUCA 4GWKA 1IZ0A 3TZCA 4CM8A 3K2EA 1JDJA 1ZJYA 2VUTA 3OJ0A 4BIIA 1C0KA 3GOHA 4EJ0A 2EWMA 1DAPA 2EIHA 4ND3A 2DTDA 4OQZA 4JJGA 1ARZA 1A4IA 4TRNA 3GK3A 1YB1A 1PJBA 2I3AA 3KZVA 1LRLA 3I4FA 5TT1A 4M54A 3QW2A 5U1PA 5KVVA 1Q7GA 1EUDA 2G17A 1I10A 1UJMA 4NPCA 1TI7A 4ALJA 3EY4A 4BNLA 5EPOA 2FY8A 3ZZNA 1EK5A 3KM0A 2C07A 1QYCA 3GG2A 1HWYA 1LU9A 2FR0A 1UZMA 1HLPA 3BMNA 3PWSA 1OZAA 5T64A 3HDYA 3ZU5A 4IQGA 2LDXA 3R3JA 4X54A 3UHAA 2VT3A 4FBGA 2VWPA 4BNZA 3JYOA 3H5AA 2VNAA 2BD0A 4DL9A 4EYEA 1UDCA 1U2DA 4IJVA 1LDEA 2ZYAA 3NGXA 1CETA 1FMCA 3KYDA 3O8QA 4LRTB 5CDGA 1MFZA 3GPIA 2ZB7A 3RC9A 2CF6A 3B1KA 1T4DA 2JCYA 3H9EO 3RWBA 2PD4A 1GQYA 4GMGA 4EBFA 4RPLA 3D5TA 3FNEA 4MVJI 2HMVA 1OOEA 2PZLA 2Q4BA 4CM7A 5TRTA 4NFSA 3EZYA 1HZJA 3ST7A
chains in the Genus database with same CATH superfamily
4X1YA 1P8AA 2BGMA 2YVKA 1ZH0A 3GRYA 4NMHA 4OK3A 1GPKA 2HWWA 3SFTA 3SICE 3NKVA 3SXJA 3UH0A 4P36A 4OLHA 4E15A 2JHPA 2Q4EA 1ZJWA 4YCLA 2I7DA 2VHCA 4J16C 4U7GA 5B7NA 2QXYA 9ATCA 1FSZA 5L7TA 1N9ZA 1D2HA 1XFAA 2NSJA 4V03A 3KXKA 2QG6A 5FBHA 3U4CA 1YVRA 2REQB 4NMWA 3L0CA 3I3OA 1OASA 5DCLA 2W6JA 4R7GA 3UJNA 2IUUA 1QQ6A 3S1LA 4Z4GA 1N33B 1E2BA 4G0ZA 4CU5A 1IIBA 1H9CA 5J63A 4ER0A 3T7EA 2QLLA 2JCGA 2I1WA 3A6GA 3LDFA 1XHFA 3HJHA 4GXRA 1T5HX 1M74A 1SIOA 5EE5B 2XGOA 1QH0A 2IOFK 3GJXC 4IH9A 4F11A 6ADHA 1ZZGA 4Q4LA 4KQEA 2L2QA 4JLKA 4UCXA 1NJGA 4ETMA 2HC9A 2VDWA 4G0YA 1SEVA 4IIFA 5DYIA 4BNUA 1UWLA 3MXTA 4QELA 2VJOA 4MJXA 4BFVA 4IX1A 5ESWA 3VO1A 2NMVA 1NSTA 4KX5A 4YAIA 3O03A 2D1QA 4XUGB 2Q2VA 4ISBA 4CV3A 3TPCA 1RI3A 4OG2A 4EKYA 4ZREA 3DTVB 3FMIA 1VYHA 1Z45A 2L18A 1EVIA 4IXDA 4E2XA 3QKSA 5LJLA 4IV5A 3IMGA 5FIUA 3RYFB 5CFPA 3ZKWB 4PC1A 3RIGA 5U9CA 1OXMA 1HFJA 3GXOA 4F1JA 4LXHA 4WCFB 2TS1A 2WU1A 2ZYTX 5DE3A 3C5CA 4HH3C 2ZE5A 2AFHA 4ZYLA 1P6XA 2Q0XA 4I55F 2QQ0A 4A6PA 3K53A 2WIJA 4OK6A 5EPUA 3H42B 3RODA 3DZFA 3FA2A 5CLJA 4BECA 2FJPA 3E7PA 4CLRA 1X80A 3EIOA 2O7VA 3P71T 5I9MA 3AY7A 3QYFA 2JIRA 2J4CA 5L45A 2XT0A 3CUKA 3F96A 4IIHA 5H5JA 2VDVE 1W36B 3QVXA 3RUEA 5CU7A 3MLEA 4M9XA 1PJZA 2GFHA 1SMKA 4N3AA 4R7TA 1NC3A 4WOKA 5ESRA 4ZK6A 3OPXA 4EG4A 2CLCX 1TYBE 1IQRA 1EGHA 1P77A 4G1MB 1E9DA 2B25A 2CXNA 2C9YA 5BYJA 4C3UA 3N59A 1TF5A 2AN5A 1ODCA 5D3KA 2O5RA 3N07A 1QF7A 4G4SO 1NDUA 3AF2A 1VKNA 3ETNA 4LMPA 4QYXA 4WWHA 4JFAA 1QYRA 1ZRHA 3T7KA 1Z4MA 1QG0A 2XSZD 2ZVQX 4RCYA 1FDOA 1W36C 5B3KA 2PUFA 4OO3A 4QIHA 4AT1A 4CM9A 3FAZA 3LD9A 1FK8A 2HGZA 2IZZA 1X7GA 5G40A 2FPPB 4ILEA 1YRQA 4WOBA 4ACAA 4YRMA 3BH6A 3RB8A 3V1NA 