4PW8A

Human tryptophan 2,3-dioxygenase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
342
structure length
306
Chain Sequence
IYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSRYKVFVDLFNLSTYLIPRHWIPKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of human tryptophan 2,3-dioxygenase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
total genus 122
structure length 306
sequence length 342
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pw8A01
4HKAA 2V7KA 4U72A 1ZEEA 5EK4A 5ETWA 4PK6A 2V7JA 5EK2A 2V7LA 1YW0A 3E08A 2X67A 2D0TA 2NW7A 2X66A 2V7MA 2NOXA 2D0UA 4PW8A 4U74A 2X68A 2V7IA 2NWBA 5EK3A 2NW8A 3BK9A 4PK5A 2NW9A
chains in the Genus database with same CATH superfamily
3CQCB 3CVRA 3I0OA 3A7MA 3P4WA 1M62A 4AXPA 2JRKA 2V8SV 3OKQA 3DJBA 1I94T 5DQWA 5M4YA 3AEAA 3F57A 4L5GA 3R6NA 2I59A 5J0ZA 1D0XA 5JR9C 2QGSA 4OHFA 3PDYA 4OX9T 1NWMX 2OV9A 3HKBE 3PU3A 3HKEE 3PUYF 4ZZCA 5C2TA 2LT3A 3HA4A 5KMGP 2Y6XA 1W09A 1QSDA 2LM2A 5LHIB 2NW7A 4O4HE 4KX6A 3SOLA 2DWKA 1R8IA 4UEMA 2D2SA 3UT5E 5KXJA 3AA7B 3AE1A 2W0GA 4F6RC 2E9XB 2Z6EA 5FXWA 4YSZA 4DR2T 2LOSA 4O2AE 3P4SA 4KBMB 4X5TA 1LVFA 1D0YA 2ODUA 4YT0A 2VL0A 2YU2A 2V6YA 1BR1A 3NBXX 2CXFA 3WAJA 1HNXT 4JI0T 3AA6B 3EHZA 4CI3B 4LFCT 2YN6A 4H9SE 1HX1B 4ZS3A 3UU4A 2PTFA 3SWHA 3EVYA 3AEGA 2X0LB 4B3ST 5DQVA 1G8XA 4NUUA 5BR8T 3IHRA 2BVLA 4U72A 2E9XC 4U31A 2V5CA 1ZHCA 5JDMA 2M6IA 2ACZA 3RRWA 3TLSA 2J62A 5HXEA 2I0MA 4WYVA 5EZYE 4AQYT 4QH1A 1ZV4X 2WAUA 3AEBA 1HFAA 2H7VC 3AE9A 3FZKB 3IF8B 3A5XA 3K3OA 3LDQB 3ONLC 3P4PA 4AKRB 2HH7A 3O1JA 3MJXA 1LVKA 2CXLA 4U74A 2W61A 3N2OA 4L9IA 3VKHA 2WB5A 2JMKA 3FHNA 1L0VA 4IIJE 4TNVA 2N9DA 1YKEB 1VRBA 5FVLA 3ZYLA 5L4EA 1BR0A 4BJNA 5AQGB 2BVMA 3N2KE 4O2BE 4QWNB 4C91A 4EZHA 5IUXA 5AQMB 3UQ7A 5AQQB 1N32T 1S94A 2JJ9A 4HE8A 4HFDA 4IHJE 3M3ZB 2FJBA 1LRZA 3RX6A 5JDQA 2VKJA 2WMNA 2WBLA 2JQQA 2FJAA 5EK4A 1FMWA 5HCJA 5HCMA 2G0UA 5FNVE 2BG9E 3VU7H 4TWHA 1YKHB 2OLTA 3LJCA 3UULA 1HX8A 4JYAT 3I9YA 2QVAA 3GN5A 5AQRB 4KI0F 2ZMAA 5AQTB 3LK3B 2CEAA 4MHCA 3ZC1A 3C98B 4B6XA 4DMVA 5LOVE 2IDOB 3LG7A 2JQ9A 3KINB 3UUNA 4AQGA 4DBRA 5IWAT 4K0KT 5AQLB 2MAWA 2L8KA 3PUWF 4DNDA 4COFA 2WZIA 3CWZB 5FKYA 2UXCT 3UUBA 5DJQC 4GKKT 2BZBA 4PK5A 3ZMTB 4KP3C 2YK0A 2WDVA 3LSVA 2WQYA 1HR0T 4IGUA 3H3MA 3RC3A 2PFVA 3PUAA 5EK2A 3UU8A 2WZHA 2V7LA 3ZKRA 2LEHA 2W62A 2GK9A 3GA8A 2CE7A 2BDEA 2E9XD 4YJ3E 5JREA 3TLWA 3PUZF 2D0TA 4HWCA 4HFEA 5LCYA 3OYZA 3RHWA 3TKLB 4DVDA 2ODVA 1OXZA 2X9WA 5HXSA 4MBQA 4DR6T 2Q9QA 4Q25A 5LNKA 1YXRA 2ACXA 2CRBA 3A8YC 3QUJA 4X20E 4DV1T 5JR9A 4QH4A 3VRBA 2NWBA 2D9DA 1CUNA 1HF8A 4OFZA 2YU1A 4OK0A 1UURA 4PNIA 2FBWA 2YEVC 2UXXB 4I43B 2NW8A 5C3JA 3Q5WA 2XQ8A 4EB6E 5ABGA 1MMGA 3PU8A 1FIOA 5H6QB 4B3MT 3PV0F 1HNZT 4FJOA 2BG9B 3L09A 5KX5E 2LRLA 4JI4T 3PUXF 2UXBT 1N36T 2QYWA 3EUHA 2CLYC 4HFVA 2XSBA 1BR2A 2W63A 2H7OA 4JI8T 4DV3T 3O9XA 4IDZA 3EDUA 5L3EB 2K5BB 4DR5T 4AKIA 1HNWT 5GONE 3Q5XA 3ZN0B 4LF4T 3ZMZB 4G63A 3VR9A 1N34T 4O4IE 2E2AA 4OYJA 3EDVA 4GYSA 2DL1A 2MBGA 3JAEA 3C4WA 3GWHA 2VURA 2QRXA 4QXCB 4H9PC 2JPFA 1KK7A 2IAKA 2WDQA 4DR4T 4EEDA 4JEHB 4EV6A 3RC8A 4KHPT 2CBJA 2PG8A 4PJJA 2NW9A 2M6BA 4DV4T 4TX5A 1OEDA 3P7IA 4P09A 1SUMB 4X1IE 5HAXA 5F3JA 3WAKA 2CLYB 2B1EA 4ANJA 3FZFB 5ETWA 3CMLA 3PUSA 3PUQA 1MMDA 4ISTA 4ZZBA 4ZS2A 2K24A 1UX4A 3MK7C 3O4XE 4J2CA 4DBQA 4AIUA 3E08A 2X67A 5KDMC 1X79A 3O1HA 2YDSA 1NAFA 1KEYA 2LKHA 2W2UA 2VKHA 3AAAB 3K3NA 3MZKB 3Q2MA 4YHJA 3L3PA 3MA9A 3NRXA 2ZM2A 3MXZA 5JDFA 5LBMA 2X0HA 5AQVB 3RQWA 5JVDE 4LFBT 5HWXA 1BR4A 1E2AA 3LFMA 2KT9A 3KV9A 2WM9A 3KV5A 3O1IA 4BJMA 5L3DB 4B3RT 4TV8E 3VR8A 3UFEA 2Y48B 2V26A 1UCUA 1UGOA 1ZOYA 3RI5A 3N9MA 5FXXA 1JNRA 3OYXA 2WWUA 3CK6A 3RKGA 2A2FX 2RP4A 3AXJB 4I0UA 4GYRA 1XNQT 3QB5A 3Q5DA 4EYUA 4YSYA 2A72A 2IHR1 3E22E 4QX7B 4UV9B 1MNDA 2BG9C 3QOFA 2BBJA 5FXZA 4LF7T 3ZMVB 3PUGA 3ZSTA 3CIRA 4JI2T 4IDOA 5HEOA 3AB3B 2WU5A 3AA1B 3JADA 4V1Av 3UUXB 4LF9T 3AVRA 4JV5T 3RYIE 5ABEA 2IUBA 4DO0A 4NXMT 2VWAA 2XZEA 2YDQA 3K1SA 3SRZA 2V6YB 5HEJA 5J2UE 4YSXA 5JDHA 4GK5E 3IEEA 3ESLA 4LMLA 4WBNE 3HL6A 1OWAA 2B76A 4H9OC 4XAXB 5L3BB 1XMQT 3KVAA 3ONJA 4MFRA 5L3FB 2M67A 4KUMB 3ZJ1A 1IAPA 4U2YA 4X66T 2ES0A 3HKCE 3KV6A 3ONXA 2JQHA 2H88A 5E0OA 3TLVA 1Z8UA 2K3WA 2XQ7A 2KNDA 2XTLA 2KWIB 3ZMSB 2SPCA 2PBIA 4UIGA 2LOPA 3IBPA 1N33T 2UXNB 3UTKA 4L0RA 1YD8G 