4PVZA

Structure of yeast importin a bound to the membrane protein nuclear localization signal sequence of inm protein heh2
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
422
structure length
422
Chain Sequence
ELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Importin subunit alpha
publication title Distinctive Properties of the Nuclear Localization Signals of Inner Nuclear Membrane Proteins Heh1 and Heh2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Protein binding
total genus 172
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4pvzA00
3BX2A 4WV6A 3QHEA 4P6ZB 3OBVA 4H3KA 5HHGE 3KNDA 3WOYA 4RZPA 1M8ZA 4U5NA 4HNMA 3TJZB 3ZINA 3TT9A 3BTRC 4CRVB 3BSXA 5DN7A 2W3CA 4CB8A 2BKUB 1M8XA 1TH1A 1QBKB 3GB8A 2H4MA 4FZFA 3K61A 4NEEA 3UKZB 5BZ1A 4JW2B 3ZIQA 3FEXC 2PKGA 1O6PA 1LUJA 4I2ZA 1B3UA 5BZUA 4U58A 4OIHA 1JPPA 5BYMA 3QGCA 1U6GC 3K49A 3GVOA 3ND2A 3Q0LA 4K92A 4U5VA 1IQ1C 1I7WA 2JAKA 1QGRA 3TPOA 1EE4A 2NYLA 2IX3A 3V71A 3NMXA 2IAEA 3NMZA 5LSWA 3T7UA 3WOZA 1EJYI 4NZWA 3OPBA 4U3JC 4CRUB 2NYLB 3ZHPA 5B56A 1WA5C 4MZ5E 3NOWA 5KLTB 3TPMA 3Q0QA 3O2QA 2IAEB 3UKWB 4P6ZG 2PF4A 4MFUA 4RXHB 4B18A 5CTTA 4O27A 4DB8A 3UVUA 3BX3A 2C1MA 1Z2CB 3FGAA 3DADA 4RV1A 2X1GF 2Z5MA 4U5LA 4CBAA 1QGKA 3L3QA 3K5QA 3AU3A 1M8YA 3Q0MA 4YJEA 4R10A 4CT7B 2P8QA 4H3HA 4B8JA 3V6YA 3LTJA 4YI0C 3Q0PA 4I5LA 3FGAB 1OYZA 4V3RA 4D49A 5KLRB 3OQSA 4OO6A 4MZ6E 2YNSA 4D4EA 1IBRB 3UL1B 5HUWC 2C1TA 3V74A 1W63A 3K4EA 5HUYC 1Q1TC 1M1EA 4EVPA 4FQ3A 4PLQA 3O2TA 4BQKA 5J3VA 2DB0A 5SW9A 4DBAA 3IFQA 2Q5DA 2BCTA 3L3FX 3PSTA 4E4VA 3EA5B 4L7MA 2X19B 1W63B 1PJMB 5BZVA 1O6OA 3ODRA 1EJLI 3UKXB 1LRVA 2NYMA 3OUXA 2Z6HA 3QMLC 4PVZA 5KL1A 2Z5JA 1Y2AC 4HM9A 3OUWA 3TX7A 2RU4A 4DVGB 4UAFB 3K64A 2JKRA 4QMHA 4BA3A 3WYFC 2NYMB 1V18A 4JLQA 4IMIA 2F31A 2OF3A 4CV5B 2WTKA 2XA7A 2RU4B 5SVZA 2NPPA 5FC8E 4IMJA 4FZAA 1EE5A 2JKRB 4FFBC 2JKTA 2QK1A 3W3UA 1F59A 3RZ9A 1T08A 1JPWA 5EKFA 3C5WA 4I2WA 4YGXA 3Q0OA 4DB6A 4KZGA 3EG5B 3DW8A 2XA7B 3GVTA 3K5YA 2NPPB 3QG9A 5E6QB 2JKTB 1BK6A 4HXTA 2FV2A 3Q0NA 3BWTA 5D5KC 3BCTA 4B8PA 4V3QA 5H2XA 4TNMA 3O2SA 3NMWA 5JJAA 4EVTA 3ZKVA 1UPLA 5K6SA 3VE6A 1JDHA 5BZ5A 5EKGA 5KLAA 1QZ7A 4HTVA 4EVAA 1W9CA 3L6YA 2VGLA 2QMRA 2IW3A 1XM9A 4A0CA 4UAEA 2YNRA 4DB9A 5EWPA 2YJYA 2OT8A 3QGBA 3L6XA 2JDQA 3ZIRA 3VWAA 1UN0A 4U5OA 1XQSA 5K9SA 4U5UA 1GCJA 2VGLB 3FEYC 5H2WA 4R11A 2GL7A 4K6JA 3LTMA 3WPTA 3Q5UA 5KL8A 4QMJA 3K62A 4Y5JA 4YJLA 4UQIA 1Q1SC 2BAPA 2Z6GA 1UPKA 1BK5A 4V3OA 3H3DX 4DJSA 4LACA 3UL0B 3TJ3A 3ODSA 2Z5NA 4EV9A 