4PVCA

Crystal structure of yeast methylglyoxal/ isovaleraldehyde reductase gre2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
b'MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent methylglyoxal reductase GRE2
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
pubmed doi rcsb
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.265: 3-methylbutanal reductase.
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pvcA00
3M2TA 4BKQA 5U9CA 2UUOA 1YKFA 2AHRA 2ZCUA 3A14A 1V9LA 3AFMA 2B5WA 4DLLA 2BH9A 4NJMB 3GEMA 3PWKA 3G79A 1NQOA 3HFGA 5A05A 3DAPA 2AW5A 5KKAA 3VH4A 5IN5A 3ZHYA 3CEAA 1J5PA 1R4MA 2R00A 1ZXBA 6LDHA 1M67A 1WZIA 3KYDB 4B8WA 1X15A 3V1UA 1WP4A 1ZK1A 2ZIZA 2Q99A 4OKNA 5JC1A 2CFCA 1CJCA 3RBZA 2X9NA 4WJZA 3QW2A 1SPXA 5KJ1A 4RZHA 4JJFA 4BO3A 1FDUA 2WM3A 1AXEA 4Y8VA 3RJ9A 1MFPA 1N1EA 1NWHA 3DBRA 3JQAD 5G2OA 4L76A 4AJ1A 2EP7A 3K30A 4D44A 4AJPA 4XX0A 4BNVA 1TLTA 3T7CA 4UEKA 5KIAA 3G0OA 2PNFA 1T2FA 4B8ZA 1HEUA 1SEVA 4IZHA 4OGWA 4CLHA 3JD4A 4BNHA 1MXHA 3C85A 4YAGA 4GWGA 2BKAA 4ALLA 2QG4A 5A9SA 1XSEA 1U7TA 2QX7A 3WLEA 3ORFA 2P9CA 4F46A 3F46A 5A4DA 4YBZA 5DZSA 4RLHA 1PTJA 4ND3A 2A92A 3C3XA 5ICMA 3IJPA 5LDHA 1PX0A 3DXFA 1RKXA 3UCXA 3C7CB 2AMFA 1LDYA 5DDIP 2D8AA 4D41A 2JHFA 3RCBA 5C3MA 3FPCA 3LQFA 3WJAA 5JCJA 1HWYA 3I9LA 4NBRA 4CUKA 2VTDA 5DP2A 1M6HA 5K6AC 3WGYA 2YFQA 3KXDA 3OF2A 1VM6A 4FGSA 4N18A 3FTPA 1GZ4A 1YGYA 2EGGA 2XAAA 3ZW9A 3F5SA 4OXYA 4CM6A 2QYSA 3DAGA 2E48A 3GHHA 3ASUA 4CMKA 3D5QA 4R9RA 2RBEA 4UULA 4Y6PA 4PLFA 4Q3DA 1IPFA 4CR7A 3D3WA 1MC4A 3QWFA 4CMIA 1AHIA 4N5MA 3U3XA 1UH5A 3WGQA 1BXZA 1RJWA 3DHEA 4BB5A 4A7PA 4H3VA 3GPIA 3RI3A 5CHEA 2UDPA 2BMAA 3SX2A 4OQYA 4DA9A 4UUMA 3PI7A 2J3HA 4FFPA 1ZW1A 2PFGA 2OHXA 4BKPA 1MV8A 5JNLA 3FWNA 3KOUA 3ST7A 3AU9A 4PZDA 1T24A 1BMDA 2P5YA 1X7GA 3HG7A 4YT4A 3QP9A 3N58A 2ZQYA 4BO5A 1HF3A 1XYGA 3ZU2A 1G0NA 2CUKA 1XWFA 2P5UA 2C59A 2F00A 1R0SA 1X13A 5B12A 4G81A 3ZHBA 2XXJA 1GUYA 2W2KA 5KVCA 1DDOA 3G1UA 1JU9A 4XEHA 2VNSA 4FBGA 1WZEA 5IDWA 2JCXA 2X0IA 4AJJA 2GDZA 3JQ7B 1C1XB 2YJZA 9LDBA 5B4UA 1NQTA 4AJ4A 4CPDA 5ES3A 3QVXA 3QWHA 1QP8A 3HJAA 1J4AA 2PLAA 3IJRA 5CDGA 4M55A 4DBZA 4OSOA 2YV1A 1L1FA 2VYNA 5I7SA 2D5CA 3DZKA 5A1TA 1Y8QB 3E1KA 3H8VA 3NV9A 1T25A 4IMPA 3NDJA 2DPGA 4J1NA 3WWZA 4RVGA 2D2IA 3Q6IA 4B4WA 2EP5A 3QRWA 2O2SA 2CSUA 2ILTA 3DO5A 4KMSA 1E1NA 1R0LA 4BO1A 5HTOA 1EBUA 4DBVO 4CQLA 5T67A 4ZHSA 4MVJF 5JDIC 3K92A 3ON5A 2QZ9A 4UVHA 4DYDA 2UUPA 2X0JA 3BMNA 3EK2A 1HLDA 1LRLA 1WW8A 3U4IA 4GQAA 2P4HX 2GN9A 3FNGA 4AG3A 4PRKA 2P91A 4QO7A 4JQCA 4Y67A 3DZIA 3VTZA 3OH8A 3BZUA 3WR5A 4RDHA 3W1VA 4AJ2A 3VZSA 1H94A 3KSUA 3LLVA 4CL8A 1ZJZA 3L9XA 1KETA 4CM4B 2GPTA 4CM8B 2I6TA 3QWAA 3INGA 3DAFA 2GNAA 1NX6A 3RVDA 2X8LA 4RO0A 3G17A 1MP0A 1E7YA 4OL9A 3PWZA 4IDEA 4LVCA 1QG6A 5T8KC 3RJ5A 4BO4A 1R16A 4BUCA 2OGUA 3KO8A 5DCUA 4BV9A 3Q9UA 1PJBA 4Z9XA 2VUUA 1PGPA 1N9GA 1V35A 3ABIA 5I7VA 3L4BA 2I5PO 4NBVA 1PGNA 3FR8A 1AUPA 4XD2A 4BNXA 5EN4A 1UAGA 3PZBA 4W4TA 4J3FA 4MO2A 4II2A 5KOIA 4CLOB 1V3VA 1N8KA 2FSVA 2ZJ0A 3DMTA 3AWDA 3BMNB 1EZ4A 4YACA 5MGBA 1NXQA 3GG9A 4XR4A 3ICPA 1LDEA 3U9LA 4BNLA 4HKTA 2IYOA 3EZLA 4RPKA 2PD6A 4PLWA 1MFZA 3T7EA 1OZAA 4BV8A 1IY8A 1XEAA 4YJGA 4QTZA 2NM0A 4BO7A 4D3DA 1RM0A 1LDMA 1I0ZA 2GZ3A 4GI2A 1YQXA 3ZWVA 4BQRA 1SMKA 2HU2A 3GQVA 5GY7A 1NHWA 1VC2A 3JTMA 1Q1NA 3LT4A 2HJSA 1DFIA 3WMXA 1OAAA 1EFLA 2G1UA 1IYZA 3Q11A 4P8RA 3CUKA 3PHJA 1QYCA 4PLZA 2FR0A 1RYDA 2V6GA 1PJ2A 2X5JO 4YDRA 4EDFA 2NU7A 1R0KA 3PPIA 1ENPA 5IG2A 4QQRA 3S2IA 1KEUA 3ZU4A 4FFRA 2AQIA 3JSAA 5F1KA 6ADHA 1QLJA 1K3TA 4I5FA 1QKIA 3DMYA 3MZ0A 1M2WA 2NU6A 2VT3A 1P44A 3P5SA 2E6UX 3D1LA 3GH3A 4LW8A 2GF2A 4NFSA 3RAJA 4XWYA 3INTA 5FEUA 3DQPA 1DSSG 1LRKA 3KYBA 4E3ZA 3BMOB 1HT0A 4WEOA 1H9AA 1MB4A 1FDVA 2HMWA 2I3AA 2QHXA 4ALNA 3RC2A 3O8QA 1PSDA 3CXRA 1VL6A 3WGZA 1Z45A 1VSUA 3PQEA 1ISFA 1PZFA 4RVHA 8ADHA 1EDOA 4RVUA 2EKQA 3F6YA 5AXCA 5CEJA 3OIGA 2DTXA 4W7HA 5TLSA 2HLPA 4YAKA 4K26A 3HUDA 2AG5A 3IKVA 4GKVA 4LCEA 4R69A 2NWQA 3AI2A 3UAGA 2DQ4A 5AOVA 2QRLA 1GR0A 2YDXA 3I9NA 5EPOA 4BKRA 1RM3A 4ND1A 3EVTA 1KIFA 3H65A 1UXJA 1JN0A 1DHRA 3LLSA 3V2HA 3SEFA 3VPFA 1Y5MA 1NPTO 4PRLA 3V2UA 1O95A 3MOIA 4NFYA 1E77A 1D4FA 1GPJA 2F1KA 5F3RA 3KBOA 4I9NA 3QVTA 4ALKA 1B0AA 4E12A 3GGPA 1PU2A 2H9IA 3ZWXA 3UH1A 1ZVMA 4FC6A 3ETDA 5DNAA 4Z0PA 1E3WA 5BR7A 2R2GA 1X0VA 4LCJA 4MVJM 1C0PA 5U4QA 3KM0A 4BVAA 4BNGA 3GF4A 3ROMA 4G65A 4ZN6A 1QYDA 4YXFA 4ZQEA 4WLUA 4PLYA 1EBFA 2UYYA 4L75A 3X2FA 4DC1A 5KKCA 3P7MA 4R9SA 4EGFA 5IXSA 1ZEJA 1DIAA 4GX1A 2OFPA 3L6EA 5ITWA 4J7CA 3IOYA 4R5MA 3UICA 1PJLA 1Y9EA 4B7CA 2OBYA 3RU9A 3RC7A 3E9NA 1U3TA 3DZJA 4N5NA 3A4VA 3L07A 1YBAA 4MP6A 4DPMA 1PIWA 2FZEA 3VZRA 2EERA 1VI2A 5COQA 5DN9A 4OIMA 3JQFC 2CVZA 3GOHA 1B8VA 2PD3A 2X0RA 4WLOA 3DZFA 2NNLD 2IRWA 2B36A 4TRNA 3L0DA 5F5LA 2ZTUA 4NBUA 1CETA 2X7HA 4N7RA 1HSOA 1Q7CA 1PQUA 1QV7A 2JD0A 5CEEA 1FDSA 2ZB3A 3MWEB 1ZJYA 1HL3A 2ZYDA 1ENZA 1N2SA 4F6CA 1BDBA 1C14A 3RU7A 2NTNA 3I9OA 5GZ1A 4J43A 4MVJD 5L9AA 2HKIA 4LISA 4U8GA 5JY1A 4Q3BA 1Q7GA 4P4GA 3HN7A 1ENOA 1VL8A 3GNTA 4I5GA 3C1OA 3OHSX 