2HN2A 2KMFA 3T1YT 4IE0A 2UUBT 5CFBA 3B13A 4UVBB 4ZHQE 3HR0A 5FL1A 1HS7A 2L3LA 2XQ9A 5FYMA 4BAYB 1YW0A 3B5MA 2CCQA 2LKGA 2PJQA 2WSSV 3OPCA 3UQ4A 4AQFA 4ASKA 3ZYKA 4IREA 4GIWA 1DU2A 4PFOA 2BS4A 4UELA 2NOXA 4ZI7E 3VRAA 4JI1T 1XDPA 3AE4A 1AJ3A 2VB6A 4EGWA 1EZ3A 3I1AA 3Q5EA 1J5ET 5AQNB 2X68A 1V9DA 4EAHA 3ANWB 4CXXA 2EHOB 3AVSA 3CQGB 3JCFA 4P1NA 2LSYA 2ZM8A 1E1HB 4ISSA 3X1DA 4X65T 1WCRA 2C5JA 2XQYA 4FI5A 2KXPB 4DV0T 3FZMB 3C64A 2CBIA 3FZLB 4ERRA 3JC6D 4CQIA 2LSKA 4Z8XA 4YJ2E 4LMJA 4F8HA 2NTYA 5JTGA 2D5UA 2FUPA 2XQAA 3PJAA 2QA7A 1JNZA 2BBHA 2EHOD 2WDRA 4PFPA 4YLHA 1GQEA 2X9XA 3M65A 3PUVF 5ABHA 2HPJA 5AQFB 2BKNA 3RIAA 4X64T 2RA1A 2HN1A 5FL0A 3U3IA 5JDLA 5JDNA 5HEGA 1MIWA 3RH3A 5LP6E 4PK4A 4Z91A 4X1YE 3AE2A 4H9RC 2IC6A 4ILUA 1MIVA 4IDPA 4QX8B 5JRCB 5LB7B 1FEWA 2KZ7B 5AQSB 4UF0A 4U7YA 3ZMUB 4GKJT 5JDGA 4IE4A 4ILAA 5HEUA 1MMNA 1T98A 3KVBA 4HFBA 4WBOA 5IHYA 3AE3A 3T8OA 3FXEB 5AFUL 5J2TE 1NENA 5L4HA 1FMVA 4ZI2D 1UUSA 2YKSA 4KMCA 3ZJ2A 5HWYA 2DNXA 3RLFF 2LHNA 2X9YA 5FY1A 3CX6B 1YQ3A 5ABFA 3RPUA 4DR7T 2A9UA 3B57A 3J9X1 4K0UA 5CA1E 1WRDA 4LF6T 2J47A 3HKDE 3RIUA 4CN4A 4PK6A 5F8PA 3WI3A 4YY3T 5LGTB 1W0BA 2UUAT 4MALA 2E5LT 3N5LA 3R84B 3TLUA 4JI7T 2IW5B 4B3TT 3C4XA 1XWMA 4I4TE 1KNZA 2CWYA 1US7B 4U2ZA 5JR9B 3SFDA 4DR3T 4NXNT 3KBUA 4P0AA 4H63H 5LMNT 3NVOA 1WYBA 2WS3A 2VVSA 3ANWA 3N9NA 2NTXA 5LG3A 2W4XA 2X51A 3RKOA 2XSAA 2XUEA 5LA6E 4ILCA 1OEDC 5AQOB 4DIDB 2A3DA 1UX5A 2E8IA 1G73A 2VASA 1U4QA 2VKOA 3AAIA 3FBZA 2KWHA 4OYKA 3P4RA 2XAJB 3N2GE 3EI0A 2MPKA 2LHRA 2WMOA 2E9XA 3ZCJA 2I6HA 3UFGA 1SA0E 5AQUB 2N2NA 3PTRB 3PURA 2JMHA 4IL4A 4TWDA 1B7TA 2XAFB 2V7JA 3KDSE 1T72A 3NRYA 4UVAB 5J1GA 4EOZB 3HI2A 4AKHA 4CN1A 1OEDB 5TAOA 5LHGB 3BQLA 2UU9T 3AECA 4IDQA 2OA5A 4TUYE 4XZCA 3ZSSA 4WZXA 3AA0B 3LBXA 1SHZC 1VCSA 2XJ7A 4UXNB 1WLXA 2L9QA 4IE6A 2V5DA 4UF0B 3OVUA 4PJMA 3U78A 3VHLA 5AQIB 5L3GB 4JI6T 4G2AA 4HN9A 4HWIB 3FB2A 2BS2A 5FY0A 4YXDA 5JH7E 1WR6A 2CMRA 4E7ZA 3RYCE 3C50A 1ZKEA 3F31A 2CWOA 1HG5A 1D1BA 4AQFC 1QLBA 2WU2A 2VKDA 4H9NC 4ILBA 5IYZE 4EYYR 4XBFB 3FZHB 2RPAA 2XM2A 4IL9A 2CHOA 1J1JA 2BG9A 1UK5A 2LE8A 4IE5A 4C90A 5L47A 3GMIA 4DV5T 2K48A 2YDRA 2LM9A 1M7KA 2XPKA 4O4JE 3AE6A 4QKNA 4A98A 4ZOLE 3RIFA 3ZCIA 4AI6A 1WYCA 3CX8B 4A56A 2FJDA 4LMKA 1IJ5A 3GN5B 4IT4A 4UV8B 5L3CB 2UUCT 2XQ3A 4PJNA 3JAFA 3KFWX 4EIWA 5LGUB 2AE9A 3D0TA 3MKDA 2J4GA 3V5UA 5JRCA 4JLEA 4WNKA 1HCIA 1IBKT 2IMLA 2LJLA 2W67A 3E0ZA 3QNUA 1Y01A 5BMVE 1MMAA 2YOEA 5LGNB 3C51A 2C5IT 2C5KT 5LMUT 4JBWF 4X1KE 2EHOC 3TLTA 4BA9A 5HXCA 4PAGA 5ADXL 1KFYA 3CPZA 4EEBA 1ZP0A 1J5WA 2MYSA 4HEAA 3RGLA 2V7KA 4AISA 4KHZF 4E7SA 2H89A 2LSGA 5LHHB 1OEDE 2NR4A 4QH5A 1ZEEA 3LBXB 5FP3A 2CA5A 5CB4E 3IA3A 1O3XA 2BKOA 2VVNA 2X0YA 3LK2B 4ZEYA 3SFEA 1XZYA 1HTJF 2BS3A 3NKZA 3NWIA 4I55E 5AQPB 2AXDS 4LF5T 4LFAT 3AE8A 4TZ4C 4U7IA 4LF8T 5LJMA 4ZI2C 5AQJB 2DLRA 5C8YE 2HPLA 2X66A 4EZ4A 4M1PA 3UUMA 1LKXA 1D1AA 3Q9DA 4PJLA 4ZXLA 1KNRA 3W15B 1MIYA 2Q9QB 3L39A 4HFIA 2C0SA 4PW8A 4TNWA 1XMOT 3PE0A 2VQFT 4IE7A 2Y8DA 4P0BA 4QHOA 5HXHA 4HWFA 3SS1A 3P8CD 1W0AA 1U5PA 3ZN1B 3MACA 5FVKA 3ETVA 1CHUA 5LXTE 3J7Yq 1XNRT 2XAGB 3N9QA 4HFHA 2ZLYA 2ZM0A 4QXHB 3JC6C 1H7CA 4A5XA 2XY8B 5A1LA 4NUVA 2BKPA 5F5WA 4YTMA 2Q9QC 3BQIA 4HFCA 3NZPA 3V5SA 2V1DB 3DP7A 2N1GA 3ABVA 4ZI3C 4NPPA 1KF6A 2W66A 4YTNA 5AQHB 3K8PC 2DWGA 3PJAJ 3I0QA 2JQKA 1FJGT 2XAHB 4Z90A 5FMNA 4TV9E 4U33A 4DUYT 1T7SA 5FY7A 4CXYA 4U3CA 3P4QA 4ADZA 4CI2B 4CXWA 3ZYMA 2KLQA 3ZEFB 1MNEA 2XAQB 3ZT6A 3ETUA 2VK9A 5LJNA 1D0ZA 3N9LA 2V6XA 3KV4A 2W00A 4GK0E 2LRKA 3P50A 3UU3A 2FJEA 4HWDA 3RYFE 4DMWA 2H3RA 2XHEB 1SE7A 4DV6T 4CI1B 3BQKA 1Y64B 4TN7B 2LLYA 2X9HA 1I6ZA 3AEEA 4I50E 5H6RB 5CJ5A 2CPTA 2CXDA 2NP9A 3AE5A 3CQXC 3DTOA 3AE7A 3EABA 3OJAA 4HGAA 4HKAA 4JUYA 1Z0PA 4MLKA 4WW0A 4DV2T 4DR1T 3NZQA 3UU6A 1IZNB 2KINB 2E5VA 2WY2A 4YFSA 3ZLIA 3ZT7A 4EXTA 2MOZA 3OTOT 3AEFA 4O4LE 3OBVE 3S4UA 4DV7T 4CZZB 2DI4A 3VKGA 1XDOA 2EHOA 2YINA 1WR0A 4N78D 5HYAA 1NEKA 4UVCB 5LBQB 3AEDA 1HG2A 2V7MA 2K9AA 5DABA 2CHNA 5FXVA 5HXRA 2WWVA 2VL8A 2XQ4A 4X62T 3L8RA 3FXDB 3H37A 1T8BA 2VQET 2UXDT 5AQKB 4IDNA 4CN6A 2HHHT 4DUZT 1D1CA 2V7IA 1VOMA 2DHRA 3QB5K 2JIWA 3F2EA 3CX7B 5ABFB 3RYHE 3FBLA 1QUUA 3LK42 4QXBB 3QK6A 2MTQA 4UR9A 3AXJA 1WFDA 2XM1A 2F4VT 4AKGA 3C4ZA 3KBTA 3N9OA 4JI5T 3ZT5A 3T1HT 2IIUA 1VCTA 1S35A 3RF1A 4O8SA 2WP9A 3N9PA 3QC9A 4TWFA 5L2LA 5CGMA 1E7PA 1IBLT 2WCAA 3AAEB 5HEHA 2XQ5A 4YHHT 3UU5A 4YTPA 4HWHA 5LYJE 4AKLA 2XASB 4HTEA 4JEUB 2Q9QD 2J1DG 3EAMA 1W9RA 3G06A 2XQ6A 3RRCA 4H9QC 5LG4A 3CKDA 2ZM6T 1IBMT 3RIUC 3ZC0A 2LSJA 2D0UA 3H3AA 4GOUA 1KNPA 3K3QC 2KSRA 3ZPOA 4A97A 5CA0E 2P9BA 4NIQA 4JI3T 4ZI3D 2R6GF 5EK3A 3RQUA 2DCFA 1YQ4A 3BK9A 5JQGE 2CM0A 2IC9A 1IJ6A 2LSIA 4H63V 3I9WA 1X9BA