2BNXA 3K5ZA 4UQIB 1UKLA 3K7WA 2QK2A 3GRLA 4UWXA 4PLRA 1HO8A 3O4XA 4MFVA 3PSPA 2IE3A 4PLSA 3Q0RA 4ADYA 3Q0SA 4FZDA 4G3AA 4GMNA 2Z5OA 3GQ2A 4R0ZA 4ZDUA 1G3JA 4I5NA 4XZRB 2IWHA 4DZSA 2QNAA 5AEIA 4U5SA 4UADA 4YK6A 1WA5B 4QMIA 3ZIPA 3C2GA 3GS3A 4GMOA 3A6PA 3ZIOA 3K7VA 3UKYB 1PJNB 1I7XA 5SWFA 1IB2A 1XQRA 3GAEA 2IE4A 3GNIA 4B8OA 4BPLA 3EBBA 4EV8A 3RZXA 1M8WA 3C2HA 3IBVA 4CT6B 4U54A 4FDDA 3LWWA 4CB9A 2Z5KA 1IALA 3BSBA 1M5NS
chains in the Genus database with same CATH superfamily
3BX2A 4WV6A 3QHEA 4P6ZB 3OBVA 4H3KA 5HHGE 3KNDA 3WOYA 4RZPA 1M8ZA 4U5NA 4HNMA 3TJZB 3ZINA 4JW2A 3TT9A 3BTRC 5KUBA 3JXYA 4CRVB 3BSXA 5DN7A 2W3CA 4CB8A 2BKUB 1M8XA 1TH1A 1QBKB 3GB8A 4I1EA 2H4MA 5CL7A 4FZFA 3K61A 4NEEA 3UKZB 5BZ1A 4JW2B 3ZIQA 3FEXC 3UJ4A 2PKGA 1O6PA 1LUJA 4I2ZA 1B3UA 5BZUA 4U58A 4OIHA 1JPPA 5BYMA 3QGCA 1U6GC 3K49A 3GVOA 3ND2A 3Q0LA 3BVSA 4K92A 4U5VA 1IQ1C 1I7WA 2JAKA 4FP7A 1QGRA 3TPOA 1EE4A 2NYLA 2IX3A 5CLEA 3V71A 3NMXA 2IAEA 3NMZA 5LSWA 3JY1A 3T7UA 1EJYI 4NZWA 3WOZA 3OPBA 4U3JC 4CRUB 2NYLB 4I6IA 3ZHPA 5B56A 1WA5C 4MZ5E 3NOWA 5KLTB 4I96A 3TPMA 3O2QA 3Q0QA 2IAEB 1TE4A 3UKWB 4P6ZG 2PF4A 4MFUA 4RXHB 4B18A 5CTTA 3T8SA 4O27A 4DB8A 3UVUA 3BX3A 2C1MA 1Z2CB 3FGAA 3DADA 4RV1A 2X1GF 2Z5MA 4U5LA 4CBAA 1QGKA 3L3QA 3K5QA 3AU3A 5CL8A 1M8YA 3Q0MA 4YJEA 4R10A 4CT7B 2P8QA 4H3HA 4B8JA 3V6YA 4JW3C 3LTJA 4YI0C 3Q0PA 4I5LA 3SLAA 3FGAB 1OYZA 4V3RA 4D49A 5KLRB 3OQSA 4I7IA 4OO6A 4MZ6E 2YNSA 5CLCA 4D4EA 1IBRB 3UL1B 5HUWC 2C1TA 3V74A 1W63A 3K4EA 5HUYC 1Q1TC 4A3TA 1M1EA 4EVPA 4FQ3A 4PLQA 3O2TA 3VLEA 4BQKA 5J3VA 2DB0A 5SW9A 4DBAA 3IFQA 2Q5DA 2BCTA 3L3FX 4JKQA 3PSTA 4L4IA 4E4VA 3EA5B 4L7MA 5CL6A 2X19B 1W63B 1PJMB 5BZVA 1O6OA 3ODRA 1EJLI 3UKXB 1LRVA 2NYMA 3OUXA 2Z6HA 3QMLC 4PVZA 5KL1A 2Z5JA 1Y2AC 3VLDA 4HM9A 3OUWA 3TX7A 2RU4A 4DVGB 4UAFB 3K64A 2JKRA 4QMHA 4BA3A 3WYFC 2NYMB 1V18A 4JLQA 4IMIA 2F31A 2OF3A 4CV5B 2WTKA 2XA7A 2RU4B 5SVZA 2NPPA 5FC8E 4IMJA 4FZAA 1EE5A 2JKRB 4FFBC 2JKTA 3SL9A 1LSHA 2QK1A 3W3UA 1F59A 5CL5A 3RZ9A 1T08A 1JPWA 5EKFA 3C5WA 4I2WA 4YGXA 3Q0OA 4DB6A 4KZGA 3EG5B 3DW8A 5CL4A 2XA7B 3GVTA 3K5YA 2NPPB 3QG9A 5E6QB 2JKTB 1BK6A 5CL9A 5CL3A 4HXTA 2FV2A 3Q0NA 3BWTA 5D5KC 3BCTA 4B8PA 4V3QA 5H2XA 4TNMA 3O2SA 3NMWA 4I37A 5JJAA 3ZILA 4EVTA 3ZKVA 4U2XD 1UPLA 5K6SA 3VE6A 1JDHA 5BZ5A 5EKGA 5KLAA 1QZ7A 4HTVA 4EVAA 1W9CA 3L6YA 2VGLA 2QMRA 2IW3A 1XM9A 4A0CA 4UAEA 2YNRA 4DB9A 5EWPA 2YJYA 2OT8A 4L4HA 3QGBA 3L6XA 2JDQA 3ZIRA 3VWAA 1UN0A 4U5OA 1XQSA 5K9SA 4I3NA 4U5UA 3JXZA 1GCJA 2VGLB 3FEYC 5H2WA 4R11A 2GL7A 4I0YA 4K6JA 