1T4BA 1R6DA 5DBIA 1M6WA 1ULUA 4DGSA 3TN7A 3L4BC 2GYYA 5KJFA 5JMPA 4M87A 4QFDA 3EHEA 2E82A 2YY7A 1GL3A 1ADBA 2PWZA 4RJTA 1I3KA 2ZK7A 4HFJA 2B4QA 3GLQA 1JAYA 1H2HA 1M76A 5IDQA 4YJDA 3D4NA 5DBGA 2EW8A 4ZQHA 2Q2WA 4YJFB 3UF0A 3V5NA 1ZBQA 1K5HA 2NTJA 4DRYA 3EC7A 2CZCA 1XCBA 3RBXA 1ZMTA 1I3MA 2PH3A 1F14A 2HRBA 4WCFA 4A0SA 3JCZA 4E4YA 2X58A 4BO2A 1OFGA 1EFKA 2BLLA 2RHCA 1CEQA 3PGJA 2HJRA 4FS3A 4OHUA 2OMEA 2QQ5A 1BG6A 1FXSA 3KLPX 2Y99A 1YB5A 3K96A 4DQUA 3QA9A 4WASA 4Z0TA 3ROPA 1QYWA 3ZGYA 1XA0A 3B20A 2YHIA 1PR9A 1JVBA 1HSZA 3O03A 3I1JA 5A3VA 1PQPA 3DBHB 1DB3A 2X6TA 3NDRA 4IINA 1D8AA 1JW9B 1ZFNA 2C20A 2BGLA 1SAYA 4M89A 1LNQA 2IXAA 1ZH8A 3KLMX 3LZ6A 2JFFA 4R3WA 5THQA 1TT7A 2PY6A 3GN2A 4PZCA 4FFLA 4PZEA 4XDZA 2CY0A 3RFXA 5TT0A 2LDBA 1VSVA 4ZRMA 4JN6B 5TQVA 3KYCA 1GADO 3MWDB 5LC1A 5KVVA 5JMWA 1HE4A 2X9VA 4MIOA 1BW9A 4GKBA 2I76A 1I2CA 2XXBA 3AFNA 2VCYA 3K31A 4WCDA 3JQGA 4J4HA 5MDHA 4IIUA 1WVGA 4ZVVA 3VPXA 4ONEA 3S2EA 3EAGA 3KV3O 5JAQA 4WLFA 4CM7A 5HM8A 4MINA 1MG0A 4FJ0A 2LDXA 3NJ8A 4BNJA 4QUKA 1VL0A 4OM8A 4E30A 5A5FA 2PKQP 1BVUA 1PS8A 3BXXA 2YFHA 2X86A 1QYVA 5L4NA 5TSDA 4KUEA 2WYWA 1JLLA 5U1PA 2GO1A 4KP7A 3WFJA 1ZSNA 3DBLA 5G0SA 5KVSA 3ZHZA 4KUHA 1YB4A 4M54A 2OP1A 3DBVO 1GQYA 1LBEA 3OJ0A 1HYGA 1LC3A 4HFMA 4IDBA 4R41A 3EYWA 2JJYA 2AQ8A 3AOGA 4JNKA 1CERA 2WD7A 4HADA 1YJQA 4E0BA 5I8WA 5BSEA 2HMVA 3HWRA 3WBFA 2J3KA 1P1RA 3VTFA 1HDGO 3WICA 2W90A 1UXHA 4PLPA 2Y1CA 4ZRNA 3W4JA 5EMHA 4R01A 3FNHA 4DIBA 3C7DB 3DONA 3C1TA 4A26A 1XLTA 4MPDA 2CMDA 4TSKA 5T64A 2J5RA 3VVCA 4NIMA 1XG5A 4CQMB 5JPIA 4XQ9A 3GGGA 4RZIA 1EEHA 4UUNA 1I33A 4IBOA 1SBYA 1UDBA 3HZZA 3TJRA 3FN4A 2HAEA 4R16A 3K73O 2B4TO 3CE6A 2NVUB 1YH3A 5A03A 5AQ1A 3FPLA 1YQDA 4J6FA 4BMSA 2JL1A 3F3SA 4BHTA 1P1JA 5I7FA 2DBRA 3GEGA 3MCVA 1HYEA 5F21A 2HO5A 2HMTA 4DIOA 1BTOA 4IGEA 1IHXA 3PK0A 4BS9A 3CZRA 4XGIA 1Y8RA 4PCVA 5TRTA 4YRAA 2V65A 1GAEO 1ADFA 4YTEA 3UCEA 4BL5A 2Q4BA 1WNTA 1H93A 1GUFA 1PS0A 1DC5A 2X4GA 4RPHA 4AJOA 4MKRA 2VHWA 3PVZA 3QSGA 4EJ0A 1W4ZA 2J6IA 1I8TA 1E7RA 5B4TA 1UZNA 3VDQA 4GBJA 1YL5A 4AJEA 2B35A 2RAFA 4H16A 4MIYA 4W7IA 2B37A 1E3EA 5AXDA 1G6KA 3QVOA 2AE1A 4ALMA 2PZKA 2NTVA 3TZQA 5BSFA 4ZQFA 3FBGA 4ND4A 2RCYA 4JBHA 3PLNA 2AQHA 2GD1O 3A9WA 3CMMA 3X2EA 3MJTA 4ITUA 4B7XA 5AVOA 4PLCA 1ZSYA 4DVJA 1I10A 3DB2A 1I30A 2GRAA 2BFAA 1XU7A 1ULSA 3VZQA 4ROSA 4MIEA 1CDOA 1T4DA 3O4RA 4XYLA 5IFLA 1TA4A 3V1TC 3WGIA 2X9GA 2ZATA 1MX3A 4BQPA 3D64A 5G4LA 3WTBA 3IP3A 5G0VA 3EUWA 2G0TA 4WK6A 4IDAA 4J16A 2X1HA 5BNTA 3C24A 3H2ZA 3WSVA 3NTQA 3IAHA 3HN2A 2O7SA 2VRCA 4FN4A 1XKQA 3U5TA 3GN1A 3KVOA 1LSSA 4LVUA 2C54A 4IJWA 1X7HA 4D43A 2XPCA 3AUUA 3QVWA 1EUZA 4L0QA 5FFFA 5G0WA 3ITKA 2TMDA 2Y1OA 3ETEA 1VRWA 4TRRA 4I9UA 2C2YA 4ZICA 4KTTE 3W8EA 4B4UA 3JYNA 4BGVA 4BNWA 1P74A 1E3LA 2O3RA 4NJOA 5CFZA 1BW9B 3JD3A 1RPNA 1LRJA 3K9QO 1CIVA 2QRKA 2E37A 1GY8A 2CNBA 3HDQA 4DTIA 1AN9A 2HK7A 3TFOA 1IE3A 3ITDA 1CQIA 1HDZA 1KERA 4ZU3A 3ZNPA 5C5IA 2W2LA 4RF5A 4JCOA 1Z75A 1DIBA 3E9QA 2AA3A 1QLHA 1WAMA 1ID1A 3GNSA 4JROA 5B4VA 4CV1A 4ZQGA 5TNXA 1ISMA 1DHTA 5CDYA 3V8BA 3TZKA 1YL6A 2D5AA 3CTMA 3GFGA 3STHA 5L53A 3UGKA 4DREA 2BFMA 5KNLA 1Q0HA 1NASA 1T1RA 2D4AA 3ZW8A 3U4DA 3EY4A 1F8FA 3E5MA 3OP4A 3W6UA 4DQVA 2JFGA 5IN4A 2XOXA 5BSGA 5FF9A 3KB6A 5DP1A 2JCYA 4HY3A 1TVEA 2JKVA 3FRJA 1R4NB 3D3EA 4NBWA 4NR0A 3VKUA 4OOFA 2VUSA 2VUTA 1C1DB 3PWSA 1KEWA 1M75A 4CM9A 1B2LA 5KTKA 4S1VA 3D5TA 5BNFA 4HXYA 4WNIA 2HK8A 1GV1A 3OIFA 1SNYA 1GEGA 1IUKA 4A03A 1U1IA 1B26A 3VPSA 4J0EA 3KEOA 3O8QB 5HS4A 4YA6A 4HUJA 5HRUA 1G0OA 5IF3A 1T1SA 4BO0A 5JAMA 1GD1O 4NH4A 3RFVA 3RUEA 4GSLA 3GNQA 2A4KA 2D59A 3PYLA 2VN8A 4BNIA 2CDBA 3OQ1A 4FIZA 2OORA 3BMOA 3AY7A 3O26A 4XQCA 1YBMA 2OL4A 5A04A 5IZCA 4CQLB 1LDNA 3WGGA 3E6AA 4RPLA 4A5OA 1YWGO 2Q1SA 3RUCA 2EEZA 5L4LA 2QZZA 1R37A 4M8SA 1FMCA 4UVDA 1HE2A 4E6PA 4D45A 5DCYA 3ZH2A 4U0KA 4KDEA 5IAAA 1NBOA 3PYXA 3KHUA 1SC6A 4XQGA 1Z82A 3TOXA 4B4OA 1KBZA 1CWUA 5JCXA 1QRRA 2WEKA 4FJ1A 4J0FA 2G82A 3DBLB 4BO8A 1SCUA 3AI3A 4JP2A 1NFRA 2PGJA 3A1NA 1NAIA 3DFZA 2PA3A 2JD1A 1N7GA 5THKA 1JVSA 4JX8A 3GAZA 2NQ8A 3BYZA 1ZCJA 2EF1A 5JAIA 3B1FA 3BAZA 3MEQA 4FW8A 4JBIA 4EJMA 3LC7O 4QEDA 2DBVO 5CP8A 5A06A 1E5QA 4RPJA 4BNYA 4A10A 4DC0A 2DM6A 2QYTA 4R1UA 1XIVA 3GG2A 1LSJA 4Q3EA 4J2HA 4MVJG 3WDSA 3KUXA 8LDHA 5ER6A 3PHHA 1NWCA 4AJIA 4Z0HO 3OIDA 1GCUA 1TXGA 4UUOA 1PGOA 4GX0A 4XB2A 2V6FA 3BTSA 2Y1FA 4FD3A 3VHRA 1B3RA 4GGOA 2J5KA 3PDUA 4R4JA 4RQTA 3ONFA 3H6KA 1Q0QA 4N5LA 3AY6A 4KOAA 4CR8A 1NQAO 4WLVA 1N92A 4YQYA 4Q3NA 3B6ZA 3WFIA 1EE2A 5AYVA 2O50A 4AJNA 3PFFA 2EIHA 1KY4A 5JAZA 3LT0A 3HDYA 3JD0A 2O2YA 1M66A 1CQJA 5KJEA 5DCWA 4FOOA 1O8CA 2GZ2A 2G76A 2W2LD 4WGGA 2YQ5A 2D3TA 5C7IO 5EINA 1A9ZA 2RH8A 3B70A 4KWIA 1KVTA 1E6UA 2AEFA 3JQEA 3ADOA 4NBTA 3W8FA 1K0UA 7ADHA 4OOEA 3M1LA 1DJNA 3E9MA 3GEDA 5EJ2A 4YT8A 2OO5A 3FHLA 3NJ4A 3OFSA 3WS7A 2IEDA 3UCFA 4J1SA 2I65A 4TRJA 2R6JA 1PJ4A 1OC4A 2C82A 1Y8QA 3DMTC 4L4SA 4EUEA 2E4AA 4OXKA 1V0JA 3LC2O 1E3WB 4WLEA 3DZGA 1HDCA 3IC5A 3INRA 3NT5A 4WCFC 2HUNA 4E5PA 3MJ4A 3DL2A 3PLRA 4N54A 3WWYA 3RSHA 2VYND 1Y1PA 2DT5A 3ANLA 3OEWA 