chains in the Genus database with same CATH topology
3CQCB 3CVRA 3I0OA 4AXPA 2JRKA 3OKQA 3DJBA 5DQWA 5M4YA 3R6NA 3F57A 4L5GA 2I59A 1D0XA 2QGSA 4OHFA 3PDYA 1NWMX 3HKBE 3PU3A 3HKEE 2LT3A 3HA4A 5KMGP 2Y6XA 1QSDA 5LHIB 2NW7A 4O4HE 3SOLA 2DWKA 4UEMA 2D2SA 3UT5E 3AA7B 2W0GA 4F6RC 2E9XB 2Z6EA 5FXWA 2LOSA 4O2AE 4KBMB 1LVFA 1D0YA 2ODUA 2YU2A 1BR1A 3NBXX 2CXFA 3WAJA 3AA6B 4CI3B 4H9SE 4ZS3A 3SWHA 3EVYA 2X0LB 5DQVA 1G8XA 4NUUA 3IHRA 2BVLA 4U72A 2E9XC 1ZHCA 5JDMA 3RRWA 5HXEA 5EZYE 1ZV4X 2WAUA 1HFAA 2H7VC 3IF8B 3A5XA 3K3OA 4AKRB 2HH7A 3O1JA 3MJXA 1LVKA 2CXLA 4U74A 2W61A 3N2OA 4L9IA 3VKHA 2JMKA 3FHNA 4IIJE 3ZYLA 2N9DA 1YKEB 1VRBA 1BR0A 4BJNA 2BVMA 3N2KE 4O2BE 4QWNB 4C91A 4EZHA 1S94A 2JJ9A 4HE8A 4IHJE 1LRZA 3RX6A 5JDQA 2VKJA 2WMNA 2WBLA 2JQQA 5EK4A 1FMWA 3VU7H 2G0UA 1YKHB 3LJCA 3UULA 1HX8A 3I9YA 3GN5A 2ZMAA 3LK3B 2CEAA 4MHCA 3ZC1A 3C98B 4B6XA 4DMVA 5LOVE 3LG7A 4AQGA 3KINB 3UUNA 4DBRA 2L8KA 4DNDA 3CWZB 5DJQC 2BZBA 4PK5A 3ZMTB 4KP3C 2YK0A 4IGUA 3RC3A 2PFVA 3PUAA 5EK2A 2V7LA 2LEHA 2W62A 2GK9A 3GA8A 2CE7A 2BDEA 2E9XD 4YJ3E 5JREA 2D0TA 5LCYA 3OYZA 3TKLB 4DVDA 2ODVA 1OXZA 2X9WA 5HXSA 4MBQA 2Q9QA 5LNKA 2ACXA 3QUJA 4X20E 5JR9A 5L3DB 2NWBA 1CUNA 1HF8A 4OFZA 2YU1A 4OK0A 4PNIA 4I43B 2YEVC 2UXXB 2NW8A 3Q5WA 4EB6E 1MMGA 3PU8A 1FIOA 5H6QB 4FJOA 3L09A 5KX5E 3EUHA 2CLYC 4HFVA 1BR2A 2W63A 2H7OA 3O9XA 4IDZA 3EDUA 5L3EB 2K5BB 4AKIA 3Q5XA 3ZN0B 3ZMZB 4G63A 4O4IE 4OYJA 3EDVA 4GYSA 2MBGA 3C4WA 3GWHA 4QXCB 4H9PC 2JPFA 1KK7A 2IAKA 4JEHB 3RC8A 4PJJA 2PG8A 2NW9A 4TX5A 3P7IA 4P09A 4X1IE 5HAXA 5F3JA 3WAKA 2CLYB 2B1EA 4ANJA 5ETWA 3CMLA 3PUSA 3PUQA 1MMDA 4ISTA 4ZS2A 2K24A 1UX4A 3MK7C 3O4XE 4J2CA 4DBQA 3E08A 2X67A 5KDMC 1X79A 3O1HA 1NAFA 3MZKB 3AAAB 3K3NA 2VKHA 3Q2MA 4YHJA 5FNVE 5LGNB 5LBMA 3L3PA 3MA9A 3NRXA 2ZM2A 3MXZA 5JDFA 5JVDE 5HWXA 1BR4A 3LFMA 4BJMA 2KT9A 3KV9A 2WM9A 3KV5A 3O1IA 4TV8E 3UFEA 2Y48B 2V26A 1UCUA 3N9MA 5FXXA 3OYXA 2WWUA 2A2FX 2RP4A 4GYRA 4EYUA 2A72A 3E22E 4QX7B 4UV9B 1MNDA 5FXZA 3ZMVB 3PUGA 3AB3B 3AA1B 4V1Av 3UUXB 3AVRA 3RYIE 4DO0A 2VWAA 3SRZA 5JDHA 4GK5E 3IEEA 3ESLA 4WBNE 3HL6A 1OWAA 4XAXB 4H9OC 5L3BB 3KVAA 4MFRA 5L3FB 2M67A 4KUMB 3ZJ1A 1IAPA 2ES0A 3HKCE 3KV6A 3ONXA 5E0OA 2KNDA 2XTLA 2KWIB 3ZMSB 2SPCA 2PBIA 4UIGA 2LOPA 3IBPA 2UXNB 3UTKA 4L0RA 1YD8G 2KMFA 4IE0A 3B13A 4UVBB 4ZHQE 3HR0A 1HS7A 2L3LA 5FYMA 4BAYB 1YW0A 2CCQA 2PJQA 2WSSV 4ASKA 4AQFA 3ZYKA 4GIWA 4PFOA 4UELA 2NOXA 4ZI7E 1AJ3A 2VB6A 1EZ3A 3I1AA 2X68A 1V9DA 4EAHA 3ANWB 4CXXA 2EHOB 3CQGB 3AVSA 2LSYA 2ZM8A 1E1HB 4ISSA 2C5JA 2XQYA 4FI5A 2KXPB 3C64A 4ERRA 3JC6D 4CQIA 2LSKA 4Z8XA 4YJ2E 2NTYA 2D5UA 2QA7A 2EHOD 4YLHA 4PFPA 3M65A 2X9XA 2HPJA 2RA1A 5JDNA 3U3IA 5JDLA 5LP6E 1MIWA 3RH3A 4PK4A 4X1YE 4H9RC 2IC6A 4ILUA 1MIVA 5JRCB 4QX8B 1FEWA 2KZ7B 4UF0A 3ZMUB 5JDGA 4IE4A 5IHYA 1MMNA 1T98A 3KVBA 4WBOA 3T8OA 3FXEB 5AFUL 5J2TE 1FMVA 4ZI2D 3ZJ2A 4KMCA 5HWYA 2DNXA 2LHNA 2X9YA 5FY1A 3CX6B 3RPUA 3B57A 3J9X1 4K0UA 5CA1E 1WRDA 3HKDE 4PK6A 5F8PA 3WI3A 5LGTB 4MALA 3N5LA 3R84B 1KNZA 2IW5B 3C4XA 4I4TE 2CWYA 1US7B 5JR9B 3KBUA 4P0AA 4H63H 1WYBA 3ANWA 3N9NA 2NTXA 2X51A 3RKOA 5LA6E 2XUEA 2A3DA 1UX5A 2E8IA 1G73A 2VASA 3FBZA 1U4QA 2VKOA 3AAIA 2KWHA 4OYKA 5J2UE 2XAJB 3N2GE 2WMOA 2LHRA 2E9XA 3ZCJA 1SA0E 2N2NA 3PTRB 3PURA 2JMHA 1B7TA 2XAFB 2V7JA 3KDSE 3NRYA 4UVAB 5J1GA 4AKHA 4EOZB 3HI2A 5TAOA 5LHGB 3BQLA 4TUYE 2OA5A 4XZCA 3AA0B 3LBXA 1SHZC 4UXNB 1WLXA 2L9QA 4IE6A 4UF0B 4PJMA 3VHLA 3U78A 5L3GB 4G2AA 4HN9A 3FB2A 5FY0A 5JH7E 1WR6A 2CMRA 4E7ZA 3RYCE 3C50A 1ZKEA 3F31A 2CWOA 1HG5A 1D1BA 4AQFC 2VKDA 4H9NC 5IYZE 4EYYR 4XBFB 2LE8A 4IE5A 4C90A 3GMIA 2K48A 2LM9A 4O4JE 4AI6A 4QKNA 4ZOLE 3ZCIA 1WYCA 3CX8B 4A56A 1IJ5A 3GN5B 4UV8B 5L3CB 4PJNA 3KFWX 4EIWA 5LGUB 3D0TA 3MKDA 3V5UA 5JRCA 4JLEA 4WNKA 1HCIA 2LJLA 5BMVE 3E0ZA 1MMAA 3C51A 2C5IT 2C5KT 4X1KE 2EHOC 4BA9A 5HXCA 4PAGA 5ADXL 3CPZA 2MYSA 4HEAA 2V7KA 4E7SA 2LSGA 5LHHB 1ZEEA 3LBXB 5FP3A 2CA5A 5CB4E 1O3XA 3LK2B 1HTJF 4I55E 