4PVKA

Phl p 4 i153v n158h variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvkA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvkA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvkA03
1MBTA 1HSKA 3PM9A 2GQUA 3JS8A 2BVFA 3SR6B 1T3QC 1N62C 4BCAA 3EUB3 4PZFA 3HSUA 3POPA 1UXYA 1FFUC 5D79A 3S1DA 1VDVA 1N63C 3RJ8A 3NS1B 4PWCA 5ADZA 2Q85A 3ETRB 1E8HA 1WVEA 1DZNA 4DNSA 3B9JB 1ZR6A 4ML8A 5AE1A 5AWVA 2Y3SA 3W8WA 2AXRA 4XLOA 1E8FA 1AHZA 5HQXA 4PWBA 1W1QA 5FXEA 2I0KA 5FXPA 1E8GA 4ZOHB 1W1JA 3S1FA 1QLTA 4JAYA 3D2HA 2QKNA 2Y3RA 1E0YA 1FFVC 4O95A 3BW7A 2IPIA 2Y08A 4PVKA 3RJAA 2VFTA 2W3SA 2GQTA 1JROA 3KJMA 3NRZB 3S1CA 5AE2A 5L6GA 2W54A 3D2DA 2E3TA 1FO4A 1MBBA 4OALA 1QLUA 5I1VA 2WDWA 3I99A 4BC7A 5FXDA 1W1KA 3S1EA 1DIQA 1AHUA 2VFSA 3AMZA 4PVHA 4BBYA 1N60C 2W3RA 4JB1A 2Y4GA 3TSHA 3W8ZA 4PVEA 1W1MA 4UD8A 3AM9A 3TSJA 5L6FA 2MBRA 3D2JA 2BVHA 3GSYA 4MLAA 3FW8A 2QPMA 3FWAA 5K8EA 3PQBA 2VFVA 4PYTA 4BC9A 1WVFA 5HHZA 4EC3A 1I19A 2EXRA 2Q4WA 1AHVA 1W1RA 2VFRA 5FXFA 2VAOA 1FIQB 1W1OA 5AE3A 4PVJA 1W1SA 1DIIA 1W1LA 3DQ0A 3FW9A 2W55A 3FW7A 1N5WC 1ZXIC 1N61C 2VFUA 1WYGA 3TX1A 3W8XA 5HMRA 3C0PA 5I1WA 3AN1A 1F0XA 1VAOA 3NVZB 3VTEA 1N5XA 1V97A 2BVGA
chains in the Genus database with same CATH superfamily
1MBTA 1HSKA 3PM9A 2GQUA 2P13A 3JS8A 2UUVA 2BVFA 3SR6B 1T3QC 1N62C 4BCAA 3EUB3 4PZFA 5G5HB 3HSUA 3POPA 1UXYA 1FFUC 5D79A 3S1DA 1VDVA 2RK5A 3NVVB 1N63C 3RJ8A 4HG0A 3NS1B 4PWCA 2P3HA 2P4PA 5ADZA 2Q85A 3ETRB 1E8HA 1WVEA 1DZNA 4DNSA 3B9JB 2O3GA 1ZR6A 4ML8A 5AE1A 5AWVA 2Y3SA 3W8WA 2AXRA 4XLOA 1E8FA 1AHZA 5HQXA 4PWBA 1W1QA 5FXEA 2I0KA 5FXPA 1E8GA 4ZOHB 1W1JA 3S1FA 1QLTA 4JAYA 3D2HA 2QKNA 2Y3RA 1E0YA 3LLBA 1FFVC 4O95A 3BW7A 2IPIA 2Y08A 4PVKA 3RJAA 2VFTA 2W3SA 2GQTA 1JROA 3KJMA 3NRZB 3S1CA 5AE2A 3EJBB 1JRPA 5L6GA 2W54A 3NVYB 3D2DA 2E3TA 1FO4A 1MBBA 4OALA 3DEDA 1QLUA 5I1VA 2WDWA 3I99A 2YVSA 4BC7A 5FXDA 1W1KA 3S1EA 1DIQA 1AHUA 2VFSA 3AMZA 4PVHA 2R8DA 4BBYA 1SB3B 2PLSA 1N60C 2W3RA 4JB1A 2Y4GA 3TSHA 3W8ZA 2UUUA 1RM6B 5G5GB 2PLIA 4PVEA 1W1MA 4UD8A 3AM9A 3TSJA 5L6FA 2MBRA 3D2JA 2BVHA 3GSYA 4MLAA 2NQWA 3FW8A 2QPMA 3FWAA 5K8EA 3PQBA 2VFVA 4PYTA 4BC9A 1WVFA 5HHZA 4EC3A 1I19A 2EXRA 2Q4WA 1AHVA 2R2ZA 1W1RA 2VFRA 5FXFA 2VAOA 1FIQB 1W1OA 2OAIA 5AE3A 3NVWB 4PVJA 3HRDC 3EJEB 1W1SA 1DIIA 1W1LA 3DQ0A 3FW9A 2W55A 3FW7A 1N5WC 1ZXIC 1N61C 2VFUA 1WYGA 3EJDB 3TX1A 3W8XA 5HMRA 3C0PA 5I1WA 3AN1A 1F0XA 3LAEA 1VAOA 3NVZB 3VTEA 1N5XA 1V97A 2BVGA
