4PVCA

Crystal structure of yeast methylglyoxal/ isovaleraldehyde reductase gre2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvcA00
2Y1FA 4RF5A 3OHSX 3CUKA 3BHMA 4RVGA 3GVHA 4K28A 1EUZA 5H83A 5C37A 4AVYA 1BHSA 5IAAA 4BQPA 2GN8A 3NGXA 4Q3AA 4BOYA 1U2GA 3PHIA 4I5EA 3BMQA 3ZGYA 5JYDA 4R1TA 4DGSA 3L77A 5EQFA 1Z6ZA 1NR1A 1H94A 3SC4A 3RJ5A 2NVWA 3L6OO 4FPXA 1NQOA 4E5PA 1BGVA 3OA0A 3QE3A 3WJAA 1ZK0A 2ET6A 3ADPA 3PYLA 4DMMA 4RVDA 4OAQA 1B3RA 1DFGA 4QO7A 3M6IA 3B20A 3EVTA 2Q2WA 4A0SA 1MP0A 4ZQGA 1V3VA 4EJ6A 2EWMA 2I6TA 5ER9A 3I9OA 5T57A 1UDBA 3M2TA 4N5MA 1ZXBA 4QXMA 3D0OA 1YL5A 4NBWA 5EN4A 2O3TA 4E2YA 4TMFA 1QMGA 1GD1O 4Y98A 2AQ8A 3BHJA 4PLCA 5DN9A 4CMKA 3DOJA 2VHVA 2QIOA 2GF2A 3OQBA 4KUEA 3W6UA 3D5QA 2J5QA 2Q1UA 2OORA 3LVFO 3ASVA 3ZU4A 4XQGA 3HSKA 4LVUA 3IDSA 4UREA 2R00C 3JQ8B 1FMCA 3WGGA 3OBBA 1X1TA 5L4LA 1Q0HA 5CDSA 1AUPA 2JHGA 4I5GA 4YACA 4ND1A 1WZEA 4QQRA 2A92A 2YQ5A 4J16A 2VTEA 1U3UA 2WJPA 4CR7A 3RUHA 2O4UX 1E3EA 1UR5A 2W8ZA 4XYBA 1MC5A 3ZI0A 3JQ7A 5IXSA 4WCFA 3TOZA 1DSSG 4W6ZA 2EV9A 1YDEA 2WYVA 3FR7A 4J7XA 2C54A 4HY3A 4CUZA 4YJFB 3RASA 5FEUA 4RPKA 5AOVA 2DU8A 1R12A 1J6UA 2D5CA 2D1YA 2ZB7A 4J4BA 3BIOA 1GCOA 1P44A 2D3TA 2Y1DA 2I76A 5T64A 1X7DA 3CXRA 3JQ9A 3TZHA 3CKYA 5JC8A 4CM8B 2X0JA 3KXDA 2VZ0A 4S1VA 1ONPA 2Y93A 1PWZA 1NHGA 1UAYA 2VZ8A 4AJIA 1TEHA 1B7GO 3ZWNA 4A73A 3Q9NA 4NJMA 4XGIA 1BDBA 1KEUA 2NACA 5FFFA 4M49A 3DTYA 3ROMA 1WPQA 3QVWA 4NG5A 4CM4A 1SEPA 1U28A 2X0NA 1EQ2A 5HM8A 4BGEA 1A5ZA 3GMSA 4I8XA 1Y6JA 2W2KA 1B8VA 3IAHA 3GZNB 1T25A 2AE2A 4E5KA 2EERA 2OO5A 1O0SA 3LC1O 3PWZA 4B7CA 3KSDO 4FOSA 4Q3NA 5KTKA 2X0IA 1Q0LA 2QYTA 4E30A 4R1SA 4DBZA 4EITA 4IJKA 1TXGA 3NX4A 5JFOA 4IS2A 2YFHA 3GGPA 4JGBA 5JAMA 4PGFA 4R4JA 3U9LA 3ZWOA 4YR9A 3TSCA 3HJAA 1IHXA 4GX2A 1G0OA 1U7HA 1KY4A 5DZSA 4BO0A 3OQ6A 4L9RA 4AL4A 1FDTA 2YYYA 4FCCA 2OXIA 1NR7A 1ONNA 4UUNA 3TF5A 3GAFA 5EMHA 1GPJA 1GV1A 5JS6A 4OL9A 1NASA 1GAEO 3T7EA 3IJPA 2ZYDA 2GASA 3GVIA 1R0SA 1Y8QB 2V7PA 4BGIA 2ZCUA 4ZJUA 4ROSA 2GZ1A 4BO9A 4Q3BA 3WSWA 1P33A 3ON5A 3PWSA 3SC6A 1N5DA 4Y6SA 2Y0CA 2PH5A 3VDQA 2I9PA 1VKOA 2Q1SA 4KUHA 3AK4A 3BMCB 3H2SA 3H5RA 4TRMA 4YT4A 3PHJA 1QP8A 4G81A 1V8BA 3ITDA 1RYDA 3QIVA 2J5RA 3U62A 1VI2A 1ZH8A 1I3LA 3DZIA 3MJEA 2J6IA 4DPKA 3WGYA 2GO1A 3PGJA 3F4BA 5G0VA 4BO1A 1I3NA 2OP1A 4EW6A 3FRJA 2FP4A 1KEVA 1NQTA 3ZWMA 2PGJA 3K8ZA 4PZEA 3GPDG 4K6CA 4OJNA 2Y1OA 4L4XA 1HXHA 3FTNA 1KY5A 3E03A 3FPCA 3MJVA 1CF2O 2UUOA 3AOGA 3K6JA 5F5LA 1EE9A 3A9WA 4O63O 1C0KA 3PJFA 4WLNA 4FFOA 5I8ZA 4PVDA 1ENOA 1YRLA 1YJ8A 2P5YA 3DAFA 3UUWA 1NAIA 1LDEA 3JQ8A 1YB1A 3H5AA 4NU5A 5CPBA 3H5NA 2AEMA 2BGMA 3IIEA 4M89A 2HK9A 4N5NA 1EUCA 4C4OA 3HDYA 2BH9A 2BFOA 4KOAA 1E3JA 1LDGA 3PLNA 5EQDA 5CFZA 3JCZA 4BNUA 3BZUA 3OJOA 3Q6IA 3L6EA 4BO4A 1QR6A 4QX6A 1D7OA 4HFMA 3ZWPA 3DMTC 3U09A 2RH4A 4ALNA 2J5KA 3RC9A 4HX5A 4TQGA 1P1KA 2Q49A 1HLDA 3AY6A 4LVCA 2P4QA 1PZFA 2C7GA 3Q11A 4PLZA 5CEJA 3IUPA 1KYQA 2CY0A 4LSWA 4TKLA 1H6DA 1PL7A 2Q1TA 3HG7A 1DHRA 2JD2A 4E5NA 4HWKA 4WLOA 4R1UA 1JAYA 3SJUA 2HK8A 4CM8A 1H6BA 3RIHA 2BGKA 4NU6A 3PFFA 5CP8A 3PHLA 2NQ8A 5U9CA 3QP9A 2AXQA 1QYVA 3O8QB 3JQAD 4CV2A 1UH5A 2HO5A 2UAGA 4AFNA 3FTPA 3X2EA 1LXCA 3L0DA 2C29D 2JFFA 4YJGB 4QFDA 1EVJA 4OHUA 4K26A 3NT4A 2YW9A 1E3WB 1E77A 4XDYA 3ZU2A 4E12A 1M67A 3MOGA 1FDUA 2XAAA 1VSUA 1D8AA 3DWFA 4OM8A 4Z0HO 3E82A 4IMPA 4J7CA 3ZHYA 3DONA 2NUAA 1EVZA 3FD8A 4D41A 1TB4A 4G2NA 1ZNQO 3BMOA 3GZNA 3OQ1A 4XQCA 1R15A 5I7FA 1D3AA 1WDLA 1U3TA 1A4IA 2QQ5A 1VLLA 2W2LD 1H6AA 2CD9A 3PQDA 1E7RA 1GDHA 2AE1A 2P9CA 4BIIA 5C3MA 2R2GA 3MJCA 1GU7A 4I5DA 2OOSA 4XWYA 5JO0A 4BUCA 4U7WA 1QV6A 3KLMX 1P1JA 2X6TA 4GKVA 1KS9A 7ADHA 3GN1A 2PGDA 3D1LA 3VPHA 2DTXA 3QRWA 4KMSA 3SX2A 2IRWA 1ADGA 2EIHA 2W90A 1X15A 1UP4A 1XELA 4OXNA 3NTOA 2TMGA 4DBVO 2P9GA 3VZPA 2Q50A 4OYRA 2EP7A 5GZ1A 2BLLA 1HRDA 3NDJA 4FFNA 4MKXA 2B5VA 1TT5A 4PG4A 1ZO8A 2Y68A 1PJQA 2P9EA 4ALIA 1GQ2A 4W99A 3B1FA 4F45A 4J43A 2VHYA 3SLKA 1ADFA 1UZMA 3MCVA 4HNHA 4TZKA 3JQFC 1R37A 1OAAA 4CR6A 3BMCA 3WBFA 2FOIA 2GERA 3D4OA 3V1TC 3AFNA 1W73A 3BMNB 3LZ6A 2C82A 4Y9DA 3AM4A 3F1LA 3PEFA 4FJ2A 1SPXA 4E31A 3U4IA 3D3WB 3E9QA 2VWGA 4BO6A 4ZQEA 3I4CA 2X4GA 2RHCA 2VWHA 3UXYA 1VC2A 3CSDA 4R1NA 4JBGA 3HFSA 4R5HA 4RLHA 4YAKA 3ZNQA 7MDHA 4F6LA 1I8TA 1BVUA 1U8XX 1QLJA 1QYDA 4TSKA 4UVGA 2W98A 5G4KA 2Z95A 4A7PA 1ZSVA 1ULSA 3B1JA 2NVUB 5JW6A 3AUSA 1HDCA 4CMIB 4RVHA 1KVSA 1LTHR 1QORA 5DCUA 2TMDA 1KOLA 2E82A 3IQDB 5CEFA 1LRLA 2PZKA 1GYPA 3R3JA 3V2UA 3BTOA 2UDPA 2DBVO 5DCYA 1IE3A 5HS4A 2FMUA 1P9LA 3EZLA 1ENYA 2O48X 4JP3A 4H3VA 1FJHA 1B16A 4CQLB 5L53A 4ND5A 1QYWA 1LRKA 1IPFA 1NPYA 2QRLA 1F8FA 3ZW8A 4U8GA 3G1TA 1K2WA 2EF1A 2IEBA 1M6WA 5JMWA 2NU8A 4W7IA 1YGYA 3KEOA 4BO5A 4BMVA 4MIEA 1MFPA 2B83A 1RWBA 5IDWA 1DRVA 3JSAA 2Q4BA 3UKOA 1YBMA 4E5MA 2PWZA 3JD4A 3C7CB 1U1IA 5HTOA 1IPEA 1QSGA 2FR1A 2JL1A 2X9GA 3I52A 2DT5A 2WD7A 2EHDA 3HN2A 3ZHBA 2E37A 3DTTA 3JD2A 4DUPA 1HKUA 2Y99A 3WFIA 4I1IA 4NPCA 1ID1A 4WNIA 2CZCA 3A4VA 4LCJA 3VAZA 4C7JA 1F12A 1HZZA 2A35A 3PHGA 4MVJM 5THQA 2P91A 1PWXA 1BXKA 3TPCA 