4TZ4C 5LJMA 4ZI2C 2DLRA 5C8YE 2HPLA 2X66A 4EZ4A 4M1PA 3UUMA 1LKXA 1D1AA 3Q9DA 4PJLA 3W15B 1MIYA 2Q9QB 4PW8A 2C0SA 3PE0A 4IE7A 2Y8DA 4P0BA 4QHOA 5HXHA 3SS1A 3P8CD 1U5PA 3ZN1B 3MACA 3ETVA 5LXTE 3J7Yq 2XAGB 3N9QA 2ZLYA 2ZM0A 4QXHB 3JC6C 1H7CA 5A1LA 5JR9C 4NUVA 2Q9QC 3BQIA 3V5SA 3NZPA 2V1DB 3DP7A 2N1GA 4ZI3C 3K8PC 2DWGA 3I0QA 2XAHB 5FMNA 4TV9E 5FY7A 4CXYA 4ADZA 4CXWA 4CI2B 3ZYMA 2KLQA 3ZEFB 1MNEA 2XAQB 3ETUA 2VK9A 5LJNA 1D0ZA 3N9LA 3KV4A 2W00A 4GK0E 4DMWA 3RYFE 2H3RA 2XHEB 4CI1B 3BQKA 1Y64B 4TN7B 2X9HA 4I50E 5H6RB 2NP9A 2CXDA 3CQXC 3DTOA 4HKAA 4JUYA 4MLKA 5GONE 3OJAA 4HGAA 4WW0A 1Z0PA 3NZQA 1IZNB 2KINB 4YFSA 3ZLIA 4EXTA 2MOZA 4O4LE 3OBVE 3S4UA 4CZZB 2DI4A 3VKGA 2EHOA 2YINA 5HYAA 4N78D 4UVCB 5LBQB 1HG2A 2V7MA 2K9AA 5DABA 5FXVA 5HXRA 2VL8A 3FXDB 3H37A 1D1CA 2V7IA 1VOMA 2DHRA 3F2EA 3CX7B 3RYHE 3FBLA 1QUUA 3LK42 4QXBB 3QK6A 2MTQA 4AKGA 3C4ZA 3KBTA 3N9OA 1S35A 4O8SA 3N9PA 3QC9A 5L2LA 3AAEB 5LYJE 4AKLA 2XASB 4HTEA 4JEUB 2Q9QD 2J1DG 5LG4A 3RRCA 4H9QC 3CKDA 3ZC0A 2LSJA 2D0UA 3H3AA 4GOUA 3K3QC 3ZPOA 5CA0E 2P9BA 4ZI3D 5EK3A 2DCFA 3BK9A 5JQGE 2CM0A 2IC9A 1IJ6A 2LSIA 4H63V 3I9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKA A;  2V7K A;  4U72 A;  1ZEE A;  5EK4 A;  5ETW A;  4PK6 A;  2V7J A;  5EK2 A;  2V7L A;  1YW0 A;  3E08 A;  2X67 A;  2D0T A;  2NW7 A;  2X66 A;  2V7M A;  2NOX A;  2D0U A;  4PW8 A;  4U74 A;  2X68 A;  2V7I A;  2NWB A;  5EK3 A;  2NW8 A;  3BK9 A;  4PK5 A;  2NW9 A; 
#chains in the Genus database with same CATH topology
 3CQC B;  3CVR A;  3I0O A;  3A7M A;  3P4W A;  1M62 A;  4AXP A;  2JRK A;  2V8S V;  3OKQ A;  3DJB A;  1I94 T;  5DQW A;  5M4Y A;  3AEA A;  3F57 A;  4L5G A;  3R6N A;  2I59 A;  5J0Z A;  1D0X A;  5JR9 C;  2QGS A;  4OHF A;  3PDY A;  4OX9 T;  1NWM X;  2OV9 A;  3HKB E;  3PU3 A;  3HKE E;  3PUY F;  4ZZC A;  5C2T A;  2LT3 A;  3HA4 A;  5KMG P;  2Y6X A;  1W09 A;  1QSD A;  2LM2 A;  5LHI B;  2NW7 A;  4O4H E;  4KX6 A;  3SOL A;  2DWK A;  1R8I A;  4UEM A;  2D2S A;  3UT5 E;  5KXJ A;  3AA7 B;  3AE1 A;  2W0G A;  4F6R C;  2E9X B;  2Z6E A;  5FXW A;  4YSZ A;  4DR2 T;  2LOS A;  4O2A E;  3P4S A;  4KBM B;  4X5T A;  1LVF A;  1D0Y A;  2ODU A;  4YT0 A;  2VL0 A;  2YU2 A;  2V6Y A;  1BR1 A;  3NBX X;  2CXF A;  3WAJ A;  1HNX T;  4JI0 T;  3AA6 B;  3EHZ A;  4CI3 B;  4LFC T;  2YN6 A;  4H9S E;  1HX1 B;  4ZS3 A;  3UU4 A;  2PTF A;  3SWH A;  3EVY A;  3AEG A;  2X0L B;  4B3S T;  5DQV A;  1G8X A;  4NUU A;  5BR8 T;  3IHR A;  2BVL A;  4U72 A;  2E9X C;  4U31 A;  2V5C A;  1ZHC A;  5JDM A;  2M6I A;  2ACZ A;  3RRW A;  3TLS A;  2J62 A;  5HXE A;  2I0M A;  4WYV A;  5EZY E;  4AQY T;  4QH1 A;  1ZV4 X;  2WAU A;  3AEB A;  1HFA A;  2H7V C;  3AE9 A;  3FZK B;  3IF8 B;  3A5X A;  3K3O A;  3LDQ B;  3ONL C;  3P4P A;  4AKR B;  2HH7 A;  3O1J A;  3MJX A;  1LVK A;  2CXL A;  4U74 A;  2W61 A;  3N2O A;  4L9I A;  3VKH A;  2WB5 A;  2JMK A;  3FHN A;  1L0V A;  4IIJ E;  4TNV A;  2N9D A;  1YKE B;  1VRB A;  5FVL A;  3ZYL A;  5L4E A;  1BR0 A;  4BJN A;  5AQG B;  2BVM A;  3N2K E;  4O2B E;  4QWN B;  4C91 A;  4EZH A;  5IUX A;  5AQM B;  3UQ7 A;  5AQQ B;  1N32 T;  1S94 A;  2JJ9 A;  4HE8 A;  4HFD A;  4IHJ E;  3M3Z B;  2FJB A;  1LRZ A;  3RX6 A;  5JDQ A;  2VKJ A;  2WMN A;  2WBL A;  2JQQ A;  2FJA A;  5EK4 A;  1FMW A;  5HCJ A;  5HCM A;  2G0U A;  5FNV E;  2BG9 E;  3VU7 H;  4TWH A;  1YKH B;  2OLT A;  3LJC A;  3UUL A;  1HX8 A;  4JYA T;  3I9Y A;  2QVA A;  3GN5 A;  5AQR B;  4KI0 F;  2ZMA A;  5AQT B;  3LK3 B;  2CEA A;  4MHC A;  3ZC1 A;  3C98 B;  4B6X A;  4DMV A;  5LOV E;  2IDO B;  3LG7 A;  2JQ9 A;  3KIN B;  3UUN A;  4AQG A;  4DBR A;  5IWA T;  4K0K T;  5AQL B;  2MAW A;  2L8K A;  3PUW F;  4DND A;  4COF A;  2WZI A;  3CWZ B;  5FKY A;  2UXC T;  3UUB A;  5DJQ C;  4GKK T;  2BZB A;  4PK5 A;  3ZMT B;  4KP3 C;  2YK0 A;  2WDV A;  3LSV A;  2WQY A;  1HR0 T;  4IGU A;  3H3M A;  3RC3 A;  2PFV A;  3PUA A;  5EK2 A;  3UU8 A;  2WZH A;  2V7L A;  3ZKR A;  2LEH A;  2W62 A;  2GK9 A;  3GA8 A;  2CE7 A;  2BDE A;  2E9X D;  4YJ3 E;  5JRE A;  3TLW A;  3PUZ F;  2D0T A;  4HWC A;  4HFE A;  5LCY A;  3OYZ A;  3RHW A;  3TKL B;  4DVD A;  2ODV A;  1OXZ A;  2X9W A;  5HXS A;  4MBQ A;  4DR6 T;  2Q9Q A;  4Q25 A;  5LNK A;  1YXR A;  2ACX A;  2CRB A;  3A8Y C;  3QUJ A;  4X20 E;  4DV1 T;  5JR9 A;  4QH4 A;  3VRB A;  2NWB A;  2D9D A;  1CUN