4PVKA

Phl p 4 i153v n158h variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvkA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvkA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvkA03
4PWCA 1N61C 3D2HA 5HQXA 1WVEA 2VAOA 5D79A 1DZNA 2BVHA 3W8XA 5FXEA 2Y3RA 4PVHA 1QLTA 2VFTA 4BC7A 1N5WC 3ETRB 3VTEA 1I19A 4ZOHB 1UXYA 3PM9A 2QKNA 3AM9A 5HHZA 3AN1A 3C0PA 3DQ0A 3S1FA 1W1MA 4OALA 4UD8A 3FW7A 3I99A 4EC3A 3POPA 3FW8A 5FXPA 2MBRA 4PVEA 3W8WA 5HMRA 2Q85A 3AMZA 5FXFA 3GSYA 1FIQB 1W1QA 1T3QC 3S1DA 2Y3SA 1DIIA 4PVJA 4PWBA 2Q4WA 3S1CA 5AE3A 1FO4A 5L6FA 1N5XA 1E8FA 1JROA 4O95A 3FW9A 1E8GA 4BCAA 2E3TA 3PQBA 3EUB3 5FXDA 3D2DA 5AE2A 1F0XA 5AWVA 3TSHA 3B9JB 2VFUA 1HSKA 1W1RA 3RJ8A 5I1VA 2W55A 1W1OA 5K8EA 1N62C 1ZR6A 2AXRA 5AE1A 5ADZA 3BW7A 1ZXIC 3KJMA 3TSJA 3JS8A 4MLAA 4PYTA 1MBBA 1V97A 2GQUA 3W8ZA 5I1WA 3RJAA 2I0KA 4JB1A 4BC9A 2BVFA 1AHVA 2VFRA 2Y08A 2WDWA 3TX1A 4BBYA 1N60C 2QPMA 1W1SA 2Y4GA 4PVKA 2BVGA 1W1LA 1W1JA 1FFUC 3S1EA 4JAYA 3FWAA 5L6GA 3HSUA 4DNSA 4PZFA 1QLUA 1VDVA 1MBTA 1WYGA 2VFVA 3NS1B 2EXRA 2W3RA 2IPIA 2W3SA 2VFSA 1N63C 3D2JA 1E8HA 1AHUA 1DIQA 1VAOA 3NVZB 4XLOA 1W1KA 2GQTA 1WVFA 1AHZA 2W54A 1FFVC 4ML8A 1E0YA 3NRZB 3SR6B
chains in the Genus database with same CATH superfamily
3EJEB 2PLSA 4PWCA 1N61C 3D2HA 5HQXA 1WVEA 2VAOA 5D79A 1DZNA 2BVHA 3W8XA 5FXEA 2Y3RA 4PVHA 1QLTA 3NVVB 2P3HA 2YVSA 2VFTA 4HG0A 4BC7A 1N5WC 3ETRB 3VTEA 1I19A 4ZOHB 1UXYA 3PM9A 2QKNA 3AM9A 5HHZA 2P4PA 3AN1A 3C0PA 3DQ0A 3S1FA 1W1MA 2R2ZA 4OALA 4UD8A 2NQWA 3FW7A 3I99A 4EC3A 3POPA 3FW8A 5FXPA 3EJBB 2MBRA 2OAIA 4PVEA 3W8WA 5HMRA 3EJDB 2Q85A 3AMZA 3LLBA 5FXFA 3GSYA 1FIQB 1W1QA 1SB3B 3NVYB 1T3QC 3S1DA 2Y3SA 1DIIA 4PVJA 4PWBA 2Q4WA 2RK5A 3S1CA 5AE3A 1FO4A 2UUUA 5L6FA 1N5XA 3LAEA 1E8FA 1JROA 4O95A 3FW9A 1E8GA 4BCAA 2E3TA 3PQBA 3EUB3 5FXDA 3D2DA 5AE2A 1JRPA 1F0XA 3DEDA 5AWVA 3TSHA 3B9JB 3HRDC 2VFUA 1HSKA 1W1RA 3RJ8A 2P13A 5I1VA 2W55A 1W1OA 5K8EA 1N62C 1ZR6A 2AXRA 5AE1A 5ADZA 3BW7A 1ZXIC 3KJMA 3TSJA 2PLIA 3JS8A 4MLAA 4PYTA 3NVWB 5G5GB 1MBBA 1V97A 2GQUA 3W8ZA 5I1WA 3RJAA 2I0KA 4JB1A 4BC9A 2BVFA 1AHVA 2VFRA 2Y08A 2WDWA 3TX1A 4BBYA 1N60C 2QPMA 1W1SA 2Y4GA 4PVKA 2BVGA 1W1LA 1W1JA 1RM6B 1FFUC 3S1EA 4JAYA 3FWAA 5L6GA 3HSUA 4DNSA 4PZFA 1QLUA 1VDVA 1MBTA 1WYGA 2VFVA 3NS1B 2EXRA 2W3RA 2IPIA 2W3SA 2VFSA 5G5HB 1N63C 3D2JA 1E8HA 1AHUA 1DIQA 1VAOA 3NVZB 4XLOA 2R8DA 2O3GA 2UUVA 1W1KA 2GQTA 1WVFA 1AHZA 2W54A 1FFVC 4ML8A 1E0YA 3NRZB 3SR6B