3OY7A 1FS5A 2LRHA 2HWUA 1QYXA 1B0AA 1A2KC 4UNIA 3T8YA 2ECOA 4GOMD 2IWHA 1KRWA 2CVZA 5KX5B 1FNSA 4DV1B 1QM5A 3ANSA 3F8TA 3GT3A 4HMPA 3RLIA 4NX2A 4KO1S 2GN4A 2YJ4A 1W1WA 5KTNA 4H1TA 1Q7EA 2V1UA 1GFWA 2O0JA 3SJ7A 3ZCVA 1CJTC 2J0QA 4GMDA 4U2DA 1FUKA 1PCXA 3DTYA 3U2QA 4F2GA 5LYYA 4C88A 4ENUA 4HB0A 4QOEA 5K6AA 3AK4A 2WM3A 2D4AA 2ZUCA 2MYNA 3AM5A 3AVOA 1EH5A 4LYDA 3A1UA 3RTCA 2B0CA 2QGZA 2YOGA 3MWEA 5COAA 3M6AA 4URFA 1SZCA 1W88B 2XIJA 2XCLA 1YS4A 5ILGA 1Y5MA 5GV7A 4AQDA 3G0IA 4E5UA 1HURA 2JJMA 3TIFA 1RFGE 3SEZA 4HXYA 1XB2A 4OBWA 4EGCB 2QXTA 4N65A 3KE9A 3RFUA 3IR6A 3W2HA 3WDSA 1EK1A 1I24A 4KE7A 5B6PA 4BMYA 2K2QB 2OMEA 4R8RA 2XXJA 5BYAA 3I6MA 1IBLB 4OB8A 1CUZA 5BMVF 4R6WA 4LBYA 2G9QA 4K46A 1JDNA 2OG2A 2X4GA 3WIBA 2SICE 2A9JA 5CPBA 3TUIC 2QAJA 3EULA 3QU4A 3WYEA 2FMXA 5JZSA 1T0HB 3C7DB 3EBLA 3JWGA 3DMDA 2ZANA 1P1HA 3GJ8A 4QXOA 2XCOA 3IL2A 4BN4A 3UC9A 4L27A 3ROZA 1QH1B 1U2TA 3OQNA 4RDXA 3IUMA 1CR1A 3WBFA 3ML1A 2HUNA 1SBQA 4I5FA 4R51A 1P1BA 2WSSA 3LT1A 3O8BA 2J5XA 3WWOA 1JEEA 4KZKA 3H05A 5ALGA 3PFFA 4W7HA 1J8FA 4FFSA 2FXVA 1PQPA 2B1JA 3DMTA 5H70A 2JLRA 1DIOB 2WM2A 5JSFA 1G8SA 1QPZA 3OSZA 2E87A 2RHMA 2AOUB 3NOQA 3P9IA 4HAOA 4NYIQ 4LSGA 3LFUA 5FUXA 4CODB 5LIPA 3NUZA 1UK9A 3NWOA 3BIXA 2P30A 4C3OB 4P5EA 1DFIA 4A73A 1FVFA 1PYDA 2ETVA 3V7UA 3SIWA 2ORWA 3E9NA 4FMBB 4KIJA 4J0EA 4AIRA 4QVKA 4DMFA 2E18A 1YR8A 4I4TB 4LV6A 4DLVA 2NG1A 4MV4A 5KOYA 2XVZA 1XWIA 3NONA 4MUBA 3K9FC 3N2EA 4D3SA 1KVTA 3Q87B 1A9QA 1B3RA 4H4EA 4HLDA 4B6RA 1VA5A 4PAQA 3F3MA 3R6TA 3NNNA 2WAOA 2NNLD 4RKQA 2WA2A 2C0PA 2GKSA 3G7NA 2NACA 3MS7A 1R66A 2HY7A 3CEJA 1YDMA 1EVKA 1FUUA 2AS0A 4TOIA 3HKBA 1U9CA 3IP8A 5FOVA 1MCZA 1XZDA 2NPOA 2XBMA 2QMUA 1WUIS 1BS2A 2G9RA 2J7PA 5BV1A 2IKQA 4L8YA 2XDQA 2H5EA 4HK4A 5CXSA 5DNWA 4JOBA 1SU4A 4DRXA 2PJUA 4KN6A 4P8RA 2QPOA 2B5WA 1P1RA 2CFCA 1HE3A 3IAS6 4FHGA 3R7NA 3TX2A 1S6YA 3UAOA 2N46A 3OZXA 2OHGA 1EK2A 4KLZA 5DMHA 5CHEA 1P9OA 4DNPA 4RSMA 5C1OA 4AJOA 1B76A 4DF3A 2OP1A 4CT5A 4RZHA 3PUKA 4DZZA 1W5AA 4P7GA 1ZRNA 3C0KA 3ETCA 1NXSA 1TL7C 5DW0A 3V4RA 2XD9A 1TT5B 3G02A 3EZ9A 4DQKA 5G0VA 2F8TA 1IY9A 3HEBA 2JARA 1Z6XA 2WJPA 3HA2A 3MCUA 3DLHA 3L8FA 4ZVNA 4YWHA 3I5YA 4K8OA 1EJBA 2KQUA 5IX8A 5BN5A 3OM8A 2G28A 2C83A 4NENB 3O6VA 4ZCIA 1KPHA 4L02A 4AI6A 3GA5A 4MIOA 5AKJA 3V8BA 1R5OA 1LLCA 1WUJS 1RXIA 2R8BA 1XXLA 3EHDA 2JFQA 4JV5B 1LPMA 3AWDA 3PRHA 4ZHQB 3NASA 4DKXA 1P91A 3HL4A 3A4IA 3BJIC 2Q3BA 1XMVA 3NTVA 3UWPA 5CURA 1F9AA 1P4SA 2FF7A 1IJEA 1CDEA 3FWPA 2O23A 1OC4A 