3LTMA 3WPTA 3Q5UA 5KL8A 4QMJA 3K62A 4Y5JA 4YJLA 1N4KA 4UQIA 1Q1SC 2BAPA 2Z6GA 1UPKA 1BK5A 4V3OA 3H3DX 4DJSA 4LACA 3UL0B 3TJ3A 2XOAA 3ODSA 2Z5NA 4I8MA 4EV9A 4I2SA 2BNXA 3K5ZA 4A3VA 4UQIB 1UKLA 3K7WA 2QK2A 5CLDA 3GRLA 4UWXA 4PLRA 3ZIKA 1HO8A 3O4XA 4MFVA 3VLFA 3PSPA 2IE3A 4PLSA 3Q0RA 4ADYA 5CLAA 3Q0SA 4FZDA 4G3AA 4GMNA 2Z5OA 3GQ2A 4R0ZA 4ZDUA 1G3JA 4I5NA 4XZRB 2IWHA 4DZSA 2QNAA 5AEIA 5CLBA 4U5SA 4UADA 3UJ0A 4YK6A 1WA5B 4QMIA 3ZIPA 3C2GA 3GS3A 4GMOA 3A6PA 3ZIOA 3K7VA 3UKYB 1PJNB 1I7XA 5SWFA 1IB2A 1XQRA 3GAEA 2IE4A 3GNIA 4B8OA 4BPLA 3EBBA 4EV8A 3RZXA 1M8WA 3C2HA 3IBVA 4CT6B 4U54A 4FDDA 3LWWA 4CB9A 2Z5KA 1IALA 3JX7A 3BSBA 1M5NS
chains in the Genus database with same CATH topology
3BX2A 4WV6A 3QHEA 4P6ZB 3OBVA 4H3KA 5HHGE 3KNDA 3WOYA 4RZPA 1M8ZA 4U5NA 4HNMA 3TJZB 3ZINA 4JW2A 3TT9A 3BTRC 5KUBA 3JXYA 4CRVB 3BSXA 5DN7A 2W3CA 4CB8A 2BKUB 1M8XA 1TH1A 1QBKB 3GB8A 4I1EA 2H4MA 5CL7A 4FZFA 3K61A 4NEEA 3UKZB 5BZ1A 4JW2B 3ZIQA 3FEXC 2PKGA 1O6PA 1LUJA 4I2ZA 1B3UA 5BZUA 4U58A 4OIHA 1JPPA 5BYMA 3QGCA 1U6GC 3K49A 3GVOA 3ND2A 3Q0LA 3BVSA 4K92A 4U5VA 1IQ1C 1I7WA 2JAKA 4FP7A 1QGRA 3TPOA 1EE4A 2NYLA 2IX3A 5CLEA 3V71A 3NMXA 2IAEA 3NMZA 5LSWA 3JY1A 3T7UA 3WOZA 1EJYI 4NZWA 3OPBA 4U3JC 4CRUB 2NYLB 4I6IA 3ZHPA 5B56A 1WA5C 4MZ5E 3NOWA 5KLTB 4I96A 3TPMA 3O2QA 3Q0QA 2IAEB 1TE4A 3UKWB 4P6ZG 2PF4A 4MFUA 4RXHB 4B18A 5CTTA 4O27A 4DB8A 3UVUA 3BX3A 2C1MA 1Z2CB 3FGAA 3DADA 4RV1A 2X1GF 2Z5MA 4U5LA 4CBAA 1QGKA 3L3QA 3K5QA 3AU3A 5CL8A 1M8YA 3Q0MA 4YJEA 4R10A 4CT7B 2P8QA 4H3HA 4B8JA 3V6YA 4JW3C 3LTJA 4YI0C 3Q0PA 4I5LA 3SLAA 3FGAB 1OYZA 4V3RA 4D49A 5KLRB 3OQSA 4I7IA 4OO6A 4MZ6E 2YNSA 5CLCA 4D4EA 1IBRB 3UL1B 5HUWC 2C1TA 3V74A 1W63A 3K4EA 5HUYC 1Q1TC 4A3TA 1M1EA 4EVPA 4FQ3A 4PLQA 3O2TA 3VLEA 4BQKA 5J3VA 2DB0A 5SW9A 4DBAA 3IFQA 2Q5DA 2BCTA 3L3FX 4JKQA 3PSTA 4L4IA 4E4VA 3EA5B 4L7MA 5CL6A 2X19B 1W63B 1PJMB 5BZVA 1O6OA 3ODRA 1EJLI 3UKXB 1LRVA 2NYMA 3OUXA 2Z6HA 3QMLC 4PVZA 5KL1A 2Z5JA 1Y2AC 3VLDA 4HM9A 3OUWA 3TX7A 2RU4A 4DVGB 4UAFB 3K64A 2JKRA 4QMHA 4BA3A 3WYFC 2NYMB 1V18A 4JLQA 4IMIA 2F31A 2OF3A 4CV5B 2WTKA 2XA7A 2RU4B 5SVZA 2NPPA 5FC8E 4IMJA 4FZAA 1EE5A 2JKRB 4FFBC 2JKTA 3SL9A 2QK1A 3W3UA 1F59A 5CL5A 3RZ9A 1T08A 1JPWA 5EKFA 3C5WA 4I2WA 4YGXA 3Q0OA 4DB6A 4KZGA 3EG5B 3DW8A 5CL4A 2XA7B 3GVTA 3K5YA 2NPPB 3QG9A 5E6QB 2JKTB 1BK6A 5CL9A 5CL3A 4HXTA 2FV2A 3Q0NA 3BWTA 5D5KC 3BCTA 4B8PA 4V3QA 5H2XA 4TNMA 3O2SA 3NMWA 4I37A 5JJAA 3ZILA 4EVTA 3ZKVA 4U2XD 1UPLA 5K6SA 3VE6A 1JDHA 5BZ5A 5EKGA 5KLAA 1QZ7A 4HTVA 4EVAA 1W9CA 3L6YA 2VGLA 