4PVKA

Phl p 4 i153v n158h variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvkA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvkA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvkA03
1WYGA 1E8FA 4O95A 3RJAA 2GQUA 3TX1A 1WVEA 1AHUA 3AN1A 2IPIA 2Y3SA 4XLOA 3W8XA 5L6GA 3D2JA 1AHZA 5L6FA 1E0YA 1VDVA 3PQBA 3NS1B 1T3QC 3DQ0A 3TSHA 2VFRA 4ZOHB 5AE2A 4PWCA 3JS8A 1DIIA 4BCAA 2VAOA 1MBTA 1V97A 4PVEA 3AMZA 1W1QA 3FWAA 1N63C 3FW8A 1W1KA 2WDWA 1E8GA 4MLAA 2EXRA 5FXPA 4DNSA 1W1RA 1QLUA 1QLTA 1W1MA 1E8HA 3I99A 2GQTA 3VTEA 2E3TA 3GSYA 5AWVA 1VAOA 2W55A 3NRZB 1N60C 2VFSA 3TSJA 4BC9A 1FO4A 2BVHA 3ETRB 3AM9A 4PWBA 4BBYA 1W1OA 1W1LA 1WVFA 1W1JA 5I1WA 2QPMA 1FFVC 5FXEA 1I19A 3NVZB 5FXDA 3HSUA 2Y4GA 1FFUC 2QKNA 2Q4WA 3EUB3 4PZFA 3W8ZA 4UD8A 2Y08A 2MBRA 4JAYA 5AE3A 3D2HA 2Q85A 5HMRA 3C0PA 3S1EA 2Y3RA 3D2DA 1JROA 1HSKA 1ZXIC 2VFUA 3RJ8A 5D79A 4ML8A 3W8WA 2W3SA 3POPA 4PYTA 3S1CA 3S1DA 3FW9A 3KJMA 4OALA 3SR6B 1MBBA 1ZR6A 1UXYA 2W3RA 2W54A 4PVHA 5ADZA 1F0XA 1N5XA 1DZNA 3B9JB 3BW7A 4JB1A 5HHZA 4BC7A 2BVGA 5AE1A 1N61C 5HQXA 2VFTA 2VFVA 2I0KA 1FIQB 1N62C 1DIQA 4EC3A 5K8EA 2BVFA 5FXFA 4PVJA 1W1SA 3FW7A 3PM9A 2AXRA 1AHVA 1N5WC 3S1FA 4PVKA 5I1VA
chains in the Genus database with same CATH superfamily
5G5GB 1WYGA 1E8FA 3NVYB 4O95A 3RJAA 2GQUA 3TX1A 1WVEA 1AHUA 3AN1A 2IPIA 2Y3SA 1SB3B 4XLOA 3W8XA 2YVSA 3D2JA 5L6GA 1RM6B 1AHZA 5L6FA 2RK5A 1E0YA 1VDVA 3PQBA 3NS1B 1T3QC 3DQ0A 3TSHA 2VFRA 4ZOHB 5AE2A 4PWCA 3JS8A 1DIIA 1JRPA 3DEDA 4BCAA 2VAOA 1MBTA 1V97A 4PVEA 3AMZA 1W1QA 3FWAA 1N63C 3FW8A 1W1KA 2WDWA 1E8GA 3EJDB 2OAIA 4MLAA 2EXRA 5FXPA 3LLBA 4DNSA 2R8DA 3NVVB 2UUVA 1W1RA 1QLUA 1QLTA 1W1MA 1E8HA 3I99A 2GQTA 3VTEA 2E3TA 3GSYA 5AWVA 1VAOA 2W55A 3NRZB 1N60C 2VFSA 3TSJA 4BC9A 1FO4A 2PLSA 2BVHA 3ETRB 3AM9A 4PWBA 4BBYA 1W1OA 1W1LA 1WVFA 1W1JA 5I1WA 2R2ZA 2NQWA 2QPMA 1FFVC 5FXEA 1I19A 3NVZB 4HG0A 5FXDA 3HSUA 2Y4GA 1FFUC 2QKNA 3EJBB 2Q4WA 3EUB3 4PZFA 3W8ZA 4UD8A 2Y08A 2MBRA 4JAYA 5AE3A 3D2HA 2Q85A 5HMRA 3C0PA 3S1EA 2Y3RA 2UUUA 3D2DA 2P3HA 1JROA 1HSKA 1ZXIC 2VFUA 3RJ8A 5D79A 4ML8A 3W8WA 2W3SA 2O3GA 3POPA 4PYTA 3S1CA 3S1DA 3EJEB 3FW9A 3KJMA 4OALA 3SR6B 1MBBA 2PLIA 1ZR6A 3HRDC 1UXYA 2W3RA 2W54A 4PVHA 5ADZA 1F0XA 1N5XA 1DZNA 3B9JB 3BW7A 4JB1A 2P4PA 5HHZA 4BC7A 2BVGA 5AE1A 1N61C 5HQXA 2VFTA 2VFVA 2I0KA 1FIQB 1N62C 1DIQA 4EC3A 2P13A 5K8EA 2BVFA 3LAEA 5FXFA 4PVJA 1W1SA 3FW7A 5G5HB 3PM9A 3NVWB 2AXRA 1AHVA 1N5WC 3S1FA 4PVKA 5I1VA