5A3VA 4PRLA 2G82A 4ZA2A 1HYHA 3LC7O 1K0UA 1PJ3A 4PLFA 3S2EA 4R54A 3L9XA 2ZTLA 4I5FA 3V2GA 1YKFA 4YJGA 3TNLA 4BGVA 2FN7A 5KJ1A 1LI4A 1ZSYA 4R9SA 1AHHA 1O9BA 2Q1WA 1CRWG 1O8CA 4L76A 4R01A 3DAGA 3BMQB 4BNTA 4RPHA 4FSHA 1I10A 5A5FA 3GG2A 5DT9A 5TX7A 5A03A 2R00A 1BTOA 4CM9D 2C7VA 3DMYA 2O3JA 1DDOA 2YV2A 1PL6A 3FHLA 2Y1EA 3P19A 4NBUA 5JAQA 1A71A 1CEQA 4G5HA 3ZU5A 5KVVA 3Q3CA 3PWKA 1CETA 3KO8A 5AXCA 4IDEA 5KJCA 3I6IA 1HF3A 1LSSA 2EKQA 1DC6A 1I0ZA 4FS3A 5IXYA 1H2HA 3DQPA 3K9QO 5BSEA 8ADHA 1LQTA 1XHLA 3JD3A 4BV9A 1XWFA 2JCYA 3V1UA 4XCVA 2O2SA 3KSZO 5I9LA 3W4IA 3BTUA 5GZ6A 1UAGA 1EMDA 1Y8RA 3OJ0A 2Q3EA 4GAEA 5TQVA 4MIOA 4JN6B 5J23A 2EEZA 2AQKA 5B12A 3GHYA 3GT0A 1Q1NA 3DBLB 1V3TA 1VSVA 3N7UA 1PIWA 2H1SA 2NNLD 1SB9A 1NQ5A 4CODB 3U0BA 5BSHA 3IS3A 2Y67A 3PDUA 4RDIA 2FRDA 1KVUA 2PNFA 3WQSB 1MLDA 3DBHB 3QVTA 1YO6A 4YBZA 2GGSA 3WS7A 3ICCA 1DIRA 4PG6A 4IGFA 1F14A 2WYWA 1X13A 3F5SA 3BMNA 1MUUA 1VL6A 4BNHA 1ISHA 1YOVB 1FK8A 2CF5A 3D3WA 2PTGA 3LC2O 3EHEA 1NXQA 5IG2A 4XGKA 4BO7A 2ZTUA 2J3KA 5DBIA 4PG8A 1J49A 4YTEA 2PH3A 1NBOA 5ER6A 4PZDA 4P38A 3RAJA 5A05A 3HZZA 4IDAA 3DDNA 4I9HA 4BV8A 2NVUA 3ZW9A 1I33A 2DLDA 4B7UA 4QSMA 4BKQA 3AW9A 3DHYA 5B1YA 5EJ2A 3PJGA 3JQAA 4XB2A 1X14A 5ILGA 4RZHA 2PZLA 2O3QA 4WEOA 4Q39A 4X54A 3T4XA 1ARZA 3I9JA 3W1VA 4FB5A 4XQ9A 3HHPA 4E33A 4CQLA 3GQVA 1N7GA 3LQFA 4GKBA 2ZK7A 1NNUA 3JQCA 4UVHA 1IOLA 3K92A 3H3JA 1T2EA 1ZIDA 4OQYA 2PA3A 3OH8A 4MDHA 2VUSA 4R3NA 2W2KB 3WSVA 1A4UA 4BKPA 1S6YA 4CR8A 1PQPA 2NTVA 4DWVA 3WGTA 3NTQA 3GMDA 2AW5A 5JCJA 4J3FA 4BNWA 4PLPA 3ABIA 3LK7A 2W2LA 5TLSA 4XKJA 1WP4A 4O6VA 2ZJ1A 4CLHA 2VN8A 1PGJA 4GPD1 4CMHA 3O38A 3DOCA 1GYQA 3I1JA 1F8GA 2X8LA 2CSUA 1F0YA 3VTFA 4B79A 3LT0A 5C7LO 1ZK3A 3DO5A 4IDBA 3MTJA 4C7KA 3OFSA 4DQUA 3AM5A 5I8WA 3C24A 2BI8A 4W82A 4R68A 4D79A 2J3JA 1W4ZA 3HWRA 3LF1A 4N7RA 4QFCA 3FNFA 4MO2A 3GG9A 1H2BA 2BFPA 1ZXLA 2FPGA 2PZMA 2YY7A 5CG2A 3F1KA 3IP1A 3ZNPA 4D3FA 4DLBA 1WXDA 3DAPA 4ZQBA 1V3UA 2WE8A 2V6GA 1OOEA 1X7GA 1E5LA 1ISFA 2X0RA 3TDKA 3RJ9A 3C85A 1JN0A 4OO3A 4KTTE 4QEDA 5FF9A 2WD8A 2GN9A 3RFVA 3PPIA 5KJ6A 2VHXA 3QLJA 5ITWA 4EBFA 2D2IA 4DIBA 4ID9A 2NTNA 2ZB3A 1AGNA 1HDXA 3I3OA 1E1KA 4NHEA 4P4NA 3ZNOA 4B8WA 4NNJA 3FR8A 1Y5MA 4NH4A 4LRSB 1PZGA 3DMTA 4Q9NA 6ADHA 2FR8A 4Z9FA 5DOZA 4B4VA 2A94A 3H9QA 3V2HA 4KDFA 3C8MA 5IZ4A 5LDGA 4GBJA 4JROA 4RF4A 4D0RA 1DHTA 4CMBA 2DBRA 2CFCA 3DBRA 3KHUA 4JIGA 1JWAB 5TGDA 2PLAA 4GSKA 1VL0A 5AXAA 2ZATA 4YAGA 3PIIA 2YV1A 3ZWWA 1ISIA 4JJGA 1EBFA 3DBLA 4MVJF 4R41A 1B2LA 2J3IA 5A02A 5ITVA 1WW8A 4IZIA 1ZCJA 4CM6A 4FOOA 2WE7A 1IZ0A 1EBUA 3GK3A 3TN7A 4E13A 3AM3A 3BTSA 3GNQA 1A9ZA 3DBHA 2NV6A 1EDZA 3GLQA 5TT1A 4ZU3A 2Y1GA 3KM0A 3GNSA 4RJTA 1L7EA 5CPFA 1ENPA 3MTGA 2ZYGA 1KBZA 4AJ2A 1O6ZA 1YOVA 5L40A 2HCTA 4D7AA 3ORFA 4JBIA 3MWEB 4K6FA 1PS0A 1OMOA 5TJHA 5JDIC 1YDWA 4DIFA 3ANLA 5B4TA 2WTBA 3E5MA 1HDGO 4MP8A 1HZJA 4WLVA 4U5QA 4FN4A 3LLSA 2CVZA 1M75A 4IIVA 5L7WA 1UXJA 1JQBA 4FDAA 5IDYA 3NV9A 4RDHA 4P4GA 2C59A 4FBGA 4Y6PA 5TIIA 1CIVA 3TFOA 3WGZA 3ICPA 5B4VA 3C3XA 1XA0A 2GUGA 4XYGA 3G79A 3ROQA 4MVJP 1A7AA 2VWPA 3RUIA 1JWBB 1UP7A 2PKQP 3NTRA 1RM3A 3NJ4A 1C1XA 3OA2A 1SZJG 4GMFA 3RUEA 1Z45A 2OBNA 1IYZA 2CVQA 2NVBA 2PGLA 3L9WA 2EGGA 9LDBA 3I4FA 1BVRA 5K9ZA 2CDAA 2VHWA 2JKVA 3RU7A 3UW3A 1LBEA 1Q7CA 1RJWA 4O59O 3F9IA 2C2YA 4CM9A 1H93A 3BMOB 2OZPA 3JQGB 4FIZA 4D46A 3L6DA 4A03A 6LDHA 1PJ2A 4AJHA 2I66A 4NBTA 3WYBA 3JYLA 4Y6RA 2NSDA 3AI2A 1MGOA 1NFRA 1H9BA 2DFVA 4BO8A 1GY8A 3JQFA 4KWHA 1IUKA 4HKTA 3UOGA 1OC2A 5IZCC 3JTMA 3NDIA 3A1NA 1I24A 3DL2A 3RWBA 2X1HA 1ZK4A 1JA9A 2YZ7A 1A7KA 4XYLA 4CM3A 3QWFA 3IMFA 2NTJA 4CL3A 4MVJI 3KEQA 2EW8A 4CV3A 2EG9A 1AHIA 3WX0A 3IC5A 1J4AA 2I65A 3PQEA 1E7QA 3GGOA 2I99A 4I9NA 3I9NA 4PN3A 2LDBA 1YWGO 1E6WA 2B0JA 1YS4A 4TVOA 3NT2A 4JP2A 3JYNA 3N58A 3ANMA 3O9ZA 3VZRA 1ONOA 1TT5B 4YT2A 5F3RA 1E5QA 3U4HA 5FI3A 1T4DA 3GDOA 1VE9A 2NWQA 1YXMA 1PS9A 5FWNA 1J0XO 1NWCA 3ETEA 3QWHA 3CPSA 4QO8A 1X7HA 5KKCA 3ZCXA 2P2SA 1LQUA 1T1SA 1U3VA 3KETA 4J7UA 5JXWA 5TSDA 2V6MA 3ZWAA 2HMUA 3D3EA 3WOHA 5JNLA 3LLVA 1NFFA 1V0JA 5BSFA 1XYGA 2I67A 4I9UA 4Q3CA 2EJWA 4YEDA 1K89A 1EFKA 5EL0A 1LUAA 5F1OA 3KZVA 4CLOB 2AQIA 4XIJA 4S3MA 2HLPA 4FGWA 2B4TO 4ALKA 3L07A 2XF8A 4OXYA 5G4KB 5JAIA 5L9AA 1UP6A 1XEAA 3H65A 2QX7A 3EAGA 2FPPA 2YV3A 3P2OA 2DUWA 3G1UA 3RD5A 3QQPA 1YQXA 4BB6A 4L73A 2OFPA 3JD0A 1BW9B 3DZKA 3HDJA 1PGQA 1K5HA 2IYPA 1KVTA 2YDXA 4ILKA 4W7HA 5FI5A 4YA6A 3D7LA 4TVBA 5H81A 2IXBA 4B4OA 4MINA 3UHAA 4CLDA 2E49A 2IZ0A 1MV8A 2NM0A 2VRCD 4AJKA 3LYLA 3AOEC 4BO2A 4DRYA 1T2DA 4E21A 1IL0A 1B8PA 2X58A 3EDMA 1TA4A 4IQ8A 5KJFA 3VVBA 4EYEA 3DC2A 3EW7A 2IEDA 1B14A 1K3TA 1PGPA 2FPIA 3BTVA 4CUJA 1KEWA 5K0ZA 4XB1A 3K73O 2UV8A 2WD7B 5JDCA 3HFGA 4ALMA 2O4CA 1AN9A 3H4VA 2DTEA 2JD0A 3IUSA 1LLQA 3K30A 1XCBA 1SMKA 3M1AA 3E1KA 1QG6A 1XU9A 4A2CA 3FBGA 3QW2A 3WB9A 2O3UA 2JFGA 3GEGA 1A9YA 2BRUA 3ZDFA 4FC7A 1KEPA 2PR2A 4P22A 3WR5A 5BQFA 4R3WA 4JK3A 1N92A 2X7HA 1BG6A 1EEHA 2NU9A 1ML3A 1SAYA 1N9GB 4TROA 4NMHA 5CEEA 1DC5A 4J9UE 4RPGA 2D0IA 2B4RO 3KV3O 1WMAA 