4YEDA 3I6QA 3WB9A 3T4EA 4CMAA 3OETA 4WNCA 3MJCA 1B3BA 3ZNQA 2Q1WA 4WKGA 2O23A 1EK6A 1K89A 5ILOA 4YYZA 2FPGA 2QW8A 2DC1A 1UP4A 2PTGA 3NT2A 1E1LA 1KVSA 4MP8A 2AEJA 3BMCB 4J7XA 4LRTB 1J6UA 3BMCA 3ZV3A 2EW2A 1PWZA 5K9ZA 4KZPA 3BTVA 4ESOA 3GMSA 4INAA 1ZK2A 1NR7A 1D3AA 1YBVA 4CLRB 4HFRA 4CV2A 3D7LA 4CMEC 3UW3A 3AOEC 4RVDA 4IJVA 3ZWPA 3FBTA 1AE1A 4XIJA 4L4XA 1HXHA 4BKUA 3PTZA 2BGKA 3OM9A 3RFTA 4Q39A 1XDWA 2H63A 4D0RA 1JTVA 3WXBA 1H9BA 3WYCA 4FFOA 1P9LA 3BTOA 2HRZA 5FYDA 3WOHA 3FF4A 4KWHA 4XJTA 1Y9AA 3PYMA 5ENDA 1ISIA 4GMGA 3ZWCA 2VZ9A 4J49A 3HFSA 1E7MA 3ZU5A 4LSWA 4XQEA 1UDAA 3S55A 4R1SA 3LT1A 1KOLA 4D3SA 3OEYA 1LSOA 5I7EA 4O63O 3HB5X 1QR6A 4BNFA 2VQ3A 2OP0A 3JQFA 1BRMA 3QY9A 2J5QA 3I9KA 3NT4A 2P4QA 3LF2A 3L4SO 3V1YA 3VC7A 1HETA 3GK3A 3ZDFA 4IQ0A 3NTOA 1JWAB 2IEBA 4URFA 1EE9A 5COAA 1EQ2A 1I24A 2V6MA 1LTHR 1GYPA 2ET6A 5TJHA 2Z5LA 3HQ4O 4BB6A 1B8UA 2EGHA 2Q1TA 4HX5A 1V3UA 3VAZA 1X14A 5AXBA 2VRCD 3ZCXA 1NHGA 5K6AA 4PLTA 4TRMA 3H5AA 3TDKA 1E1KA 1F06A 3FTNA 4W82A 5GZ3A 4IXTA 4FPXA 4RCVA 3BHMA 4E5NA 2JCVA 4XYEA 2DBQA 3EVNA 2CDCA 1RM4A 4PG4A 1LJ8A 2EJWA 3WJ7A 5JYDA 3P2YA 4CMIB 1E5LA 3LDHA 1F12A 1LLDA 3K2BA 1H6DA 1W0CA 4OQZA 1BWSA 1H0KA 5ITVA 1WDMA 3AK4A 4DPKA 1QV6A 3TZ6A 1Y81A 2VHVA 4TVBA 5HS6A 3IUSA 3H9JA 4CLOA 3NGXA 2GN4A 4YT2A 1EDZA 1OI7A 3LK7A 1HRDA 4JP3A 3RWBA 2EG9A 4J9UE 4YJHA 4TVOA 1QXSA 1QYXA 4IDFA 2ZKLA 4CV0A 2VZ8A 2Z1MA 3NYWA 5LCXA 2NACA 3WTCA 4C4OA 3F5QA 4CMEA 1N5DA 4H7PA 5TS3A 1GQQA 2GCGA 2XF8A 4A73A 3I23A 1I5RA 1EVYA 3H3FA 3PIDA 4MP3A 2QIOA 4JK3A 2Q50A 3JQBA 1AXGA 5I9MA 3HHPA 1DAOA 4GPD1 4CLDA 1IPEA 3DC2A 4IXWA 4RF3A 3WYEA 4BNKA 5FI3A 3ZV6A 3OQBA 4JJIA 2VTEA 3QQPA 3CIFA 3GPDG 4NI5A 4NPCA 4U5QA 1DLJA 4CUJA 2NQTA 2C29D 4CV3A 1B16A 1S6YA 3NX4A 1KY5A 3FNEA 1U2DA 1UZLA 4KQWA 3WGTA 5JLAA 3B1KA 5TGDA 2AG8A 3ZV5A 1HDXA 3EZYA 4OAQA 3LYLA 3CZMA 1ZK0A 4RL6A 3U4HA 2DBZA 2I99A 1E3IA 1I32A 3CMCO 2A94A 3I4CA 4WECA 1LSUA 3QWBA 4FC7A 3RUAA 1PJCA 4I8XA 2WJPA 1GZ6A 3JQ9A 4HP8A 4J9VA 3VZPA 1PJQA 4ZD6A 2JD2A 4CM5A 1SOWA 4B3HA 3JQ6A 4NK4A 4CODB 4FCCA 3VPGA 4HNHA 3UUWA 3E5RA 5AXAA 4MJLA 1WPQA 5JDCA 2QRJA 2Q1UA 2PD4A 2WD7B 1P1KA 4MKZA 1H6AA 1ENYA 5DOZA 5I9NA 5L4SA 3NUGA 4W9NA 3KSDO 3TZCA 1A71A 3S2FA 3EW7A 1DEHA 3VKVA 2FZWA 2V7PA 3JD2A 3PXXA 4YJFA 3O9ZA 3PGXA 1D1SA 1BVRA 4GVXA 1ML3A 2VYVA 5JW6A 2O3UA 1CF2O 1K6XA 3JQGB 4B3IA 1KEVA 1QSGA 1JKIA 5G4KA 5DULA 1LU9A 3RUHA 2ZTVA 2JAHA 3GGOA 2GUGA 3FCOA 4BNMA 4XRRA 4F3YA 5G0TA 3ASVA 4BKOA 2BD0A 5ENVA 2WTBA 3WGHA 2IXBA 2NU9A 4G5HA 4GLOA 1LXCA 1OOEA 2C7GA 4YJHB 3VH2A 1O9BA 1B15A 2IZ0A 2WWRA 3F4LA 3UKOA 3S2GA 3DBHA 5JYEA 4TWRA 3RIHA 4FB5A 3RQSA 2ZB8A 4P4NA 3UOGA 2PZJA 3SJ7A 3JYPA 5CDSA 1QORA 3HNPA 3GUCA 1DC4A 4S3MA 4PFJA 5JS6A 4W6ZA 4B79A 1TI7A 2X5OA 2ZB7A 4J4BA 3WQSB 4YRBA 4Z3KA 5F1PA 1NPDA 1WDLA 2PZLA 1NVMB 1A9YA 5FI5A 3L77A 5L45A 4IIVA 3FWZA 2NUAA 3PEFA 4MVJP 4ND2A 4OXNA 4HV4A 4NNJA 1DLIA 3ANMA 3LSYA 1YS4A 2J8ZA 4O0LA 4WLNA 2PGLA 4NDNE 2B69A 1U2GA 4PVCA 4Y98A 1VJ1A 3JV7A 1FF9A 1PL6A 3RROA 4ILKA 3WX0A 3DDNA 4DWVA 4GX2A 2EXXA 1NFFA 2O3QA 1TT5B 3IS3A 4RGBA 4NU6A 2FWMX 3FR7A 1LA2A 2Y1DA 4EZBA 5EESA 4JJGA 3RUDA 3W4IA 4XCVA 5IXYA 1IL0A 4UREA 1QMGA 4EBFA 3M2PA 3DOJA 4Q3CA 4L8VA 5TJ9A 3KETA 4CJXA 1A4IA 4E21A 3OJOA 1LQTA 4G2NA 4RF2A 1MA0A 3N74A 1NPYA 5L95A 3GMDA 3ZNOA 4RPGA 5J23A 4CM3A 1I3LA 1UZMA 3TZHA 4BO9A 4L4RA 1DAPA 4U7WA 3WGOA 1E3JA 4W99A 3U62A 4AJKA 3DFUA 4IGFA 3H4VA 2PV7A 2ZYGA 3JQCA 3GZNA 4YCAA 2RHRA 3AUSA 2NU8A 1E7WA 1ZSVA 2GZ1A 4P4LA 2YHUA 1GUZA 2GGSA 3DOCA 3WNVA 3CINA 2BF7A 4K6CA 4IJKA 3ZWOA 4RF4A 4TZTA 4I9HA 4YB8A 2H5LA 3HDJA 1UDCA 2IZZA 3A06A 4R68A 1ADGA 3BHIA 5JE8A 1YB1A 5EERA 1SO8A 4EUFA 3TNLA 4Z9YA 2VOEA 4K6FA 2G17A 4PG7A 1YRLA 3N7UA 1PS9A 1EVZA 2ZQZA 1UR5A 3IMFA 3AM5A 1LC0A 4OKIA 4F45A 1R66A 1DO8A 3U09A 2C0CA 4NQZA 1GPDG 4B3JA 4GLLA 1YOVA 3WSWA 1ZMOA 4IJUA 2DUWA 4I08A 1YDWA 1GZ3A 3F1KA 4FQ8A 1MXFA 3QV1A 2ZCVA 2P9GA 3I5MA 3EMKA 1C0IA 1P0FA 3LC1O 4BNNA 1YDEA 3RUFA 4YJGB 1LDBA 1V8BA 3E8XA 3GHYA 4K9DA 4CMCA 1PJTA 1U3WA 1B8PA 2OXIA 3TPCA 4ZQBA 4MOWA 5HA5A 5T8KA 1BHSA 1FK8A 4BGEA 3DOOA 4LK3A 4PGFA 4OYRA 1I01A 3DEYX 3G1TA 4RORA 2HCTA 1U8FO 3Q2IA 4A27A 2FPIA 2X0NA 3ZV4A 4CM4A 2VWQA 3GRPA 2ZTMA 3Q1LA 1XR3A 3GZNB 5CAEA 4IQ8A 5TX7A 2IYPA 2I9PA 4YRDA 1IULA 1SB9A 2JHGA 3F1LA 1FDWA 1I3NA 2UV8A 3K5PA 1W8DA 3I9MA 4NZ9A 2DLDA 3AOEA 1O0SA 3W4KA 2D0IA 3GVXA 2FY8A 1IHYA 2C7VA 3R0IA 3ZNNA 4NHEA 4DLAA 3ZWWA 2YW9A 1UXKA 5JSFA 3GDOA 4UEOA 3CSDA 4ZA2A 5F1OA 2BRUA 4EW6A 1IOLA 3OSUA 2A35A 5B1YA 2VZ0A 3BMQA 5H81A 1T26A 4IPTA 1ARZA 4XZ3A 3H2SA 4B7UA 5A9TA 2HMUA 3QE3A 1ONOA 3L6DA 2OZPA 2CVQA 4HNGA 4BIIA 1PJ3A 4DMLA 1F8GA 3PQFA 1EQUA 5HWSA 1GYQA 4CM9D 4XB1A 4XRGA 4IDCA 1VPDA 1DPGA 4TQGA 2C2XA 3Q9NA 1DIGA 2GLXA 4II3A 3L9WA 4AL4A 3R6DA 3P2OA 3SBOA 4YT5A 4TKLA 4NG5A 4NMHA 3JQ7A 3F47A 1ONNA 2ZJ1A 3M6IA 4DIFA 1EVIA 3GFBA 3ETGA 4OMUA 4E2YA 3GZ4A 3PIIA 4Y9DA 1J0XO 1Z7BA 1A7KA 2IODA 1DIHA 3R1IA 4Q3AA 3AI1A 3ZWAA 2YDYA 5CPFA 1PZEA 3H9QA 3FSRA 3JYLA 5KJCA 4EYEA 1YVEI 3RD5A 1JAXA 4J91A 1C1DA 5I8ZA 3F4BA 4YR9A 3JQ8A 1P1FA 2NVWA 