chains in the Genus database with same CATH topology
2PLSA 4PWCA 1N61C 3D2HA 5HQXA 1WVEA 2VAOA 5D79A 1DZNA 2BVHA 3W8XA 5FXEA 2Y3RA 4PVHA 1QLTA 2P3HA 3NVVB 2YVSA 2VFTA 4HG0A 4BC7A 1N5WC 3ETRB 3VTEA 1I19A 4ZOHB 1UXYA 3PM9A 2QKNA 3AM9A 5HHZA 2P4PA 3AN1A 3C0PA 3DQ0A 3S1FA 1W1MA 2R2ZA 4OALA 4UD8A 2NQWA 3FW7A 3I99A 4EC3A 3POPA 3FW8A 5FXPA 2MBRA 2OAIA 4PVEA 3W8WA 5HMRA 2Q85A 3AMZA 3LLBA 5FXFA 3GSYA 1FIQB 1W1QA 1SB3B 3NVYB 1T3QC 3S1DA 2Y3SA 1DIIA 4PVJA 4PWBA 2Q4WA 2RK5A 3S1CA 5AE3A 1FO4A 2UUUA 5L6FA 1N5XA 3LAEA 1E8FA 1JROA 4O95A 3FW9A 1E8GA 4BCAA 2E3TA 3PQBA 3EUB3 5FXDA 3D2DA 5AE2A 1JRPA 1F0XA 3DEDA 5AWVA 3TSHA 3B9JB 3HRDC 2VFUA 1HSKA 1W1RA 3RJ8A 2P13A 5I1VA 2W55A 1W1OA 5K8EA 1N62C 1ZR6A 2AXRA 5AE1A 5ADZA 3BW7A 1ZXIC 3KJMA 3TSJA 2PLIA 3JS8A 4MLAA 4PYTA 3NVWB 5G5GB 1MBBA 1V97A 2GQUA 3W8ZA 5I1WA 3RJAA 2I0KA 4JB1A 4BC9A 2BVFA 1AHVA 2VFRA 2Y08A 2WDWA 3TX1A 4BBYA 1N60C 2QPMA 1W1SA 2Y4GA 4PVKA 2BVGA 1W1LA 1W1JA 1RM6B 1FFUC 3S1EA 4JAYA 3FWAA 5L6GA 3HSUA 4DNSA 4PZFA 1QLUA 1VDVA 1MBTA 1WYGA 2VFVA 3NS1B 2EXRA 2W3RA 2IPIA 2W3SA 2VFSA 5G5HB 1N63C 3D2JA 1E8HA 1AHUA 1DIQA 1VAOA 3NVZB 4XLOA 2R8DA 2O3GA 2UUVA 1W1KA 2GQTA 1WVFA 1AHZA 2W54A 1FFVC 4ML8A 1E0YA 3NRZB 3SR6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWC A;  1N61 C;  3D2H A;  5HQX A;  1WVE A;  2VAO A;  5D79 A;  1DZN A;  2BVH A;  3W8X A;  5FXE A;  2Y3R A;  4PVH A;  1QLT A;  2VFT A;  4BC7 A;  1N5W C;  3ETR B;  3VTE A;  1I19 A;  4ZOH B;  1UXY A;  3PM9 A;  2QKN A;  3AM9 A;  5HHZ A;  3AN1 A;  3C0P A;  3DQ0 A;  3S1F A;  1W1M A;  4OAL A;  4UD8 A;  3FW7 A;  3I99 A;  4EC3 A;  3POP A;  3FW8 A;  5FXP A;  2MBR A;  4PVE A;  3W8W A;  5HMR A;  2Q85 A;  3AMZ A;  5FXF A;  3GSY A;  1FIQ B;  1W1Q A;  1T3Q C;  3S1D A;  2Y3S A;  1DII A;  4PVJ A;  4PWB A;  2Q4W A;  3S1C A;  5AE3 A;  1FO4 A;  5L6F A;  1N5X A;  1E8F A;  1JRO A;  4O95 A;  3FW9 A;  1E8G A;  4BCA A;  2E3T A;  3PQB A;  3EUB 3;  5FXD A;  3D2D A;  5AE2 A;  1F0X A;  5AWV A;  3TSH A;  3B9J B;  2VFU