3H3FA 5JBIA 5TRTA 3U49A 3U4CA 2YHUA 3FNGA 3WICA 5HRUA 2GR9A 2O50A 4ND2A 3ZV5A 5L4NA 1KERA 1U4OA 3ULKA 3PP8A 4CJXA 1WNTA 4Y67A 5AYVA 2O23A 4U0KA 1T4BA 4KQXA 4II3A 1B26A 2XXBA 1LLUA 4BVAA 5F21A 3JQGA 3PJEA 3FBTA 2ZKLA 4IDGA 3VPFA 1JDJA 2WWRA 4CMCA 1ZSNA 4BB5A 4NFSA 3GDFA 4RCVA 1SNYA 3WFJA 4L8VA 1RM5A 4Q3DA 1Q0QA 4D3DA 3JQEA 1H0KA 3LDHA 1HSOA 4ESOA 5I7SA 4E3ZA 2JCXA 1GUFA 3HNPA 4YQZA 5CDTA 4LN1A 1YJQA 5C7OO 1DPGA 4AJEA 4WECA 1MC4A 1Y9AA 2B37A 1JTVA 4LW8A 4Z6KA 1Y8RB 3H9JA 5CG1A 2AG8A 4Z0TA 1LX6A 2G1UA 5AVOA 4WGGA 1PZEA 3WWZA 5ICMA 1EVYA 3K96A 3H7AA 1SCUA 3D4PA 2HJRA 4PLHA 4PLGA 1ZK2A 3LF2A 4CLRA 3ST7A 5DNAA 1O89A 3GVCA 4BNVA 1HETA 3PZBA 4QTZA 2HMVA 4XR9A 2AA3A 5TS3A 3U5TA 1C3VA 4JCOA 1YVEI 3E9MA 4DPLA 4BNYA 1W0CA 4W9NC 4WEQA 1QKIA 4MP6A 5AQ1A 2PK3A 3GRPA 4E0BA 1ENZA 1BXZA 4OMUA 4YPOA 1ZKMA 2VWQA 3M2PA 1LU9A 3H6KA 1BDMA 4IMRA 4RVFA 4KZPA 1WDKA 4XZ3A 4IQ0A 4G65A 4ZVVA 4CLOA 5AXBA 3OIDA 1ISJA 1KVQA 1YQGA 5KVQA 1GUZA 1WWKA 4NJOA 3TZCA 2ZJ0A 1DIGA 4BMNA 1Q7GA 3OIFA 3V8BA 4EI2A 2EW2A 4IZHA 1KC3A 4M86A 2I5PO 3JYOA 2O2YA 3NDRA 5LC1A 3WJ7A 3JQAB 4WE3A 3WMWA 1DAPA 1VRWA 3U4DA 2YQ4A 1I01A 4GVXA 4JQCA 1BW9A 2Y05A 3RROA 5MGBA 3GZ4A 3RUDA 2WSBA 4NFYA 2NU6A 1YL6A 2Y66A 2QYSA 2Q4EA 1OFGA 1I30A 4JNKA 2IE0A 1NWHA 2XPCA 1P1HA 3F3SA 1E7WA 2PZJA 3K31A 5BT9A 1LC0A 2NQTA 4YAIA 4GL4A 1IULA 1PSDA 3SLGA 5JSFA 3QY9A 1BRMA 5THKA 1PJTA 1HL3A 1XIVA 5DBGA 2DTDA 4WJZA 3H9UA 3WLEA 4YRBA 4U6SA 2OP0A 4H15A 5CDGA 2OUIA 2E6UX 2X9NA 4MPDA 2ZTMA 1XU7A 3VZQA 4KQWA 2GD1O 5ICSA 1DFHA 4FFPA 4GSLA 4BNZA 1E6UA 3RBXA 1XSEA 1Y7TA 4IQGA 5DP1A 2HRBA 1DAOA 1EUDA 1TLTA 4J0EA 3LT2A 4R69A 3SBOA 3OMLA 4TKMA 4B3IA 3ZHXA 1I2BA 2O3SA 1WAMA 5EPOA 3HQ4O 1XG5A 4INAA 1UDCA 2BF7A 3GFBA 3X2FA 1BXGA 1UXKA 3NAQA 1R0LA 1N9GA 2ZCVA 1E7YA 3CMCO 2CF6A 2VYND 3W6ZA 1PQUA 2GNAA 4PIVA 1MXHA 1N1EA 3W8DA 4D43A 5L51A 3GRKA 2X5OA 3ZV4A 2QW8A 3ZZNA 1GZ6A 2DKNA 2RAFA 3CMMA 1E3SA 5AXDA 4DYDA 3UGKA 1R0KA 5JDCC 1N7HA 1NX6A 1YE3A 2E48A 3ZNNA 4BGUA 2AEFA 4TRNA 4F3YA 1OZAA 3DEYX 3VKVA 3MJTA 4AJJA 4KWIA 4ZD6A 2B69A 4J1NA 4QT0A 4DPMA 5DBFA 3TOXA 4IXTA 3ASUA 1P45A 2VRBA 1HDOA 1ZBQA 4GWKA 3T7CA 3TZQA 4CUKA 4ALJA 3OM9A 1Z7EA 3UVEA 2VNAA 1DXYA 2EKLA 2P4HX 3PZRA 5BR7A 3VDRA 1CYDA 5JDIA 3TRIA 1VL8A 2H9IA 1N2SA 4BNGA 3DBRB 3U3XA 3GN2A 3RUAA 4M54A 3PXXA 3QWBA 4YAEA 1ZW1A 4Z0PA 1I3KA 3BA1A 3H9EO 3AUAA 4BQRA 4NR0A 4XA8A 2BMAA 1CDOA 1EDOA 4DTIA 2JD1A 2VOEA 3IOYA 3BYZA 4CLXA 4DVJA 2PY6A 2Y0EA 4EZBA 1A72A 2D4AA 4A26A 1IB6A 4IDFA 5IFLA 1E0DA 2FZWA 1PTJA 3D4NA 4J91A 3RCBA 4LSMA 3WTBA 1UDAA 2W4QA 4HFJA 1OBFO 2VRCA 4EJMA 3RFXA 2VT2A 1PX0A 5TJ9A 4AJ4A 4FC6A 4J9VA 4CMAA 3DZGA 5KJEA 1AXGA 2WDZA 3D5TA 3RKUA 4URFA 3TL2A 2GRAA 2OGUA 4CMJA 4YCAA 4GI2A 4DQVA 4DMLA 3VTZA 4MVJG 2IYOA 2WMDA 3P5SA 4GWGA 3KB6A 5T6BA 5G4LA 3FWZA 3WNVA 3COSA 2X23A 4A27A 5CHEA 2H6EA 1J5PA 3KSUA 3JQ6A 3W8EA 3WWYA 2A4KA 4PZCA 3VOSA 1DLJA 5IDQA 4J4TA 2YHIB 3VHRA 3VPSA 3KOUA 1EK6A 4OSPA 4RVUA 5IF3A 3VH4A 2BHLA 3RC2A 4ZGWA 1JW9B 3GEDA 1JAXA 5I7EA 2JJYA 4D44A 5IZCA 4LK3A 4MP3A 3KUXA 1GQYA 1QRRA 4B3HA 2GDZA 3F5QA 1H9AA 3QVOA 2HMTA 4J4HA 3ONEA 4RO0A 4UVIA 2JAHA 4TRJA 4XYEA 1FXSA 3HB5X 1P0CA 2CUKA 4E2WA 4TWRA 2FSVA 1JLLA 4NZ9A 4HV4A 1C1XB 1UXGA 1Y1PA 4MKRA 4IJUA 1ZUD1 1RM4A 4YRDA 5F1PA 1U2DA 1H6CA 3CE6A 2EGHA 1PU2A 4B7XA 1SB8A 4KP7A 4PLVA 2HSDA 3S2GA 1E7MA 1LRJA 4ITUA 3RFTA 1Y5RA 3OF2A 4FFRA 1U7TA 1GFSA 3B70A 3OJLA 5ENVA 4CLEA 5KOIA 1U4SA 4CM5A 1I2CA 4YXFA 1P31A 4E2ZA 4YQYA 1TI7A 4YB8A 1GEEA 3OICA 1LLCA 1M2WA 2E4AA 4JJIA 3WYEA 3BHIA 4DLLA 2VCYA 1V35A 3V1YA 3PI7A 4FR5A 1NQAO 5L7TA 4XQEA 1AXEA 3ZWYA 2DM6A 3BAZA 4YRAA 3NUGA 2QRKA 3DXFA 3W4KA 4RF2A 3WGOA 1PGNA 4JLWA 5IN4A 4P8RA 1ZEMA 4OSOA 4IM7A 5A3JA 2DBZA 3O4RA 1D1TA 1XKQA 3R6DA 3EGOA 4RLSA 3O03A 4XYMA 1ZEJA 3RVDA 2IZ1A 3GHHA 1B3BA 2VZ9A 2QHXA 5I9MA 4NIMA 1E3IA 1ZVMA 3C7AA 4WOJA 3UN1A 4WCDA 4EUEA 5F1KA 1G6KA 4HFRA 4CMEC 1C0IA 2CNBA 4W4TA 2ILTA 4WOKA 1ZMOA 4IS3A 2H63A 3ROKA 3KLPX 1XLTA 1QLHA 5COBA 3GEMA 1G1AA 5JE8A 3I83A 3KYDA 3B6ZA 1KETA 3ZWCA 4FW8A 2B5WA 1CQJA 4UAGA 4N5LA 1ISMA 3A28A 2VHZA 2D5AA 1PJLA 1M76A 1NPDA 5GZ3A 3AOEA 4UVEA 5C7IO 4OH1A 3SXPA 1YL7A 3E18A 2IZZA 1B15A 1JVSA 2BKAA 1F06A 3IKVA 2FHSA 4XIYA 1Z75A 5JO9A 3GF4A 4UEJA 5T5QA 4BL5A 1KVRA 3WXBA 4CV0A 4HXYA 1ZMTA 3P2YA 1NFQA 3QHAA 5KWEA 3L4BC 3G3EA 4J2HA 1UXIA 3GAZA 2C2XA 4JXKA 5F5NA 1XQ6A 4E5YA 1V9LA 4WLEA 5COQA 4L4RA 4XD2A 4RGBA 4ZRNA 3KVOA 3UCEA 1NM5A 2NU7A 1YONA 2EXXA 4B4UA 4XDZA 2DUUA 1E1LA 1X1EA 2GN4A 1HE2A 1ORRA 2X5JO 3FWNA 2OMEA 1C14A 1Q2XA 2O3RA 3NJ8A 3F6YA 5I9NA 4D45A 1GR0A 1I36A 3WGIA 4M55A 3GNTA 2PKRA 2ZB4A 4XX0A 1ADCA 4K1LA 3DHNA 3FPLA 5HBRA 1SBYA 4CM1A 3EC7A 3AWDA 2BELA 4YT8A 1YBAA 3DB2A 3GR6A 3QWIA 1HEUA 1E7SA 5JCXA 5H82A 2F00A 5DDIP 3ZWBA 1JKIA 3VPXA 1R66A 1PZHA 1R16A 3H8VA 4DYVA 3ZV6A 4TZTA 1Z7BA 1ZFNA 2YHIA 2Z5LA 1B8UA 3W4JA 5DP2A 3HB4X 4AJ1A 3KRTA 3ZWXA 2PD3A 4LGVA 3QV1A 3I23A 2GPTA 1QYCA 5L3ZA 4MVJH 4J0FA 3DHEA 4BS9A 3PHHA 1IY8A 1GZ3A 3ITKA 1N1GA 2VYNA 4IY1A 5A04A 3PYXA 2Y1CA 2PD4A 2C20A 3AI3A 