chains in the Genus database with same CATH topology
1MBTA 1HSKA 3PM9A 2GQUA 2P13A 3JS8A 2UUVA 2BVFA 3SR6B 1T3QC 1N62C 4BCAA 3EUB3 4PZFA 5G5HB 3HSUA 3POPA 1UXYA 1FFUC 5D79A 3S1DA 1VDVA 2RK5A 3NVVB 1N63C 3RJ8A 4HG0A 3NS1B 4PWCA 2P3HA 2P4PA 5ADZA 2Q85A 3ETRB 1E8HA 1WVEA 1DZNA 4DNSA 3B9JB 2O3GA 1ZR6A 4ML8A 5AE1A 5AWVA 2Y3SA 3W8WA 2AXRA 4XLOA 1E8FA 1AHZA 5HQXA 4PWBA 1W1QA 5FXEA 2I0KA 5FXPA 1E8GA 4ZOHB 1W1JA 3S1FA 1QLTA 4JAYA 3D2HA 2QKNA 2Y3RA 1E0YA 3LLBA 1FFVC 4O95A 3BW7A 2IPIA 2Y08A 4PVKA 3RJAA 2VFTA 2W3SA 2GQTA 1JROA 3KJMA 3NRZB 3S1CA 5AE2A 1JRPA 5L6GA 2W54A 3NVYB 3D2DA 2E3TA 1FO4A 1MBBA 4OALA 3DEDA 1QLUA 5I1VA 2WDWA 3I99A 2YVSA 4BC7A 5FXDA 1W1KA 3S1EA 1DIQA 1AHUA 2VFSA 3AMZA 4PVHA 2R8DA 4BBYA 1SB3B 2PLSA 1N60C 2W3RA 4JB1A 2Y4GA 3TSHA 3W8ZA 2UUUA 1RM6B 5G5GB 2PLIA 4PVEA 1W1MA 4UD8A 3AM9A 3TSJA 5L6FA 2MBRA 3D2JA 2BVHA 3GSYA 4MLAA 2NQWA 3FW8A 2QPMA 3FWAA 5K8EA 3PQBA 2VFVA 4PYTA 4BC9A 1WVFA 5HHZA 4EC3A 1I19A 2EXRA 2Q4WA 1AHVA 2R2ZA 1W1RA 2VFRA 5FXFA 2VAOA 1FIQB 1W1OA 2OAIA 5AE3A 3NVWB 4PVJA 3HRDC 1W1SA 1DIIA 1W1LA 3DQ0A 3FW9A 2W55A 3FW7A 1N5WC 1ZXIC 1N61C 2VFUA 1WYGA 3TX1A 3W8XA 5HMRA 3C0PA 5I1WA 3AN1A 1F0XA 3LAEA 1VAOA 3NVZB 3VTEA 1N5XA 1V97A 2BVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBT A;  1HSK A;  3PM9 A;  2GQU A;  3JS8 A;  2BVF A;  3SR6 B;  1T3Q C;  1N62 C;  4BCA A;  3EUB 3;  4PZF A;  3HSU A;  3POP A;  1UXY A;  1FFU C;  5D79 A;  3S1D A;  1VDV A;  1N63 C;  3RJ8 A;  3NS1 B;  4PWC A;  5ADZ A;  2Q85 A;  3ETR B;  1E8H A;  1WVE A;  1DZN A;  4DNS A;  3B9J B;  1ZR6 A;  4ML8 A;  5AE1 A;  5AWV A;  2Y3S A;  3W8W A;  2AXR A;  4XLO A;  1E8F A;  1AHZ A;  5HQX A;  4PWB A;  1W1Q A;  5FXE A;  2I0K A;  5FXP A;  1E8G A;  4ZOH B;  1W1J A;  3S1F A;  1QLT A;  4JAY A;  3D2H A;  2QKN A;  2Y3R A;  1E0Y A;  1FFV C;  4O95 A;  3BW7 A;  2IPI A;  2Y08 A;  4PVK A;  3RJA A;  2VFT A;  2W3S A;  2GQT A;  1JRO A;  3KJM A;  3NRZ B;  3S1C A;  5AE2 A;  5L6G A;  2W54 A;  3D2D A;  2E3T A;  1FO4 A;  1MBB