A;  1HSK A;  1W1R A;  3RJ8 A;  5I1V A;  2W55 A;  1W1O A;  5K8E A;  1N62 C;  1ZR6 A;  2AXR A;  5AE1 A;  5ADZ A;  3BW7 A;  1ZXI C;  3KJM A;  3TSJ A;  3JS8 A;  4MLA A;  4PYT A;  1MBB A;  1V97 A;  2GQU A;  3W8Z A;  5I1W A;  3RJA A;  2I0K A;  4JB1 A;  4BC9 A;  2BVF A;  1AHV A;  2VFR A;  2Y08 A;  2WDW A;  3TX1 A;  4BBY A;  1N60 C;  2QPM A;  1W1S A;  2Y4G A;  4PVK A;  2BVG A;  1W1L A;  1W1J A;  1FFU C;  3S1E A;  4JAY A;  3FWA A;  5L6G A;  3HSU A;  4DNS A;  4PZF A;  1QLU A;  1VDV A;  1MBT A;  1WYG A;  2VFV A;  3NS1 B;  2EXR A;  2W3R A;  2IPI A;  2W3S A;  2VFS A;  1N63 C;  3D2J A;  1E8H A;  1AHU A;  1DIQ A;  1VAO A;  3NVZ B;  4XLO A;  1W1K A;  2GQT A;  1WVF A;  1AHZ A;  2W54 A;  1FFV C;  4ML8 A;  1E0Y A;  3NRZ B;  3SR6 B; 
#chains in the Genus database with same CATH topology
 3EJE B;  2PLS A;  4PWC A;  1N61 C;  3D2H A;  5HQX A;  1WVE A;  2VAO A;  5D79 A;  1DZN A;  2BVH A;  3W8X A;  5FXE A;  2Y3R A;  4PVH A;  1QLT A;  3NVV B;  2P3H A;  2YVS A;  2VFT A;  4HG0 A;  4BC7 A;  1N5W C;  3ETR B;  3VTE A;  1I19 A;  4ZOH B;  1UXY A;  3PM9 A;  2QKN A;  3AM9 A;  5HHZ A;  2P4P A;  3AN1 A;  3C0P A;  3DQ0 A;  3S1F A;  1W1M A;  2R2Z A;  4OAL A;  4UD8 A;  2NQW A;  3FW7 A;  3I99 A;  4EC3 A;  3POP A;  3FW8 A;  5FXP A;  3EJB B;  2MBR A;  2OAI A;  4PVE A;  3W8W A;  5HMR A;  3EJD B;  2Q85 A;  3AMZ A;  3LLB A;  5FXF A;  3GSY A;  1FIQ B;  1W1Q A;  1SB3 B;  3NVY B;  1T3Q C;  3S1D A;  2Y3S A;  1DII A;  4PVJ A;  4PWB A;  2Q4W A;  2RK5 A;  3S1C A;  5AE3 A;  1FO4 A;  2UUU A;  5L6F A;  1N5X A;  3LAE A;  1E8F A;  1JRO A;  4O95 A;  3FW9 A;  1E8G A;  4BCA A;  2E3T A;  3PQB A;  3EUB 3;  5FXD A;  3D2D A;  5AE2 A;  1JRP A;  1F0X A;  3DED A;  5AWV A;  3TSH A;  3B9J B;  3HRD C;  2VFU A;  1HSK A;  1W1R A;  3RJ8 A;  2P13 A;  5I1V A;  2W55 A;  1W1O A;  5K8E A;  1N62 C;  1ZR6 A;  2AXR A;  5AE1 A;  5ADZ A;  3BW7 A;  1ZXI C;  3KJM A;  3TSJ A;  2PLI A;  3JS8 A;  4MLA A;  4PYT A;  3NVW B;  5G5G B;  1MBB A;  1V97 A;  2GQU A;  3W8Z A;  5I1W A;  3RJA A;  2I0K A;  4JB1 A;  4BC9 A;  2BVF A;  1AHV A;  2VFR A;  2Y08 A;  2WDW A;  3TX1 A;  4BBY A;  1N60 C;  2QPM A;  1W1S A;  2Y4G A;  4PVK A;  2BVG A;  1W1L A;  1W1J A;  1RM6 B;  1FFU C;  3S1E A;  