1Y81A 2BI7A 1UJMA 3PYMA 2RHRA 1DC4A 4BNJA 3QVXA 3NGLA 4MJLA 1E6EA 4D0SA 1VJ1A 2RCYA 2OL4A 4P4LA 2QRJA 2G5CA 5JYEA 1EQUA 1O94A 3KTDA 4RF3A 5T8KC 2DBQA 3RQSA 2PKQO 2UVDA 2BFAA 4HNGA 4UVDA 2RBEA 1ISGA 1I2ZA 1CQIA 1P1RA 2GZ3A 2PV7A 3FI9A 3SJ7A 3QA9A 3IKTA 5COAA 1O5IA 4BO3A 1EFLA 3K5PA 4FQ8A 1R4MA 4W9NA 3C1TA 1ULUA 1JVBA 3HN7A 1DIAA 2J3HA 3V5NA 3UAGA 2B4QA 4EUFA 1Z82A 4IBOA 3WIDA 1VKNA 4PG5A 4J2OA 3ZV3A 1XDWA 3M1LA 1ZZEA 1GYRA 3WNQA 9LDTA 2Y0DA 3C7DB 2FY8A 5K6AC 1LSOA 3I9LA 5HS6A 5BNTA 2NADA 1VM6A 5A9TA 3HDQA 4XR4A 1D1SA 1PR3A 4CLRB 1NHWA 3OECA 4GQAA 5ADHA 5CDUA 1HLPA 1Y9EA 4ZRMA 1JKFA 3P7MA 1L1FA 1HE3A 2GZ2A 5ES3A 4E2XA 3WBBA 5DULA 3WGQA 3AI1A 3AUTA 1T26A 1OI7A 3MWDB 4Z3DA 5G2OA 2QG4A 4A10A 4PVCA 2V6BA 3N74A 2I3AA 4Z9YA 3DR3A 2Q2VA 3ETDA 1DLIA 3TWOA 1FDVA 2FZEA 3WQRA 4YYZA 5KCZA 2J8ZA 4M1QA 5A4DA 1DC3A 1BSVA 5BNFA 3QJ5A 4E6PA 4PLYA 5KIAA 4CQMD 1RYEA 5GY7A 4CMGA 1NVTA 3TJRA 3JQBC 4UULA 5G0SA 3ONDA 2H5LA 2DQ4A 1U8FO 4XRRA 3Q0EA 1YQDA 1ZJZA 4NBRA 5MDHA 5IDXA 1GEGA 1P77A 1T1RA 4AG3A 4RZIA 4AJNA 3GUYA 3WIEA 4L0QA 3S2FA 3GFGA 3GVXA 3EUWA 1T2CA 1U9JA 4WPGA 2HAEA 1C0LA 2EP5A 4WK6A 5ILOA 3PDJA 4U0JA 4GX0A 4GLLA 2CDBA 4MKZA 5KVSA 3KBOA 1T2FA 4XRGA 4BNNA 1FDWA 3KYCB 4IIUA 3EZYA 4NK5A 4UUOA 3TL3A 3CINA 4CPDA 4BHTA 2HK7A 4UUMA 4E4YA 3L4SO 1AE1A 4F6CA 3S8MA 1NPTO 2ZTVA 1U5AA 1GUYA 2WEKA 1HTBA 3CH6A 3ZHZA 1JKJA 3OETA 4EGFA 4CM7A 4N18A 4PCVA 1GTMA 2IDZA 3NYWA 4BNMA 1GL3A 4FJ0A 2VQ3A 4Y8VA 5CDYA 3I5MA 2R6JA 3EYWA 3G49A 3OEYA 2C5EA 3FCOA 2CVOA 3GDGA 1LNQA 2X5KO 3F4LA 1P3DA 1MFZA 2VYVD 4Q3EA 5IN5A 3ANNA 1EVIA 5JY6A 3DFUA 4MOWA 4WKGA 2C0CA 3ENNA 2CMDA 3I9KA 3NRCA 4GX1A 4IGEA 1R4NB 3ENKA 1EZ4A 4YVFA 1SOVA 4YJFA 1BXGB 4HFNA 4CV1A 1X0VA 4UEOA 1B0AA 3NT5A 3VC7A 1KC1A 1M66A 1NAHA 3LSYA 4OOEA 3PIDA 2BD0A 1KIFA 4NDNE 3STHA 1UZLA 2X86A 5DOVA 1GQQA 3UCXA 3F46A 4L75A 3JD1A 4J1SA 3AFMA 4BKUA 4BKRA 1Z74A 5KVCA 4Z3KA 1YB5A 4QUKA 5U1PA 4AICA 3IL2A 3G17A 3A06A 2A9FA 4GH5A 5BNIA 4B8ZA 1FDSA 2HRZA 1XR3A 1W6UA 4FFLA 3CZMA 2DVMA 3DOOA 3VH1A 1QXSA 2SCUA 3RBZA 1IZ9A 2X9VA 2HKIA 5EIOA 3S2IA 4BKOA 2DAPA 3RBVA 4U6QA 4H7PA 1K6IA 3OP4A 3FSRA 4RQTA 4WCFC 1MX3A 3PK0A 1IHYA 1LDYA 1CERA 1WMBA 5TF4A 3WDSA 4WUVA 4CQMB 1LSUA 4II2A 1C1DB 3MJ4A 3CZRA 3I6QA 1GV0A 4GVLA 4J49A 1MG0A 4LRTB 4NFHA 3RUCA 5JCJD 4RV9A 5BSGA 2WM3A 1DBVO 2GLXA 4XJTA 1DRWA 3JQ9C 2ZQZA 3S55A 4MVJD 4OKIA 2D59A 2X22A 3H2ZA 3OJEA 4WASA 1NVGA 3UCFA 1GCUA 4E32A 3DBVO 3JV7A 1WLYA 5EERA 1E1MA 4DIOA 5T67A 3ZWVA 5A1TA 1WZIA 1DEHA 3PVZA 1NYTA 1HE4A 2HU2A 4NBVA 4R16A 1DFIA 3EVNA 5B37A 3VPGA 4OOFA 1U5CA 3TFQA 4PRKA 2CDCA 3AU9A 3PQFA 5EESA 4RORA 3Q2IA 4FFMA 3OEWA 2V65A 1HDYA 3E9NA 3UF0A 4ND4A 4H16A 4RL6A 1SC6A 1MA0A 1LDMA 1Y8QA 3DZJA 3RI3A 4HBGA 3WMXA 4OIMA 1NP3A 2HMSA 2PFGA 2B35A 4J6FA 5L4SA 3OSUA 3QWAA 1HWYA 1LSJA 2Q46A 3GUCA 1TVEA 3C1OA 4XEHA 2FSSA 3E5RA 4BNIA 3D64A 4DA9A 4IDCA 1YBVA 1NTOA 1L7DA 3ROPA 3ZU3A 2GSDA 4I08A 1I5RA 3E6AA 2VUUA 4YJHB 5TNXA 4IINA 3WYCA 1ADBA 1HT0A 3LU1A 5G0UA 3E8XA 1WVGA 3MZ0A 5LDHA 4OKNA 3RC1A 3QSGA 3ZN2A 4AJLA 5U4QA 2ZYAA 4BNFA 4OQZA 1BWSA 4YDRA 2POQX 3C1AA 4J90A 1N8KA 4CL8A 5A06A 3GH3A 1EE2A 4GX5A 3JYPA 4DC0A 3Q1LA 3KYCA 4UUPA 3ONFA 3VKUA 5HA5A 1YH3A 1H5QA 2P68A 3RKRA 1SOWA 2XXJA 4PFJA 1EK5A 4CMEA 3RUFA 3UICA 3OJFA 4IPTA 3AY7A 3Q2KA 4GGPA 3CEAA 2EKPA 5C5IA 4EEXA 2QZ9A 2DFDA 2LDXA 3GVPA 2VT3A 1LLDA 2JCVA 4XGNA 1PJ4A 2UYYA 3HADA 3PRJA 4ZHSA 4IDDA 2GCGA 3DZFA 1DB3A 1SEVA 4HUJA 1PL8A 1HDRA 1ZK1A 2UUPA 4YAJA 2BGLA 1A27A 3K2BA 1P1FA 1F17A 2WYUA 4JX8A 4ZQFA 3GY0A 3TZ6A 1R4NA 3FNEA 2G76A 1C0PA 2ZQYA 3DZBA 1T24A 4FD3A 1G0NA 3K2EA 3LT4A 4FJ1A 4YJDA 1DO8A 1D4FA 3DFZA 2GYYA 4HADA 3PGXA 3WTCA 3ADOA 4EJ0A 5G0TA 5JLAA 1OC4A 3IP3A 3B1KA 3L4BA 3PTZA 1RM0A 3WQQA 2FWMX 5DCWA 4ND3A 3W8FA 1XQ1A 3DZHA 5JMPA 2IXAA 2HMWA 1RPNA 3KYDB 4PLWA 2GN6A 3O8QA 2VOJA 5I7VA 1DRUA 3VVCA 5EINA 5L95A 5A9SB 3AJRA 1VJ0A 2O7SA 1SO8A 3HDHA 1MG5A 3CTMA 2AHRA 3NEPX 4DREA 2AQHA 3FN4A 5JY1A 1QYXA 2V6FA 4GMGA 1P1IA 2OBYA 1GPDG 3S1LA 4D3SA 1DIHA 4MVJE 1E3WA 3WG9A 4R51A 3GC6A 5L7YA 4RPLA 4EDFA 2YJZA 2ZIZA 2HJSA 1T2AA 3JQDA 3UH1A 3T4EA 2HUNA 1ZJYA 5A9RA 4CQMA 3MEQA 1C1DA 2JAPA 1E3LA 4DC1A 4JBHA 2Q99A 1DJQA 1E92A 4R9RA 1CJCA 4B3JA 3ETGA 3EMKA 1QV7A 5DF1A 4O5OA 2IODA 3AU8A 4LCEA 4N54A 5KNLA 5G0WA 4F46A 4RVSA 5CAEA 3BXXA 2DPHA 2OHXA 4YWJA 4GGOA 1MXFA 2AEJA 1GZ4A 1LDNA 2AMFA 2HDHA 4IJVA 4YT5A 3HE3A 5L45A 4O1MA 1S7CA 2Z1NA 3QVSA 4ONEA 8LDHA 2Z1MA 4EUHA 1HDZA 3TZKA 3VH2A 1UUFA 2B36A 1UXHA 2FR0A 3PJDA 4NQZA 1PJBA 4OGWA 3SEFA 4DL9A 3GPIA 4KDEA 1PJCA 1HYGA 4HP8A 3KYBA 3I9MA 4PLTA 1FF9A 2RIRA 2VNSA 3ZH2A 3INGA 4AJPA 3EK2A 4AJOA 2AG5A 2EJVA 4GLOA 1VPDA 1VJTA 3R0IA 4EEZA 2D8AA 4LMRA 3AUUA 4L74A 3RC7A 4NK4A 4QECA 4DXHA 4IJWA 4PG7A 4IXWA 1GADO 3GGGA 1PS8A 1U3WA 3PLRA 1DOHA 3Q9UA 5HWSA 1JU9A 3G0OA 3JYQA 5LCXA 5TT0A 1YB4A 4ZICA 5T8KA 2VYVA 1Q7BA 4ZN6A 2YUTA 1LC3A 1P0FA 3EY4A 3JQ7B 4B4WA 4WCFB 4DLAA 1HSZA 1X0XA 2G0TA 1TT7A 3GA0A 2F1KA 4YJHA 4J1TA 3VH3A 4ALLA 1PR9A 4FGSA 1M6HA 2YDYA 2PD6A 5JAZA 2Q45A 4Z9XA 3INRA 