2QMRA 2IW3A 1XM9A 4A0CA 4UAEA 2YNRA 4DB9A 5EWPA 2YJYA 2OT8A 4L4HA 3QGBA 3L6XA 2JDQA 3ZIRA 3VWAA 1UN0A 4U5OA 1XQSA 5K9SA 4I3NA 4U5UA 3JXZA 1GCJA 2VGLB 3FEYC 5H2WA 4R11A 2GL7A 4I0YA 4K6JA 3LTMA 3WPTA 3Q5UA 5KL8A 4QMJA 3K62A 4Y5JA 4YJLA 4UQIA 1Q1SC 2BAPA 2Z6GA 1UPKA 1BK5A 4V3OA 3H3DX 4DJSA 4LACA 3UL0B 3TJ3A 2XOAA 3ODSA 2Z5NA 4I8MA 4EV9A 4I2SA 2BNXA 3K5ZA 4A3VA 4UQIB 1UKLA 3K7WA 2QK2A 5CLDA 3GRLA 4UWXA 4PLRA 3ZIKA 1HO8A 3O4XA 4MFVA 3VLFA 3PSPA 2IE3A 4PLSA 3Q0RA 4ADYA 5CLAA 3Q0SA 4FZDA 4G3AA 4GMNA 2Z5OA 3GQ2A 4R0ZA 4ZDUA 1G3JA 4I5NA 4XZRB 2IWHA 4DZSA 2QNAA 5AEIA 5CLBA 4U5SA 4UADA 4YK6A 1WA5B 4QMIA 3ZIPA 3C2GA 3GS3A 4GMOA 3A6PA 3ZIOA 3K7VA 3UKYB 1PJNB 1I7XA 5SWFA 1IB2A 1XQRA 3GAEA 2IE4A 3GNIA 4B8OA 4BPLA 3EBBA 4EV8A 3RZXA 1M8WA 3C2HA 3IBVA 4CT6B 4U54A 4FDDA 3LWWA 4CB9A 2Z5KA 1IALA 3JX7A 3BSBA 1M5NS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BX2 A;  4WV6 A;  3QHE A;  4P6Z B;  3OBV A;  4H3K A;  5HHG E;  3KND A;  3WOY A;  4RZP A;  1M8Z A;  4U5N A;  4HNM A;  3TJZ B;  3ZIN A;  3TT9 A;  3BTR C;  4CRV B;  3BSX A;  5DN7 A;  2W3C A;  4CB8 A;  2BKU B;  1M8X A;  1TH1 A;  1QBK B;  3GB8 A;  2H4M A;  4FZF A;  3K61 A;  4NEE A;  3UKZ B;  5BZ1 A;  4JW2 B;  3ZIQ A;  3FEX C;  2PKG A;  1O6P A;  1LUJ A;  4I2Z A;  1B3U A;  5BZU A;  4U58 A;  4OIH A;  1JPP A;  5BYM A;  3QGC A;  1U6G C;  3K49 A;  3GVO A;  3ND2 A;  3Q0L A;  4K92 A;  4U5V A;  1IQ1 C;  1I7W A;  2JAK A;  1QGR A;  3TPO A;  1EE4 A;  2NYL A;  2IX3 A;  3V71 A;  3NMX A;  2IAE A;  3NMZ A;  5LSW A;  3T7U A;  3WOZ A;  1EJY I;  4NZW A;  3OPB A;  4U3J C;  4CRU B;  2NYL B;  3ZHP A;  5B56 A;  1WA5 C;  4MZ5 E;  3NOW A;  5KLT B;  3TPM A;  3Q0Q A;  3O2Q A;  2IAE B;  3UKW B;  4P6Z G;  2PF4 A;  4MFU A;  4RXH B;  4B18 A;  5CTT A;  4O27 A;  4DB8 A;  3UVU A;  3BX3 A;  2C1M A;  1Z2C B;  3FGA A;  3DAD A;  4RV1 A;  2X1G F;  2Z5M A;  4U5L A;  4CBA A;  1QGK A;  3L3Q A;  3K5Q A;  3AU3 A;  1M8Y A;  3Q0M A;  4YJE A;  4R10 A;  4CT7 B;  2P8Q A;  4H3H A;  4B8J A;  3V6Y A;  3LTJ A;  4YI0 C;  3Q0P A;  4I5L A;  3FGA B;  1OYZ A;  4V3R A;  4D49 A;  5KLR B;  3OQS A;  4OO6 A;  4MZ6 E;  2YNS A;  4D4E A;  1IBR B;  3UL1 B;  5HUW C;  2C1T A;  3V74 A;  1W63 A;  3K4E A;  5HUY C;  1Q1T C;  1M1E A;  4EVP A;  4FQ3 A;  4PLQ A;  3O2T A;  4BQK A;  5J3V A;  2DB0 A;  5SW9 A;  4DBA A;  3IFQ A;  2Q5D A;  2BCT A;  3L3F X;  3PST A;  4E4V A;  3EA5 B;  4L7M A;  2X19 B;  1W63 B;  1PJM B;  5BZV A;  1O6O A;  3ODR A;  1EJL I;  3UKX B;  1LRV A;  2NYM A;  3OUX A;  2Z6H A;  3QML C;  4PVZ A;  