4JAY A;  3FWA A;  5L6G A;  3HSU A;  4DNS A;  4PZF A;  1QLU A;  1VDV A;  1MBT A;  1WYG A;  2VFV A;  3NS1 B;  2EXR A;  2W3R A;  2IPI A;  2W3S A;  2VFS A;  5G5H B;  1N63 C;  3D2J A;  1E8H A;  1AHU A;  1DIQ A;  1VAO A;  3NVZ B;  4XLO A;  2R8D A;  2O3G A;  2UUV A;  1W1K A;  2GQT A;  1WVF A;  1AHZ A;  2W54 A;  1FFV C;  4ML8 A;  1E0Y A;  3NRZ B;  3SR6 B; 
#chains in the Genus database with same CATH homology
 2PLS A;  4PWC A;  1N61 C;  3D2H A;  5HQX A;  1WVE A;  2VAO A;  5D79 A;  1DZN A;  2BVH A;  3W8X A;  5FXE A;  2Y3R A;  4PVH A;  1QLT A;  2P3H A;  3NVV B;  2YVS A;  2VFT A;  4HG0 A;  4BC7 A;  1N5W C;  3ETR B;  3VTE A;  1I19 A;  4ZOH B;  1UXY A;  3PM9 A;  2QKN A;  3AM9 A;  5HHZ A;  2P4P A;  3AN1 A;  3C0P A;  3DQ0 A;  3S1F A;  1W1M A;  2R2Z A;  4OAL A;  4UD8 A;  2NQW A;  3FW7 A;  3I99 A;  4EC3 A;  3POP A;  3FW8 A;  5FXP A;  2MBR A;  2OAI A;  4PVE A;  3W8W A;  5HMR A;  2Q85 A;  3AMZ A;  3LLB A;  5FXF A;  3GSY A;  1FIQ B;  1W1Q A;  1SB3 B;  3NVY B;  1T3Q C;  3S1D A;  2Y3S A;  1DII A;  4PVJ A;  4PWB A;  2Q4W A;  2RK5 A;  3S1C A;  5AE3 A;  1FO4 A;  2UUU A;  5L6F A;  1N5X A;  3LAE A;  1E8F A;  1JRO A;  4O95 A;  3FW9 A;  1E8G A;  4BCA A;  2E3T A;  3PQB A;  3EUB 3;  5FXD A;  3D2D A;  5AE2 A;  1JRP A;  1F0X A;  3DED A;  5AWV A;  3TSH A;  3B9J B;  3HRD C;  2VFU A;  1HSK A;  1W1R A;  3RJ8 A;  2P13 A;  5I1V A;  2W55 A;  1W1O A;  5K8E A;  1N62 C;  1ZR6 A;  2AXR A;  5AE1 A;  5ADZ A;  3BW7 A;  1ZXI C;  3KJM A;  3TSJ A;  2PLI A;  3JS8 A;  4MLA A;  4PYT A;  3NVW B;  5G5G B;  1MBB A;  1V97 A;  2GQU A;  3W8Z A;  5I1W A;  3RJA A;  2I0K A;  4JB1 A;  4BC9 A;  2BVF A;  1AHV A;  2VFR A;  2Y08 A;  2WDW A;  3TX1 A;  4BBY A;  1N60 C;  2QPM A;  1W1S A;  2Y4G A;  4PVK A;  2BVG A;  1W1L A;  1W1J A;  1RM6 B;  1FFU C;  3S1E A;  4JAY A;  3FWA A;  5L6G A;  3HSU A;  4DNS A;  4PZF A;  1QLU A;  1VDV A;  1MBT A;  1WYG A;  2VFV A;  3NS1 B;  2EXR A;  2W3R A;  2IPI A;  2W3S A;  2VFS A;  5G5H B;  1N63 C;  3D2J A;  1E8H A;  1AHU A;  1DIQ A;  1VAO A;  3NVZ B;  4XLO A;  2R8D A;  2O3G A;  2UUV A;  1W1K A;  2GQT A;  1WVF A;  1AHZ A;  2W54 A;  1FFV C;  4ML8 A;  1E0Y A;  3NRZ B;  3SR6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...