chains in the Genus database with same CATH topology
5G5GB 1WYGA 1E8FA 4O95A 3NVYB 3RJAA 2GQUA 3TX1A 1WVEA 1AHUA 3AN1A 2IPIA 2Y3SA 1SB3B 4XLOA 3W8XA 2YVSA 3D2JA 5L6GA 1RM6B 1AHZA 5L6FA 2RK5A 1E0YA 1VDVA 3PQBA 3NS1B 1T3QC 3DQ0A 3TSHA 2VFRA 4ZOHB 5AE2A 4PWCA 3JS8A 1DIIA 1JRPA 3DEDA 4BCAA 2VAOA 1MBTA 1V97A 4PVEA 3AMZA 1W1QA 3FWAA 1N63C 3FW8A 1W1KA 2WDWA 1E8GA 2OAIA 4MLAA 2EXRA 5FXPA 3LLBA 4DNSA 2R8DA 3NVVB 2UUVA 1W1RA 1QLUA 1QLTA 1W1MA 1E8HA 3I99A 2GQTA 3VTEA 2E3TA 3GSYA 5AWVA 1VAOA 2W55A 3NRZB 1N60C 2VFSA 3TSJA 4BC9A 1FO4A 2PLSA 2BVHA 3ETRB 3AM9A 4PWBA 4BBYA 1W1OA 1W1LA 1WVFA 1W1JA 5I1WA 2R2ZA 2NQWA 2QPMA 1FFVC 5FXEA 1I19A 3NVZB 4HG0A 5FXDA 3HSUA 2Y4GA 1FFUC 2QKNA 2Q4WA 3EUB3 4PZFA 3W8ZA 4UD8A 2Y08A 2MBRA 4JAYA 5AE3A 3D2HA 2Q85A 5HMRA 3C0PA 3S1EA 2Y3RA 2UUUA 3D2DA 2P3HA 1JROA 1HSKA 1ZXIC 2VFUA 3RJ8A 5D79A 4ML8A 3W8WA 2W3SA 2O3GA 3POPA 4PYTA 3S1CA 3S1DA 3FW9A 3KJMA 4OALA 3SR6B 1MBBA 2PLIA 1ZR6A 3HRDC 1UXYA 2W3RA 2W54A 4PVHA 5ADZA 1F0XA 1N5XA 1DZNA 3B9JB 3BW7A 4JB1A 2P4PA 5HHZA 4BC7A 2BVGA 5AE1A 1N61C 5HQXA 2VFTA 2VFVA 2I0KA 1FIQB 1N62C 1DIQA 4EC3A 2P13A 5K8EA 2BVFA 3LAEA 5FXFA 4PVJA 1W1SA 3FW7A 5G5HB 3PM9A 3NVWB 2AXRA 1AHVA 1N5WC 3S1FA 4PVKA 5I1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYG A;  1E8F A;  4O95 A;  3RJA A;  2GQU A;  3TX1 A;  1WVE A;  1AHU A;  3AN1 A;  2IPI A;  2Y3S A;  4XLO A;  3W8X A;  5L6G A;  3D2J A;  1AHZ A;  5L6F A;  1E0Y A;  1VDV A;  3PQB A;  3NS1 B;  1T3Q C;  3DQ0 A;  3TSH A;  2VFR A;  4ZOH B;  5AE2 A;  4PWC A;  3JS8 A;  1DII A;  4BCA A;  2VAO A;  1MBT A;  1V97 A;  4PVE A;  3AMZ A;  1W1Q A;  3FWA A;  1N63 C;  3FW8 A;  1W1K A;  2WDW A;  1E8G A;  4MLA A;  2EXR A;  5FXP A;  4DNS A;  1W1R A;  1QLU A;  1QLT A;  1W1M A;  1E8H A;  3I99 A;  2GQT A;  3VTE A;  2E3T A;  3GSY A;  5AWV A;  1VAO A;  2W55 A;  3NRZ B;  1N60 C;  2VFS A;  3TSJ A;  4BC9 A;  1FO4 A;  2BVH A;  3ETR B;  3AM9 A;  4PWB A;  4BBY A;  1W1O A;  1W1L A;  1WVF A;  1W1J A;  5I1W A;  2QPM A;  1FFV