1VJ0A 2UVDA 1W6UA 2OBNA 1DC6A 4HWKA 4CQMD 3I83A 4IY1A 4I5EA 3AUAA 3GDGA 1WWKA 3H7AA 4BGIA 4RV9A 1V6AA 1UP7A 5JY6A 4GWKA 4CMBA 4R54A 4MVJE 3AM4A 4M86A 4O59O 3VVBA 1SZJG 1WXDA 3L6OO 1P77A 5COBA 4E5YA 4BMNA 1F0YA 3OJFA 1HE5A 4J4TA 2GN8A 1XU9A 4DXHA 5DBFA 4MKXA 4PG6A 3GT0A 1SOVA 3H9UA 3TOZA 4DUPA 5JO0A 5IZ4A 4BNZA 3NAQA 4TMFA 3RUIA 4UAGA 3C7AA 1UXIA 3ONEA 3HSKA 2AEMA 4ALIA 1P31A 4LMPA 3QIVA 4WE3A 1L7EA 4MVJH 5BNIA 2DFDA 1E6EA 4E13A 3JYQA 2AE2A 3DTTA 3DZBA 3I9JA 2WE8A 1D1TA 1K2WA 1MG5A 4IDDA 3SC6A 3TSCA 2YHIB 3SXPA 2BI8A 3JQDA 1PL7A 2Q49A 1ZXLA 3I52A 3RC9A 1NM5A 3Q0EA 3WBBA 4I1IA 4CLEA 4E32A 4NFHA 4QXMA 2CF6A 2DVMA 2Y0EA 3PJDA 3U0BA 3WIDA 1P0CA 3FD8A 5KWEA 4DPLA 3DTYA 2HK9A 1EUCA 1WMBA 3RKUA 4P22A 4H15A 5CPBA 2WE7A 4GL4A 1MC5A 4C7KA 1EMDA 4Y6SA 4CMGA 2EKPA 3MTJA 3ZWNA 3COSA 2GSDA 4XGKA 3OQ6A 2E49A 5CDTA 2NADA 3OICA 2PGDA 1JA9A 1H2BA 2Z95A 1K6IA 3M1AA 3FNFA 5HBRA 3NTRA 3PHIA 2GN6A 1O94A 2Y68A 2NVBA 4IQGA 1H5QA 1YL7A 4ID9A 3GUYA 4RQUA 3MJSA 1HE3A 3IL2A 4RLSA 2NSDA 5JDIA 1OBFO 1VKOA 4E5MA 3TL2A 1A5ZA 2O48X 3MJEA 3E03A 4FJ2A 5F5NA 4X54A 4CM8A 1Q7BA 1N7HA 1DC3A 2AXQA 4MVJA 1J49A 2J3JA 2PZMA 3KYDA 4L74A 1JDJA 4FGWA 4OO3A 1PZHA 1Y7TA 5A02A 4F6LA 3QHAA 4R1NA 1A4UA 1PL8A 9LDTA 3MTGA 4OSPA 4PG8A 4Z6KA 4AFNA 1LLUA 1Y6JA 2D1YA 1T2AA 4K28A 1V3TA 4WUVA 1DBVO 4DYVA 4EI2A 2X23A 4J1QA 4JBGA 3TL3A 1GQ2A 2SCUA 2RIRA 3OA0A 5ILGA 1LEHA 1ISHA 1GFSA 3Q2KA 1U8XX 3AUTA 4E31A 1ONPA 3ENNA 1MLDA 3I3OA 3WQRA 5JFOA 3LU1A 2FR8A 2EKLA 2Y0DA 5CDUA 1A27A 4D46A 1IB6A 4TZKA 5H82A 1YOVB 2DFVA 4B4VA 1P33A 3KRTA 4Y6RA 4AVYA 4E2ZA 3TQHA 3NGLA 4R51A 3SLGA 3PHGA 2Y66A 4U6QA 1I36A 4L73A 5EL0A 3GC6A 4E2XA 4U0JA 1E7SA 3BIOA 3WG9A 3IUPA 4D42A 4DQXA 1Y5RA 3IP1A 4EJ6A 2Q45A 3NDIA 1GCOA 2PR2A 1DIRA 2YUTA 1UAYA 5JC8A 2HDHA 1DRUA 2NLOA 1PZGA 1ZUD1 5BQFA 4Z3DA 4QX6A 4LSMA 4TROA 2BGMA 3KSZO 1IZ9A 1U5AA 3E48A 4QECA 2WMDA 4XDYA 1R15A 1UP6A 3NKLA 3BHJA 1GTMA 1Z7EA 5ADHA 1KYQA 4DLBA 2ZTLA 3H9GA 3RC1A 1BXKA 3GRKA 4PVDA 4IMRA 3JQ9C 4JLWA 2VYVD 1ZK4A 1U7HA 1YXMA 1U4SA 2HQ1A 4HFNA 1I2ZA 1GYRA 2DTDA 4UEJA 2G5CA 4FFMA 3OJLA 2ZYAA 2PKRA 1H6BA 1R4MB 4IS2A 2UAGA 1KC3A 3W6ZA 5TIIA 1R12A 1NFQA 4PN3A 2PK3A 1B7GO 1ADCA 1G1AA 4GSKA 3U49A 1NVTA 2VHXA 5IZCC 4YAEA 3NEPX 5JO9A 4D79A 5EQFA 3ZWYA 4U6SA 5L7WA 3PJEA 3Q3CA 2DPHA 3D4PA 3GR6A 4YAJA 5T57A 3RKRA 7MDHA 1A72A 1LLCA 2FHSA 2Q2QA 3I6IA 4ALJA 1XHLA 4D3FA 1DFHA 1U3VA 5JDCC 2Q46A 1DRWA 4WOKA 1XQ6A 4IDGA 3VH3A 1YJ8A 1HTBA 4WCFB 1MUUA 1ZKMA 1Q2XA 5G4KB 1E92A 5BSHA 4CL3A 1P45A 4A2CA 4CMHA 1HKUA 3ROQA 2C5AA 1NTOA 1DJQA 2C5EA 1O5IA 3PQDA 5TF4A 4QT0A 1N9GB 1GV0A 4WEQA 1D7OA 3H5RA 4UUPA 3PZRA 4M49A 1YE3A 5EIOA 1CRWG 4WOJA 4FSHA 3QVSA 3T4XA 2H1SA 4RVFA 5T5QA 4YAIA 4K1LA 4PLGA 1HLPA 3SC4A 3SLKA 3AM3A 2VRBA 3TFQA 3HDHA 2W2KB 3O38A 2DU8A 1EUDA 2J3IA 5L3ZA 3PHLA 4XR9A 5CEFA 4GH5A 4R5HA 2Y93A 3GVCA 5ICSA 1NNUA 2FOIA 3SJUA 1NP3A 3KEQA 2BI7A 2I67A 3P19A 1BXGB 4GAEA 1ORRA 1VE9A 5DT9A 4CR6A 2FMUA 4EEXA 3AY3A 1OMOA 3JQAA 1YO6A 3PFWO 3E18A 4Z9FA 2H6EA 2WD8A 3WIEA 2IDZA 3OECA 1BGVA 1HDRA 3GDFA 5L51A 1IZ0A 3V2GA 1KVQA 1EK5A 2B4RO 2FRDA 1GU7A 2WSBA 4EITA 3K2EA 1DXYA 3AU8A 3ZI0A 3JQBC 4BNTA 1X7DA 1MGOA 3D3WB 2YV2A 2P68A 4LRSB 3CKYA 2CF5A 4QO8A 1HDOA 1DOHA 1E7QA 1KS9A 2W4QA 3C1AA 1PQWA 3DR3A 5DOVA 3FI9A 2BELA 2CD9A 4J1TA 1U4OA 4TKMA 3W8DA 3RBVA 3WLFA 1AGNA 1T2DA 2A9FA 1T2EA 1LUAA 1KVRA 1UXGA 1VJTA 2WDZA 3G3EA 3G49A 2ZB4A 4NK5A 1HZZA 1F17A 3ZU3A 4O6VA 1JKJA 1ISJA 2YZ7A 3GY0A 2NVUA 4I5DA 1XGKA 3H9EO 2VWPA 3OA2A 4AJHA 1E1MA 2Z1NA 1B14A 1Z73A 1CYDA 3E82A 4R1TA 3LT2A 2DTEA 1XQ1A 1RM5A 1K6JA 3HB4X 4CQMA 4IM7A 1DRVA 4RDIA 3QLJA 4PLHA 1VKNA 3DZHA 1C3VA 4KTVE 4XKJA 4BMVA 2Y1EA 2POQX 1HZJA 2FN7A 2I66A 4FDAA 3IIEA 4RVSA 3RASA 1NR1A 3UVEA 2Y0CA 5A9RA 1ZEMA 1GEEA 1LQUA 5CG1A 2AQKA 3CH6A 3K6JA 2C07A 1NVGA 4OJNA 1VLLA 2Y05A 5JXWA 4ND5A 2PH5A 5ER9A 1LI4A 3ANNA 3C8MA 1PGJA 3TF5A 2VWGA 2VNAA 2EWMA 1FDTA 1R4NA 2TMGA 4FOSA 4P38A 1BSVA 4XJSA 2VT2A 1SEPA 2O3JA 2B0JA 3WYBA 3WQQA 3ZN2A 1WDKA 4W9NC 1DFGA 5TC4A 1ZNQO 1TEHA 2O7QA 4YVFA 4PG5A 4XA8A 4UVGA 2FP4A 1U3UA 1YQGA 3VDRA 3ULKA 4GVLA 4LN1A 3GAFA 3MJVA 2Y67A 3ICCA 2FPPA 3JD1A 4IZIA 3WMWA 5L40A 2IE0A 3D0OA 3OJEA 2VOJA 4XYMA 4JXKA 2B83A 3R3SA 4D0SA 1BDMA 2RH4A 4CUZA 1HDYA 1RYEA 5LDGA 5C37A 5G0UA 3BMQB 2O4UX 3K8ZA 5A3JA 2HMSA 3U4CA 3KTDA 1L7DA 4QSMA 5KVQA 1P3DA 1EVJA 2GR9A 2VHYA 3PJGA 1E3SA 4NU5A 1E6WA 4KUGA 3GVHA 3JYOA 5GMOA 4DL9A 1UJMA 3DBRB 2OUIA 2Y1GA 3ZHXA 3KYCB 5C7OO 4C7JA 4FR5A 5FWNA 1JQBA 2NV6A 4PLVA 4YWJA 1P1IA 3GVPA 5T6BA 3TRIA 1U5CA 3PRJA 1SB8A 5L7TA 5A5EA 3MOGA 3UFXA 2P2SA 2R00C 4GX5A 4J2OA 1Z74A 3BA1A 4XGNA 3IKTA 2VHZA 4QFCA 3DHNA 2W8ZA 1P1HA 1ZK3A 3ROKA 4BNUA 1PEDA 1KC1A 1LX6A 3VOSA 2V6BA 3ZZNA 4M1QA 1XELA 2DAPA 4BO6A 5C7LO 5IDXA 4HBGA 4NJMA 2CDAA 2Q4EA 3LVFO 4UVIA 4IUYA 1N1GA 1Q0LA 4GMFA 1W73A 1YONA 3I4FA 1ZZEA 2EHDA 3EDMA 3DHYA 1OC2A 2IZ1A 3PP8A 1WMAA 2HSDA 2DUUA 3IQDB 2EV9A 3UN1A 1O89A 1T2CA 3S1LA 3UHAA 4DMMA 2YV3A 3KZVA 2FR1A 4O5OA 3TWOA 4MVJI 4XYBA 2WYUA 3ZWMA 4ZJUA 3S8MA 4E33A 1C1XA 1NQ5A 4JGBA 4FFNA 2W98A 2DKNA 3AJRA 