2DHRA 3TR5A 3LYLA 1D4OA 1ISHA 2YYSA 3HA3A 4OI4A 2IZ6A 3VTZA 3LT4A 2BHSA 3I62A 2PEZA 3VTFA 2NLOA 4PZ0A 4C0KA 2P1ZA 3CSDA 3U4IA 4PINA 3W4KA 2PS9A 5KBYA 3AUTA 5IVHA 2V97A 2Q46A 3A2LA 3D3QA 2B36A 1NURA 4D81A 2V4ZA 2QG4A 4TN5A 1CT9A 4JJIA 5BW5A 1DKNA 3C7KA 1IY0A 1N3YA 3LOQA 1WSWA 4FFRA 2CHEA 1XRNA 1GV1A 4FYMA 4V1CA 5CH8A 4IY1A 3ZGYA 4IDQA 2Q0SA 3QQ5A 2Y66A 4BJ5A 2ORED 3BXHA 3FDZB 2ZXFA 4A2WA 5AESA 3UMYA 1SKMA 1EFRA 1TQ8A 5BOSB 4B4DA 5ADUS 2QUAA 1RTTA 3LY9A 1G60A 1UAYA 1L9KA 5KB3A 2JFXA 1A71A 4WE3A 4CW7A 2Z5VA 5J43A 3LP8A 3LRPA 1ZVMA 3ZWWA 3ICOA 2W2VA 3M4ZA 5E3IA 1AS3A 2QNIA 1RVDA 2FSUA 2I0FA 1CUHA 3CEHA 4EUNA 3OEWA 1JB1A 1WZUA 3L77A 1EEXB 4DCJA 2QRMA 1TA4A 1G8AA 1UM9B 1G5PA 1ZUNB 4C2TA 3CLHA 1X1SA 1ZM3A 1IUOA 4OFBA 2O59A 1WZEA 1IPEA 2D00A 1K7FB 2R6R1 2WHPA 2FCRA 2ZIFA 3AIIA 3FHJA 4XDGA 2NVUA 3CZRA 2FQYA 5HIMA 1D04A 3KPYA 5SY4A 1UJ4A 2WWYA 1XTUA 3SZUA 2QYHA 4GRAA 4NOMA 4N1AA 1VMKA 3NB0A 1RQNA 4OXYA 3OBBA 4MUYA 2WILA 2PZJA 4XUDA 5D85A 2HW8A 2QQEA 1DV1A 2FE1A 4IQ0A 4NPHA 3L4BC 5JD5A 3P32A 2ZWMA 4TS4A 1NYRA 4G5GA 1WMEA 2P1RA 2MOKA 3S2UA 4RU1A 1JA0A 4KHZA 5TT0A 3T7RA 4GKVA 3GFTA 5K05A 4MVJA 2D1YA 2ZW9A 1XEAA 4PW0A 4B45A 1R4ZA 2ODWA 1E2DA 3V33A 3VZSA 1NTOA 1XNGA 4Z7OB 4MDFA 1V6SA 3EC2A 2QT1A 3PQ4A 3WP0A 1JLSA 1COWD 3LW7A 1J33A 5DHPA 3VYUB 5DM1A 2PUGA 4H7IA 1ADBA 1CY2A 1YS9A 3FH0A 3O7MA 3OFKA 2D1TA 3AYZB 1E6CA 3ZWPA 4GXNA 2XB4A 1M8GA 1KI1A 4WASA 1VECA 4D8XA 4KO3S 1PLKA 2ISSD 5C8YB 5I7UA 1GXSB 2NV6A 1GUYA 3B82A 5BSGA 4L72A 2ZTSA 2CJYA 2NYUA 1FFWA 2ZS7A 3K92A 4LEIA 2I8LA 2QTBA 3ZZ0A 2G82A 3WNCA 4DRYA 4C9BA 1M7HA 2C2XA 3C87A 4QU5A 4KG7A 4D9JA 5E0KB 4EY4A 3DFIA 3DV2A 3B8HA 1GHTA 1ORVA 4LHZA 1P0QA 3RR2A 3ZS8A 2H7CA 2SKEA 2YV5A 1WB5A 2CDRA 621PA 4B7AA 1JI3A 3FWYA 3BE6A 1U7OA 2GK4A 1RM3A 3H2YA 3VM6A 1V26A 2A0FA 4JVNA 3QPBA 1MV5A 2W2LA 3OHMA 4M1TA 3VU1A 1ESNA 2SNIE 2O2EA 1YIOA 2P7IA 3J80A 4M1MA 4A6DA 4DAEA 3FCAA 3HDTA 5EHZA 4HH0A 3Q1KA 1I1QB 2Q6VA 1PR0A 2CLSA 3FPLA 3NHPA 2CFIA 2P4SA 4HZUA 5AICA 4YHBA 1A8UA 1QCZA 1TJYA 2QP4A 5BQOA 2UKDA 1LBHA 3U3XA 4ZO7A 5HOEA 1C3EA 4KJXA 5KQPA 2DPMA 1EFHA 1KY4A 3IPRA 4LBWA 2OKCA 2YXLA 4GDMA 4FZRA 2H1RA 4MI1A 2ADMA 1YTUA 2E82A 2A33A 1RRPA 2QZPA 2EQ5A 3ZDCA 4PCLA 2JHAA 3KTDA 2X0NA 5LZ2A 4GU5A 4L5JA 4CLOA 1NDHA 2WZCA 2XCQA 1GR0A 1II0A 3DEJA 4MAFA 2YNMD 1JHOA 4MMYB 4L2IB 2P27A 2PQ6A 1L5LA 3CB2A 3PDCA 1NU8A 4ZAWA 3WHKA 4HAVA 1NHGA 5KNBH 3KXLA 3OAAD 3G0GA 4QFMA 5C51B 5KYUA 2QTRA 1LDMA 2BMWA 5HM6A 1XIVA 1UK6A 3OTHA 1PEAA 1LC0A 