5KL1 A;  2Z5J A;  1Y2A C;  4HM9 A;  3OUW A;  3TX7 A;  2RU4 A;  4DVG B;  4UAF B;  3K64 A;  2JKR A;  4QMH A;  4BA3 A;  3WYF C;  2NYM B;  1V18 A;  4JLQ A;  4IMI A;  2F31 A;  2OF3 A;  4CV5 B;  2WTK A;  2XA7 A;  2RU4 B;  5SVZ A;  2NPP A;  5FC8 E;  4IMJ A;  4FZA A;  1EE5 A;  2JKR B;  4FFB C;  2JKT A;  2QK1 A;  3W3U A;  1F59 A;  3RZ9 A;  1T08 A;  1JPW A;  5EKF A;  3C5W A;  4I2W A;  4YGX A;  3Q0O A;  4DB6 A;  4KZG A;  3EG5 B;  3DW8 A;  2XA7 B;  3GVT A;  3K5Y A;  2NPP B;  3QG9 A;  5E6Q B;  2JKT B;  1BK6 A;  4HXT A;  2FV2 A;  3Q0N A;  3BWT A;  5D5K C;  3BCT A;  4B8P A;  4V3Q A;  5H2X A;  4TNM A;  3O2S A;  3NMW A;  5JJA A;  4EVT A;  3ZKV A;  1UPL A;  5K6S A;  3VE6 A;  1JDH A;  5BZ5 A;  5EKG A;  5KLA A;  1QZ7 A;  4HTV A;  4EVA A;  1W9C A;  3L6Y A;  2VGL A;  2QMR A;  2IW3 A;  1XM9 A;  4A0C A;  4UAE A;  2YNR A;  4DB9 A;  5EWP A;  2YJY A;  2OT8 A;  3QGB A;  3L6X A;  2JDQ A;  3ZIR A;  3VWA A;  1UN0 A;  4U5O A;  1XQS A;  5K9S A;  4U5U A;  1GCJ A;  2VGL B;  3FEY C;  5H2W A;  4R11 A;  2GL7 A;  4K6J A;  3LTM A;  3WPT A;  3Q5U A;  5KL8 A;  4QMJ A;  3K62 A;  4Y5J A;  4YJL A;  4UQI A;  1Q1S C;  2BAP A;  2Z6G A;  1UPK A;  1BK5 A;  4V3O A;  3H3D X;  4DJS A;  4LAC A;  3UL0 B;  3TJ3 A;  3ODS A;  2Z5N A;  4EV9 A;  2BNX A;  3K5Z A;  4UQI B;  1UKL A;  3K7W A;  2QK2 A;  3GRL A;  4UWX A;  4PLR A;  1HO8 A;  3O4X A;  4MFV A;  3PSP A;  2IE3 A;  4PLS A;  3Q0R A;  4ADY A;  3Q0S A;  4FZD A;  4G3A A;  4GMN A;  2Z5O A;  3GQ2 A;  4R0Z A;  4ZDU A;  1G3J A;  4I5N A;  4XZR B;  2IWH A;  4DZS A;  2QNA A;  5AEI A;  4U5S A;  4UAD A;  4YK6 A;  1WA5 B;  4QMI A;  3ZIP A;  3C2G A;  3GS3 A;  4GMO A;  3A6P A;  3ZIO A;  3K7V A;  3UKY B;  1PJN B;  1I7X A;  5SWF A;  1IB2 A;  1XQR A;  3GAE A;  2IE4 A;  3GNI A;  4B8O A;  4BPL A;  3EBB A;  4EV8 A;  3RZX A;  1M8W A;  3C2H A;  3IBV A;  4CT6 B;  4U54 A;  4FDD A;  3LWW A;  4CB9 A;  2Z5K A;  1IAL A;  3BSB A;  1M5N S; 
#chains in the Genus database with same CATH topology
 3BX2 A;  4WV6 A;  3QHE A;  4P6Z B;  3OBV A;  4H3K A;  5HHG E;  3KND A;  3WOY A;  4RZP A;  1M8Z A;  4U5N A;  4HNM A;  3TJZ B;  3ZIN A;  4JW2 A;  3TT9 A;  3BTR C;  5KUB A;  3JXY A;  4CRV B;  3BSX A;  5DN7 A;  2W3C A;  4CB8 A;  2BKU B;  1M8X A;  1TH1 A;  1QBK B;  3GB8 A;  4I1E A;  2H4M A;  5CL7 A;  4FZF A;  3K61 A;  4NEE A;  3UKZ B;  5BZ1 A;  4JW2 B;  3ZIQ A;  3FEX C;  3UJ4 A;  2PKG A;  1O6P A;  1LUJ A;  4I2Z A;  1B3U A;  5BZU A;  4U58 A;  4OIH A;  1JPP A;  5BYM A;  3QGC A;  1U6G C;  3K49 A;  3GVO A;  3ND2 A;  3Q0L