5IJZA 5JCJD 3EGOA 3OMLA 2I3GA 1ZO8A 2CVOA 1ISGA 4YQZA 4UVEA 5GZ6A 4YPOA 4CLXA 5TT1A 3VPHA 3NRCA 3ADPA 1NAHA 1HYHA 4OH1A 2B5VA 3DWFA 4Q9NA 2Q2VA 5K0ZA 1TT5A 3ENKA 5JBIA 1PGQA 4XIYA 1JKFA 4MDHA 3H3JA 1RWBA 2VWHA 3ZWBA 1Z6ZA 3AW9A 4KQXA 3D4OA 4LMRA 2WYVA 1AHHA 1PR3A 2EJVA 3HE3A 3PJFA 1FJHA 3JQ8B 4L9RA 2X22A 1X1EA 2X5KO 5H83A 4O1MA 4E2WA 5L7YA 4R3NA 3R3JA 4LGVA 4IS3A 1Y8RB 2YYYA 4CM1A 1ZIDA 3GA0A 1O6ZA 3ONDA 4J90A 5A9SB 2JAPA 2Q3EA 5EQDA 5B37A 1A7AA 3WNQA 2GASA 2O3SA 1H6CA 4GGPA 4ZGWA 1X1TA 2BHLA 3SVTA 5I9LA 1NYTA 1U9JA 4J7UA 2GERA 5BT9A 1TB4A 1JWBB 1I2BA 1PWXA 2FSSA 3IDSA 3LF1A 1UUFA 4CLRA 3QWIA 4CMJA 1GDHA 3B1JA 3BTUA 1KEPA 3OBBA 3VH1A 2BFPA 2OOSA 4E5KA 1X0XA 1LDGA 1BXGA 2YQ4A 4AJLA 5KCZA 2BFOA 4D7AA 1E0DA 4PIVA 3UXYA 4XYGA 2PKQO 4EUHA 3CPSA 1U28A 4EEZA 1LLQA 1C0KA 2P9EA 1C0LA 2JFHA 1WLYA 1PJSA 4WPGA 4KDFA 5KJ6A 1KVUA 3F9IA 4AICA 5CG2A 3GVIA 4BGUA 3H5NA 3A28A 3QJ5A 5DF1A 1S7CA 5IDYA 3PDJA 4BOYA 2O4CA 3HADA 4JIGA 2O3TA 3JQAB
chains in the Genus database with same CATH superfamily
4BKQA 1EFDN 3KSRA 5U9CA 1YR6A 3IUNA 3A14A 4M8NE 2YVLA 2BH9A 2NO0A 5CCXA 3GEMA 2JASA 3PWKA 5H16A 3G79A 2IX9A 1TPZA 4TYPA 5A05A 5TARA 1V95A 3SC2B 1FMTA 2RHDA 4XARA 1FTQA 3C39A 3P45A 3V6LA 3UFBA 4JKOA 1A9XB 5KOHB 2NW6A 3KT0A 5B64A 1ZXBA 1TTPB 3SM9A 3KYDB 2JGFA 1ZKDA 2HWYA 2DWUA 1R6XA 5DYNA 3W5DA 2YY5A 2C4NA 1BN6A 3QM1A 3H19A 4NNPA 2ZIZA 3TZBA 3QH4A 1FMFA 2Q99A 4OKNA 2QUIA 4YAOA 4F3NA 4CG1A 1CJCA 4Y6QA 3RBZA 1IB0A 4KYUA 4MYRA 1X1DA 1ONBA 4WJZA 1TJPB 1TM5E 2IZOA 4JDUA 4RZHA 3MLBA 4JZKA 2A2ZA 1AXEA 1IWOA 2I1VB 4E2FA 2H48A 3UC9A 1N9ZA 4PE5B 1NWHA 4P7JA 3K4QA 1PZMA 4QBHA 3K30A 2A8YA 1EM6A 1AZWA 1W8IA 4UEKA 2B4AA 5KIAA 1WBBA 2JS7A 4ZWNA 2FVXA 4H1UA 1BWQA 1CF9A 2W6JD 3V48A 2JG3A 1VKHA 4L51A 2DQKA 1MXHA 4YAGA 1Q6YA 4XM2A 2AOUB 5H0IA 5A4MS 4ALLA 1W52X 2QG4A 2IX3A 1E5VA 2CZGA 4BZZA 1Y5IA 3R75A 3OKPA 1J9GA 2MYTA 1OYWA 3UHOA 5DZSA 1JTFA 3UM9A 1PTJA 2C98A 4EATA 3IJPA 3SF8B 2K7ZA 3AVUA 1PX0A 1QGDA 1TOAA 3LQ2A 4REQA 1IMJA 1T6ZA 5F7XA 8MHTA 3C7CB 3K9GA 5DX8A 4S1NA 3QZUA 1TCVA 4ZTBA 1JZTA 2AMFA 2JHCA 5DVZA 1I7QB 4BCBA 2N75A 3LUBA 3C3EA 3VPDA 4EHNA 2IYUA 3LQFA 2FWBA 6AT1A 3OZCA 5LQMA 1XX6A 5JCJA 2PXAA 4YRTA 5DYIA 5B57C 3C3JA 5TGTA 2WVGA 1DBIA 3NV7A 3BK2A 1QVRA 1VQ1A 3TQFA 2PWYA 3HL0A 1Q95A 4FGSA 3KXDA 5J5AA 1VM6A 4GXTA 3CF6R 2XRYA 3R9WA 1GZ4A 1DT3A 3FCYA 3IP6A 3EF3A 2RGXA 2WFLB 4M6WA 1G8AA 2WWHA 4DY4A 5EWLA 1U5BB 1RI4A 3GHHA 1OROA 3D5QA 1J56A 5IJ0B 5ILQA 5IH7A 4JXXA 2VNHA 1MC4A 5DYWA 3BERA 4R71A 5EJ6A 5J63A 3U3XA 2ODAA 2R6HA 1TFUA 4IVNA 4ZK2A 1SK8A 2JKYA 3W3ZB 2J0UA 1BWRA 3WGQA 5J4HA 2R48A 4M9SA 1F9AA 2QD3A 3UFXB 1YRAA 4BB5A 4RVCA 4H3VA 1AKYA 3GPIA 3RI3A 1T0JB 4MWZA 1W5BA 1YIAA 4U9IS 1T5HX 2UDPA 2VCEA 4HNAA 1XMJA 1IY0A 2A9JA 4OLFA 4UUMA 3NONA 3L2OB 4FFPA 3KCNA 3KR1A 4OI2A 3QPDA 1H66A 1JIKA 2XYHA 1MV8A 2Y92A 1Y8CA 3FWNA 2R62A 2CL6X 5A4JA 1O96B 3ST7A 2HJGA 3AFOA 3E3MA 2AK3A 4H4EA 5KYVA 1X7GA 4GSYA 2G72A 4W5WA 1HF3A 1XL0A 1QRUA 1L7XA 2GYWA 3IOBA 4QTTB 1JKJB 1DELA 1W5FA 1EX1A 4N49A 4K9LA 2V97A 5B3AA 1E2HA 3NMUF 1AY0A 1G0NA 1XWFA 3SDSA 2ETVA 2F00A 4XCQA 5TEVA 1U8AA 3OUTA 4PYJA 2POCA 4Y9RA 4MK4A 4S05A 5KQLA 3II6X 2R7NA 3I6YA 4FHCA 5A71A 3QX3A 2JGLA 3B82A 1DDOA 2H31A 3PXCX 2VHUA 4I5GA 1PJZA 1JU9A 2P67A 4OSEA 2MSDB 2VNSA 4RA6B 3W7BA 2PQ6A 3F8TA 1HE1C 3W2GA 2WICA 4EB6B 1WU8A 4QDZA 1YAJA 4U2KA 3GA7A 5B4UA 4AJ4A 4JVMA 4EHIA 4CR8A 3QWHA 4DZZA 3DDSA 4Q21A 3EPRA 4ZCRA 2VDRB 4CN8A 2NZJA 1V41E 1QU3A 4KNYA 1N6PA 3OAAA 2X14A 3H8VA 2VF2A 2DEUA 3HH8A 4IMPA 3NDJA 2QA5A 5AUPB 1L8LA 4UZSA 3AZPA 4RVGA 4MDYA 3G0CA 4X61A 1CHDA 3C41J 4UFPA 2GEVA 3JAMA 5AK6A 2EP5A 3ORSA 3B53X 2Z43A 4J2TA 1AQUA 4KO3S 4N5HX 4U9UA 3QELA 3LUDA 3T7DA 3NC0C 4LHEA 1FYEA 4ND6A 1I2AA 4CQLA 1UJ4A 1OV4A 5JDIC 2VO1A 3HEBA 3K92A 5FORA 2CFSA 3FKSD 2R1VB 2R5NA 2UUPA 2Q5JA 1HLDA 3BMNA 3EK2A 1MX1A 3U4IA 4H60A 4X41A 4X6XA 4AG3A 3I8XA 4FKZA 4QO7A 4A2QA 2WUGA 4HQ6A 4EG6A 3Q6MA 2P2DA 4LHSA 1EFAA 5LLDA 3GW8A 3E81A 2IPLA 3L9XA 3ZXUB 1KETA 1U04A 2W6IA 5K8TA 2WVAA 2OAEA 4ODIA 3Q3JB 3VI3B 3MWJA 1TAQA 1Q0ZA 3QWAA 1M7HA 4RS4A 2OHGA 1UPBA 1NX6A 3ADCA 1V37A 2PL3A 2X8LA 3LHKA 1W36B 3NGMA 4LXXA 1E7YA 3AR3A 5B55A 5MN4A 3KKKA 1VHJA 4IDEA 4CMCA 4DA0A 4PTZA 1ZCFA 2FN3A 2OGUA 5CU7A 5DCUA 1USWA 2A57A 1YE5A 2BLNA 3C8DA 5DBOA 4N9QA 4ACAA 4DLNA 2VUUA 1PGPA 3EN0A 3FCXA 1ZVVA 1MZPA 3NBKA 3R5TA 3TI9A 5I7VA 1JVNA 1VL2A 1Z3IX 3ZLUA 3I5YA 4L95C 5JEDA 2BDUA 2B1GA 3OD1A 2XMDA 1E2MA 2FUEA 5FTNA 4KR2A 1LKZA 4L5CA 2AZDA 3AF6A 1OXUA 4HXEB 4HMQA 3Q8WA 4TQUS 2PAAA 4W4TA 4ZARA 1LGYA 4QUBA 5TS2A 4B31A 5INTA 5FLXA 1XZCA 1CHNA 4TUYA 3DMTA 3AWDA 2A0FA 4QE3A 2R86A 1EZ4A 2GTPA 1Z22A 3MFQA 4IDNA 5MGBA 1NXQA 5HUHA 1HQDA 3GG9A 4UDXX 1EA7A 4W9RA 1SY7A 4XR4A 1WDTA 4MMZB 5HIJA 2JDIA 1WKVA 1P6UA 1SKBA 3EZLA 4RPKA 5DEIA 3RVKA 1C4XA 4B80A 4X3PA 4PLWA 1MFZA 1I6LA 1XN1A 2EC5A 2WJ4A 4UBIA 4YJGA 1RBMA 3DP7A 4D3DA 1RQGA 2FCAA 3EHDA 4Q48A 1I0ZA 4GI2A 3LDUA 4BDSA 5A5DA 2YTZA 1U98A 4EELA 1Y3CE 1WSBA 4MHTA 2WQZA 4EECA 1ISPA 3UBMA 2HU2A 1VC2A 1Z37A 2DJ5A 4EA9A 5DRYA 1VP9A 1Q1NA 1W47A 