A;  1HF8 A;  4OFZ A;  2YU1 A;  4OK0 A;  1UUR A;  4PNI A;  2FBW A;  2YEV C;  2UXX B;  4I43 B;  2NW8 A;  5C3J A;  3Q5W A;  2XQ8 A;  4EB6 E;  5ABG A;  1MMG A;  3PU8 A;  1FIO A;  5H6Q B;  4B3M T;  3PV0 F;  1HNZ T;  4FJO A;  2BG9 B;  3L09 A;  5KX5 E;  2LRL A;  4JI4 T;  3PUX F;  2UXB T;  1N36 T;  2QYW A;  3EUH A;  2CLY C;  4HFV A;  2XSB A;  1BR2 A;  2W63 A;  2H7O A;  4JI8 T;  4DV3 T;  3O9X A;  4IDZ A;  3EDU A;  5L3E B;  2K5B B;  4DR5 T;  4AKI A;  1HNW T;  5GON E;  3Q5X A;  3ZN0 B;  4LF4 T;  3ZMZ B;  4G63 A;  3VR9 A;  1N34 T;  4O4I E;  2E2A A;  4OYJ A;  3EDV A;  4GYS A;  2DL1 A;  2MBG A;  3JAE A;  3C4W A;  3GWH A;  2VUR A;  2QRX A;  4QXC B;  4H9P C;  2JPF A;  1KK7 A;  2IAK A;  2WDQ A;  4DR4 T;  4EED A;  4JEH B;  4EV6 A;  3RC8 A;  4KHP T;  2CBJ A;  2PG8 A;  4PJJ A;  2NW9 A;  2M6B A;  4DV4 T;  4TX5 A;  1OED A;  3P7I A;  4P09 A;  1SUM B;  4X1I E;  5HAX A;  5F3J A;  3WAK A;  2CLY B;  2B1E A;  4ANJ A;  3FZF B;  5ETW A;  3CML A;  3PUS A;  3PUQ A;  1MMD A;  4IST A;  4ZZB A;  4ZS2 A;  2K24 A;  1UX4 A;  3MK7 C;  3O4X E;  4J2C A;  4DBQ A;  4AIU A;  3E08 A;  2X67 A;  5KDM C;  1X79 A;  3O1H A;  2YDS A;  1NAF A;  1KEY A;  2LKH A;  2W2U A;  2VKH A;  3AAA B;  3K3N A;  3MZK B;  3Q2M A;  4YHJ A;  3L3P A;  3MA9 A;  3NRX A;  2ZM2 A;  3MXZ A;  5JDF A;  5LBM A;  2X0H A;  5AQV B;  3RQW A;  5JVD E;  4LFB T;  5HWX A;  1BR4 A;  1E2A A;  3LFM A;  2KT9 A;  3KV9 A;  2WM9 A;  3KV5 A;  3O1I A;  4BJM A;  5L3D B;  4B3R T;  4TV8 E;  3VR8 A;  3UFE A;  2Y48 B;  2V26 A;  1UCU A;  1UGO A;  1ZOY A;  3RI5 A;  3N9M A;  5FXX A;  1JNR A;  3OYX A;  2WWU A;  3CK6 A;  3RKG A;  2A2F X;  2RP4 A;  3AXJ B;  4I0U A;  4GYR A;  1XNQ T;  3QB5 A;  3Q5D A;  4EYU A;  4YSY A;  2A72 A;  2IHR 1;  3E22 E;  4QX7 B;  4UV9 B;  1MND A;  2BG9 C;  3QOF A;  2BBJ A;  5FXZ A;  4LF7 T;  3ZMV B;  3PUG A;  3ZST A;  3CIR A;  4JI2 T;  4IDO A;  5HEO A;  3AB3 B;  2WU5 A;  3AA1 B;  3JAD A;  4V1A v;  3UUX B;  4LF9 T;  3AVR A;  4JV5 T;  3RYI E;  5ABE A;  2IUB A;  4DO0 A;  4NXM T;  2VWA A;  2XZE A;  2YDQ A;  3K1S A;  3SRZ A;  2V6Y B;  5HEJ A;  5J2U E;  4YSX A;  5JDH A;  4GK5 E;  3IEE A;  3ESL A;  4LML A;  4WBN E;  3HL6 A;  1OWA A;  2B76 A;  4H9O C;  4XAX B;  5L3B B;  1XMQ T;  3KVA A;  3ONJ A;  4MFR A;  5L3F B;  2M67 A;  4KUM B;  3ZJ1 A;  1IAP A;  4U2Y A;  4X66 T;  2ES0 A;  3HKC E;  3KV6 A;  3ONX A;  2JQH A;  2H88 A;  5E0O A;  3TLV A;  1Z8U A;  2K3W A;  2XQ7 A;  2KND A;  2XTL A;  2KWI B;  3ZMS B;  2SPC A;  2PBI A;  4UIG A;  2LOP A;  3IBP A;  1N33 T;  2UXN B;  3UTK A;  4L0R A;  1YD8 G;  2HN2 A;  2KMF A;  3T1Y T;  4IE0 A;  2UUB T;  5CFB A;  3B13 A;  4UVB B;  4ZHQ E;  3HR0 A;  5FL1 A;  1HS7 A;  2L3L A;  2XQ9 A;  5FYM A;  4BAY B;  1YW0 A;  3B5M A;  2CCQ A;  2LKG A;  2PJQ A;  2WSS V;  3OPC A;  3UQ4 A;  4AQF A;  4ASK A;  3ZYK A;  4IRE A;  4GIW A;  1DU2 A;  4PFO A;  2BS4 A;  4UEL A;  2NOX A;  4ZI7 E;  3VRA A;  4JI1 T;  1XDP A;  3AE4 A;  1AJ3 A;  2VB6 A;  4EGW A;  1EZ3 A;  3I1A A;  3Q5E A;  1J5E T;  5AQN B;  2X68 A;  1V9D A;  4EAH A;  3ANW B;  4CXX A;  2EHO B;  3AVS A;  3CQG B;  3JCF A;  4P1N A;  2LSY A;  2ZM8 A;  1E1H B;  4ISS A;  3X1D A;  4X65 T;  1WCR A;  2C5J A;  2XQY A;  4FI5 A;  2KXP B;  4DV0 T;  3FZM B;  3C64 A;  2CBI A;  3FZL B;  4ERR A;  3JC6 D;  4CQI A;  2LSK A;  4Z8X A;  4YJ2 E;  4LMJ A;  4F8H A;  2NTY A;  5JTG A;  2D5U A;  2FUP A;  2XQA A;  3PJA A;  2QA7 A;  1JNZ A;  2BBH A;  2EHO D;  2WDR A;  4PFP A;  4YLH A;  1GQE A;  2X9X A;  3M65 A;  3PUV F;  5ABH A;  2HPJ A;  5AQF B;  2BKN A;  3RIA A;  4X64 T;  2RA1 A;  2HN1 A;  5FL0 A;  3U3I A;  5JDL A;  5JDN A;  5HEG A;  1MIW A;  3RH3 A;  5LP6 E;  4PK4 A;  4Z91 A;  4X1Y E;  3AE2 A;  4H9R C;  2IC6 A;  4ILU A;  1MIV A;  4IDP A;  4QX8 B;  5JRC B;  5LB7 B;  1FEW A;  2KZ7 B;  5AQS B;  4UF0 A;  4U7Y A;  3ZMU B;  4GKJ T;  5JDG A;  4IE4 A;  4ILA A;  5HEU A;  1MMN A;  1T98 A;  3KVB A;  4HFB A;  4WBO A;  5IHY A;  3AE3 A;  3T8O A;  3FXE B;  5AFU L;  5J2T E;  1NEN A;  5L4H A;  1FMV A;  4ZI2 D;  1UUS A;  2YKS A;  4KMC A;  3ZJ2 A;  5HWY A;  2DNX A;  3RLF F;  2LHN A;  2X9Y A;  5FY1 A;  3CX6 B;  1YQ3 A;  5ABF A;  3RPU A;  4DR7 T;  2A9U A;  3B57 A;  3J9X 1;  4K0U A;  5CA1 E;  1WRD A;  4LF6 T;  2J47 A;  3HKD E;  3RIU A;  4CN4 A;  4PK6 A;  5F8P A;  3WI3 A;  4YY3 T;  5LGT B;  