C;  5FXE A;  1I19 A;  3NVZ B;  5FXD A;  3HSU A;  2Y4G A;  1FFU C;  2QKN A;  2Q4W A;  3EUB 3;  4PZF A;  3W8Z A;  4UD8 A;  2Y08 A;  2MBR A;  4JAY A;  5AE3 A;  3D2H A;  2Q85 A;  5HMR A;  3C0P A;  3S1E A;  2Y3R A;  3D2D A;  1JRO A;  1HSK A;  1ZXI C;  2VFU A;  3RJ8 A;  5D79 A;  4ML8 A;  3W8W A;  2W3S A;  3POP A;  4PYT A;  3S1C A;  3S1D A;  3FW9 A;  3KJM A;  4OAL A;  3SR6 B;  1MBB A;  1ZR6 A;  1UXY A;  2W3R A;  2W54 A;  4PVH A;  5ADZ A;  1F0X A;  1N5X A;  1DZN A;  3B9J B;  3BW7 A;  4JB1 A;  5HHZ A;  4BC7 A;  2BVG A;  5AE1 A;  1N61 C;  5HQX A;  2VFT A;  2VFV A;  2I0K A;  1FIQ B;  1N62 C;  1DIQ A;  4EC3 A;  5K8E A;  2BVF A;  5FXF A;  4PVJ A;  1W1S A;  3FW7 A;  3PM9 A;  2AXR A;  1AHV A;  1N5W C;  3S1F A;  4PVK A;  5I1V A; 
#chains in the Genus database with same CATH topology
 5G5G B;  1WYG A;  1E8F A;  3NVY B;  4O95 A;  3RJA A;  2GQU A;  3TX1 A;  1WVE A;  1AHU A;  3AN1 A;  2IPI A;  2Y3S A;  1SB3 B;  4XLO A;  3W8X A;  2YVS A;  3D2J A;  5L6G A;  1RM6 B;  1AHZ A;  5L6F A;  2RK5 A;  1E0Y A;  1VDV A;  3PQB A;  3NS1 B;  1T3Q C;  3DQ0 A;  3TSH A;  2VFR A;  4ZOH B;  5AE2 A;  4PWC A;  3JS8 A;  1DII A;  1JRP A;  3DED A;  4BCA A;  2VAO A;  1MBT A;  1V97 A;  4PVE A;  3AMZ A;  1W1Q A;  3FWA A;  1N63 C;  3FW8 A;  1W1K A;  2WDW A;  1E8G A;  3EJD B;  2OAI A;  4MLA A;  2EXR A;  5FXP A;  3LLB A;  4DNS A;  2R8D A;  3NVV B;  2UUV A;  1W1R A;  1QLU A;  1QLT A;  1W1M A;  1E8H A;  3I99 A;  2GQT A;  3VTE A;  2E3T A;  3GSY A;  5AWV A;  1VAO A;  2W55 A;  3NRZ B;  1N60 C;  2VFS A;  3TSJ A;  4BC9 A;  1FO4 A;  2PLS A;  2BVH A;  3ETR B;  3AM9 A;  4PWB A;  4BBY A;  1W1O A;  1W1L A;  1WVF A;  1W1J A;  5I1W A;  2R2Z A;  2NQW A;  2QPM A;  1FFV C;  5FXE A;  1I19 A;  3NVZ B;  4HG0 A;  5FXD A;  3HSU A;  2Y4G A;  1FFU C;  2QKN A;  3EJB B;  2Q4W A;  3EUB 3;  4PZF A;  3W8Z A;  4UD8 A;  2Y08 A;  2MBR A;  4JAY A;  5AE3 A;  3D2H A;  2Q85 A;  5HMR A;  3C0P A;  3S1E A;  2Y3R A;  2UUU A;  3D2D A;  2P3H A;  1JRO A;  1HSK A;  1ZXI C;  2VFU A;  3RJ8 A;  5D79 A;  4ML8 A;  3W8W A;  2W3S A;  2O3G A;  3POP A;  4PYT A;  3S1C A;  3S1D A;  3EJE B;  3FW9 A;  3KJM A;  4OAL A;  3SR6 B;  1MBB A;  2PLI A;  1ZR6 A;  3HRD C;  1UXY A;  2W3R A;  2W54 A;  