4PVKA

Phl p 4 i153v n158h variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvkA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvkA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvkA03
4PYTA 2GQUA 5I1WA 3DQ0A 1W1MA 2BVGA 4ZOHB 2Y3RA 3POPA 2GQTA 4O95A 5FXFA 5AE2A 1W1RA 1W1JA 1E8GA 3B9JB 4PZFA 2E3TA 1AHUA 3FW9A 4EC3A 5HQXA 3NRZB 1ZXIC 2QPMA 4DNSA 3D2HA 4PWBA 4JAYA 3I99A 3S1DA 1T3QC 1MBBA 3RJAA 5L6GA 3HSUA 1N60C 3FWAA 3W8XA 1AHZA 1VAOA 1F0XA 1W1QA 3KJMA 4OALA 1ZR6A 1V97A 2VFSA 4PVKA 1W1LA 4ML8A 5FXEA 5L6FA 2BVFA 3NS1B 4MLAA 3TSHA 5HMRA 3D2JA 3FW7A 3FW8A 1FFUC 1N63C 4JB1A 5FXPA 2Q4WA 1QLUA 3SR6B 1I19A 3S1FA 2AXRA 3GSYA 5D79A 3W8WA 3AM9A 1FFVC 1VDVA 5K8EA 4PWCA 1FO4A 1WVEA 1N61C 1FIQB 1WYGA 2VFUA 3PM9A 3EUB3 3TX1A 1WVFA 1W1KA 1DIIA 1W1OA 2MBRA 2VFTA 5AWVA 1UXYA 2W3SA 2I0KA 1W1SA 2IPIA 5I1VA 4UD8A 4BC7A 3JS8A 3AMZA 2Q85A 3VTEA 1N5XA 3NVZB 3BW7A 1E8FA 4XLOA 3S1EA 2VFVA 2EXRA 1E0YA 1JROA 4PVEA 2Y3SA 3PQBA 2VAOA 3D2DA 2Y08A 3S1CA 3W8ZA 2W3RA 3C0PA 3TSJA 4BC9A 1N5WC 1MBTA 1QLTA 1AHVA 2Y4GA 2VFRA 2W54A 1HSKA 4BBYA 4PVJA 5HHZA 4PVHA 4BCAA 2BVHA 3ETRB 3AN1A 3RJ8A 5ADZA 1DIQA 1DZNA 1E8HA 5AE1A 5FXDA 5AE3A 2QKNA 1N62C 2W55A 2WDWA
chains in the Genus database with same CATH superfamily
4PYTA 2GQUA 5I1WA 3DQ0A 1W1MA 2BVGA 3NVYB 4ZOHB 2Y3RA 2GQTA 3POPA 4O95A 5FXFA 5AE2A 1W1RA 1W1JA 1E8GA 3B9JB 4PZFA 2E3TA 2O3GA 1AHUA 3HRDC 3FW9A 4EC3A 5HQXA 3NRZB 1ZXIC 2QPMA 4DNSA 3D2HA 4PWBA 4JAYA 3I99A 3S1DA 1T3QC 1MBBA 3RJAA 5G5GB 5L6GA 2RK5A 2UUVA 3HSUA 1N60C 3FWAA 3W8XA 1AHZA 1VAOA 1F0XA 2UUUA 1W1QA 3KJMA 4OALA 1ZR6A 1V97A 2VFSA 4PVKA 1W1LA 4ML8A 5FXEA 1RM6B 2BVFA 2PLSA 5L6FA 3NS1B 4MLAA 3TSHA 5HMRA 3D2JA 3LLBA 3FW7A 3FW8A 2P4PA 1FFUC 1N63C 4JB1A 2OAIA 2P13A 5FXPA 2Q4WA 1QLUA 3SR6B 1I19A 5G5HB 3S1FA 2AXRA 3GSYA 4HG0A 5D79A 1JRPA 3W8WA 3AM9A 1FFVC 1VDVA 5K8EA 3NVWB 4PWCA 1FO4A 1WVEA 1N61C 1FIQB 1WYGA 2VFUA 2PLIA 3PM9A 3EUB3 3EJDB 3TX1A 1WVFA 1W1KA 1DIIA 1W1OA 2MBRA 2YVSA 2VFTA 5AWVA 1UXYA 2P3HA 2W3SA 2I0KA 1W1SA 1SB3B 2IPIA 5I1VA 4UD8A 4BC7A 3JS8A 2R2ZA 3NVVB 3AMZA 2Q85A 3EJBB 1N5XA 3NVZB 3VTEA 3BW7A 1E8FA 4XLOA 3S1EA 2VFVA 2EXRA 1E0YA 1JROA 4PVEA 3DEDA 2Y3SA 3PQBA 2VAOA 3D2DA 2Y08A 3S1CA 3W8ZA 2W3RA 3C0PA 3TSJA 4BC9A 1N5WC 1MBTA 1QLTA 3LAEA 1AHVA 2Y4GA 2VFRA 2W54A 1HSKA 3EJEB 4PVJA 4BBYA 5HHZA 4PVHA 4BCAA 2R8DA 2BVHA 3ETRB 3AN1A 2NQWA 3RJ8A 5ADZA 1DIQA 1DZNA 1E8HA 5AE1A 5FXDA 5AE3A 2QKNA 1N62C 2W55A 2WDWA