3R3SA 1DJNA 2RH8A 4M87A 2YFQA 1W8DA 3HUDA 1XGKA 4WLUA 5JC1A 1K6XA 3R1IA 4KTVE 3RU9A 1LA2A 1PJSA 3H9GA 4LMPA 2NLOA 3OIGA 1LEHA 4BNKA 2I3GA 2C5AA 3UFXA 5K6AA 4O0LA 1WDMA 3SVTA 1P74A 2DPGA 4WNCA 3WLFA 3O26A 4CMIA 3MOIA 4TRRA 3TQHA 4A5OA 3GOHA 1O95A 1NVMB 1HE5A 5FYDA 3IJRA 1I3MA 4NJMB 2G17A 5IJZA 2VTDA 4K9DA 3CIFA 4RQUA 2ZB8A 1BMDA 3FF4A 1DIBA 4KUGA 4CM4B 4J1QA 4WLFA 5KKAA 1R4MB 3F47A 4LISA 1V6AA 4ZQHA 3PFWO 4NI5A 4R5MA 5GMOA 2XOXA 3E48A 3FNHA 2O7QA 2Q2QA 1PGOA 2HQ1A 4IUYA 2DC1A 4XJSA 3VZSA 1Z73A 3A14A 2P5UA 2JFHA 4MVJA 5A5EA 4BNXA 4JJFA 1K6JA 3INTA 4D42A 5JPIA 2C07A 3JQBA 5ENDA 3MJSA 3AY3A 4BNLA 1MB4A 1CWUA 1PEDA 1UZNA 4OXKA 4MIYA 4RPJA 1I32A 4L4SA 4M8SA 4DQXA 1RKXA 2VUTA 1LDBA 1PQWA 2QZZA 1E1NA 3RSHA 3WGHA 1HYEA 5TC4A 2BFMA 5B4UA 2JHFA 4UEKA 1R6DA 3LT1A 4BMSA 1LJ8A 5A9SA 3NKLA
chains in the Genus database with same CATH superfamily
1M5RA 3BHMA 3WL5A 3TNDA 2WAAA 4KO8A 5FKJA 3TBKA 2IV7A 4ACAA 4PZUA 1XK7A 1WVIA 2WY2D 3WA7A 2GN8A 4XD7A 1K2VN 1ORIA 2O7NA 3CG4A 4WZBE 4EHAA 1WO8A 3PHIA 1C8LA 3ZDEA 1TTQB 4R1TA 5K4AA 3I1IA 2G83A 2VZEA 3FOCA 3RJ5A 2HLNA 2NVWA 4IILA 3TQIA 2A2ZA 5KQSA 4FKMA 1NI4A 4YUWA 3QE3A 1N2CA 4NMLA 3BXHA 4DMMA 1X92A 3TD6A 4WK2B 3HRHA 3PTLA 1HE8B 1B3RA 2PUCA 1GT6A 3WB0A 3RRMA 4D9NA 8AT1A 1RTTA 4KQFA 3HJGA 3PD1A 5AKHA 3C7KA 4MPTA 1V3VA 2H06A 5BOSB 2QOEA 3MC1A 1HFJA 4J7AA 5FNVB 4WOCA 1OYWA 1VBFA 2C5HA 2ZITA 3QF4A 2NIPA 3LGXA 3EIEA 5T57A 1UDBA 4RDCA 4N5MA 4ES6A 1DXHA 1ZHFA 1UPCA 3B85A 3D0OA 1YL5A 4NBWA 5EN4A 1PG0A 4ZO7A 1L3BA 2R11A 1GTRA 1RZRA 3CWQA 3GGJA 4B0PA 2AJ8A 5JISA 3RW9A 2AQ8A 3GROA 1WCV1 5DM70 5C5CA 4ESHA 4INPA 3IAAA 4MWGA 2Z6AA 1W19A 1LQ2A 2G0NA 3RS8A 2B2NA 3OUTA 1T1JA 3K0FA 4FDVA 4XQGA 5BMVA 4UREA 2R00C 3O8DA 1DQSA 3WGGA 2DPMA 4B4KA 4DM4A 2HADA 2ID8A 1CR0A 3S2SA 3W2HA 3BRCA 4JOSA 2R8XA 2O2EA 7REQB 4C43A 1GRVA 1Q0HA 1BYUA 3RK4A 2GK7A 1L0BA 4C2AA 3ZDAA 4I5GA 2JHGA 2EBFX 2PZEA 3CX4A 3B82A 3FNIA 1BE1A 4JHXA 4OK6A 3L0PA 3CLHA 1KFBB 1NIPA 4TKZA 4AUKA 1VG1A 3T0FA 1U3UA 2ORWA 4MW4A 4EKDA 3RUHA 1W46A 2O4UX 3TM4A 2VDOB 3E0QA 1IAQA 2FW8A 2FLVA 1MC5A 5ALRA 1AUQA 1Y5NA 3ILXA 5D5PA 5IXSA 3NBZC 2CXSA 2R44A 4EFDA 2XB8A 4W6ZA 2UXDB 1NMQA 2V97A 3SZUA 2VPXA 4H1HA 5ALDA 3MRSA 1E9EA 1TNDA 4QOFA 3WV5A 1GSOA 4Q0MA 1NF2A 1MRSA 2XVZA 1C3OB 4YP0A 1SUPA 5DGDA 4DA7A 1ESNA 1E4EB 3OAAA 1X7DA 1NN5A 4XGQA 1THMA 3CXRA 3V8VA 3RRZA 5HIKA 4JDPA 1E2MA 1EGHA 2XVMA 1L7XA 2HN9A 1U7DA 3VFDA 3K0EA 5KTMA 5DHPA 4HMQA 5AHKA 3OPYB 2VHQA 2X0JA 2ZRKA 4LJSA 1JAZA 4MDYA 1TZJA 2CHGA 2X6QA 1PWZA 4MPJA 3AVTA 1G21E 1Q11A 1UAYA 2VZ8A 4UTXA 4AURA 4WZAE 1KQFA 3SQDA 3EGEA 3ZWNA 4FSXA 4IEIA 1KSHA 4OJMX 1KEUA 5JVDF 5AW6A 4BWVA 1QK3A 3AESA 3L41A 1CQPA 2YBDA 3DTYA 1NMEA 2ERYA 4QULA 4ITRC 4D74A 1WPQA 3QVWA 4NG5A 3M6FA 3TZLA 3NASA 1ZD9A 4TQ9A 5BV8A 5IXJA 2YWXA 1U28A 1IBCA 4ARVA 2IY8A 2IBMA 3SSMA 3OPQA 4Q1AA 1OSNA 1BJRE 1KRHA 2WP8J 3KQYA 1M2KA 2JB9A 2BUBA 1A5ZA 3GMSA 4QOJA 4XPIA 3I5XA 1B8VA 4BVHA 4U7JA 3NGMA 3IAHA 4KXVA 1TTTA 3K20A 4OHOA 4E5KA 4KXLA 1EFPB 2EERA 3FGPA 2BP7B 4QAQA 4CTJA 4D4GA 1JALA 2PRJA 1KQGA 1IHUA 5JHGB 3AFOA 3PWZA 3Q9LA 4R84A 2FX2A 4Y6LA 3TKYA 1IXYA 2P11A 4BVBA 2GZHA 3EW9A 4IJKA 2C7PA 3FUWA 4AZ0B 3CX3A 3OZIA 4N6GA 3GGPA 3QM1A 1TUBA 5LZ9A 3KXKA 3DMHA 4PGFA 3U9LA 3ZWOA 1X8KA 3TSCA 4CF5A 4YR9A 1IHXA 2HHAA 3N0VA 4YFVA 1UF9A 2QXYA 4B1FA 3V4OA 3TLBA 1VCMA 2EFDB 2H1LA 4XVUA 4HR7A 1K3UB 4FFWA 4OXIA 4L9RA 1FDTA 2UZ1B 4J3NA 1NR7A 3IQGX 4UUNA 4X1KA 5EMHA 2A1UA 2HF9A 3HGTA 4X00A 1ND5A 1NASA 1GAEO 5BW8A 3FKSD 1ISRA 3KXIA 3GVIA 4YV2A 3AI7A 1W2WB 1NSFA 2J0VA 1AX9A 1V47A 3MINB 4P5DA 2YVUA 5DNCA 1Z34A 3GUVA 2C9BA 2H85A 3ZC3A 1WOYA 2PH5A 4EELA 4U2BA 4RVOA 5LXTF 4F6RB 5FO1A 3Q7EA 4KFRA 4P7FA 2H16A 3H5RA 4TRMA 1MW9X 4B9AA 1M8GA 1XNHA 1LZKA 3PNLA 4G81A 1RDFA 2E3JA 1RYDA 2VJQA 3EEQA 3QZUA 4N3BA 3U62A 4WVFA 1VI2A 4XTRA 1ODJA 2ZSKA 4POAA 4RV4A 3ZIDA 3USES 4X62B 5BWBA 4JIMA 2VSYA 2PJZA 4RIFA 4Q9IA 2GO1A 3PGJA 3IKLA 2F90A 4S1NA 4BO1A 2JRLA 1V41E 5JNUA 2FP4A 1KEVA 3UB3A 5AQEA 2P6UA 3K8ZA 1X80A 5EZYA 2H59A 1EDEA 3V2IA 3GPDG 4OJNA 2Y1OA 1NOJA 4LY9A 3GARA 3VNVA 1KY5A 1L8XA 3B5IA 2XCRB 3A6EA 3K6JA 1NG9A 3ILHA 4P84A 1E2DA 1Z25A 5K3BA 2J9FA 4ZV7A 4WLNA 2V6JA 4CEIA 5I8ZA 1IVSA 2QD3A 3Q10A 1OROA 3GJYA 1V16A 2P5YA 3SKVA 3U3ZA 1YIAA 3LWDA 4XM1A 3WKDA 3UUWA 1ZAKA 1CFJA 1NAIA 2ZAYA 2C3YA 1WKCA 3LWBA 4PR0A 1YZ3A 3AKZA 3QE9Y 2LPMA 4YRPA 4YBRA 4NU5A 4I4NA 4XIFA 4CKEB 2W8BA 2AEMA 3RS2A 3R5FA 4RTNA 4IRUB 1NW4A 1XDZA 2JATA 3IQWA 4N5NA 4Z49A 1JXMA 3OZRA 1EUCA 3NAGA 3ILYA 2XDWA 1SUDA 2HSEA 1CHNA 1OXVA 2J31A 2V9ZA 3QUSA 3V3TA 4HZGA 3UKDA 3KU4A 1G21A 2VEOA 1F2DA 4L6AA 2JLQA 4R8LA 1SVOA 1OFUA 4E7PA 1Y4DE 3L6EA 4KWTA 4QX6A 3LBAA 2XDQB 1D7OA 4IX9A 2E7ZA 4HDQB 1XL1A 4HFMA 5GV7A 5AVRA 2HPVA 3U09A 1E96A 2W6OA 3CRQA 3P2MA 5BR8B 1WHTB 3MIIA 4HX5A 3MWEA 3JQPA 1HLDA 1HC7A 5CEJA 2A0YA 1PZFA 2P4QA 4GLFA 4UATA 5DV9A 3TRJA 3U44B 4LSWA 4TKLA 3E84A 4WINA 4XJXA 2BGUA 4GI5A 1NW8A 2OHGA 1DHRA 2IHJA 3HG7A 2QXUA 1O5OA 4HWKA 4EARA 4UBOA 2JK1A 2R1VB 2VJNA 2W6ZA 3L79A 3REOA 3ZI7A 