4PVH A;  5ADZ A;  1F0X A;  1N5X A;  1DZN A;  3B9J B;  3BW7 A;  4JB1 A;  2P4P A;  5HHZ A;  4BC7 A;  2BVG A;  5AE1 A;  1N61 C;  5HQX A;  2VFT A;  2VFV A;  2I0K A;  1FIQ B;  1N62 C;  1DIQ A;  4EC3 A;  2P13 A;  5K8E A;  2BVF A;  3LAE A;  5FXF A;  4PVJ A;  1W1S A;  3FW7 A;  5G5H B;  3PM9 A;  3NVW B;  2AXR A;  1AHV A;  1N5W C;  3S1F A;  4PVK A;  5I1V A; 
#chains in the Genus database with same CATH homology
 5G5G B;  1WYG A;  1E8F A;  4O95 A;  3NVY B;  3RJA A;  2GQU A;  3TX1 A;  1WVE A;  1AHU A;  3AN1 A;  2IPI A;  2Y3S A;  1SB3 B;  4XLO A;  3W8X A;  2YVS A;  3D2J A;  5L6G A;  1RM6 B;  1AHZ A;  5L6F A;  2RK5 A;  1E0Y A;  1VDV A;  3PQB A;  3NS1 B;  1T3Q C;  3DQ0 A;  3TSH A;  2VFR A;  4ZOH B;  5AE2 A;  4PWC A;  3JS8 A;  1DII A;  1JRP A;  3DED A;  4BCA A;  2VAO A;  1MBT A;  1V97 A;  4PVE A;  3AMZ A;  1W1Q A;  3FWA A;  1N63 C;  3FW8 A;  1W1K A;  2WDW A;  1E8G A;  2OAI A;  4MLA A;  2EXR A;  5FXP A;  3LLB A;  4DNS A;  2R8D A;  3NVV B;  2UUV A;  1W1R A;  1QLU A;  1QLT A;  1W1M A;  1E8H A;  3I99 A;  2GQT A;  3VTE A;  2E3T A;  3GSY A;  5AWV A;  1VAO A;  2W55 A;  3NRZ B;  1N60 C;  2VFS A;  3TSJ A;  4BC9 A;  1FO4 A;  2PLS A;  2BVH A;  3ETR B;  3AM9 A;  4PWB A;  4BBY A;  1W1O A;  1W1L A;  1WVF A;  1W1J A;  5I1W A;  2R2Z A;  2NQW A;  2QPM A;  1FFV C;  5FXE A;  1I19 A;  3NVZ B;  4HG0 A;  5FXD A;  3HSU A;  2Y4G A;  1FFU C;  2QKN A;  2Q4W A;  3EUB 3;  4PZF A;  3W8Z A;  4UD8 A;  2Y08 A;  2MBR A;  4JAY A;  5AE3 A;  3D2H A;  2Q85 A;  5HMR A;  3C0P A;  3S1E A;  2Y3R A;  2UUU A;  3D2D A;  2P3H A;  1JRO A;  1HSK A;  1ZXI C;  2VFU A;  3RJ8 A;  5D79 A;  4ML8 A;  3W8W A;  2W3S A;  2O3G A;  3POP A;  4PYT A;  3S1C A;  3S1D A;  3FW9 A;  3KJM A;  4OAL A;  3SR6 B;  1MBB A;  2PLI A;  1ZR6 A;  3HRD C;  1UXY A;  2W3R A;  2W54 A;  4PVH A;  5ADZ A;  1F0X A;  1N5X A;  1DZN A;  3B9J B;  3BW7 A;  4JB1 A;  2P4P A;  5HHZ A;  4BC7 A;  2BVG A;  5AE1 A;  1N61 C;  5HQX A;  2VFT A;  2VFV A;  2I0K A;  1FIQ B;  1N62 C;  1DIQ A;  4EC3 A;  2P13 A;  5K8E A;  2BVF A;  3LAE A;  5FXF A;  4PVJ A;  1W1S A;  3FW7 A;  5G5H B;  3PM9 A;  3NVW B;  2AXR A;  1AHV A;  1N5W C;  3S1F A;  4PVK A;  5I1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...