3GARA 3SCZA 5LD2B 2QW0X 1WKBA 3QMMA 5DNYB 3WMXA 4FEYA 1OAAA 1EFLA 1WCIB 3P96A 4LAFA 2GB4A 3M6FA 4F56A 4CEJB 3PHJA 1QYCA 3C5EA 1L4NA 3G9TA 2VS1A 1Z0JA 4B87A 3KFLA 5LA6B 1RYDA 5K8JB 2C77A 1C7IA 2AC2A 5CH3A 4L6IA 3I34X 3T9DA 1MPTA 3KZMA 4GBMA 4EDFA 2NU7A 3DMGA 2V3CC 2WM8A 4N82A 3V80A 4QQRA 1T15A 3S2IA 1KAMA 2RHLA 5AKLA 2ZZKA 1KTIA 4MW0A 2YIMA 5EZYA 1QLJA 1K3TA 4M0DA 1HX7A 3WE7A 3DMYA 3MZ0A 1V1MA 2QLLA 2NZ2A 3CE9A 5G1OA 3T3MB 4N5IX 3VZDA 3PFKA 1P44A 1NULA 5JANA 2E6UX 5K6TA 4JR2A 4YAFA 3D1LA 4NFSA 2W70A 4ZTZB 1XJWA 2Y6UA 3QPUA 4FFDA 4MUBA 5C0OE 2IYQA 4EHJA 1NL3A 3DQPA 5IC4A 4KSBA 1EXMA 1N3LA 4FE4A 4P4SA 2O8DA 4E3ZA 1L9KA 1HT0A 2G83A 3BD6A 1MB4A 5HCNA 1FDVA 3E4CA 5LZ4A 4LV8B 4XFDA 5KPJA 5IVPA 4MRAA 1PSDA 3CRZA 4AY3A 5C53B 3N0TA 1A9SA 1HFWA 1V4BA 1OGIA 2IKQA 5BYKA 2O6LA 4WKBA 2X4IA 2UZ3A 1II8B 1N2CE 2HHAA 5DRTA 1AB5A 1WF6A 2QP9X 4BJ5A 3AVXA 2EKZA 3QOWA 1TKRA 2QN6A 5HCUA 5I7UA 2FG5A 2ZIWB 4GPZA 2Q3BA 2WJYA 4W7HA 3D2AA 4G84A 4U1RA 5TLSA 5CVCA 1QMPA 1ESMA 5BO5A 4YAKA 5I9BA 1IVSA 1D5WA 1WD7A 3OTHA 4I36A 2G5PA 2MYPA 3IKVA 3PEUA 4TWZA 1J8YF 1OA1A 3OZFA 1KOFA 2NWQA 3AI2A 4X1OA 3UAGA 1JB9A 1NXWA 3GLKA 1QHGA 3IUMA 5BMVA 5KTMA 4URZR 2YDXA 3I9NA 8AT1A 2YWFA 3GDWA 3K5IA 1HFKA 4HBZA 1SZPA 1KIFA 4IF6A 2ZVDA 1JN0A 3LLSA 3R24A 1JHAA 5E7QA 3OZWA 1Y5MA 4K6GA 4PRLA 3SEFA 3MOIA 2YRXA 2ONYA 3PFNA 1OVGA 4P2BA 3VO1A 5SYAA 4F8EA 2RKOA 2WWTA 1XAIA 3DVAA 3CB4A 3KBOA 4UEWA 2Q5CA 1BGWA 1RABA 1RLMA 2JLSA 4IIFA 1LK7A 2VLIA 1YFZA 5DM70 5JPDA 2NXJA 4GS5A 2WTAA 3G13A 3EQ8A 3WQBA 2JIMA 4UXIA 2DFNA 5U4QA 3EJ6A 3GLRA 1IBCA 1LQ2A 3W9UA 3TM5A 4ZN6A 3RVMA 3SNKA 4YXFA 4MUNA 4ZQEA 1IQ0A 3G2PA 4JOBA 4ETWA 4MV8A 1EBFA 4MYDA 2PYZA 2M2IA 3P7MA 1JMVA 1M2KA 1TVKA 1ZEJA 2P0AA 2WZDA 1HA3A 3BBLA 3U13A 1H3EA 1D2GA 1M83A 2IYZA 3FNIA 1JRLA 3QLUC 4MR8B 4YN3A 4D9FA 1CZKA 1Y9EA 4B7CA 4LF9B 4JP5A 5AVUA 4BVBA 3GFOA 2KPOA 2QLJA 2FP4B 2XCRB 3RGWS 2EARA 3IAM1 3L07A 1RZUA 3H5VA 3FGNA 4QYIA 2R96A 3F96A 3OPYB 3FPHA 4UFOA 4C0KA 1L4KA 3PE3A 1QHIA 4QODA 3JPYA 1OH8A 1QPGA 2GPNA 1NN1A 1QHHA 5I01A 2X0RA 2PA0A 3DZFA 1G5TA 1F4PA 3A4MA 3KU4A 4G0XA 3G9QA 2W22A 2PQMA 2NZWA 3HR7A 4BLUA 1Z8HA 2QPAA 1N2IA 3BFXA 5AKKA 1Q7EA 1SUAA 3FVWA 3TTWA 1BVHA 3TLJA 1C8KA 2R65A 2X7HA 1OPXA 4GNRA 3P4YA 4HGOA 1KYZA 4RYDA 2BGGA 1RRMA 2C2MA 2IVFA 2ATVA 3W2FA 5JATA 1KDRA 1LPBB 1QOPB 2CEAA 1EVKA 4NU0A 2BKVA 4ISCA 1ENZA 4QHYA 4ZXFA 1N2SA 1ZIYA 1FU8A 3OZBA 1KNQA 4HLNA 2BE7A 4IYJA 4K9MA 3STWA 2VSQA 4TXLA 3T3EA 3EXEA 2P9YA 2CL0X 4AD8A 2F4VB 2PZGA 3MJDA 2IY7A 2LGJA 1TYEB 3O94A 5FA6A 5TMBA 2YR0A 1DL5A 4BGDA 3HN7A 3WIBA 4KK4A 3OZIA 4EJSC 3KL2A 4EKDA 2DKOA 4EA6A 1VL8A 3V4SA 5BQ3A 4FFSA 1T4BA 3CRRA 2OO3A 4ZVQA 4LJ8A 2PMCA 4C43A 5B5SA 1NJSA 2R1TA 4IICA 2GKGA 2F43A 2X3FA 3F5DA 3RABA 5JXGA 1JJVA 2GYYA 2IGTA 3BKXA 3I6MA 4TXNA 5JMPA 5KYWB 3ZJUA 4QFDA 1K3FA 1TAHA 3EHEA 3WGUA 1TW3A 4IH1A 2FLWA 3QE4A 4EL0A 4KRFA 1ADBA 1GNQA 1NW6A 3B7PA 4BYGA 1H2HA 2O5VA 2ZJZA 1S8FA 3L93A 3EF0A 4C30A 5DBGA 3S1AB 1D6JA 2IUEA 3SYMA 4XWGA 1KGSA 2HDOA 2WKQA 3W5AA 2OZEA 3PENA 4B9EA 4DRYA 4RULA 3LUJA 4G8DA 2CWDA 3MFYA 3MUEA 5D86A 4E7OA 4PYLA 3RBXA 1I3MA 1F14A 3JCZA 4MCAA 4UE3S 4G4IA 3E22B 1GL9B 2BLLA 2FSPA 2JIPA 1CEQA 3PGJA 4O2LA 5HMMA 1HEIA 3AHCA 2BIFA 4DQLA 2Q2OA 5BR4A 3ROPA 3E70C 3M89A 4Z0TA 1DXQA 5REQB 1RI3A 5C32A 4RTSA 5ALIA 1DX6A 2YHIA 2BGRA 4KLAA 1G9TA 1PQPA 4IINA 1U2DC 4BLOA 3Q8LA 2BKEA 1X80A 2BGLA 5H9WA 1SAYA 4R3WA 1KK3A 2IXAA 2Z57A 3KLMX 3LZ6A 5J40A 521PA 5THQA 1CVIA 3HJHA 2WZCA 1ZHHA 3B9RA 3GN2A 4L3WA 4FFLA 4UXHA 3REQB 4BAUA 4BQSA 2PH7A 5TT0A 4XOIA 1A0OA 4PICA 1WR8A 1UOQA 5IMBA 4AZ0A 2ATIA 3MWDB 5LPNA 5JMWA 1VFPA 3V6MA 1HE4A 2ACKA 1W94A 4MIOA 3FFWA 2I76A 4IIHA 3M4ZA 3U17A 3OU7A 1SUDA 3PS9A 2QPOA 1W4AA 5MDHA 2CMFA 1PR6A 4IIUA 4DLUA 4YCSA 1WVGA 3PXAA 1YU6A 2J9FB 3I92A 3PI6A 4ONEA 3SBEA 1RW4A 3KJEA 3EAGA 3AUYA 4OHXA 3HZHA 5JAQA 5J1SB 4WLFA 4PX2A 2OB2A 4WXMA 1MG0A 2WHXA 3TEFA 4QQNA 4R98A 1A69A 1NC3A 1V43A 1YI8A 3OQPA 4MGEA 1GVNB 4QUKA 1J1UA 3UWOA 4E30A 1RVV1 4GI5A 3T5AA 1H05A 5L4NA 5LZ9A 3ZYZA 5TSDA 3CVYA 1NVWQ 1JLLA 5I48A 2GO1A 2P1DA 2XE7A 2EVWX 3WFJA 1ZSNA 3M33A 2Q9CA 3DBLA 4N47A 1E9RA 4IMJB 4V0KA 5CNMA 1GM5A 1O0CA 4PPYA 5FUBA 2JJMA 2YH2A 5KVSA 4FKMA 3ZHZA 4UOEA 4ME6A 4RJJA 1ANKA 2BONA 2OP1A 3DBVO 1CLEA 4O33A 4DOMA 2UXBB 1G21A 1UK7A 4HFMA 4IDBA 4BP1A 3BWCA 5AJTA 3LQRA 4DUYB 2CJFA 1YB2A 1DV1A 4EA8A 2FJPA 2AQ8A 1YC5A 2QX6A 3AOGA 1NVVR 1B6TA 2FQ1A 5KHAA 1TQ4A 4ZIRB 3F3MA 4TN5A 1FLDA 1G5FA 3NIBA 3UB4A 2QB5A 1C4KA 4WACA 1ECPA 1PG2A 2QUAA 3EGWA 3ZCRA 1R5BA 4JUDX 3A37A 5K4AA 4PLPA 3Q7IA 5A2GA 1QANA 4B3RB 2IS6A 1SXJC 4R01A 1SXJA 4DIBA 4RMIA 4X93A 3HXOA 4IP0A 2BTEA 1AZSC 4FNMA 4A26A 2AFVA 3M6XA 3IB3A 1PKXA 3QU4A 4MPDA 2XNJA 1NXPA 3KWMA 1XDBA 4V2IA 1N1MA 3QE2A 1JECA 1X2EA 4TSKA 5T64A 4RK7A 4MS4B 2OV3A 4FMPA 4MAFA 3WWPA 5KNDD 3BWBA 1QOZA 2V0NA 2QTGA 5ALMA 4KNVA 4NF2A 4H17A 2PX0A 4QOHA 4HAUA 6NULA 2F48A 1UBFA 3AT1A 2Q3JA 1FY2A 2F9MA 3K2IA 3VGPA 4F5YA 1ECJA 3PNKA 1YUBA 4TXJA 3ZE0B 5AQ1A 2A59A 4OHRA 2O5RA 3MWEA 3ZHVA 2ST1A 5EE1A 2H0QA 4K8RB 4BHTA 1OZGA 3L7KA 2H4FA 