3TB6A 2ZSBA 2WFZA 1JAYA 2QUHA 3O94A 4W5RA 3H11A 4RMIA 3DLBA 1W76A 3PCRB 4RV5A 5AK3A 4AN0A 4LKOA 4U9HS 4R71A 2VHCA 4QUDA 3SBDA 3PFFA 2AR7A 3AHIA 2NQ8A 1XT6A 4IDNA 4ZK6A 2AXQA 3VOBA 2O1XA 3I0MA 4KE7A 4PHGA 1UKYA 2ZPUA 4X6YA 4FFBA 2ZM6B 2R8YA 3FTPA 1JG6A 1N33B 2P4EA 3CA8A 3FFXA 4UM7A 3X2EA 1QP7A 5FBKA 3IUMA 2JFFA 4K26A 3NBUA 3RRNA 1F4LA 1E77A 2XD9A 4K3UA 1FB5A 3EA5A 1M67A 3ZU2A 3RNOA 1L3IA 5FUWA 3GFRA 1UJCA 1VSUA 1D8AA 1TLLA 1CUGA 2ZJ3A 4YCNA 3FHTA 4IMPA 2BFCA 5B2EA 2CVFA 3ZE6A 2Q6TA 3FD8A 2IUEA 4JA0A 2VVTA 4OAOA 5D01A 5LYJA 3IP9A 3G2QA 4G2NA 3GD7A 1TO6A 4BUJA 4PZZA 4G1VA 5BSVA 3K71B 3HPQA 3RS3A 2BR3A 4H3HB 1TMOA 2ATVA 2ERCA 3BMOA 2RHGB 1Z2OX 2W5UA 3FJYA 1JDZA 3M4YA 3MAGA 1D3AA 4TV9B 5BP7A 3QFHA 2QQ5A 1VLLA 2GM5A 2HV9A 3EFEA 2EC5A 4RHXA 3PQDA 3SSOA 1JDBC 3RAFC 3C3PA 4R9NA 2O0HA 4EAQA 1Y6FA 3IEMA 5CYPA 4A2WA 3CX8A 5JH7B 4PYRA 4B80A 4KITB 1P1JA 1LI5A 2LIPA 1DWOA 4FOLA 4X20A 4YH1A 4C78A 4C7OA 1F3OA 1E2BA 1ZH6A 1J8FA 3BWDD 4K8OA 4CCYB 5LKRA 5M29A 1T0JB 1MVOA 1G5RA 3QI7A 3EN0A 4RHEA 3ECSA 4H7DA 3DW1X 4HJRA 4U6NA 1TIPA 4UMDA 2O2XA 4WXRA 3FMPB 4C4YA 2R87A 3SX2A 1C4WA 2IRWA 1ADGA 1R3DA 3DV0B 4JBNA 3U26A 3X1WA 1UP4A 2JASA 1SVLA 1PTKA 2C5GA 2J6CA 2H2WA 4OXNA 1OU0A 4BJHB 2Q50A 3M3DA 1M6VA 3VR3A 1SXIA 5K2MA 2BLLA 4FFNA 4MKXA 4A91A 1TT5A 1XNQB 4G1MB 1PJQA 3KQPA 4ALIA 1GQ2A 3B1FA 2DPXA 5CGQB 4F45A 4J43A 2VHYA 3SLKA 2PMKA 2A5LA 1Q12A 1U90A 1ADFA 1E66A 4YLGA 5AOAA 4TZKA 5EP2A 2QTVA 4EMUA 4D6XA 2AX3A 3O2QB 5J3JA 2GERA 2GETA 3V1TC 3AFNA 3H05A 1OI4A 2GBFA 1Q22A 4Y9DA 2G0AA 3AM4A 3PEFA 3A1SA 1O4WA 5KNDD 5H8WA 1EP9A 3QBJA 1K08A 2XZOA 4E31A 3THYB 1GA4A 1Y8CA 3G23A 3H1PA 5D85A 4BO6A 4EHFA 3H4TA 4ZQEA 1VL5A 1XRMA 4NJEB 2X4GA 5AJWA 2VWHA 2V3CC 1UWKA 3CN7A 4GOLD 4KJXA 2VJPA 1IN6A 2PS0A 3NH6A 4X63A 2AUNA 1N5OX 1XJQA 5CK5A 3DEJA 3TINA 2ZCJA 4HWTA 1B0PA 4WDQA 3SN6A 3K05A 3WWOA 4DG8A 4YAKA 2BFBB 5IM4F 2JA2A 2KE5A 3ZNQA 4F3KA 7MDHA 3PPXA 5B1EA 1BVUA 3PQ5A 1JHDA 1QLJA 1QYDA 1TCVA 2W98A 4INJA 4UVGA 3NV7A 5YASA 1ULSA 2FKNA 3LPMA 4IRXA 4JLAA 5TPWB 1D0IA 3TAXA 3DDUA 2YVKA 4PHHA 1HDCA 1Z39A 4LNUA 2CWDA 1E0AA 4W5NA 2W83A 3K0BA 3PSAA 5DCUA 1KOLA 2TMDA 4RTQA 2E82A 5CEFA 5A3SA 4Z4FA 1NT2A 4B8WA 1FQKA 4BAUA 2LIVA 3DKVA 2XQGA 1M3SA 3EZLA 4NARA 2H4XA 2O48X 4X3PA 4C04A 3QKSA 4JP3A 4DCGA 1RWVA 4MGZR 2WIGA 3GT4A 4NESA 4CQLB 4HN4B 1P75A 3Q3VA 2L17A 3ZW8A 1DT5A 4FNAA 1MRZA 3H8JA 1RZRD 1KAHA 1RAHA 2C03A 2I6FA 1SHLA 2L19A 3A9UA 2WWYA 4EP1A 4W7IA 3TW8A 1IQPA 4JLKA 5I47A 2O0KA 3RVQA 3V46A 5C4MA 2BWJA 1TCBA 1XTIA 3NETA 2XKBA 4G1EB 3LZCA 4I55F 4EZEA 1FX0A 3QUAA 1ADJA 1SQSA 3JD4A 4KQGA 5E4YA 2IEAA 3C7CB 1GG5A 5HTOA 1IPEA 1QSGA 3HXLA 3HYRA 3SP1A 3FYSA 3AC0A 3CNEA 3MWJA 3JD2A 3O6VA 1X1SA 1U2TA 4OYYA 5CVTA 1I1QB 2VT6A 3IUJA 3ZQUA 2Y99A 4RH3A 3WFIA 4EY6A 5KTRA 3OTOB 4NPCA 4HXGA 3TTSA 3RBAA 3UZUA 3V6MA 3HDTA 3EGWA 1G2PA 5DU2A 3MJDA 2H1IA 2Q5LA 1RWKA 3S8EA 4C29A 4C7JA 3OWHA 1F12A 2A35A 3QHPA 4ZOEA 4HEJA 2XWJI 2WKPA 3IP6A 1HT3A 1BXKA 3HNRA 4CYMA 1RHQA 3MFQA 3PS9A 2XHZA 3FKJA 4K9QA 5A3VA 1UT5A 4PRLA 3G8YA 2R7AA 3LC7O 3DVRX 5FL7D 1WSBA 1ZGBA 1ZN8A 3FSEA 3S2EA 4ZVNA 4FP9A 3L9XA 1R2QA 2ZTLA 4O08A 2WIAA 1E1DA 1O6CA 1P2GA 1S9DA 1WXXA 1XD8A 1Z4KA 4QBHA 2WI8A 4YRJA 3TNLA 2O20A 4BX0A 2OENG 1AIPA 3WVNA 3LRTA 3S1SA 3RDPA 4CI0B 1E2NA 1QIKA 4R9SA 5DH9A 2Q1WA 4JVLA 1O8CA 1R10A 1RXEA 2I8LA 1Y3FE 1CUXA 2ZVQX 3EZ9A 3ZZMA 1Z4NA 4I50A 1II8A 2IHNA 4J0CA 2PN1A 5ILQA 5IP5A 5DT9A 3AP2A 5TX7A 2R1TB 3A9TA 3G9ZA 4YCCA 5C18A 2K4MA 1BTOA 3FYUC 4CM9D 4JENA 4AUMA 5C4GB 1QNFA 1IVNA 2MSNA 1VBKA 2YV2A 3DMYA 5EXSA 5KNBA 1PL6A 5HNKA 2VXCA 2CHUA 4B3XA 1OX4A 2CMFA 3NDPA 2Y1EA 3P19A 3F9RA 4NBUA 3AIMA 5JAQA 1THZA 2LKCA 3AUFA 4QRIA 6Q21A 1NXSA 3Q9SA 4GRDA 4V24A 3R3ZA 3ZU5A 1LY1A 3CBGA 2GLUA 2Z9BA 2X5NA 3DKRA 3QF4B 4IDEA 1KR2A 3C3BA 5E3IA 3NRBA 4OHZA 3WGVA 1ESMA 2OUKA 3Q8LA 2EKQA 3KEMA 2D3WA 3HUFA 1NXTA 4WTOA 4YMLA 1WUHS 1Z47A 1KY2A 4DF3A 1AV7A 1K8RA 1LQTA 1XHLA 4BV9A 1RRKA 1AO0A 4Z3OA 4C21A 3ZS9A 1QGUA 1G5TA 1QQBA 4KMOA 3KSZO 5FTKA 5I9LA 1QF7A 5GZ6A 2QW0X 4OB6A 2QDKA 2MINB 3E35A 4HDRB 2Z6QA 2R4QA 4DR6B 5ALKA 2JARA 3A27A 4GAEA 1XRJA 5TQVA 3I2FA 4JN6B 4L02A 1T2UA 1ZVJA 2EEZA 1HQYE 5EFZA 5BMVB 1SUEA 3AETA 1FTWA 2I33A 1DQPA 3HL4A 3LBYA 3HA2A 1E0JA 4KO2S 2R5WA 4GFDA 4C0QC 2J3DA 3F6RA 4LJ6A 2BJWA 3KTAB 1SB9A 4CODB 5BSHA 5DTEA 1BYIA 3HB0A 3IS3A 4ZAWA 1V2HE 5A6SB 4AUEA 2FRDA 3NVMB 3WQSB 2C9ZA 3EUEA 2PXCA 3V4RA 3CR7A 3DBHB 1YZFA 2QV7A 2ZIWB 4ENUA 4DDVA 1IK6A 2FN8A 2GGSA 3WS7A 2G77B 4Y1FA 1X87A 5K3FA 1X1BA 1X13A 1DWPA 4AZ3A 4BMDA 3F5SA 3BMNA 1MUUA 5K0NA 4BNHA 1I2AA 3QXGA 2OOKA 1XQYA 2CF5A 1HQKA 4LHYA 1SWVA 3NR2A 3K9WA 4RGVA 1R0BA 3EHEA 3PX7A 4RA9A 5HZHA 2XQFA 2H2FA 3LBNA 2Y27A 2FSIA 2J3KA 2QTHA 5ESXA 2W93A 4C4AA 5LP6B 1YJ5A 3JAKB 4F97A 1CNMA 5C8ZA 5GV8A 4EM6A 3IUQA 3LX5A 4XFJA 3OO1A 2OHFA 1CY0A 3A70A 5FD8A 2GBLC 2P79A 1TRHA 3L8MA 4PZDA 4M60A 2ZT5A 1BZYA 1P72A 4YDQA 3HZZA 4XW2A 3OOHA 2FQWA 2P1DA 1T4CB 2PUAA 4BV8A 3LUGA 2NVUA 4BFXA 3ZW9A 3Q3JB 2DLDA 4QSMA 3RSFA 4BKQA 5B1YA 2H4WA 1NLUA 2JJ2A 