1W0B A;  2UUA T;  4MAL A;  2E5L T;  3N5L A;  3R84 B;  3TLU A;  4JI7 T;  2IW5 B;  4B3T T;  3C4X A;  1XWM A;  4I4T E;  1KNZ A;  2CWY A;  1US7 B;  4U2Z A;  5JR9 B;  3SFD A;  4DR3 T;  4NXN T;  3KBU A;  4P0A A;  4H63 H;  5LMN T;  3NVO A;  1WYB A;  2WS3 A;  2VVS A;  3ANW A;  3N9N A;  2NTX A;  5LG3 A;  2W4X A;  2X51 A;  3RKO A;  2XSA A;  2XUE A;  5LA6 E;  4ILC A;  1OED C;  5AQO B;  4DID B;  2A3D A;  1UX5 A;  2E8I A;  1G73 A;  2VAS A;  1U4Q A;  2VKO A;  3AAI A;  3FBZ A;  2KWH A;  4OYK A;  3P4R A;  2XAJ B;  3N2G E;  3EI0 A;  2MPK A;  2LHR A;  2WMO A;  2E9X A;  3ZCJ A;  2I6H A;  3UFG A;  1SA0 E;  5AQU B;  2N2N A;  3PTR B;  3PUR A;  2JMH A;  4IL4 A;  4TWD A;  1B7T A;  2XAF B;  2V7J A;  3KDS E;  1T72 A;  3NRY A;  4UVA B;  5J1G A;  4EOZ B;  3HI2 A;  4AKH A;  4CN1 A;  1OED B;  5TAO A;  5LHG B;  3BQL A;  2UU9 T;  3AEC A;  4IDQ A;  2OA5 A;  4TUY E;  4XZC A;  3ZSS A;  4WZX A;  3AA0 B;  3LBX A;  1SHZ C;  1VCS A;  2XJ7 A;  4UXN B;  1WLX A;  2L9Q A;  4IE6 A;  2V5D A;  4UF0 B;  3OVU A;  4PJM A;  3U78 A;  3VHL A;  5AQI B;  5L3G B;  4JI6 T;  4G2A A;  4HN9 A;  4HWI B;  3FB2 A;  2BS2 A;  5FY0 A;  4YXD A;  5JH7 E;  1WR6 A;  2CMR A;  4E7Z A;  3RYC E;  3C50 A;  1ZKE A;  3F31 A;  2CWO A;  1HG5 A;  1D1B A;  4AQF C;  1QLB A;  2WU2 A;  2VKD A;  4H9N C;  4ILB A;  5IYZ E;  4EYY R;  4XBF B;  3FZH B;  2RPA A;  2XM2 A;  4IL9 A;  2CHO A;  1J1J A;  2BG9 A;  1UK5 A;  2LE8 A;  4IE5 A;  4C90 A;  5L47 A;  3GMI A;  4DV5 T;  2K48 A;  2YDR A;  2LM9 A;  1M7K A;  2XPK A;  4O4J E;  3AE6 A;  4QKN A;  4A98 A;  4ZOL E;  3RIF A;  3ZCI A;  4AI6 A;  1WYC A;  3CX8 B;  4A56 A;  2FJD A;  4LMK A;  1IJ5 A;  3GN5 B;  4IT4 A;  4UV8 B;  5L3C B;  2UUC T;  2XQ3 A;  4PJN A;  3JAF A;  3KFW X;  4EIW A;  5LGU B;  2AE9 A;  3D0T A;  3MKD A;  2J4G A;  3V5U A;  5JRC A;  4JLE A;  4WNK A;  1HCI A;  1IBK T;  2IML A;  2LJL A;  2W67 A;  3E0Z A;  3QNU A;  1Y01 A;  5BMV E;  1MMA A;  2YOE A;  5LGN B;  3C51 A;  2C5I T;  2C5K T;  5LMU T;  4JBW F;  4X1K E;  2EHO C;  3TLT A;  4BA9 A;  5HXC A;  4PAG A;  5ADX L;  1KFY A;  3CPZ A;  4EEB A;  1ZP0 A;  1J5W A;  2MYS A;  4HEA A;  3RGL A;  2V7K A;  4AIS A;  4KHZ F;  4E7S A;  2H89 A;  2LSG A;  5LHH B;  1OED E;  2NR4 A;  4QH5 A;  1ZEE A;  3LBX B;  5FP3 A;  2CA5 A;  5CB4 E;  3IA3 A;  1O3X A;  2BKO A;  2VVN A;  2X0Y A;  3LK2 B;  4ZEY A;  3SFE A;  1XZY A;  1HTJ F;  2BS3 A;  3NKZ A;  3NWI A;  4I55 E;  5AQP B;  2AXD S;  4LF5 T;  4LFA T;  3AE8 A;  4TZ4 C;  4U7I A;  4LF8 T;  5LJM A;  4ZI2 C;  5AQJ B;  2DLR A;  5C8Y E;  2HPL A;  2X66 A;  4EZ4 A;  4M1P A;  3UUM A;  1LKX A;  1D1A A;  3Q9D A;  4PJL A;  4ZXL A;  1KNR A;  3W15 B;  1MIY A;  2Q9Q B;  3L39 A;  4HFI A;  2C0S A;  4PW8 A;  4TNW A;  1XMO T;  3PE0 A;  2VQF T;  4IE7 A;  2Y8D A;  4P0B A;  4QHO A;  5HXH A;  4HWF A;  3SS1 A;  3P8C D;  1W0A A;  1U5P A;  3ZN1 B;  3MAC A;  5FVK A;  3ETV A;  1CHU A;  5LXT E;  3J7Y q;  1XNR T;  2XAG B;  3N9Q A;  4HFH A;  2ZLY A;  2ZM0 A;  4QXH B;  3JC6 C;  1H7C A;  4A5X A;  2XY8 B;  5A1L A;  4NUV A;  2BKP A;  5F5W A;  4YTM A;  2Q9Q C;  3BQI A;  4HFC A;  3NZP A;  3V5S A;  2V1D B;  3DP7 A;  2N1G A;  3ABV A;  4ZI3 C;  4NPP A;  1KF6 A;  2W66 A;  4YTN A;  5AQH B;  3K8P C;  2DWG A;  3PJA J;  3I0Q A;  2JQK A;  1FJG T;  2XAH B;  4Z90 A;  5FMN A;  4TV9 E;  4U33 A;  4DUY T;  1T7S A;  5FY7 A;  4CXY A;  4U3C A;  3P4Q A;  4ADZ A;  4CI2 B;  4CXW A;  3ZYM A;  2KLQ A;  3ZEF B;  1MNE A;  2XAQ B;  3ZT6 A;  3ETU A;  2VK9 A;  5LJN A;  1D0Z A;  3N9L A;  2V6X A;  3KV4 A;  2W00 A;  4GK0 E;  2LRK A;  3P50 A;  3UU3 A;  2FJE A;  4HWD A;  3RYF E;  4DMW A;  2H3R A;  2XHE B;  1SE7 A;  4DV6 T;  4CI1 B;  3BQK A;  1Y64 B;  4TN7 B;  2LLY A;  2X9H A;  1I6Z A;  3AEE A;  4I50 E;  5H6R B;  5CJ5 A;  2CPT A;  2CXD A;  2NP9 A;  3AE5 A;  3CQX C;  3DTO A;  3AE7 A;  3EAB A;  3OJA A;  4HGA A;  4HKA A;  4JUY A;  1Z0P A;  4MLK A;  4WW0 A;  4DV2 T;  4DR1 T;  3NZQ A;  3UU6 A;  1IZN B;  2KIN B;  2E5V A;  2WY2 A;  4YFS A;  3ZLI A;  3ZT7 A;  4EXT A;  2MOZ A;  3OTO T;  3AEF A;  4O4L E;  3OBV E;  3S4U A;  4DV7 T;  4CZZ B;  2DI4 A;  3VKG A;  1XDO A;  2EHO A;  2YIN A;  1WR0 A;  4N78 D;  5HYA A;  1NEK A;  4UVC B;  5LBQ B;  3AED A;  1HG2 A;  2V7M A;  2K9A A;  5DAB A;  2CHN A;  5FXV A;  5HXR A;  2WWV A;  2VL8 A;  2XQ4 A;  4X62 T;  3L8R A;  