chains in the Genus database with same CATH topology
4PYTA 2GQUA 5I1WA 3DQ0A 1W1MA 2BVGA 4ZOHB 2Y3RA 3NVYB 2GQTA 3POPA 4O95A 5FXFA 5AE2A 1W1RA 1W1JA 1E8GA 3B9JB 4PZFA 2E3TA 2O3GA 1AHUA 3HRDC 3FW9A 4EC3A 5HQXA 3NRZB 1ZXIC 2QPMA 4DNSA 3D2HA 4PWBA 4JAYA 3I99A 3S1DA 1T3QC 1MBBA 3RJAA 5G5GB 5L6GA 2RK5A 2UUVA 3HSUA 1N60C 3FWAA 3W8XA 1AHZA 1VAOA 1F0XA 2UUUA 1W1QA 3KJMA 4OALA 1ZR6A 1V97A 2VFSA 4PVKA 1W1LA 4ML8A 5FXEA 1RM6B 2BVFA 2PLSA 5L6FA 3NS1B 4MLAA 3TSHA 5HMRA 3D2JA 3LLBA 3FW7A 3FW8A 2P4PA 1FFUC 1N63C 4JB1A 2OAIA 2P13A 5FXPA 2Q4WA 1QLUA 3SR6B 1I19A 5G5HB 3S1FA 2AXRA 3GSYA 4HG0A 5D79A 1JRPA 3W8WA 3AM9A 1FFVC 1VDVA 5K8EA 3NVWB 4PWCA 1FO4A 1WVEA 1N61C 1FIQB 1WYGA 2VFUA 2PLIA 3PM9A 3EUB3 3TX1A 1WVFA 1W1KA 1DIIA 1W1OA 2MBRA 2YVSA 2VFTA 5AWVA 1UXYA 2P3HA 2W3SA 2I0KA 1W1SA 1SB3B 2IPIA 5I1VA 4UD8A 4BC7A 3JS8A 2R2ZA 3NVVB 3AMZA 2Q85A 3VTEA 1N5XA 3NVZB 3BW7A 1E8FA 4XLOA 3S1EA 2VFVA 2EXRA 1E0YA 1JROA 4PVEA 3DEDA 2Y3SA 3PQBA 2VAOA 3D2DA 2Y08A 3S1CA 3W8ZA 2W3RA 3C0PA 3TSJA 4BC9A 1N5WC 1MBTA 1QLTA 3LAEA 1AHVA 2Y4GA 2VFRA 2W54A 1HSKA 4BBYA 4PVJA 5HHZA 2R8DA 4PVHA 4BCAA 2BVHA 3ETRB 3AN1A 2NQWA 3RJ8A 5ADZA 1DIQA 1DZNA 1E8HA 5AE1A 5FXDA 5AE3A 2QKNA 1N62C 2W55A 2WDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYT A;  2GQU A;  5I1W A;  3DQ0 A;  1W1M A;  2BVG A;  4ZOH B;  2Y3R A;  3POP A;  2GQT A;  4O95 A;  5FXF A;  5AE2 A;  1W1R A;  1W1J A;  1E8G A;  3B9J B;  4PZF A;  2E3T A;  1AHU A;  3FW9 A;  4EC3 A;  5HQX A;  3NRZ B;  1ZXI C;  2QPM A;  4DNS A;  3D2H A;  4PWB A;  4JAY A;  3I99 A;  3S1D A;  1T3Q C;  1MBB A;  3RJA A;  5L6G A;  3HSU A;  1N60 C;  3FWA A;  3W8X A;  1AHZ A;  1VAO A;  1F0X A;  1W1Q A;  3KJM A;  4OAL A;  1ZR6 A;  1V97 A;  2VFS A;  4PVK A;  1W1L A;  4ML8 A;  5FXE A;  5L6F A;  2BVF A;  3NS1 B;  4MLA A;  3TSH A;  5HMR A;  3D2J A;  3FW7 A;  3FW8 A;  1FFU C;  1N63 C;  4JB1 A;  5FXP A;  2Q4W A;  1QLU A;  3SR6 B;  1I19 A;  3S1F A;  2AXR A;  3GSY A;  5D79 A;  3W8W A;  3AM9 A;  1FFV C;  1VDV