3R8FA 4Q4HB 1FX0B 1RAFA 2IEZA 1HYEA 2B5OA 2UYHA 2COEA 1RIIA 2HO5A 3O8OA 3EWAA 4IILA 4QNRA 4UZFA 2PUWA 4BS9A 1V5WA 1CQIB 3ABQB 1Q2UA 1Z07A 3EPPA 3CZRA 3PXBA 4MAAA 4RZSA 1UOEA 3H2YA 4LJRA 1VSTA 3DKKA 4IMIB 4MS1A 1ZUNB 4XGIA 1Y8RA 3CWCA 3DE5X 5AJZA 4OMFG 1GAEO 3UCEA 2KB0A 2Q4BA 4KXMA 1WNTA 2C5LA 4RZUA 3L8ZA 4BFYA 1H93A 4D8TA 4E5VA 3C5HA 1DC5A 1VG1A 2COKA 2V74B 4C3ZA 3D4BA 4B6QA 5JSQA 1TQ6A 3A1TA 1B0UA 1QRAA 4H0FA 3THXA 2Q07A 3ZHUA 5DM4A 3N59A 3QSGA 1GNSA 2IEYA 1NBMA 2AC4A 4Q1EA 1E7RA 2D2XA 2JF0A 1UZNA 3RTAA 2JFVA 1EWRA 3DAYA 4XCXA 1YL5A 1GZ7A 3PQ8A 4YREA 4KO8A 3VDQA 4TZ0A 1NMQA 1RS0A 4AW9A 2RAFA 4OKSA 4WSOA 2IPAB 2WA2A 1QJCA 3ASZA 4W7IA 2ZWIA 5CX1A 5BUCA 1E3EA 5MGNA 3D3NA 3DLIA 5IW8A 3QVOA 1W44A 2AE1A 3CJRA 3QVLA 3FBGA 1KHHA 3GA5A 5LKAA 1XT6A 2RCYA 3L1KA 2AQHA 2GD1O 1GPYA 1IATA 3V8RA 4LMAA 4U2GA 2VHCA 4TMXA 4GOXA 1YACA 3HDTA 2O14A 4ZVKA 4H08A 2PXHA 5K51A 2JLZA 4MW6A 3DFMA 3A2MA 2BP7B 2GRAA 3HJRA 1CDEA 1ULSA 3THWA 3N0XA 3NM6B 5AKJA 1B2RA 3A9SA 4IUDS 1V5GA 2O5EA 3V4OA 3K9WA 3T3NA 3CNQS 2OV1A 4XYLA 4H35A 1TA4A 3K7EA 3KYJB 4MZXA 2ZATA 1MX3A 2ZI9A 3REOA 2W42A 2J33A 2O0MA 3D64A 3L0YA 4UMVA 1Q7RA 2PVCA 1M6EX 1KPIA 2OEPA 2Q5IA 4X3CA 2XSZA 2FTKE 4IDAA 4BEVA 3GH1A 4DM7A 3WSVA 3F6EX 1QIFA 5DCLA 1EXVA 3G2OA 3RHFA 3U5TA 2VRCA 1LX7A 4DV6B 1IEQA 4PR3A 5MN5A 5GONF 1U8CB 1CKEA 4IJWA 2UU9B 1X7HA 1FYVA 5KQGA 4YUVA 4D43A 3OU2A 4D81A 1LY1A 2ECFA 3BWYA 5FLKA 5IUJC 2GAFA 3P5BA 1IWBB 1ITZA 3PGA1 1KJYA 5G0WA 2FPKA 3F6SA 1GLVA 3N7TA 4I9UA 4NKRA 4J0IA 3HYSA 4KTTE 4BGVA 2AVDA 4OA8A 4RH0A 4JQYA 4AUNA 4DEXA 5CFZA 1BW9B 4MW2A 3JD3A 3E1SA 4F91B 3SX0A 1B74A 2CCKA 5ALUA 4DTIA 2Q5LA 3H8WA 3VPBA 1HDZA 3G68A 13PKA 5IBQA 2I2DA 3ZNPA 3MMXA 4DT1A 2EQAA 1WB4A 3K94A 4HVCA 3D3KA 2AA3A 3A1SA 3C7TA 5CVEA 1WAMA 1P81A 3H42B 3THYA 2QM8A 5GGYA 1KWGA 3DYIA 3GNSA 4LYJA 5IEBA 4D9CA 3U3KA 5CDYA 3V8BA 5L53A 1YL6A 4WJKB 2RFLA 2HRCA 3STHA 1V39A 4AIRA 4ZMSA 4LXYA 3UGKA 2FX5A 1OASA 3AR9A 3EXG2 1U02A 2BR5A 2YZMA 3DEFA 3QLVC 1E2BA 2CFTA 1Q0HA 2ZCJA 3DE7X 1ORVA 4WNAA 3EY4A 3M6MD 4ZT7A 1SQSA 1T5OA 4GYJA 3O83A 4WXPA 3W6UA 1YQQA 3DP9A 2JAXA 4RY8A 5FNVB 2J59A 3K72B 2AUNA 4KAFA 4RYLA 2XOXA 5F7ZA 4BMCA 2JATA 4ZP1A 4JI5B 3D59A 3OC6A 3HXLA 1YR3A 1CE8B 3CKMA 1BJKA 4QLOA 3KAQA 1HC7A 3RJZA 4BAGA 4D4MA 1TA9A 3NI2A 5J2TA 5JTTA 5DP1A 4BVKA 4RLFA 1GZ5A 5GOZA 1KEEB 2N1BA 4LOLA 4ECEA 4ZI7A 5JFTA 4BNDB 4DR2B 1FFAA 3UY4A 3UN1A 1FTWA 5D85A 4OOFA 3LBHA 2Y8EA 4B6OA 5IYZB 5DM1A 4NENB 1C1DB 1XZBA 2BHRA 3PL1A 2PLFA 1KEWA 3PWSA 5TQ2B 3DDOA 1GKKA 3RVOA 1QK4A 1V1RA 4CM9A 3OZAA 1OZHA 2FRVA 3L05A 4NY1A 1RFLA 2INGX 3D5TA 3BEDA 2VP2A 3UJCA 3QMPA 4D2IA 2HK8A 3PXEA 1GV1A 4ZVPA 2V0GA 3B89A 3ZWKA 1VOTA 4FZRA 1QB8A 2ZVPX 2P7HA 3L84A 1QPBA 5DNCA 1SBNE 3U16A 4NYMQ 5LJLA 3FPEA 3R74A 5B3JA 1O7JA 4YA6A 4HUJA 5HRUA 1E63A 1V25A 4Q4HA 1KYIA 1GPKA 2BDTA 2E18A 3FSEA 1GD1O 4O02B 5KNCA 1MO2A 4LQLA 3X1DA 3SYKA 2A4KA 3AR6A 3PYLA 2VN8A 4BNIA 3X43A 4A16A 1KI6A 2QN3A 3AUXA 4D5GA 2QLMA 4MYTA 1NLZA 4WRRA 2G1JA 1QG0A 4N76A 2XHZA 3ETLA 3DM5A 4K6OA 4XQCA 1YDFA 2GTHA 3KX2A 1VE3A 4XD7A 3U1VA 3X44A 5IZCA 3GEEA 2A14A 1LDNA 2GXQA 4AUKA 3E6AA 1TCCA 4LZWA 1MZVA 4RPLA 2KJQA 3RUCA 4F93B 1Z17A 4RFLA 2QX9A 1U80A 1SU8A 3D3JA 1R37A 1WVMA 3AXSA 5DTJA 3QBJA 1FYWA 1E3DA 1IM8A 1G42A 2LV8A 4LY6A 3Q1KA 1RQ2A 2CNDA 3G23A 4DHWA 5DCYA 5K8LA 3ZH2A 2W6OA 2YIJA 3I61A 4U0KA 4KDEA 3OKAA 5A2QA 1HT3A 4C0XA 5JSHA 3NRBA 3PYXA 3D2BA 1QM5A 1GZDA 4N0MA 2OYCA 3SGLA 2XGGA 4Y2YA 4ARZB 4B4OA 4EVIA 2OENG 3RYTC 1KBZA 3VRHA 1M2JA 4J0FA 1ZMBA 2L42A 3DBLB 3G9UA 5FBVB 4V1CA 4BO8A 4D4JA 1G6Q1 4C5AA 1SCUA 3K0AB 5HGXA 4KR6A 1NFRA 2CUTA 1P29A 3JVEA 1JVSA 2VFAA 5AUOB 1SD1A 4A4DA 2NQ8A 4HAVA 1W36D 4EKGA 4JSTA 2X1VA 1ZCJA 2TECE 1G21B 4AROA 4IL5A 2RMKA 3BAZA 3LA8A 5ARDA 4WI1A 1ZJJA 3AEYA 3LC7O 4G67A 4QEDA 5A06A 4R1QA 1E5QA 5T3UA 4G1MB 4LZNA 4RPJA 4A10A 3CKKA 5ALLA 1Z68A 4Q3EA 5E6UA 3RFFA 4KLNA 4F12A 1N5RA 5KYYA 3WDSA 1QH8A 1GP2A 3DO6A 3PEWA 3HWSA 3PDHA 1CRPA 1U4NA 5B7NA 3BPSA 1TXGA 2HRDA 4M7PA 4BCDA 2IXGA 1RYBA 2V6FA 2O8BB 4KCGA 2QY6A 3PIRA 1CJUC 1UJ5A 2Z8YM 3ET5A 2WRZA 4UNNA 5ALSA 2CLDX 2DPXA 2HIGA 4GGOA 5KTRA 2HA7A 1S4MA 3H6KA 4N5LA 1Y3DE 3G7NA 4AYXA 5AW7A 3AY6A 1YQUA 4GR4A 1JLSA 1UBEA 1QVVA 1USKA 2Q9AA 3NHYA 3O75A 1X2BA 4YQYA 4S1OA 4C6SA 3UPDA 3F9CA 4P4TA 1EE2A 1Y34E 2BEKA 4FZVA 4DMHA 1TEVA 4TMVA 2EIHA 2K6GA 1THGA 3QHPA 3HDYA 4M21A 1WULS 3A6HA 1VKRA 3MRVA 3ORHA 3VR5D 4O2AA 4XWAA 1IWPB 2YCLA 1O8CA 4HDMB 2QX4A 2W2LD 2Q6VA 2C7OA 1O6FA 4Z9BA 1O77A 2D3TA 2V7QD 1LV8A 1W4RA 1V96A 3C6KA 2RH8A 1RRFA 3D4IA 4KWIA 2WYOA 1Z4NA 3M34A 2WIFA 2WLSA 3EBPA 3HP7A 1KVTA 2HEGA 4J0JA 1EESA 4D26A 3ADOA 1W49A 4JLUA 5A3QA 4EEKA 3ELYA 1K0UA 1KK2A 7ADHA 2QLFA 1P3JA 4MQUA 3IUBA 4OOEA 1DJNA 3GEDA 1G20E 4I4LA 3MRSA 3FHLA 3QBVA 4YP7A 3VSDA 1GN9A 1CUBA 3ILHA 3U80A 1DKQA 2QM3A 2Q9BA 2W93A 3UCFA 2HV8A 4TS1A 5K8VA 4TRJA 2R6JA 1PJ4A 2B78A 3P8ZA 3DMTC 4R1LA 2E4AA 4AMBA 2IBSA 2WJIA 3VHXA 3LC2O 2VDNB 3BXEA 1BEUB 1JBEA 3DZGA 3OO0A 5GVSA 3GAAA 3GRYA 2W4IA 2HJVA 3IC5A 3KG2A 4Z86A 3FTEA 4WCFC 2HUNA 1LVUA 3L7JA 4N54A 2EFDB 