3LUPA 3D1VA 2D7CA 2Q41A 4B4VA 1XN4A 2G70A 3PE3A 3STYA 3LK7A 3ENNA 4G09A 3SLGA 5ARBA 5EINA 4D8UA 3L0OA 3PD7A 5CB4A 1FQJA 2X22A 3EW9A 3TF5A 3EXFB 5JY6A 1V1RA 2GLTA 4LV5B 3PPXA 2Q0QA 1AZSC 4QODA 2IIVA 2R65A 2FPIA 2XQFA 3PGJA 4LHXA 1RC0A 4GZ5A 5ALLA 4J4HA 4C0LA 5KTRA 1QYWA 4MUXA 4MVJH 3E84A 3EFHA 3KIPA 4MWZA 2RHDA 1JFTA 1B26A 1SVNA 1CDOA 2X2OA 3QNUA 3N9IA 3PSHA 5IAKA 1CD5A 2JIBA 1MW9X 2YZNA 4FEGA 1E18A 4MYTA 1T0BA 3OOWA 2WABA 5I7WA 3RBZA 4OGLA 4E3ZA 3BE8A 5T6MA 5AH0A 1EFTA 1V9CA 4LWZA 3H2HA 2OUIA 3FKSD 2HKIA 4FMDF 4QX6A 3PFIA 4R81A 1MT0A 2PS3A 1U8XX 3LDGA 4CMJA 2R25B 1NW6A 5DK6A 1RQXA 2RGNA 1CU1A 4A5OA 3AM1A 4BJ6A 1Y82A 2XHEA 1RCUA 1JFRA 1S8OA 3F49S 3W8NA 1S8NA 3BDAA 4B5LA 4IIDA 5K0FA 3F97A 2P4UA 2I03A 1YQXA 2X7JA 3JAWB 2W6ID 3TPFA 4I1OA 4O2AA 2Q3CA 1S1CA 4URZR 1CUJA 5D8DA 1A27A 5F1YA 3X3HA 1O5TA 4GX5A 3HYCA 2LPMA 3F4BA 1PJCA 1MOSA 2O2IA 3BTOA 3OT4A 2CFSA 4MQLA 2HRCA 4KDRA 4WY8A 3W2EA 3KPJA 5I3ZA 5DM60 1CTQA 4B3MB 1Y8CA 4WVFA 3L8YA 1JQAA 2X9QA 1I80A 3WGJA 4GM1A 1YZNA 2E49A 3HUUA 5DBOA 2WTAA 5D87A 5AWFC 4NK4A 2NZWA 3P9YA 4NJEB 4AKIA 3B70A 1DRJA 3I2HA 1WV1A 3MCAA 1T5BA 1QHIA 1YZVA 3ISJA 3KC2A 4DQUA 3TG8A 4UM7A 3EWSA 1UBGA 1A5BB 2H00A 1JKIA 1YNSA 1JJBA 2R4UA 4FT4A 4I8XA 3RFTA 2M98A 3WGNA 3TECE 1B0UA 1B41A 3M9WA 1Q91A 4NVRA 2P69A 4EPWA 5IYZB 3MWFA 5IC5A 4FZ5A 2X5KO 2CHGA 4OJNA 4DXAA 4ZOEA 3JZDA 1N8KA 1KMIY 3CEPB 4S1WA 1MJGM 3P9RA 5HWSA 4PO8A 3HDGA 3ZN2A 1TF7A 3OLYA 2OLJA 5DGDA 5IT0A 4UVHA 4PPYA 5E9QA 5FLXA 1UC5B 3CPJB 5DWVA 2IPOA 5ANRB 3ESDA 3HHEA 4B2IA 1K3TA 3ZBPA 2ZYSA 2J5KA 5EIOA 4UUPA 1EHCA 2HA6A 3EN0A 4EW3A 3KJNA 4E13A 8OHMA 3EF1A 3ENZA 3ESAA 1WV0A 4UHBA 5FOSA 3REQB 1VKZA 3ZD8A 5JSYA 4OD0A 3H04A 3N8DA 3SKVA 1SU6A 4E2ZA 2UXBB 3OC0A 4GMHA 2OZEA 1HTWA 2H2AA 2QV7A 3AGPA 5LBIA 5D3QA 3JX9A 5CTAA 4X60A 5A3JA 5KVSA 3NT4A 1TYCA 4BO5A 4MCJA 1JX6A 3BYZA 1WF3A 3OJFA 1CUVA 3KFLA 3G5MA 4J0CA 3WB9A 4HMOA 4A8JC 4DMHA 2ZJ0A 4CM8B 2P3QA 4ZT2A 1UWKA 1ZKMA 4GYYA 3VO8A 1T1JA 4NARA 4BWVA 3UMMA 2H07A 3HCDA 3U6BA 4B6JA 3AVVA 1NQAO 1S3FA 2GRJA 1LSOA 5JATA 2L0XA 4EGFA 1OQAA 1Q22A 1Z68A 3AETB 4JU9A 3IULA 3A31A 3EX7C 1ZI6A 2OZLB 4TUYF 2WT4A 2B61A 3LQ4A 1E96A 3N6VA 4NCAA 5KAPA 1KO4A 1OZ0A 1T4MA 1SCQA 1Z2AA 3NRBA 4RVSA 5ENZA 1MIOA 1ONNA 4FD2A 4NKRA 5HBGA 2PFGA 1NMSA 4ZQGA 3LYUA 5HRUA 2HMWA 2P8JA 3OQIB 3TCKA 8ADHA 1NW4A 2YRXA 5HHTA 1K8ZB 2HHHB 1QZZA 3GGPA 3ZUGA 3SC3A 1VZ3A 1T2VA 1BO6A 4N0PA 3BF7A 2YRWA 3EISA 3JQDA 4U6QA 2P3SA 1OX6A 1GVNB 3DUFB 4CUJA 1M1XB 3Q11A 4KIGA 