A;  5K8E A;  4PWC A;  1FO4 A;  1WVE A;  1N61 C;  1FIQ B;  1WYG A;  2VFU A;  3PM9 A;  3EUB 3;  3TX1 A;  1WVF A;  1W1K A;  1DII A;  1W1O A;  2MBR A;  2VFT A;  5AWV A;  1UXY A;  2W3S A;  2I0K A;  1W1S A;  2IPI A;  5I1V A;  4UD8 A;  4BC7 A;  3JS8 A;  3AMZ A;  2Q85 A;  3VTE A;  1N5X A;  3NVZ B;  3BW7 A;  1E8F A;  4XLO A;  3S1E A;  2VFV A;  2EXR A;  1E0Y A;  1JRO A;  4PVE A;  2Y3S A;  3PQB A;  2VAO A;  3D2D A;  2Y08 A;  3S1C A;  3W8Z A;  2W3R A;  3C0P A;  3TSJ A;  4BC9 A;  1N5W C;  1MBT A;  1QLT A;  1AHV A;  2Y4G A;  2VFR A;  2W54 A;  1HSK A;  4BBY A;  4PVJ A;  5HHZ A;  4PVH A;  4BCA A;  2BVH A;  3ETR B;  3AN1 A;  3RJ8 A;  5ADZ A;  1DIQ A;  1DZN A;  1E8H A;  5AE1 A;  5FXD A;  5AE3 A;  2QKN A;  1N62 C;  2W55 A;  2WDW A; 
#chains in the Genus database with same CATH topology
 4PYT A;  2GQU A;  5I1W A;  3DQ0 A;  1W1M A;  2BVG A;  3NVY B;  4ZOH B;  2Y3R A;  2GQT A;  3POP A;  4O95 A;  5FXF A;  5AE2 A;  1W1R A;  1W1J A;  1E8G A;  3B9J B;  4PZF A;  2E3T A;  2O3G A;  1AHU A;  3HRD C;  3FW9 A;  4EC3 A;  5HQX A;  3NRZ B;  1ZXI C;  2QPM A;  4DNS A;  3D2H A;  4PWB A;  4JAY A;  3I99 A;  3S1D A;  1T3Q C;  1MBB A;  3RJA A;  5G5G B;  5L6G A;  2RK5 A;  2UUV A;  3HSU A;  1N60 C;  3FWA A;  3W8X A;  1AHZ A;  1VAO A;  1F0X A;  2UUU A;  1W1Q A;  3KJM A;  4OAL A;  1ZR6 A;  1V97 A;  2VFS A;  4PVK A;  1W1L A;  4ML8 A;  5FXE A;  1RM6 B;  2BVF A;  2PLS A;  5L6F A;  3NS1 B;  4MLA A;  3TSH A;  5HMR A;  3D2J A;  3LLB A;  3FW7 A;  3FW8 A;  2P4P A;  1FFU C;  1N63 C;  4JB1 A;  2OAI A;  2P13 A;  5FXP A;  2Q4W A;  1QLU A;  3SR6 B;  1I19 A;  5G5H B;  3S1F A;  2AXR A;  3GSY A;  4HG0 A;  5D79 A;  1JRP A;  3W8W A;  3AM9 A;  1FFV C;  1VDV A;  5K8E A;  3NVW B;  4PWC A;  1FO4 A;  1WVE A;  1N61 C;  1FIQ B;  1WYG A;  2VFU A;  2PLI A;  3PM9 A;  3EUB 3;  3EJD B;  3TX1 A;  1WVF A;  1W1K A;  1DII A;  1W1O A;  2MBR A;  2YVS A;  2VFT A;  5AWV A;  1UXY A;  2P3H A;  2W3S A;  2I0K A;  1W1S A;  1SB3 B;  2IPI A;  5I1V A;  4UD8 A;  4BC7 A;  3JS8 A;  2R2Z A;  3NVV B;  3AMZ A;  2Q85 A;  3EJB B;  1N5X A;  3NVZ B;  3VTE A;  3BW7 A;  1E8F A;  4XLO A;  3S1E A;  2VFV A;  2EXR A;  1E0Y A;  1JRO A;  4PVE A;  3DED A;  2Y3S A;  3PQB A;  2VAO A;  3D2D A;  