A;  4OAL A;  1QLU A;  5I1V A;  2WDW A;  3I99 A;  4BC7 A;  5FXD A;  1W1K A;  3S1E A;  1DIQ A;  1AHU A;  2VFS A;  3AMZ A;  4PVH A;  4BBY A;  1N60 C;  2W3R A;  4JB1 A;  2Y4G A;  3TSH A;  3W8Z A;  4PVE A;  1W1M A;  4UD8 A;  3AM9 A;  3TSJ A;  5L6F A;  2MBR A;  3D2J A;  2BVH A;  3GSY A;  4MLA A;  3FW8 A;  2QPM A;  3FWA A;  5K8E A;  3PQB A;  2VFV A;  4PYT A;  4BC9 A;  1WVF A;  5HHZ A;  4EC3 A;  1I19 A;  2EXR A;  2Q4W A;  1AHV A;  1W1R A;  2VFR A;  5FXF A;  2VAO A;  1FIQ B;  1W1O A;  5AE3 A;  4PVJ A;  1W1S A;  1DII A;  1W1L A;  3DQ0 A;  3FW9 A;  2W55 A;  3FW7 A;  1N5W C;  1ZXI C;  1N61 C;  2VFU A;  1WYG A;  3TX1 A;  3W8X A;  5HMR A;  3C0P A;  5I1W A;  3AN1 A;  1F0X A;  1VAO A;  3NVZ B;  3VTE A;  1N5X A;  1V97 A;  2BVG A; 
#chains in the Genus database with same CATH topology
 1MBT A;  1HSK A;  3PM9 A;  2GQU A;  2P13 A;  3JS8 A;  2UUV A;  2BVF A;  3SR6 B;  1T3Q C;  1N62 C;  4BCA A;  3EUB 3;  4PZF A;  5G5H B;  3HSU A;  3POP A;  1UXY A;  1FFU C;  5D79 A;  3S1D A;  1VDV A;  2RK5 A;  3NVV B;  1N63 C;  3RJ8 A;  4HG0 A;  3NS1 B;  4PWC A;  2P3H A;  2P4P A;  5ADZ A;  2Q85 A;  3ETR B;  1E8H A;  1WVE A;  1DZN A;  4DNS A;  3B9J B;  2O3G A;  1ZR6 A;  4ML8 A;  5AE1 A;  5AWV A;  2Y3S A;  3W8W A;  2AXR A;  4XLO A;  1E8F A;  1AHZ A;  5HQX A;  4PWB A;  1W1Q A;  5FXE A;  2I0K A;  5FXP A;  1E8G A;  4ZOH B;  1W1J A;  3S1F A;  1QLT A;  4JAY A;  3D2H A;  2QKN A;  2Y3R A;  1E0Y A;  3LLB A;  1FFV C;  4O95 A;  3BW7 A;  2IPI A;  2Y08 A;  4PVK A;  3RJA A;  2VFT A;  2W3S A;  2GQT A;  1JRO A;  3KJM A;  3NRZ B;  3S1C A;  5AE2 A;  3EJB B;  1JRP A;  5L6G A;  2W54 A;  3NVY B;  3D2D A;  2E3T A;  1FO4 A;  1MBB A;  4OAL A;  3DED A;  1QLU A;  5I1V A;  2WDW A;  3I99 A;  2YVS A;  4BC7 A;  5FXD A;  1W1K A;  3S1E A;  1DIQ A;  1AHU A;  2VFS A;  3AMZ A;  4PVH A;  2R8D A;  4BBY A;  1SB3 B;  2PLS A;  1N60 C;  2W3R A;  4JB1 A;  2Y4G A;  3TSH A;  3W8Z A;  2UUU A;  1RM6 B;  5G5G B;  2PLI A;  4PVE A;  1W1M A;  4UD8 A;  3AM9 A;  3TSJ A;  5L6F A;  2MBR A;  3D2J A;  2BVH A;  3GSY A;  4MLA A;  2NQW A;  3FW8 A;  2QPM A;  3FWA A;  5K8E A;  3PQB A;  2VFV A;  4PYT A;  4BC9 A;  1WVF A;  5HHZ A;  4EC3 A;  1I19 A;  2EXR A;  2Q4W A;  1AHV A;  2R2Z A;  