1IJFA 1SG9A 3D6VA 2AQHA 3LJKA 4LOHA 4E1VA 2B5OA 1AKWA 3PUIA 2YASA 3TLXA 4ALIA 4AZWA 1C7QA 2IOFA 1ETHA 2IRWA 5IXSA 2QK4A 4AICA 3LYHA 5AIAA 1NY6A 3E7DA 4Q9KA 3R24A 1D9ZA 1EB9A 2NOAA 2VPXA 4TQGA 5ERYA 3GHYA 3COSA 5ULLA 1VHQA 3K1AA 4IIYA 1U8TA 5T3YA 2DERA 3O73A 5B3AA 4B2LA 3E1SA 3HNPA 3PGA1 4H59A 1EQAA 4FEEA 4Y7CA 5FNVB 5J47A 1Y4DE 4RTQA 4BRUA 3LIIA 2IPMA 5JS2A 1VRVA 4OI0A 5ALWA 2XNKA 1PGOA 1UFRA 4X6YA 3PLNA 1VLHA 4FOPA 2UYQA 3NEAA 3QZUA 5EA2A 2GTIA 2RONA 2WUVA 2X3UA 4YDSA 1C8LA 3DHYA 3BD8A 4FCTA 1XJWA 3DG9A 1SG0A 1GPJA 2OAP1 4LISA 4BE7B 4S3MA 2ZM5A 4R5HA 2ZOSA 4RH3A 3PNMA 1FY2A 4R2MA 4YUXA 4K0KB 2ANCA 4H2DA 1U2DC 3FVQA 4K9LA 1H6CA 3T1VA 3FWZA 3HACA 4QTZA 1LV8A 1L5QA 3TZBA 3N39C 3TLAA 5I9LA 4NDZA 5J59A 3IBGA 3EUFA 1YRYE 1Z7GA 3BVPA 2FMHA 4FHEA 4D3FA 2XT9A 1NUQA 3HJCA 1CUBA 4AMZA 4B8ZA 1DZIA 2AKYA 1NJ2A 1VP3A 3E5MA 2ZITA 4UBIA 3ZKAA 2HD4A 2WMYA 1VLVA 3A25A 3HWX1 5ICSA 1QU2A 3RTAA 2Z6AA 3VNBA 3VISA 3IYLW 4NBVA 1ZPDA 1E9FA 4AJLA 1KY5A 4CKZA 2E4UA 1Z07A 1XF1A 1UBJS 1GSOA 1P0IA 1AG9A 1V9SA 2XI4A 3LUJA 4O0LA 4O2LA 2YDYA 1Y6RA 4XE5A 5JW6A 2YFQA 2VUHB 3LZCA 3R5HA 4ZPXA 2QJFA 4ZGBA 3EGIA 1ABEA 2P91A 3MYYA 3ZTYA 2QUZA 5F5LA 5L40A 4OHVA 4GP9A 1MN6A 1U6IA 3PIRA 4FFDA 2ZDQA 1EIWA 4FGWA 4NBKA 4MHSA 2B2XA 2EP7A 2VQDA 4CKWA 3IODA 1IWOA 3HY4A 3JU3A 1PNQA 2XMBA 1NDQA 3X0DA 4YBRA 3GZTB 1EP9A 3CRZA 3OQOA 5DTIA 1XLTC 3EF0A 2FRDC 3JQ6A 4F92B 2XNSA 3Q3VA 4AKGA 4HQ0A 1NVBA 1ONOA 5HCUA 1MU0A 3ZJVA 2GN9A 2IYXA 4HOYA 5MN6A 1GUFA 1ZJJA 3AZOA 3GJ5A 3HZRA 3DCYA 2QD2A 2ZVPX 1L7VC 4DREA 2V7BA 4U3JA 3VZCA 3ZE1B 4ZQFA 1PSZA 2G0TA 2VF2A 3I4LA 1S3SA 1JMKC 3JR7A 1WPXA 3KLBA 5FL3A 3UXEA 5D01A 1NT2A 3MIZA 3WXMA 1ZD2P 3VDRA 1O9GA 2EJUA 2PMBA 2QORA 3WAGA 1WMFA 4D3YA 5LA6A 4B6QA 3HDVA 4D42A 1FW6A 1IZ7A 2RI1A 3UXMA 2PNFA 3SHOA 4HNSA 1B4DA 3VSBA 2FSVC 1N34B 3U9LA 3E8SA 5EJFA 1J9ZA 3A6LA 3F7OA 2BM0A 2VHQA 1VPVA 4EF5A 1XZPA 2Z30A 2P2CA 4Q7EA 4LJYA 1E64A 5KU1A 3WLFA 1I2ZA 4M9QA 4AJ2A 4DZRA 1EIZA 3LKZA 2GI4A 1EAYA 1KI9A 2VH5R 2OQVA 4I1VA 5FEUA 1KTIA 1WMDA 4EI7A 1L9XA 1ZSVA 2GJSA 1NAIA 1VIYA 3PHCA 1W73A 1X19A 2I6UA 4AROA 1GN9A 2BSAA 3KSUA 4C7OA 3H9CA 4BKMA 3PNPA 4XWAA 4LNHA 4EUFA 3AF6A 2X9NA 1TD1A 2JVJA 2NQ8A 2FZ4A 1NF2A 3PCXA 4UZFA 3ZWDA 2PRZA 2WJIA 3DFFA 1RBQA 5GMOA 3JRWA 1F2UA 4JBXA 4PTZA 5FV4A 4OUDA 1KEUA 13PKA 4TXMA 5AM0A 4W5WA 3ZE8A 1UT5A 4BRSA 3H8WA 4J2OA 3PJDA 1TO2E 2Z2JA 3PEYA 3GD7A 3I61A 1NBIA 1IBMB 4LK3A 1F14A 4RW0A 2WB2A 2B34A 1KOLA 1RLIA 1CJSA 2PZGA 2ZIGA 4JROA 3ROQA 4CQMB 