3LXMA 1M8FA 3PNSA 1X14A 5LZ4A 1Q2UA 2HF8A 3AESB 1BN7A 3V4PB 1SH7A 3CZ4A 5EGSA 1RBMA 4JP5A 1VHWA 2ZVPX 2YZNA 4B4DA 5B36A 5CLJA 3Q0IA 1NNUA 3KQUA 4UVHA 3DAYA 3WGNA 2XYHA 5HQTA 3H3JA 2QTTA 4QOEA 3RS9A 3CPEA 1KF0A 2R6CA 4E08A 4MTLA 1ML4A 4MDHA 5F78A 1YA4A 3BWEA 3T12A 3AGQA 4TSRA 2CV2A 2OKGA 2WVHA 4BYGA 3WGTA 2X8WA 2AXPA 5JAOA 3OT5A 4EGAA 1A9PA 4J3FA 1ZNWA 1IJEA 3G0BA 2RKOA 2VF4X 3ABIA 1E2HA 3MHPA 2FV8A 3NTUA 2ID9A 4DJ5X 4CDMA 5ENZA 5DISB 1UM8A 1W6RA 3K5HA 2PS1A 2ZJ1A 5KX5B 3BZBA 2PO7A 3G5TA 4Z7JA 3PEUA 3O38A 3R7NA 3DOCA 1GYQA 1X1AA 2IDKA 4KJZA 2PSEA 2QORA 1K75A 1KZYC 1Z33A 2EFJA 1MD9A 2PBZA 4B79A 4D3YA 1KJJA 1Z8DA 3LT0A 5LQUA 2CD7A 2JDID 3W9UA 2Y4OA 3N7AA 2ALJA 1J7KA 1R6XA 3F9CA 3U3KA 4HRVA 5I8WA 1VIAA 2QZJA 2RARA 3C24A 1MTZA 2A1UB 4ZT3A 2F43B 4TYWA 1W5TA 2JI4A 4FBLA 4E1BA 5B5SA 1PR4A 1W4ZA 4G09A 4N7RA 3OLCX 4MO2A 1DARA 4QQNA 1OAKA 2AR9A 2FPGA 5AVVA 4U02A 5FV4A 1WXDA 3DAPA 5IJZA 3GI1A 1P18A 2SNIE 4X8OA 2EF0A 1QHNA 2XUGA 2IWRA 4EY7A 2WE8A 4GVPA 3U7QA 5K8LA 4XE5A 3G5UA 2C31A 4X1OA 1TM4E 5AW0A 4M8LA 2C98A 1WF6A 3PQCA 4MRAA 1CZHA 3TEFA 5MGNA 2J67A 1E5LA 3HVJA 3QH4A 1EDDA 2K2WA 4R6WA 3JZDA 1FYFA 4M21A 4MHOA 5FF9A 5LU8A 3VKGA 2GN9A 4PV7A 4EBFA 3CW9A 2D2IA 4GRIA 3I3OA 5F1YA 2W11A 1P4JA 4NNJA 1S3IA 3FR8A 2QVCA 3WLNA 5CFRA 1X80B 4G0ZA 4O2BB 2GCIA 3OIVA 3LDUA 4NATA 3OT1A 2C3OA 1QPGA 2QPOA 5C7YA 2OV4A 3I8OA 4LI3X 4XM2A 1PNTA 4MITA 4ODIA 2DWQA 5ECGC 1K86A 2Q07A 3R7SA 3V00A 4KI0A 1A8IA 2FPPB 4C7OB 3E9YA 4DT1A 3HXTA 3I6YA 2HDOA 5HTKA 3KHUA 3PUWA 3DBRA 3KZ1E 4HLNA 3A2LA 2MIIA 2PLAA 2RBKA 1VLZA 5DYGA 5FWYB 3B3QA 1E1QD 1Z5WA 2CC2A 2FDRA 3MA0A 4U9IS 4ZYWA 3SKYA 1V16B 1MH1A 2HA7A 3V8RA 4YAGA 1RYNA 2YV1A 3FNQA 4J0KA 3WL8A 1US8A 5FPSA 2KBFA 4TV8A 5IMBA 3K0CA 5EXDA 1DAFA 3DBLA 1TZ2A 4Y2RA 5JSQA 2J7PD 5ITVA 2J0UA 5KYYB 4IZIA 1G16A 1ZCJA 1E6MA 1U0SY 1XP5A 2ZYRA 3K9LA 2FZCA 3OZVA 4NOKA 5CX4A 1JR6A 1SXHA 1DQRA 1EUCB 1CR6A 1KEEB 3TN7A 4E13A 1YA6A 2XUQA 1CV2A 3AM3A 3SE0A 3BTSA 1A9ZA 4CEJA 5CA0B 1TVKB 2PPLA 4CFYA 2F1OA 4Q9AA 3OUUA 4YRNA 2Y1GA 1YVRA 3ZHQA 1ORTA 1WF3A 1JR4A 1AA6A 1L6RA 1L7EA 2H51A 2CB9A 1JH9A 5M2QA 1CUJA 2QK4A 3I58A 4N41A 3EVEA 4PSVA 4YAOA 4LFCB 1EEXB 3N05A 3RWOA 3TAUA 5L40A 5JTUA 4RELA 4DNXA 2PUFA 2BAGA 3ORFA 4JBIA 4E11A 3GGSA 1HQDA 1PS0A 2E5WA 1OMOA 3MWEB 3MMSA 2JGDB 3N53A 4D8WA 3D8SA 3T1VA 4HAUA 3E5MA 1KE2A 1C7EA 1EGVB 3H1GA 4RADA 5EEGA 2O1SA 1IY1A 1HZJA 2VTBB 4OJKA 5K0TA 2ENWA 3Q8WA 4PQFA 1D4AA 1Y7HA 3K9HA 3ZX5A 2XUFA 3LLSA 3IT3A 4ICIA 3P5BA 3L93A 1JTEA 4EFKA 2R8BA 1BRTA 3CURA 2JF0A 5B3AA 1RBQA 1USVA 2VP3A 2XI4A 3PXCX 3EASA 3H6HA 5BQ5A 3BEOA 1HORA 3NV9A 4Z1MD 4TZ0A 2BCJQ 5TIIA 1RS0A 2V7GA 2O5CA 2BZ1A 3A6JA 1CIVA 3TFOA 1JFTA 3AZPA 3HEMA 4YJ3B 3Q8KA 4XYGA 1CF4A 5C8VA 2B8EA 4MVJP 4M1YA 3WLLA 1IUOA 1UWCA 1Q19A 2RI1A 3O47A 1SIUA 2GTPA 1R1DA 4TS3A 4NULA 3RUIA 2PKQP 1RHRA 4G4JA 1RM3A 2GPAA 1J2EA 1O57A 4ZCPA 2YNMD 1TVCA 3OA2A 4Y6OA 4GMFA 3U6BA 2WJGA 4JV5B 4D4KA 2W70A 3NOXA 2JKVA 2GEBA 4PTZA 2EKBA 3NHRA 1E2EA 3RU7A 1Q7CA 1RJWA 4J0QA 1L7QA 2Q6IA 1AGRA 1QQAA 5AW5A 3F9IA 4JB8A 2C2YA 1RHMA 1TAQA 3BMOB 1RQXA 1QWOA 2EP8A 2C42A 2QM8A 1GNPA 1Y1LA 3SDSA 7AT1A 1W4AA 4N0EA 4DWJA 4LBWA 4BEVA 2NSDA 4MLZA 4B0OA 5BW6B 2A8YA 2DFVA 1NFRA 1N0WA 3C8HA 4HMPA 5HDQA 4BO8A 1GY8A 1BEUB 1Y9DA 2GB4A 4KWHA 3I42A 5IMSA 3EIWA 2R7KA 4UD6A 3SQLA 4MKFA 1XKTA 2QLTA 4HZUB 4LY3A 1FEZA 5EQJB 4LDAA 2Q7DA 1XA3A 3JU3A 4K7JA 4CDNA 4K0KB 2P3LA 1V9CA 1IZZA 1JA9A 2ZYVX 3DUWA 3P2EA 2YZ7A 4I7EA 4MUBA 4ZXFA 4YRZA 2Y1XA 4XYLA 5ICCA 5IT0A 2QX9A 3QWFA 3VJLA 4M6WA 4MVJI 3KEQA 5FJIA 4HEA6 2FSVC 2A84A 1KWGA 3UJNA 4JMPA 3IC5A 5DM2A 1M83A 1BU8A 1OILA 1JRLA 1J4AA 1EX6A 3TJZA 3ZR4B 2FW7A 4GLBA 2WFLA 5DM4A 3OD1A 1XZMA 3KV1A 4EG7A 1OYVA 1AVTA 2V7EA 3Q4GA 4MKGA 4TQUS 3BIXA 1QMPA 3LCRA 4MVWA 3I9NA 5SYNA 5HZMA 2PNJA 4D9KA 3IA7A 4K9KA 3AVXA 1QOQB 1SCUB 1Z3CA 3CONA 3IB6A 3OMXA 4FT2A 5JQGA 3QKIA 5K8CA 3N58A 1TT5B 1MB3A 1R6TA 2N1MA 3CLRD 5FTNA 5B53A 4EQ6A 4ZI2A 1SXPA 4JL5A 5G02A 5FI3A 1KJZA 5AW8A 5FWNA 2NWQA 4I9FA 4KAJA 4YR7A 3C16C 2V5VA 3CPSA 3DQQA 1K7EB 2GFQA 1BO6A 2QTVB 5KKCA 3KKPA 1TADA 4YONB 3BL6A 5CTJA 2P2SA 2QN3A 4D8TA 3T7KA 3KETA 2XJ9A 5TSDA 1I51A 2WG1A 3EISA 4JZKA 2D4HA 2HMUA 3REFA 3K8YA 1C9YA 3FCAA 4Q7LA 3LLVA 1V0JA 1ZI9A 5JXGA 4I9UA 2COEA 1KS2A 4IG4A 3VXKA 1K89A 1N34B 4PN7A 4U7FA 3RJTA 2XWBF 3FVWA 2VJAA 3S2YA 4E51A 5AKIA 5GONF 1QRTA 3MJFA 1E94E 3OC0A 4Q4HA 4S3MA 3ZBTA 5MFPA 3ZGZA 2B4TO 2VNIA 4EGJA 3L07A 1KDPA 3KE8A 1GGVA 1M1YE 5IBRA 1XEAA 3EYAA 4Z8YA 1ZONA 4K9OA 2XEDA 3AVWA 2ZIVB 3QQPA 4DCOA 3H1BA 2C2GA 5CVVA 4BB6A 4DMRA 1XAIA 4L73A 1Y89A 4EA6A 3A9SA 2HLHA 3FPHA 2P6OA 3HA3A 4KQ9A 2MSWA 1P1BA 3HDJA 1NUTA 1MJHA 4S04A 2IYPA 1NW7A 1UJ2A 5AUQA 5JNSA 3NTLA 2I2CA 2YDXA 5FI5A 2CJPA 4BBJA 4YA6A 2C9OA 5H81A 3GLGB 3D6JA 4CLDA 5TE9A 5JBNA 3BWYA 2HNAA 2IZ0A 2NM0A 1MVNA 2VRCD 3K0AA 3ORQA 4OQDA 3LYLA 5ISMA 3TYXA 1JWLA 1T2DA 3PFIA 4D0NA 4BASA 1ZG3A 3EDMA 2HIMA 1C9MA 1TA4A 4H0FA 1GG8A 2IIPA 3VVBA 1CE8A 3OY2A 2WMYA 5AK5A 4H4CA 1PGPA 1FX0B 1DRJA 3EUFA 4OQQA 5K0ZA 1KRWA 1GL6A 