1W1R A;  2VFR A;  5FXF A;  2VAO A;  1FIQ B;  1W1O A;  2OAI A;  5AE3 A;  3NVW B;  4PVJ A;  3HRD C;  3EJE B;  1W1S A;  1DII A;  1W1L A;  3DQ0 A;  3FW9 A;  2W55 A;  3FW7 A;  1N5W C;  1ZXI C;  1N61 C;  2VFU A;  1WYG A;  3EJD B;  3TX1 A;  3W8X A;  5HMR A;  3C0P A;  5I1W A;  3AN1 A;  1F0X A;  3LAE A;  1VAO A;  3NVZ B;  3VTE A;  1N5X A;  1V97 A;  2BVG A; 
#chains in the Genus database with same CATH homology
 1MBT A;  1HSK A;  3PM9 A;  2GQU A;  2P13 A;  3JS8 A;  2UUV A;  2BVF A;  3SR6 B;  1T3Q C;  1N62 C;  4BCA A;  3EUB 3;  4PZF A;  5G5H B;  3HSU A;  3POP A;  1UXY A;  1FFU C;  5D79 A;  3S1D A;  1VDV A;  2RK5 A;  3NVV B;  1N63 C;  3RJ8 A;  4HG0 A;  3NS1 B;  4PWC A;  2P3H A;  2P4P A;  5ADZ A;  2Q85 A;  3ETR B;  1E8H A;  1WVE A;  1DZN A;  4DNS A;  3B9J B;  2O3G A;  1ZR6 A;  4ML8 A;  5AE1 A;  5AWV A;  2Y3S A;  3W8W A;  2AXR A;  4XLO A;  1E8F A;  1AHZ A;  5HQX A;  4PWB A;  1W1Q A;  5FXE A;  2I0K A;  5FXP A;  1E8G A;  4ZOH B;  1W1J A;  3S1F A;  1QLT A;  4JAY A;  3D2H A;  2QKN A;  2Y3R A;  1E0Y A;  3LLB A;  1FFV C;  4O95 A;  3BW7 A;  2IPI A;  2Y08 A;  4PVK A;  3RJA A;  2VFT A;  2W3S A;  2GQT A;  1JRO A;  3KJM A;  3NRZ B;  3S1C A;  5AE2 A;  1JRP A;  5L6G A;  2W54 A;  3NVY B;  3D2D A;  2E3T A;  1FO4 A;  1MBB A;  4OAL A;  3DED A;  1QLU A;  5I1V A;  2WDW A;  3I99 A;  2YVS A;  4BC7 A;  5FXD A;  1W1K A;  3S1E A;  1DIQ A;  1AHU A;  2VFS A;  3AMZ A;  4PVH A;  2R8D A;  4BBY A;  1SB3 B;  2PLS A;  1N60 C;  2W3R A;  4JB1 A;  2Y4G A;  3TSH A;  3W8Z A;  2UUU A;  1RM6 B;  5G5G B;  2PLI A;  4PVE A;  1W1M A;  4UD8 A;  3AM9 A;  3TSJ A;  5L6F A;  2MBR A;  3D2J A;  2BVH A;  3GSY A;  4MLA A;  2NQW A;  3FW8 A;  2QPM A;  3FWA A;  5K8E A;  3PQB A;  2VFV A;  4PYT A;  4BC9 A;  1WVF A;  5HHZ A;  4EC3 A;  1I19 A;  2EXR A;  2Q4W A;  1AHV A;  2R2Z A;  1W1R A;  2VFR A;  5FXF A;  2VAO A;  1FIQ B;  1W1O A;  2OAI A;  5AE3 A;  3NVW B;  4PVJ A;  3HRD C;  1W1S A;  1DII A;  1W1L A;  3DQ0 A;  3FW9 A;  2W55 A;  3FW7 A;  1N5W C;  1ZXI C;  1N61 C;  2VFU A;  1WYG A;  3TX1 A;  3W8X A;  5HMR A;  3C0P A;  5I1W A;  3AN1 A;  1F0X A;  3LAE A;  1VAO A;  3NVZ B;  3VTE A;  1N5X A;  1V97 A;  2BVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...