1F9EA 4EY8A 1KWGA 4GPBA 1IZYA 1R3UA 3VJKA 4N8DA 3V9PA 2OOSA 2HAEA 3F7NA 3C8ZA 2WOOA 4BJ3A 5JXGA 1USIA 1GKIA 1O95C 2PXHA 1MO2A 2QZ9A 3KKZA 3LL4A 1F8XA 1LLFA 4FOLA 2GRAA 3O91A 3Q7EA 4RESA 4M8LA 2OT3B 2V7TA 5GZ3A 2JJ8A 2HF8A 5LYJF 1YHNA 1V7PC 1NV8A 1ZAKA 1QB8A 2FWMX 3AL0C 1JMYA 1SPBS 1E1KA 5EP2A 4YUAA 1GL7A 5DRTA 5JDIC 3QVKA 5EE1A 1E2HA 1HQDA 2QGFA 1D1SA 3EDCA 3OMLA 4M8KA 5IVDA 2QI9C 1NXTA 1Q0HA 3AEYA 2A0XA 2RHGB 1JB9A 1PR5A 5AVUA 1VJGA 1AO0A 1TM3E 3IMEA 4IMPA 1H0HA 4H0FA 3PC7A 2FP4A 4BQRA 4JYZA 1L5FA 4BO6A 1Z3IX 4EYGA 2UXDB 4GYKA 4TMXA 5F33A 1Z06A 3CWQA 1XNQB 3OSUA 3D3KA 2O2XA 3MQ4A 4FSDA 3S1SA 2LWIA 2AHOA 5G4KA 5K4GA 5TMBA 1R7RA 3ZIAA 1CR4A 1KJ8A 1FBTA 1OU0A 4PO1A 3WL5A 1SUPA 5IBQA 2OAGA 4XUEA 2PPVA 2Q4TA 2QIPA 4MOWA 1RI4A 3K9WA 4MW4A 2CLEB 3L6BA 3NYIA 2W2OA 1HNWB 1P1KA 1OHHD 1Z39A 1M1ZA 3BE5A 4WH0A 3OUZA 2QTZA 2XGMA 4MA4A 2ZG6A 3P2JA 2JGJA 4RABA 1N32B 2VWQA 4IXNA 4GLJA 4GUAA 3UK0A 4HWKA 1TZCA 4GE0A 1WHSB 3FMGA 1GUDA 1TM2A 3WV5A 3ANMA 5BUQA 5LOVB 1NXPA 3N0TA 3LUFA 5LZ5A 3LKBA 1QE5A 3V7YA 2V0CA 2BGWA 2O07A 1H1TA 1C9YA 1NSYA 4Q3DA 1UBFA 3OECA 4PXAA 1RI2A 3ZDZB 1II9A 1NLMA 2RARA 2WBLC 3AMVA 4NQRA 2VHEA 3OU6A 3NCTA 5TGZA 1JFFA 1Y5RA 1GNVA 2EP8A 1G17A 1Z0SA 1G9TA 1ZU4A 3BHMA 4JMPA 2IU3A 4WK0B 1OIWA 1G1AA 4LKRA 4BDTA 2GNPA 2YR0A 3KB2A 3CC8A 4WKBA 2WPDD 1AX9A 2C0QA 1PT7A 4YMIA 3SM9A 4BHTA 1YKGA 3E9RA 4MW9A 4ZCPA 3KOYA 2C4KA 3ACBA 1JLLB 3EQ2A 4HGNA 4RF3A 4CFYA 3I45A 1R6XA 3IA7A 4JQCA 1RQLA 1S7GA 1P1IA 4HFMA 4OLJA 2ZEJA 4QYSA 2R8XA 3ER9A 3QELA 4PSKA 4E6PA 1L5NA 3KKNA 1RHMA 3UANA 3R9XB 1NOJA 1DX6A 4LQDA 2ZR7A 2BZ1A 5BPFA 1KKLA 1Z33A 2VH1A 4YCMA 2I6SA 1TF2A 4B3XA 2G1UA 1CV2A 1EWYA 3S0JA 4QTYA 2EF1A 2OGUA 4KFCA 5IAOA 1KC3A 3ENQA 4CMIA 4ZHSA 4YRPA 4ZKDA 2XA2A 2ZRKA 1BXRA 1KA9H 1ULBA 3CH7A 3PXEA 4BX8A 4GOJA 4XVCA 2CUKA 3KE8A 7ADHA 2PIAA 3TLGB 3TW8B 1X7ZB 2MSCB 3VC7A 5JI3E 4BXOA 4FGLA 5AHRA 2ZR0A 3WQSB 1JZSA 5T8KC 4BGDA 2I6XA 1WVIA 2D0IA 3NTRA 4DCVA 4MV6A 3VDMA 1JKMA 3QPWA 4E12A 1VL5A 3FPCA 1A50B 3RRZA 1UXHA 4V38A 3WGMA 4QAQA 1UINA 1QOQB 3T1NA 1M34A 2P0AA 3G5UA 1STOA 1CQIB 4LMBA 3P2KA 4OSEA 3MJTA 1MB9A 4H7PA 2I4RA 2QTNA 4UW9A 4B81A 1QG2A 3M2PA 3CVWA 4L28A 2MYPA 1SXJB 3Q0EA 2ANBA 3O26A 4MLDA 1DRWA 1OXKB 2WSLA 2FMFA 2H4ZA 1SD2A 2XDWA 3EVFA 3HWRA 3P19A 1VM6A 2BKVA 1NY5A 4OB6A 1M6VB 1J2TA 1NQUA 1KU6A 2I33A 2QQ5A 3DKPA 5AK5A 3GR6A 2BR3A 4YMSA 3Q3EA 1JVBA 1VXRA 3VHLB 2V8OA 4A10A 4DZTA 4F3CA 1XPUA 1LQTA 1B15A 2PKQP 5FB3A 3FVRA 2P9CA 5JAZA 3COWA 3W3AA 