A;  3BVS A;  4K92 A;  4U5V A;  1IQ1 C;  1I7W A;  2JAK A;  4FP7 A;  1QGR A;  3TPO A;  1EE4 A;  2NYL A;  2IX3 A;  5CLE A;  3V71 A;  3NMX A;  2IAE A;  3NMZ A;  5LSW A;  3JY1 A;  3T7U A;  1EJY I;  4NZW A;  3WOZ A;  3OPB A;  4U3J C;  4CRU B;  2NYL B;  4I6I A;  3ZHP A;  5B56 A;  1WA5 C;  4MZ5 E;  3NOW A;  5KLT B;  4I96 A;  3TPM A;  3O2Q A;  3Q0Q A;  2IAE B;  1TE4 A;  3UKW B;  4P6Z G;  2PF4 A;  4MFU A;  4RXH B;  4B18 A;  5CTT A;  3T8S A;  4O27 A;  4DB8 A;  3UVU A;  3BX3 A;  2C1M A;  1Z2C B;  3FGA A;  3DAD A;  4RV1 A;  2X1G F;  2Z5M A;  4U5L A;  4CBA A;  1QGK A;  3L3Q A;  3K5Q A;  3AU3 A;  5CL8 A;  1M8Y A;  3Q0M A;  4YJE A;  4R10 A;  4CT7 B;  2P8Q A;  4H3H A;  4B8J A;  3V6Y A;  4JW3 C;  3LTJ A;  4YI0 C;  3Q0P A;  4I5L A;  3SLA A;  3FGA B;  1OYZ A;  4V3R A;  4D49 A;  5KLR B;  3OQS A;  4I7I A;  4OO6 A;  4MZ6 E;  2YNS A;  5CLC A;  4D4E A;  1IBR B;  3UL1 B;  5HUW C;  2C1T A;  3V74 A;  1W63 A;  3K4E A;  5HUY C;  1Q1T C;  4A3T A;  1M1E A;  4EVP A;  4FQ3 A;  4PLQ A;  3O2T A;  3VLE A;  4BQK A;  5J3V A;  2DB0 A;  5SW9 A;  4DBA A;  3IFQ A;  2Q5D A;  2BCT A;  3L3F X;  4JKQ A;  3PST A;  4L4I A;  4E4V A;  3EA5 B;  4L7M A;  5CL6 A;  2X19 B;  1W63 B;  1PJM B;  5BZV A;  1O6O A;  3ODR A;  1EJL I;  3UKX B;  1LRV A;  2NYM A;  3OUX A;  2Z6H A;  3QML C;  4PVZ A;  5KL1 A;  2Z5J A;  1Y2A C;  3VLD A;  4HM9 A;  3OUW A;  3TX7 A;  2RU4 A;  4DVG B;  4UAF B;  3K64 A;  2JKR A;  4QMH A;  4BA3 A;  3WYF C;  2NYM B;  1V18 A;  4JLQ A;  4IMI A;  2F31 A;  2OF3 A;  4CV5 B;  2WTK A;  2XA7 A;  2RU4 B;  5SVZ A;  2NPP A;  5FC8 E;  4IMJ A;  4FZA A;  1EE5 A;  2JKR B;  4FFB C;  2JKT A;  3SL9 A;  1LSH A;  2QK1 A;  3W3U A;  1F59 A;  5CL5 A;  3RZ9 A;  1T08 A;  1JPW A;  5EKF A;  3C5W A;  4I2W A;  4YGX A;  3Q0O A;  4DB6 A;  4KZG A;  3EG5 B;  3DW8 A;  5CL4 A;  2XA7 B;  3GVT A;  3K5Y A;  2NPP B;  3QG9 A;  5E6Q B;  2JKT B;  1BK6 A;  5CL9 A;  5CL3 A;  4HXT A;  2FV2 A;  3Q0N A;  3BWT A;  5D5K C;  3BCT A;  4B8P A;  4V3Q A;  5H2X A;  4TNM A;  3O2S A;  3NMW A;  4I37 A;  5JJA A;  3ZIL A;  4EVT A;  3ZKV A;  4U2X D;  1UPL A;  5K6S A;  3VE6 A;  1JDH A;  5BZ5 A;  5EKG A;  5KLA A;  1QZ7 A;  4HTV A;  4EVA A;  1W9C A;  3L6Y A;  2VGL A;  2QMR A;  2IW3 A;  1XM9 A;  4A0C A;  4UAE A;  2YNR A;  4DB9 A;  5EWP A;  2YJY A;  2OT8 A;  4L4H A;  3QGB A;  3L6X A;  2JDQ A;  3ZIR A;  3VWA A;  1UN0 A;  4U5O A;  1XQS A;  5K9S A;  4I3N A;  4U5U A;  3JXZ A;  1GCJ A;  2VGL B;  3FEY C;  5H2W A;  4R11 A;  2GL7 A;  4I0Y A;  4K6J A;  3LTM A;  3WPT A;  3Q5U A;  5KL8 