5LMCA 5IVIA 4PFKA 4BRZA 1U90A 4NICA 5AKGA 5HOEA 3ANLA 1II9A 3I73A 2VPIA 4RFVA 3I6QA 5CIYA 3UJNA 5LQKA 3FOFC 3OETA 4WNCA 5GINE 3IEIA 4A91A 1C5KA 1FLVA 3FZEA 3ZNQA 4DHEA 1HEYA 2R6AA 3EC2A 3WLQA 3IT3A 3K0CC 4HWRA 2PUBA 4MQLA 3OCUA 3RTEA 3ZJTA 1J20A 3OT1B 1NBME 4CHGA 2PAFA 1AB6A 3A26A 4WY2A 4TVKA 1CP2A 4MP8A 3UG6A 4HR7A 1M0WA 2AEJA 2XV1A 3D43A 4RXUA 3RS9A 3WB1A 3C6ZA 4LRTB 3BMCA 1VLVA 2H92A 2I4MA 2SBTA 4FCWA 1KZGB 4ZOLF 5E9WA 3NQ41 2XMPA 5K2MA 1K8ZB 2HA3A 3EG9B 3GMSA 3JATB 4ESOA 4LOAA 1ZK2A 3KLNA 1YBVA 2ZRBA 5ALPA 4YPFA 1CUUA 3R2JA 3UW3A 4RVDA 1VBNA 3ZBTA 2XSZD 3BGSA 2DSTA 1XVIA 5LVAA 4XIJA 1QC5B 3FXAA 4L4XA 1UKCA 1XDWA 2IK8A 1R8SA 4D0RA 1U9IA 4D6YA 3Q7QA 3NH9A 3A6GA 3WYCA 1WF3A 3F3YA 4ER7A 1P9LA 3N2KA 4Q7EA 1QJ4A 4HTAA 5FPYA 5K6RA 3PQ6A 3FF4A 1UEXC 4F2DA 1DZIA 4FVTA 4KE6A 1ISIA 1Q1AA 1Q1EA 3HFSA 2R3SA 3FF1A 3CF4G 4DR4B 3ZU5A 1UDAA 1GPLA 1L3BA 3LT1A 4MR9B 4TUYB 5E2AA 1RU3A 3PRKE 5I7EA 2N9UA 1U2PA 1FFDA 3VO9A 4RCZA 1H3FA 3D1VA 2VQ3A 2BTQA 2XZPA 3JQFA 3I62A 2J5QA 3NT4A 4BTLA 2P4QA 2H9AA 1BNCA 1FQOA 3S8YA 1W7AA 3PQ2A 3VC7A 1G59A 5FPPA 2YMLA 2FVYA 3USES 1U5BA 4AC9A 2IEBA 1EE9A 3CG0A 3I1IA 1EQ2A 1R0XA 3QNUA 1AHNA 3GLHA 1GYPA 2FEPA 3TUIC 5DSZA 3HQ4O 2DHRA 2EGHA 3HZRA 1E2FA 1M6VA 4H77A 3QXXA 4DN6A 5A62A 2XUFA 1K0FA 4B4KA 4D4GA 4TL8A 2XMQA 4H6PA 3FCCA 5GZ3A 2FPRA 1KDOA 5LP1A 4RCVA 2GUWA 3BHMA 4EB8A 4B6PA 4E5NA 4L57A 4RW0A 3JVIA 4O4HB 3IBFA 5AESA 5HW0A 2EJWA 2EL7A 3HYNA 3WJ7A 4M53A 2IOYA 3P2YA 2O7VA 1XDSA 2XAUA 5CW1A 3K2BA 4QRDA 2G7MC 1W0CA 4ZOCA 2CV0A 3AJDA 2PX4A 3N8DA 4BWYA 4UAJA 3SVLA 2F3SA 3R9XB 4YRNA 2AG1A 1KQNA 3EEQA 2C2HA 3OJCA 4NAHA 5B58T 4A6EA 1QV6A 4LWZA 2XMSA 1QUEA 1Y81A 4FOPA 5EZYB 4D9EA 3IUSA 1YCDA 1EFRD 2ZAIA 4CLOA 3U6KA 4PF1A 2PUAA 4KMOA 3BQ9A 1GZUA 2LXNA 5KNBH 5DSTA 4YDSA 3G9ZA 1EDZA 2GN0A 5IBRA 4A3SA 1JS1X 4X97A 1OUMA 1LBIA 2IP1A 2PGNA 3CYFA 4QVKA 2BFFA 4AWBA 2HSEA 2O8EA 5CA1B 3RWBA 2AI1A 2EG9A 1JPNA 2PRZA 4GE0A 4YJHA 5FD8A 5KNBA 3O6VA 2OV4A 3LCJA 2VZ8A 4CIAA 3AESB 3MCUA 2JRCA 4N0PA 3K0EA 1X1BA 3AUJB 3T61A 3B6EA 4C4OA 3WK6A 3F5QA 4KREA 5SZJA 3OT1A 1Z5WA 2IZ6A 3MTEA 8ATCA 2P2NA 3O3MB 2BGJA 2HQOA 2IHJA 4H7PA 1G17A 2I1QA 2Q4DA 1CR1A 2NO6A 4QPZA 1BN7A 2J67A 3ECSA 3FYUB 3JQBA 3T95A 3T1YB 4MXDA 1DAOA 2FZVA 1SVUA 1NKVA 1DTSA 2NO1A 3DC2A 4LG1A 4NZPA 4HX9A 5AVSA 5CB4B 1T9GS 4H1TA 1DJOA 3EXAA 2FN9A 4NI5A 4U5QA 1LJUA 1VECA 1LPMA 1DLJA 1OH7A 5BMVB 1IK6A 1FTGA 3L5KA 4Y0NA 4QKQA 2C29D 4MLPA 4IQFA 3O4IA 3SR3A 4CE6A 2XTNA 5IT0A 2PUVA 3FGZA 2J3LA 2PZAA 2QJRA 3WRYC 5E0OA 3WBKA 1YMVA 3IXMA 5JLAA 2C99A 1D2HA 2JFQA 3B1KA 4PQFA 3S70A 3WGTA 2Z6AA 4IEIA 3PT9A 1HDXA 3BH0A 3KJQA 4H59A 1DAEA 1ZK0A 1R4AA 4M1OA 4OAQA 4RL6A 2WAAA 5CTAA 3IA7A 1E3IA 1ODTC 2A94A 1Z9BA 4RIGA 4EJFA 4MLZA 3B51X 4KIFA 1AD2A 4EYGA 5E3HA 3K71B 1CFJA 1GZ6A 2WJPA 3JQ9A 2JZOA 1COZA 2MWMA 5ITZA 2O8BA 5ELLA 4YV0A 1IAVA 2J0UB 1SOWA 1RXUA 2OCDA 3BS4A 1NV9A 1L5KA 4AKEA 1P2BA 2YYZA 4RSGA 1GT6A 4EAAA 4AKHA 3PTLA 4MJLA 2VZLA 2QRJA 2R60A 2VT6A 2NP6A 5DOZA 2YUIA 4MKZA 2ISQA 5BUZA 5L4SA 3NUGA 3Q4GA 2QTBA 4W9NA 4RHYA 3TZCA 1AT1A 3EW7A 1DEHA 3UMJA 1T3LA 3VZCA 1WSWA 1P4GA 3PXXA 4QD3A 2IUUA 1LPPA 4OUDB 4M0EA 4O8ZA 1WCWA 2H11A 1FRVA 1RWPA 2CC2A 1ETUA 2O3UA 1OAKA 4X24A 4B3IA 1KEVA 1Y6RA 1JKIA 2P75A 1SXJE 2VTVA 5AOBA 1MO6A 5B2ZA 4BBJA 2GUGA 4IJQA 1MB2A 4XRRA 4FX2A 4F3YA 3PFBA 1ZH2A 5G0TA 2BD0A 4MB6A 1XPJA 3VSBA 5K0BA 2WTBA 2NUTB 4OJYA 2IXBA 1YT5A 2C84A 2WG2A 2IHVA 3C3AA 3GFVA 1CUDA 1FUKA 2C7GA 1OOEA 1VBFA 3MS2A 4JLVA 4EVRA 1CY6A 3EQZA 1SIOA 2RK4A 3UKOA 4FE3A 5AUNB 1KI4A 3S2GA 1XZIA 2YIDA 2A7QA 2GEDA 4JOQA 4PGMA 5DI3A 2PZ8A 2GF0A 1QTNA 5K0JA 3DO8A 3GPLA 1CZRA 2VAVA 3UOGA 3L0PA 3EIOA 3SJ7A 2E5WA 4ND7A 4BEJA 4EO7A 2P8JA 3WK7A 3FNBA 2J48A 5LQJA 3ZCQA 4MMYB 3DA8A 4TT3D 2VJAA 4J4BA 5DGCA 1L0BA 4WVFA 3U44A 3SZLA 2JCSA 3L7AA 3MQFA 3W77A 4ZZ3A 2C5HA 2JZCA 2FFHA 1NVMB 2NGRA 4TTIA 3N07A 5JCZA 4IIVA 2VDLB 2NUAA 3FWZA 3PTAA 4HV4A 3PBKA 2QRUA 4RAQA 1N5LA 1PWYE 1RC1A 2HA0A 3TEJA 2J6CA 3JWIA 1XVVA 2DB3A 1Y80A 1PL6A 3F2VA 4F2HA 4CCWA 2SECE 3CPJB 3DDNA 3FYHA 2D06A 2HR1A 2EATA 2O3QA 1FP2A 4S2EA 5ISMA 2FWMX 1OLOA 1LNSA 3HCAA 1V4NA 5IXYA 4I0WB 1XYYA 2C7PA 2OGSA 3R7FA 5LZ5A 4TXMA 1L5ZA 1CC1S 3UMRA 3LK6A 4Q3CA 3ZTWA 3GJ0A 3SHTA 4JEIA 2RHHA 1QBGA 2WBLC 3GJXC 5DM2A 4OHZA 4AXXA 2V6JA 4IIJA 4DARA 5ALQA 3GMDA 3R9KA 3ZNOA 4P84A 4G0OA 5FJIA 1RZRA 5JEEA 2YJNA 4IIEA 4D3YA 1SC4A 5JNVA 4IIBA 4OP2A 5C31A 1R00A 2KM1A 3MD0A 3BXOA 3TZHA 4BO9A 1I94B 2P3LA 2IW3A 5E9AA 1E3JA 3U62A 1KI2A 1JA1A 1NIPA 3L02A 4TYNA 1T1IA 4JJAA 1EWYA 3PDIA 3JQCA 1RHKA 2VYQA 1GZSA 3LOQA 2FH5B 1FYXA 1GCIA 3DT6A 4B33A 3DYVA 3KJXA 1E7WA 1SG0A 4Y2GA 1OJ7A 1ZSVA 3R0XA 3E53A 4GBED 4GXNA 4E08A 1TKBA 1Z4MA 2OHHA 3EFHA 4J0HA 3RYIB 4JT9A 2XZLA 3VXKA 4ZYZA 1KTVA 2KHZA 3TVYA 2BDEA 3A3KA 2C42A 3PC3A 3R3YA 1X86B 3K1ZA 2FKNA 4PYMA 4TZTA 5FBWB 2H5LA 4X1YB 2IZZA 2P4EA 3FPSA 1TEXA 3DGEC 4L8YA 4C4ZA 5B7GA 1MABA 1E6MA 4Q7KA 2A0YA 3EWIA 2AG0A 1GR1A 2W8BA 1Z62A 4K0RA 3MYRA 4K6FA 3GZJA 1ZONA 1J0CA 3DOIA 4AWXA 3S5UA 2EZUA 1R5JA 1PS9A 1EVZA 5HGJA 1UR5A 3CLSD 1W0KA 2ARKA 5AJW