5EESA 1OA1A 1Q1ZA 3B36A 3A1VA 1XTIA 2GUWA 4PSVA 5TPWB 1BVHA 1A88A 1E92A 1N2CB 2A5LA 4OKIA 3TTXA 1ZSNA 3QVMA 4DWJA 1AQUA 5A3VA 1SXJC 2G7MC 1RYMA 1RZUA 2ONJA 1D1PA 4ZVRA 4TM8A 2BT4A 3W7VA 1XA0A 3N7AA 1PQYA 1D5WA 1TAUA 1K97A 1U7DA 4KFSA 2Q5HA 2EFEB 2IH5A 4WKNA 3FG9A 3FY4A 3R8CA 5K0GA 2DSTA 3NHFA 1MD9A 2Y4OA 4I81A 3C5WP 4P7JA 1KU0A 3HWWA 4JSYA 4JLDA 5EJGA 5FOTA 2VYNA 3QU7A 2BMEA 3BGWA 2QE7D 3IKMB 5LQRA 2CD9A 3LVRE 5JCJA 1KDTA 1NN0A 2P1DA 2IYAA 3BWXA 5AMXA 2FEPA 1V35A 1PLJA 2B4AA 2ZRCA 5JD3A 3U17A 2BI8A 2G67A 1GPYA 2CN1A 1QFSA 2FW8A 3AXTA 3NPMA 2HQRA 1L1QA 2IV3A 1ZIDA 2PRJA 1Z17A 1HBJA 4CMEA 2VJBA 4JL6A 1Q0LA 1UODA 2CLDX 2HNAA 3H5NA 2WJGA 3LAWA 4HH1A 4UHKA 1YR1A 5EJ8A 4DA6A 1VLJA 2ECKA 3WQRA 2LR0A 4Q3BA 1SBHA 4YEDA 2ZBPA 1BW9A 2I3DA 3KPUA 3OOHA 1L4KA 4GX0A 4YP0A 2AFIB 1SBIA 1QTIA 1F6BA 4QWWA 4CM4B 4PBSA 1PS9A 5KTMA 3P2YA 2XXAB 2QN6A 1JQEA 2Z04A 3GCZA 3LU1A 1IXZA 4IOKA 1NSFA 2NUPA 4N7RA 1QFXA 4XUCA 5J9FA 2BGLA 3FSJX 2I2FA 2JIZA 4FI3F 3DL2A 2ISCA 4PQEA 1YDGA 5JZBA 1MGOA 1ZGGA 5C0OE 2B4YA 1UXOA 2I78A 3A3KA 3GRAA 5IVIA 4BKOA 1YRLA 3IUQA 2VKTA 2C2OA 5I5GA 1W47A 2B99A 2WFLB 4RD3A 5KINB 3TZEA 1CK4A 3IBFA 2PJDA 1XP5A 2DRIA 2J33A 4AJHA 5ITVA 4C1BA 4P4TA 2YN2A 1L2TA 1OREA 2H2IA 3F1KA 3H86A 3P45A 4HN4B 4RQAA 4Y2RA 2QTHA 5EHNA 4Y0VA 3U49A 1DAEA 4XTCS 2WDZA 3O2SB 5B5SA 2Y0EA 2Y27A 2O7RA 1VE1A 2RGEA 2UYHA 3PYXA 1TZMA 3EASA 3ZQ6A 3TQSA 4KMOA 3TL2A 1UBOS 1UWCA 2JAHA 2WI8A 2FUEA 1EA7A 2H9AA 3V7FA 3MMZA 3VOSA 4URXR 3RUFA 1WBBA 4V24A 4UTZA 3ORHA 3R09A 4AF8A 3WK4A 3REGA 3H18A 1NM5C 4EJSA 2MDTA 2ADOA 3T1YB 3B1FA 4OF4A 2GA8A 2R6GA 2F1OA 5DSTA 1B2RA 1MV8A 5KJCA 3K9LA 3K1TA 5G0SA 2PUBA 3TDNA 4HGZA 4UULA 3DWFA 5TB5A 1XYVA 3QYAA 5KNCA 2X19A 2ZQZA 1ZLYA 4B31A 4RY9A 4HLNA 4QDJA 4G67A 4RENA 4KL8S 4NZ9A 2QW8A 4WLNA 4ZAGA 3HVJA 1WSDA 1QDEA 1YE8A 1GP2A 1BU5A 3LCVB 5CB0A 1OTHA 1YD7A 3D8UA 1RPNA 5KWVA 3BWDD 4MI6A 1D2RA 2D0OB 4JHXA 3PVCA 1Q0QA 4UEJA 1NU6A 5LLSA 1X1QA 5GONB 5TQ2A 2JHGA 1L5MA 3HB7A 3W5BA 3CYFA 3NOXA 3SK0A 4I08A 2Y0BA 1LFDB 3JSAA 4R9NA 2F3SA 4EL5A 4ROTA 4FFWA 4BNVA 4KWTA 3RRBA 1E8DA 2ZUTA 1XQYA 3VX3A 2GLUA 1KI6B 5GWXA 2F9MA 2FEWB 2QJTA 3PNKA 4RZXA 1JHQA 5HYVA 5TNXA 2X9VA 4FFMA 4NZMA 5JDCA 1PJTA 3WG9A 1XTSA 4RJLA 4ZAZA 1VPTA 3Q0IA 5FAKA 1BFUA 2ECQA 5BWLA 3CU5A 1O0CA 5L3VA 4R9UC 1NE2A 1K06A 1Q1AA 2VP9A 4PPGA 4TKUA 2YHIA 5EE3A 3BILA 1EGMB 3GQBB 4QT0A 2CJWB 3T4UA 1NZDA 3AI3A 4AUKA 3SR3A 1Y63A 1QG6A 1TLTA 3AQ4A 2GNAA 1DIAA 5AFSA 3CX8A 3RNOA 4MB2A 4Y2GA 2XTMA 2Q3DA 