A;  4QMJ A;  3K62 A;  4Y5J A;  4YJL A;  1N4K A;  4UQI A;  1Q1S C;  2BAP A;  2Z6G A;  1UPK A;  1BK5 A;  4V3O A;  3H3D X;  4DJS A;  4LAC A;  3UL0 B;  3TJ3 A;  2XOA A;  3ODS A;  2Z5N A;  4I8M A;  4EV9 A;  4I2S A;  2BNX A;  3K5Z A;  4A3V A;  4UQI B;  1UKL A;  3K7W A;  2QK2 A;  5CLD A;  3GRL A;  4UWX A;  4PLR A;  3ZIK A;  1HO8 A;  3O4X A;  4MFV A;  3VLF A;  3PSP A;  2IE3 A;  4PLS A;  3Q0R A;  4ADY A;  5CLA A;  3Q0S A;  4FZD A;  4G3A A;  4GMN A;  2Z5O A;  3GQ2 A;  4R0Z A;  4ZDU A;  1G3J A;  4I5N A;  4XZR B;  2IWH A;  4DZS A;  2QNA A;  5AEI A;  5CLB A;  4U5S A;  4UAD A;  3UJ0 A;  4YK6 A;  1WA5 B;  4QMI A;  3ZIP A;  3C2G A;  3GS3 A;  4GMO A;  3A6P A;  3ZIO A;  3K7V A;  3UKY B;  1PJN B;  1I7X A;  5SWF A;  1IB2 A;  1XQR A;  3GAE A;  2IE4 A;  3GNI A;  4B8O A;  4BPL A;  3EBB A;  4EV8 A;  3RZX A;  1M8W A;  3C2H A;  3IBV A;  4CT6 B;  4U54 A;  4FDD A;  3LWW A;  4CB9 A;  2Z5K A;  1IAL A;  3JX7 A;  3BSB A;  1M5N S; 
#chains in the Genus database with same CATH homology
 3BX2 A;  4WV6 A;  3QHE A;  4P6Z B;  3OBV A;  4H3K A;  5HHG E;  3KND A;  3WOY A;  4RZP A;  1M8Z A;  4U5N A;  4HNM A;  3TJZ B;  3ZIN A;  4JW2 A;  3TT9 A;  3BTR C;  5KUB A;  3JXY A;  4CRV B;  3BSX A;  5DN7 A;  2W3C A;  4CB8 A;  2BKU B;  1M8X A;  1TH1 A;  1QBK B;  3GB8 A;  4I1E A;  2H4M A;  5CL7 A;  4FZF A;  3K61 A;  4NEE A;  3UKZ B;  5BZ1 A;  4JW2 B;  3ZIQ A;  3FEX C;  2PKG A;  1O6P A;  1LUJ A;  4I2Z A;  1B3U A;  5BZU A;  4U58 A;  4OIH A;  1JPP A;  5BYM A;  3QGC A;  1U6G C;  3K49 A;  3GVO A;  3ND2 A;  3Q0L A;  3BVS A;  4K92 A;  4U5V A;  1IQ1 C;  1I7W A;  2JAK A;  4FP7 A;  1QGR A;  3TPO A;  1EE4 A;  2NYL A;  2IX3 A;  5CLE A;  3V71 A;  3NMX A;  2IAE A;  3NMZ A;  5LSW A;  3JY1 A;  3T7U A;  3WOZ A;  1EJY I;  4NZW A;  3OPB A;  4U3J C;  4CRU B;  2NYL B;  4I6I A;  3ZHP A;  5B56 A;  1WA5 C;  4MZ5 E;  3NOW A;  5KLT B;  4I96 A;  3TPM A;  3O2Q A;  3Q0Q A;  2IAE B;  1TE4 A;  3UKW B;  4P6Z G;  2PF4 A;  4MFU A;  4RXH B;  4B18 A;  5CTT A;  4O27 A;  4DB8 A;  3UVU A;  3BX3 A;  2C1M A;  1Z2C B;  3FGA A;  3DAD A;  4RV1 A;  2X1G F;  2Z5M A;  4U5L A;  4CBA A;  1QGK A;  3L3Q A;  3K5Q A;  3AU3 A;  5CL8 A;  1M8Y A;  3Q0M A;  4YJE A;  4R10 A;  4CT7 B;  2P8Q A;  4H3H A;  4B8J A;  3V6Y A;  4JW3 C;  3LTJ A;  4YI0 C;  3Q0P A;  4I5L A;  3SLA A;  3FGA B;  1OYZ A;  4V3R A;  4D49 A;  5KLR B;  3OQS A;  4I7I A;  4OO6 A;  4MZ6 E;  2YNS A;  5CLC A;  4D4E A;  1IBR B;  3UL1 B;  5HUW C;  2C1T A;  3V74 A;  1W63 A;  3K4E A;  5HUY C;  1Q1T C;  4A3T A;  1M1E A;  