2Y08 A;  3S1C A;  3W8Z A;  2W3R A;  3C0P A;  3TSJ A;  4BC9 A;  1N5W C;  1MBT A;  1QLT A;  3LAE A;  1AHV A;  2Y4G A;  2VFR A;  2W54 A;  1HSK A;  3EJE B;  4PVJ A;  4BBY A;  5HHZ A;  4PVH A;  4BCA A;  2R8D A;  2BVH A;  3ETR B;  3AN1 A;  2NQW A;  3RJ8 A;  5ADZ A;  1DIQ A;  1DZN A;  1E8H A;  5AE1 A;  5FXD A;  5AE3 A;  2QKN A;  1N62 C;  2W55 A;  2WDW A; 
#chains in the Genus database with same CATH homology
 4PYT A;  2GQU A;  5I1W A;  3DQ0 A;  1W1M A;  2BVG A;  4ZOH B;  2Y3R A;  3NVY B;  2GQT A;  3POP A;  4O95 A;  5FXF A;  5AE2 A;  1W1R A;  1W1J A;  1E8G A;  3B9J B;  4PZF A;  2E3T A;  2O3G A;  1AHU A;  3HRD C;  3FW9 A;  4EC3 A;  5HQX A;  3NRZ B;  1ZXI C;  2QPM A;  4DNS A;  3D2H A;  4PWB A;  4JAY A;  3I99 A;  3S1D A;  1T3Q C;  1MBB A;  3RJA A;  5G5G B;  5L6G A;  2RK5 A;  2UUV A;  3HSU A;  1N60 C;  3FWA A;  3W8X A;  1AHZ A;  1VAO A;  1F0X A;  2UUU A;  1W1Q A;  3KJM A;  4OAL A;  1ZR6 A;  1V97 A;  2VFS A;  4PVK A;  1W1L A;  4ML8 A;  5FXE A;  1RM6 B;  2BVF A;  2PLS A;  5L6F A;  3NS1 B;  4MLA A;  3TSH A;  5HMR A;  3D2J A;  3LLB A;  3FW7 A;  3FW8 A;  2P4P A;  1FFU C;  1N63 C;  4JB1 A;  2OAI A;  2P13 A;  5FXP A;  2Q4W A;  1QLU A;  3SR6 B;  1I19 A;  5G5H B;  3S1F A;  2AXR A;  3GSY A;  4HG0 A;  5D79 A;  1JRP A;  3W8W A;  3AM9 A;  1FFV C;  1VDV A;  5K8E A;  3NVW B;  4PWC A;  1FO4 A;  1WVE A;  1N61 C;  1FIQ B;  1WYG A;  2VFU A;  2PLI A;  3PM9 A;  3EUB 3;  3TX1 A;  1WVF A;  1W1K A;  1DII A;  1W1O A;  2MBR A;  2YVS A;  2VFT A;  5AWV A;  1UXY A;  2P3H A;  2W3S A;  2I0K A;  1W1S A;  1SB3 B;  2IPI A;  5I1V A;  4UD8 A;  4BC7 A;  3JS8 A;  2R2Z A;  3NVV B;  3AMZ A;  2Q85 A;  3VTE A;  1N5X A;  3NVZ B;  3BW7 A;  1E8F A;  4XLO A;  3S1E A;  2VFV A;  2EXR A;  1E0Y A;  1JRO A;  4PVE A;  3DED A;  2Y3S A;  3PQB A;  2VAO A;  3D2D A;  2Y08 A;  3S1C A;  3W8Z A;  2W3R A;  3C0P A;  3TSJ A;  4BC9 A;  1N5W C;  1MBT A;  1QLT A;  3LAE A;  1AHV A;  2Y4G A;  2VFR A;  2W54 A;  1HSK A;  4BBY A;  4PVJ A;  5HHZ A;  2R8D A;  4PVH A;  4BCA A;  2BVH A;  3ETR B;  3AN1 A;  2NQW A;  3RJ8 A;  5ADZ A;  1DIQ A;  1DZN A;  1E8H A;  5AE1 A;  5FXD A;  5AE3 A;  2QKN A;  1N62 C;  2W55 A;  2WDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...