3FXD B;  3H37 A;  1T8B A;  2VQE T;  2UXD T;  5AQK B;  4IDN A;  4CN6 A;  2HHH T;  4DUZ T;  1D1C A;  2V7I A;  1VOM A;  2DHR A;  3QB5 K;  2JIW A;  3F2E A;  3CX7 B;  5ABF B;  3RYH E;  3FBL A;  1QUU A;  3LK4 2;  4QXB B;  3QK6 A;  2MTQ A;  4UR9 A;  3AXJ A;  1WFD A;  2XM1 A;  2F4V T;  4AKG A;  3C4Z A;  3KBT A;  3N9O A;  4JI5 T;  3ZT5 A;  3T1H T;  2IIU A;  1VCT A;  1S35 A;  3RF1 A;  4O8S A;  2WP9 A;  3N9P A;  3QC9 A;  4TWF A;  5L2L A;  5CGM A;  1E7P A;  1IBL T;  2WCA A;  3AAE B;  5HEH A;  2XQ5 A;  4YHH T;  3UU5 A;  4YTP A;  4HWH A;  5LYJ E;  4AKL A;  2XAS B;  4HTE A;  4JEU B;  2Q9Q D;  2J1D G;  3EAM A;  1W9R A;  3G06 A;  2XQ6 A;  3RRC A;  4H9Q C;  5LG4 A;  3CKD A;  2ZM6 T;  1IBM T;  3RIU C;  3ZC0 A;  2LSJ A;  2D0U A;  3H3A A;  4GOU A;  1KNP A;  3K3Q C;  2KSR A;  3ZPO A;  4A97 A;  5CA0 E;  2P9B A;  4NIQ A;  4JI3 T;  4ZI3 D;  2R6G F;  5EK3 A;  3RQU A;  2DCF A;  1YQ4 A;  3BK9 A;  5JQG E;  2CM0 A;  2IC9 A;  1IJ6 A;  2LSI A;  4H63 V;  3I9W A;  1X9B A; 
#chains in the Genus database with same CATH homology
 3CQC B;  3CVR A;  3I0O A;  4AXP A;  2JRK A;  3OKQ A;  3DJB A;  5DQW A;  5M4Y A;  3R6N A;  3F57 A;  4L5G A;  2I59 A;  1D0X A;  2QGS A;  4OHF A;  3PDY A;  1NWM X;  3HKB E;  3PU3 A;  3HKE E;  2LT3 A;  3HA4 A;  5KMG P;  2Y6X A;  1QSD A;  5LHI B;  2NW7 A;  4O4H E;  3SOL A;  2DWK A;  4UEM A;  2D2S A;  3UT5 E;  3AA7 B;  2W0G A;  4F6R C;  2E9X B;  2Z6E A;  5FXW A;  2LOS A;  4O2A E;  4KBM B;  1LVF A;  1D0Y A;  2ODU A;  2YU2 A;  1BR1 A;  3NBX X;  2CXF A;  3WAJ A;  3AA6 B;  4CI3 B;  4H9S E;  4ZS3 A;  3SWH A;  3EVY A;  2X0L B;  5DQV A;  1G8X A;  4NUU A;  3IHR A;  2BVL A;  4U72 A;  2E9X C;  1ZHC A;  5JDM A;  3RRW A;  5HXE A;  5EZY E;  1ZV4 X;  2WAU A;  1HFA A;  2H7V C;  3IF8 B;  3A5X A;  3K3O A;  4AKR B;  2HH7 A;  3O1J A;  3MJX A;  1LVK A;  2CXL A;  4U74 A;  2W61 A;  3N2O A;  4L9I A;  3VKH A;  2JMK A;  3FHN A;  4IIJ E;  3ZYL A;  2N9D A;  1YKE B;  1VRB A;  1BR0 A;  4BJN A;  2BVM A;  3N2K E;  4O2B E;  4QWN B;  4C91 A;  4EZH A;  1S94 A;  2JJ9 A;  4HE8 A;  4IHJ E;  1LRZ A;  3RX6 A;  5JDQ A;  2VKJ A;  2WMN A;  2WBL A;  2JQQ A;  5EK4 A;  1FMW A;  3VU7 H;  2G0U A;  1YKH B;  3LJC A;  3UUL A;  1HX8 A;  3I9Y A;  3GN5 A;  2ZMA A;  3LK3 B;  2CEA A;  4MHC A;  3ZC1 A;  3C98 B;  4B6X A;  4DMV A;  5LOV E;  3LG7 A;  4AQG A;  3KIN B;  3UUN A;  4DBR A;  2L8K A;  4DND A;  3CWZ B;  5DJQ C;  2BZB A;  4PK5 A;  3ZMT B;  4KP3 C;  2YK0 A;  4IGU A;  3RC3 A;  2PFV A;  3PUA A;  5EK2 A;  2V7L A;  2LEH A;  2W62 A;  2GK9 A;  3GA8 A;  2CE7 A;  2BDE A;  2E9X D;  4YJ3 E;  5JRE A;  2D0T A;  5LCY A;  3OYZ A;  3TKL B;  4DVD A;  2ODV A;  1OXZ A;  2X9W A;  5HXS A;  4MBQ A;  2Q9Q A;  5LNK A;  2ACX A;  3QUJ A;  4X20 E;  5JR9 A;  5L3D B;  2NWB A;  1CUN A;  1HF8 A;  4OFZ A;  2YU1 A;  4OK0 A;  4PNI A;  4I43 B;  2YEV C;  2UXX B;  2NW8 A;  3Q5W A;  4EB6 E;  1MMG A;  3PU8 A;  1FIO A;  5H6Q B;  4FJO A;  3L09 A;  5KX5 E;  3EUH A;  2CLY C;  4HFV A;  1BR2 A;  2W63 A;  2H7O A;  3O9X A;  4IDZ A;  3EDU A;  5L3E B;  2K5B B;  4AKI A;  3Q5X A;  3ZN0 B;  3ZMZ B;  4G63 A;  4O4I E;  4OYJ A;  3EDV A;  4GYS A;  2MBG A;  3C4W A;  3GWH A;  4QXC B;  4H9P C;  2JPF A;  1KK7 A;  2IAK A;  4JEH B;  3RC8 A;  4PJJ A;  2PG8 A;  2NW9 A;  4TX5 A;  3P7I A;  4P09 A;  4X1I E;  5HAX A;  5F3J A;  3WAK A;  2CLY B;  2B1E A;  4ANJ A;  5ETW A;  3CML A;  3PUS A;  3PUQ A;  1MMD A;  4IST A;  4ZS2 A;  2K24 A;  1UX4 A;  3MK7 C;  3O4X E;  4J2C A;  4DBQ A;  3E08 A;  2X67 A;  5KDM C;  1X79 A;  3O1H A;  1NAF A;  3MZK B;  3AAA B;  3K3N A;  2VKH A;  3Q2M A;  4YHJ A;  5FNV E;  5LGN B;  5LBM A;  3L3P A;  3MA9 A;  3NRX A;  2ZM2 A;  3MXZ A;  5JDF A;  5JVD E;  5HWX A;  1BR4 A;  3LFM A;  4BJM A;  2KT9 A;  3KV9 A;  2WM9 A;  3KV5 A;  3O1I A;  4TV8 E;  3UFE A;  2Y48 B;  2V26 A;  1UCU A;  3N9M A;  5FXX A;  3OYX A;  2WWU A;  2A2F X;  2RP4 A;  4GYR A;  4EYU A;  2A72 A;  3E22 E;  4QX7 B;  4UV9 B;  1MND A;  5FXZ A;  3ZMV B;  3PUG A;  3AB3 B;  3AA1 B;  4V1A v;  3UUX B;  3AVR A;  3RYI E;  4DO0 A;  2VWA A;  3SRZ A;  5JDH A;  4GK5 E;  3IEE A;  3ESL A;  4WBN E;  3HL6 A;  1OWA A;  4XAX B;  4H9O C;  5L3B B;  3KVA A;  4MFR A;  5L3F B;  2M67 A;  4KUM B;  3ZJ1 A;  1IAP A;  2ES0 A;  3HKC E;  3KV6 A;  3ONX A;  5E0O A;  2KND A;  2XTL A;  2KWI B;  3ZMS B;  