4EVP A;  4FQ3 A;  4PLQ A;  3O2T A;  3VLE A;  4BQK A;  5J3V A;  2DB0 A;  5SW9 A;  4DBA A;  3IFQ A;  2Q5D A;  2BCT A;  3L3F X;  4JKQ A;  3PST A;  4L4I A;  4E4V A;  3EA5 B;  4L7M A;  5CL6 A;  2X19 B;  1W63 B;  1PJM B;  5BZV A;  1O6O A;  3ODR A;  1EJL I;  3UKX B;  1LRV A;  2NYM A;  3OUX A;  2Z6H A;  3QML C;  4PVZ A;  5KL1 A;  2Z5J A;  1Y2A C;  3VLD A;  4HM9 A;  3OUW A;  3TX7 A;  2RU4 A;  4DVG B;  4UAF B;  3K64 A;  2JKR A;  4QMH A;  4BA3 A;  3WYF C;  2NYM B;  1V18 A;  4JLQ A;  4IMI A;  2F31 A;  2OF3 A;  4CV5 B;  2WTK A;  2XA7 A;  2RU4 B;  5SVZ A;  2NPP A;  5FC8 E;  4IMJ A;  4FZA A;  1EE5 A;  2JKR B;  4FFB C;  2JKT A;  3SL9 A;  2QK1 A;  3W3U A;  1F59 A;  5CL5 A;  3RZ9 A;  1T08 A;  1JPW A;  5EKF A;  3C5W A;  4I2W A;  4YGX A;  3Q0O A;  4DB6 A;  4KZG A;  3EG5 B;  3DW8 A;  5CL4 A;  2XA7 B;  3GVT A;  3K5Y A;  2NPP B;  3QG9 A;  5E6Q B;  2JKT B;  1BK6 A;  5CL9 A;  5CL3 A;  4HXT A;  2FV2 A;  3Q0N A;  3BWT A;  5D5K C;  3BCT A;  4B8P A;  4V3Q A;  5H2X A;  4TNM A;  3O2S A;  3NMW A;  4I37 A;  5JJA A;  3ZIL A;  4EVT A;  3ZKV A;  4U2X D;  1UPL A;  5K6S A;  3VE6 A;  1JDH A;  5BZ5 A;  5EKG A;  5KLA A;  1QZ7 A;  4HTV A;  4EVA A;  1W9C A;  3L6Y A;  2VGL A;  2QMR A;  2IW3 A;  1XM9 A;  4A0C A;  4UAE A;  2YNR A;  4DB9 A;  5EWP A;  2YJY A;  2OT8 A;  4L4H A;  3QGB A;  3L6X A;  2JDQ A;  3ZIR A;  3VWA A;  1UN0 A;  4U5O A;  1XQS A;  5K9S A;  4I3N A;  4U5U A;  3JXZ A;  1GCJ A;  2VGL B;  3FEY C;  5H2W A;  4R11 A;  2GL7 A;  4I0Y A;  4K6J A;  3LTM A;  3WPT A;  3Q5U A;  5KL8 A;  4QMJ A;  3K62 A;  4Y5J A;  4YJL A;  4UQI A;  1Q1S C;  2BAP A;  2Z6G A;  1UPK A;  1BK5 A;  4V3O A;  3H3D X;  4DJS A;  4LAC A;  3UL0 B;  3TJ3 A;  2XOA A;  3ODS A;  2Z5N A;  4I8M A;  4EV9 A;  4I2S A;  2BNX A;  3K5Z A;  4A3V A;  4UQI B;  1UKL A;  3K7W A;  2QK2 A;  5CLD A;  3GRL A;  4UWX A;  4PLR A;  3ZIK A;  1HO8 A;  3O4X A;  4MFV A;  3VLF A;  3PSP A;  2IE3 A;  4PLS A;  3Q0R A;  4ADY A;  5CLA A;  3Q0S A;  4FZD A;  4G3A A;  4GMN A;  2Z5O A;  3GQ2 A;  4R0Z A;  4ZDU A;  1G3J A;  4I5N A;  4XZR B;  2IWH A;  4DZS A;  2QNA A;  5AEI A;  5CLB A;  4U5S A;  4UAD A;  4YK6 A;  1WA5 B;  4QMI A;  3ZIP A;  3C2G A;  3GS3 A;  4GMO A;  3A6P A;  3ZIO A;  3K7V A;  3UKY B;  1PJN B;  1I7X A;  5SWF A;  1IB2 A;  1XQR A;  3GAE A;  2IE4 A;  3GNI A;  4B8O A;  4BPL A;  3EBB A;  4EV8 A;  3RZX A;  1M8W A;  3C2H A;  3IBV A;  4CT6 B;  4U54 A;  4FDD A;  3LWW A;  4CB9 A;  2Z5K A;  1IAL A;  3JX7 A;  3BSB A;  1M5N S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...