1KEWA 1Y80A 2DT8A 3CRRA 4XB1A 3ZE9A 1QBKC 4C3UA 4A9AA 2EJUA 1UMDA 3AF5A 4WY8A 2O4CA 2I34A 4EK9A 5KCMA 2NQ2C 3NZEA 1TFRA 3H4VA 2EG5A 3L02A 2NO6A 1KO8A 4FYPA 1FRNA 4HXEB 5IVKA 3K30A 3ZGVA 4QE3A 3PQ2A 5CB4F 1XU9A 4ZEVA 3KB2A 2YBEA 2A59A 4QBFA 4FZJA 3OHMA 4D9BA 1SVSA 2W71A 1QAOA 1XZQA 2JFGA 3GEGA 1Z16A 3F4KA 5T4HA 2WK1A 4FDLA 3S5UA 3MT8A 5C1DA 4P53A 2H48A 1YR8A 4P22A 4Q18A 1VIYA 4W8GA 1P4AA 1FNCA 3LCUA 2O8VA 4JK3A 4MR9B 2Q5CA 5J5VA 2X7HA 4ZQCB 1BG6A 1ZC3A 4D8VA 5EUCA 1N9GB 4R31A 4TROA 3CLTD 4GDFA 2CK3A 1P5HA 1YC2A 3CGWA 3HCBA 1YUMA 5J2UF 2CFOA 4IIYA 4O4LB 3VU1A 1WMAA 1D09A 1XI2A 3AP3A 3H3FA 3MWLA 2YHUA 3FNGA 4LZZA 2OTCA 1GWNA 1I5EA 2O0LA 1SCAA 1BX0A 3IT2A 3IVGA 2QV0A 1ZNZA 3PVSA 4FQ7A 4I50B 4N5HX 3EAFA 4US1R 4RTLA 5L4NA 3QLUA 1WNTA 4KV7A 3LHKA 3WMEA 4FWTA 1T4BA 2OFWA 3IQIX 4J07A 1LLUA 2BE7A 1YDGA 4NZZA 5JMWA 1KDOA 5HDBB 3VI4B 3FBTA 4RULA 1UWLA 5ICGA 1GZVA 1NUSA 5ED4A 1JDJA 2WWRA 4CMCA 1GAQA 5AOBA 4BB5A 2GF0A 3U13A 4LVOA 2KX7A 3WFJA 1H3FA 5KVAA 4CU2A 1U7WA 3HZHA 5DGXA 4F1JA 2I03A 3CIOA 3NHMA 4MMZB 5MFZA 2OCKA 1PQ4A 1Y4ZA 1EI9A 1YVUA 2DQYA 5FPTA 5LMCA 3NOQA 2JCXA 1RLOA 3ZLBA 3FUTA 2C4TA 1QPBA 8ABPA 1KEKA 4BE4A 2HPHA 4QGAA 2I4TA 2GX6A 4R1QA 3T4UA 5BUZA 1Y9AA 4WFJA 3BT7A 1PJRA 3PKJA 3B9RA 1L8LA 5DJ5A 1GXSB 5DHFA 1JTVA 3UG7A 4C0HA 1KK2A 4FWIB 3CXUA 5BPHA 4PINA 4QNMA 3S1AA 4LW8A 3UWKA 2G9UA 3H9JA 2ZJFA 1SELA 3L7KA 5CG1A 1ATIA 1QE0A 3CJTA 3G5MA 3W3AA 3VYUB 4ZYLA 4MIKA 4BLPA 1PZEA 5ITZA 3BFVA 4Q1BA 4DDHA 4LCBA 1T1IA 4ISBA 4BLUA 3ACBA 4A36A 3LF2A 1M2JA 4CLRA 2GN1A 3ST7A 1O89A 2O2GA 1GKYA 4NZYA 1CNFA 2GFIA 3HRKA 3PZBA 4XR9A 1B74A 1P7VA 1C3VA 1ZNYA 2GK6A 5DYYA 5IWCA 2C58A 3OZSA 3E9MA 3HYNA 3ME5A 4C30A 3DL4A 3QE0A 3R5JA 2VPPA 4YUYA 4AXXA 3QA3E 1JPUA 5KU1A 1JHAA 1I4TD 2VSQA 4L6CA 3VC1A 2OCAA 3GRPA 5EZ6B 3CS3A 1NNLA 3TZEA 1OIXA 1OZFA 4YPOA 2X77A 4NENA 4PSKA 1HNXB 4TKUA 4A6PA 4AMZA 4RVFA 3EWIA 1JIUA 2YYSA 4G65A 4QNNA 4JXZA 5G41A 4CLOA 5I5EA 4P98A 5AXBA 4MWEA 1K4MA 1UOOA 2BI4A 2J4FA 2LR0A 3D3QA 3UHFA 2JEYA 2VG8A 4I1SA 2Z5GA 5AKGA 3DULA 3FMOB 2BT4A 1V1RA 4U2GA 1WWKA 3TZCA 1WU8A 4F4HA 1Y3IA 1DIGA 1E6CA 4R9UC 4BMNA 1CUUA 3T5TA 2BBSA 2EW2A 1KC3A 3R7WB 2KWIA 4V0KA 1O03A 1GNQA 1L8OA 5IARA 4PR3A 5LC1A 2OYSA 4KO3S 3WMWA 5C8XA 1DAPA 5FPKA 4YRQA 5J1TB 5K99A 2F4VB 1IIRA 4F5ZA 4Y2VA 1BW9A 1RABA 3RROA 5G1OA 3SVLA 4G2TA 3TOSA 2NU6A 3EEFA 4D57A 1AY0A 2D2EA 1JLLB 1CDDA 2QYSA 1JFSA 2V59A 3ZCPA 4OYHA 1OFGA 4JNKA 3UW1A 1PRYA 2IE0A 1DO0A 1P1HA 3F3SA 3ZXIA 1Y37A 1W5BA 3K31A 5BT9A 4Y1EA 3SJZA 4H4DA 2RJNA 1U7PA 4Q00A 1PSDA 3BMXA 5KHLB 5JSFA 5KJCA 5DNUA 1W36B 3EIXA 2PMCA 5THKA 4BV2A 4EI7A 1PJTA 1ZMRA 3JALA 4JBYA 2I7DA 4JHLA 2FW9A 4L95C 5E6UB 1BIFA 2JFWA 2HGSA 4WJZA 3ZIAD 4C6TA 1XDDA 1KDTA 2R6DA 1XXHB 4B3BA 2HJ9A 3R75A 1HY3A 1JJ7A 4EI8A 1UKCA 3CKLA 1U7OA 3D54D 4U6SA 4C4ZA 5JD5A 1X2EA 3TL6A 3F6SA 2APJA 2OMKA 3QBEA 1GTG1 2RMKA 1XU7A 2RC6A 4F4CA 3ED5A 4NCJA 4RIIA 2J09A 1VP3A 3QY0A 5AK4A 2I2DA 2QROA 4I2VA 4WQMA 4M0UA 3SIXA 4EW3A 2O1WA 2ISCA 1PO7A 2X7JA 4HB0A 4O4HB 1XPJA 5KNLA 3OZFA 4LV6A 4J0EA 2EQBA 2WVJA 3KJHA 5IJ9B 5KNCH 1Z18A 4TKMA 3Q7SA 4HPJB 3ZHXA 3EGVA 4W7SA 2O3SA 3HYLA 3MS2A 5EXPA 5K3SA 3HQ4O 4GP6A 3VHQA 3IEVA 4WA7A 4CKXA 2BF7A 3CUWA 3GFBA 1OXMA 3X2FA 5EYPA 1X7YA 2QA5A 1LPNA 3CE9A 2PDAA 4ZT4A 1UXKA 2D2FA 3IVMA 4ITVA 3L7JA 1PNVA 1E7YA 1M34B 3FKSA 1W5EA 2F17A 3VZDA 1YCHA 2VYND 3ENWA 5K3AA 3W6ZA 4WW0A 2FPGB 1AQJA 1MZVA 4PIVA 4TLCA 2O2ZA 4JLOA 1BMQA 2EKDA 3OPYI 2Q27A 3OZDA 4D43A 4DIUA 1P2FA 2QW8A 4AUNA 3BDVA 2VXOA 4B6FA 5K0EA 4N03A 2X2PA 1H85A 4PLPA 1GPBA 1XCOA 5AXDA 5C3UA 3U7QB 2OD7A 3JASA 1N7HA 4X44A 1YE3A 3ZNNA 4YUAA 2XVYA 1BS2A 1XMJA 1BS1A 4WGFA 4TRNA 3G5LA 3A6PC 1AU9A 4TL6A 3SJBA 1ST3A 1Z29A 2VT7A 5ALNA 4ZD6A 4J1NA 4QT0A 4AP6A 4CVNA 1ATZA 1T0UA 3TOXA 5K5EA 2JBAA 1NUUA 1P45A 2VRBA 2A5DA 3A37A 4HRXA 1CVIA 5IYZF 2N0SA 3W2FA 3IVXA 3CISA 1V48A 1T43A 2VJBA 1NDHA 1M1UA 1Y63A 2Y1WA 3O8LA 4OQXA 3F7OA 4CUKA 1IEQA 3CR8A 3NNNA 4ALJA 1Z7EA 4RMHA 4XEUA 1QIGA 2V55B 1JXQA 3LP8A 3Q12A 3GEHA 2JGEA 3FPBA 4HLDA 4M53A 2WT9A 2JAOA 4GW3A 4Q9KA 1CYDA 1YU9A 5L3SB 1DKUA 2PKWA 1E79A 2FU5C 3VR6D 4JI5B 1P9RA 5FEMA 3DBRB 1GDDA 2X1VA 1W2HA 4MQ6A 4NYIR 3RUAA 3U3XA 1K97A 4ZEXA 1JNXX 3QWBA 4YAEA 5FYQA 1ZA2A 4OSEA 3EZXA 1T3HA 3H9EO 2YC2C 1L5VA 2BZSA 5IHPA 5E9JA 5EXEA 1EDOA 4PYLA 1NMZA 4CLXA 4HO1X 2D4AA 1V1MA 3CF4G 3INNA 3OEHD 1EQAA 1ZIYA 3HH8A 3IXMA 4MAAA 1KK3A 4A26A 4EFMA 2XBMA 4IDFA 1E0DA 4ZOBA 4KSYA 4RA6A 2WYHA 3VR5H 1GM5A 3JS5A 2OBXA 2B25A 3UPTA 3PRKE 4NP6A 3RFXA 4YJ2F 4MZDA 2VT2A 1M5UA 1Z0ZA 2KB0A 2CMKA 3G85A 1IU9A 3WLMA 3W5SA 4DQLA 1KGSA 4FC6A 1H0SA 1ISSA 1OZHA 3D5TA 2WYIA 2FTKE 2XRFA 4N8DA 4CMJA 5AW2A 4YCAA 2ZSDA 2Z2YA 3CN9A 1E3QA 3VTZA 4E6PA 2G08A 2YFKA 5TEWA 3RIEA 1BEEA 2JHPA 3T0GA 4CF3A 4CKBA 3H1TA 4US0R 3DNPA 4RHTA 2JVIA 2G7MC 3AJ9A 2H6EA 1M6YA 1O7JA 1YJCA 5CHEA 4EBBA 4EO7A 2C4WA 2JLVA 2P1RA 4V0SA 1FTQA 3VOSA 2G80A 3PD0A 3H19A 4ZO9A 5DK4A 5A5DA 4RENA 1GLVA 4OSPA 4RVUA 4URYR 3T7JA 2DWOA 5LD2C 4ILEA 3K1YA 5ELLA 5ADWA 3RC2A 3TSOA 4ZGWA 1JW9B