2SPC A;  2PBI A;  4UIG A;  2LOP A;  3IBP A;  2UXN B;  3UTK A;  4L0R A;  1YD8 G;  2KMF A;  4IE0 A;  3B13 A;  4UVB B;  4ZHQ E;  3HR0 A;  1HS7 A;  2L3L A;  5FYM A;  4BAY B;  1YW0 A;  2CCQ A;  2PJQ A;  2WSS V;  4ASK A;  4AQF A;  3ZYK A;  4GIW A;  4PFO A;  4UEL A;  2NOX A;  4ZI7 E;  1AJ3 A;  2VB6 A;  1EZ3 A;  3I1A A;  2X68 A;  1V9D A;  4EAH A;  3ANW B;  4CXX A;  2EHO B;  3CQG B;  3AVS A;  2LSY A;  2ZM8 A;  1E1H B;  4ISS A;  2C5J A;  2XQY A;  4FI5 A;  2KXP B;  3C64 A;  4ERR A;  3JC6 D;  4CQI A;  2LSK A;  4Z8X A;  4YJ2 E;  2NTY A;  2D5U A;  2QA7 A;  2EHO D;  4YLH A;  4PFP A;  3M65 A;  2X9X A;  2HPJ A;  2RA1 A;  5JDN A;  3U3I A;  5JDL A;  5LP6 E;  1MIW A;  3RH3 A;  4PK4 A;  4X1Y E;  4H9R C;  2IC6 A;  4ILU A;  1MIV A;  5JRC B;  4QX8 B;  1FEW A;  2KZ7 B;  4UF0 A;  3ZMU B;  5JDG A;  4IE4 A;  5IHY A;  1MMN A;  1T98 A;  3KVB A;  4WBO A;  3T8O A;  3FXE B;  5AFU L;  5J2T E;  1FMV A;  4ZI2 D;  3ZJ2 A;  4KMC A;  5HWY A;  2DNX A;  2LHN A;  2X9Y A;  5FY1 A;  3CX6 B;  3RPU A;  3B57 A;  3J9X 1;  4K0U A;  5CA1 E;  1WRD A;  3HKD E;  4PK6 A;  5F8P A;  3WI3 A;  5LGT B;  4MAL A;  3N5L A;  3R84 B;  1KNZ A;  2IW5 B;  3C4X A;  4I4T E;  2CWY A;  1US7 B;  5JR9 B;  3KBU A;  4P0A A;  4H63 H;  1WYB A;  3ANW A;  3N9N A;  2NTX A;  2X51 A;  3RKO A;  5LA6 E;  2XUE A;  2A3D A;  1UX5 A;  2E8I A;  1G73 A;  2VAS A;  3FBZ A;  1U4Q A;  2VKO A;  3AAI A;  2KWH A;  4OYK A;  5J2U E;  2XAJ B;  3N2G E;  2WMO A;  2LHR A;  2E9X A;  3ZCJ A;  1SA0 E;  2N2N A;  3PTR B;  3PUR A;  2JMH A;  1B7T A;  2XAF B;  2V7J A;  3KDS E;  3NRY A;  4UVA B;  5J1G A;  4AKH A;  4EOZ B;  3HI2 A;  5TAO A;  5LHG B;  3BQL A;  4TUY E;  2OA5 A;  4XZC A;  3AA0 B;  3LBX A;  1SHZ C;  4UXN B;  1WLX A;  2L9Q A;  4IE6 A;  4UF0 B;  4PJM A;  3VHL A;  3U78 A;  5L3G B;  4G2A A;  4HN9 A;  3FB2 A;  5FY0 A;  5JH7 E;  1WR6 A;  2CMR A;  4E7Z A;  3RYC E;  3C50 A;  1ZKE A;  3F31 A;  2CWO A;  1HG5 A;  1D1B A;  4AQF C;  2VKD A;  4H9N C;  5IYZ E;  4EYY R;  4XBF B;  2LE8 A;  4IE5 A;  4C90 A;  3GMI A;  2K48 A;  2LM9 A;  4O4J E;  4AI6 A;  4QKN A;  4ZOL E;  3ZCI A;  1WYC A;  3CX8 B;  4A56 A;  1IJ5 A;  3GN5 B;  4UV8 B;  5L3C B;  4PJN A;  3KFW X;  4EIW A;  5LGU B;  3D0T A;  3MKD A;  3V5U A;  5JRC A;  4JLE A;  4WNK A;  1HCI A;  2LJL A;  5BMV E;  3E0Z A;  1MMA A;  3C51 A;  2C5I T;  2C5K T;  4X1K E;  2EHO C;  4BA9 A;  5HXC A;  4PAG A;  5ADX L;  3CPZ A;  2MYS A;  4HEA A;  2V7K A;  4E7S A;  2LSG A;  5LHH B;  1ZEE A;  3LBX B;  5FP3 A;  2CA5 A;  5CB4 E;  1O3X A;  3LK2 B;  1HTJ F;  4I55 E;  4TZ4 C;  5LJM A;  4ZI2 C;  2DLR A;  5C8Y E;  2HPL A;  2X66 A;  4EZ4 A;  4M1P A;  3UUM A;  1LKX A;  1D1A A;  3Q9D A;  4PJL A;  3W15 B;  1MIY A;  2Q9Q B;  4PW8 A;  2C0S A;  3PE0 A;  4IE7 A;  2Y8D A;  4P0B A;  4QHO A;  5HXH A;  3SS1 A;  3P8C D;  1U5P A;  3ZN1 B;  3MAC A;  3ETV A;  5LXT E;  3J7Y q;  2XAG B;  3N9Q A;  2ZLY A;  2ZM0 A;  4QXH B;  3JC6 C;  1H7C A;  5A1L A;  5JR9 C;  4NUV A;  2Q9Q C;  3BQI A;  3V5S A;  3NZP A;  2V1D B;  3DP7 A;  2N1G A;  4ZI3 C;  3K8P C;  2DWG A;  3I0Q A;  2XAH B;  5FMN A;  4TV9 E;  5FY7 A;  4CXY A;  4ADZ A;  4CXW A;  4CI2 B;  3ZYM A;  2KLQ A;  3ZEF B;  1MNE A;  2XAQ B;  3ETU A;  2VK9 A;  5LJN A;  1D0Z A;  3N9L A;  3KV4 A;  2W00 A;  4GK0 E;  4DMW A;  3RYF E;  2H3R A;  2XHE B;  4CI1 B;  3BQK A;  1Y64 B;  4TN7 B;  2X9H A;  4I50 E;  5H6R B;  2NP9 A;  2CXD A;  3CQX C;  3DTO A;  4HKA A;  4JUY A;  4MLK A;  5GON E;  3OJA A;  4HGA A;  4WW0 A;  1Z0P A;  3NZQ A;  1IZN B;  2KIN B;  4YFS A;  3ZLI A;  4EXT A;  2MOZ A;  4O4L E;  3OBV E;  3S4U A;  4CZZ B;  2DI4 A;  3VKG A;  2EHO A;  2YIN A;  5HYA A;  4N78 D;  4UVC B;  5LBQ B;  1HG2 A;  2V7M A;  2K9A A;  5DAB A;  5FXV A;  5HXR A;  2VL8 A;  3FXD B;  3H37 A;  1D1C A;  2V7I A;  1VOM A;  2DHR A;  3F2E A;  3CX7 B;  3RYH E;  3FBL A;  1QUU A;  3LK4 2;  4QXB B;  3QK6 A;  2MTQ A;  4AKG A;  3C4Z A;  3KBT A;  3N9O A;  1S35 A;  4O8S A;  3N9P A;  3QC9 A;  5L2L A;  3AAE B;  5LYJ E;  4AKL A;  2XAS B;  4HTE A;  4JEU B;  2Q9Q D;  2J1D G;  5LG4 A;  3RRC A;  4H9Q C;  3CKD A;  3ZC0 A;  2LSJ A;  2D0U A;  3H3A A;  4GOU A;  3K3Q C;  3ZPO A;  5CA0 E;  2P9B A;  4ZI3 D;  5EK3 A;  2DCF A;  3BK9 A;  5JQG E;  2CM0 A;  2IC9 A;  1IJ6 A;  2LSI A;  4H63 V;  3I9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...