3FCEA 1AB5A 1GG5A 3CNEA 3QVGB 4BLRA 4ZU6X 4FMCF 2P5UA 4YUWA 4INOA 1WY7A 4G5OA 2JGDA 1A8IA 5CVUA 3P7MA 4MVYA 1C1XB 5JRZA 2PA0A 1L4EA 4DWVA 2HU5A 1TC1A 1SELA 4GOKA 4JI5B 1U0NA 4PS1A 4V3BA 3AKDA 1YJXA 4ZALA 5BWCA 2II6A 4ZIRB 1Z5OA 4U7HA 4CVNA 2R00A 1TU3A 2AUTA 3AESB 4EKGA 3G8DA 5B58T 1TADA 2R44A 1OX4B 1QANA 3KHTA 1O58A 3BMCB 4MYDA 4RD6A 4L73A 2DQYA 4JIGA 4KN9S 4OFXA 4RHUA 4I9GA 3A10A 2RE8A 1R0KA 4MR7A 4PZPA 4MV3A 2HRDA 4ZZIA 4WERA 4WZZA 4CIWA 3FBWA 1XDSA 4P4LA 5KMGA 1G6HA 1WIWA 3DW1X 3CKLA 1UEJA 4ZMSA 1XR3A 5CFRA 1QTNA 2XX3A 3KAQA 3FX2A 2CUNA 3H5OA 4K86A 5CTJA 4CG2A 3FGZA 5A9RA 3A2NA 2O3JA 5D2CA 3BH0A 5FPHA 2FSIA 1EA5A 1O9HA 2R8OA 5FI0B 4XX0A 3BGDA 4BEBA 3DMFA 3IAUA 2AG8A 1MBZA 3HPQA 2GJKA 2O8VA 4HGOA 1PR1A 4NE9A 4XB1A 4OQLA 3OF5A 4ZVKA 4HUQA 1QQAA 4W5TA 2QAIA 1XPRA 4G23A 3GCWA 2H51A 2PV0A 2RGAA 4IGKA 2FA9A 1V4VA 1MJGA 1ZHFA 2Q1SA 4CTKA 2JLUA 3B3AA 5DNYB 2H4JA 4J1TA 3ZX4A 4EH1A 1B23P 1Q0RA 1G55A 1G8PA 4Z8YA 5ALEA 2ZS8A 2F3PA 2QX8A 5EZ5A 3T5GA 1QPBA 3K5IA 1KS2A 1S96A 1T4BA 1L4FA 2DE0X 3IX7A 3KJQA 1OCEA 2IU0A 2I67A 1X7XB 2CEAA 1NYQA 4IMIB 4ZOLF 3T52A 2PO5A 1PG2A 3QHAA 4ND2A 4FCCA 1XCGB 5E2BA 3UA3A 3BEDA 1N2BA 1QCDA 4A26A 1E3WB 1TO6A 5GAJA 4F2PA 2FMKA 3D6UA 3E9EA 3IUSA 2OAEA 3VUEA 1PFQA 4X8MA 4YPFA 3R5XA 5LQNA 3L4KA 3WSVA 2AYYA 5B4UA 5DASA 3NVKI 4E11A 2PKYX 4D4JA 1JQLB 3WLSA 4DXHA 1XDUA 3KWFA 2HO4A 2ZSAA 3O8NA 4Q4JA 1XZFA 4DNQA 1KH3A 1UMKA 2AZXA 1FCJA 2C4HA 3O38A 4BPBA 3VR5H 4DHEA 3QXJA 5I48A 5EJMA 2HCTA 1G18A 3LX5A 3HTXA 1MNAA 5L3ZA 3OD5A 4BKUA 2P4QA 2HMSA 1MQ9A 2ZBVA 1IHXA 4BNTA 3H13A 5ISMA 3A9VA 2BAGA 4U39A 3RVNA 2PHZA 3IPXA 2GPYA 1E4YA 3BPSA 2HIGA 3LGSA 3GRVA 1MDBA 4HLUA 2QB5A 5KJ6A 3FTPA 2O2JA 1Q12A 4XPIB 4WBNA 1KI7A 4XCVA 3VNSA 3L0IB 3RO7A 1DEKA 2X40A 1Y5IA 1EUDB 4KDCA 4QNNA 2WSYB 3P0HA 3CMMA 3ZH2A 5HE9A 1QRAA 1CF9A 1PX0A 2MR6A 3FYTA 4YCCA 1ZA1A 4BO3A 3A1SA 4WK2B 2ONZA 3RC7A 4YP5A 1NJFA 2GD0A 3SYKA 5CK5A 5IKXA 1EWKA 2QYSA 3AHIA 5KQSA 1QR2A 3NKLA 1J0CA 2ACEA 4YAEA 3ZIUA 4RLQA 2GHRA 2AK3A 2BFDB 3UK7A 3T9FA 4UU0A 1DUVG 1GG9A 4ANFA 4RIHA 3E3MA 2PQMA 4M22A 3AJDA 3LVFO 3DKKA 1CZHA 4P2GA 4QGBA 4YPVA 1Z2CA 4LRQA 1Z6YA 2AG1A 1PR9A 2D74A 1OAOC 1FE8A 1N5MA 2NYVA 4BX3A 5C7IO 2A1UA 3HKCA 3MF4A 3QEJA 5CLIA 1G5FA 3WICA 5AUQA 2WWHA 3NU1A 2HYIC 3RJTA 3N75A 4YCNA 1ONBA 2Z2IA 3E22B 3P5SA 2ATCA 3F9CA 3TZHA 4WY5A 1XAGA 1QB7A 2Y0PA 2IPXA 2Z2XA 3E1GA 5F7JA 3W6OA 5TF4A 3S2FA 1KZ1A 3JASB 1SHJA 2IE0A 2RGRA 2QX6A 3RGWS 1G20E 4B85A 5ERXA 3VR4D 1BCRA 1QHYA 1FJG