4PW8A

Human tryptophan 2,3-dioxygenase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
342
structure length
306
Chain Sequence
IYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSRYKVFVDLFNLSTYLIPRHWIPKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Structural and functional analyses of human tryptophan 2,3-dioxygenase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 122
structure length 306
sequence length 342
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pw8A01
2V7JA 2X67A 5EK2A 4U72A 4HKAA 5EK3A 5ETWA 4PK5A 4U74A 1YW0A 2NOXA 2NW9A 3BK9A 2NW8A 4PW8A 2D0UA 2NW7A 2X68A 5EK4A 2V7MA 2X66A 2NWBA 1ZEEA 2D0TA 4PK6A 2V7LA 3E08A 2V7KA 2V7IA
chains in the Genus database with same CATH superfamily
4OYJA 1KNRA 1J1JA 2HN2A 1VCSA 4I43B 1IJ5A 3ZN0B 4YFSA 2J47A 2Q9QB 2LSGA 3NWIA 3KVAA 3FBLA 2WBLA 4B3TT 1IBLT 2E2AA 3PU8A 2WU2A 5AQPB 4KI0F 4PJNA 5J1GA 3PUSA 3RIFA 3ZN1B 3CIRA 1XNRT 5LA6E 4WBNE 2XQAA 3HL6A 1S35A 2V5CA 2W00A 4KHZF 5AQUB 1KNPA 3V5SA 4H63H 4DV0T 5LG4A 5JDHA 4EEBA 4A5XA 2KXPB 2YU2A 3UFGA 3UU8A 5AFUL 3SFDA 1WR0A 2YINA 1T72A 4GOUA 2JMHA 3NBXX 3IA3A 3HA4A 3L39A 3SS1A 2MPKA 2BS2A 4IT4A 5H6QB 4DNDA 2ACZA 4DR1T 4WYVA 4IREA 2UUAT 3HKBE 2IUBA 4HWIB 3IF8B 3AAIA 2YDRA 1JNRA 3EUHA 3IEEA 5HEUA 4U74A 1XDPA 4WNKA 4XZCA 2XY8B 4ZI2D 4X62T 2V1DB 1WYBA 3JAEA 5JH7E 2K24A 3RYFE 3ZEFB 5L3BB 2WSSV 5FYMA 2DL1A 2XAFB 3LG7A 2BKOA 3FZFB 4EXTA 3AE3A 2CHNA 5AQSB 4P1NA 3QNUA 4F8HA 2LJLA 2MTQA 1FEWA 3VR8A 2XSAA 4EYUA 3AVSA 4HGAA 4XBFB 2W2UA 3ONLC 1XWMA 1D0XA 2XQ4A 3UUXB 2X0HA 1UURA 5EK4A 3PURA 1NENA 4HE8A 3UFEA 4ILAA 4O8SA 4P09A 1JNZA 2UU9T 2BS3A 4BAYB 1I6ZA 4HKAA 3RPUA 2V6YA 5FKYA 5LJNA 3EVYA 4QH1A 2LM9A 4LF6T 4CI3B 3RKGA 4KX6A 2Y8DA 4KUMB 3LSVA 4DR6T 1T8BA 3MJXA 2XQ3A 2W63A 2P9BA 1MMAA 2NTYA 3HI2A 1WCRA 5JREA 1KEYA 1LRZA 2BKNA 4DVDA 2BG9C 3ABVA 3GMIA 2D0UA 3U78A 5DJQC 1LKXA 2WU5A 2YEVC 2NP9A 3TLVA 4CN4A 4UVCB 2YOEA 4PAGA 2GK9A 2K5BB 4H9OC 4X1YE 1MNDA 3ZSTA 4LMKA 4PNIA 5LGNB 2LLYA 5J2UE 2IAKA 4QWNB 1UX4A 4FJOA 2D0TA 3E08A 4A98A 4KHPT 3PUZF 2X67A 4QX8B 5JR9C 2XQYA 1NAFA 2RA1A 3P7IA 4CXYA 4AQYT 4PJMA 1WFDA 3N2GE 2DNXA 2EHOD 4K0UA 5LHIB 3ZMUB 2WZHA 4HEAA 3CX7B 5LBMA 2VKDA 2W61A 3P4SA 4HFHA 3VR9A 4ZHQE 1UUSA 5JDGA 3X1DA 2ZM8A 4UV8B 4X5TA 3C50A 2CRBA 1XMOT 1ZEEA 4TWHA 5L4HA 3PUQA 4U72A 5EK3A 4CN1A 2XAQB 4O4LE 3AE2A 2CLYB 3GA8A 2IDOB 5AQKB 4DV4T 2KMFA 3D0TA 1SHZC 3LDQB 3MZKB 3CWZB 3PUYF 1N33T 3ZJ2A 2RPAA 4LF5T 3A7MA 3ZMSB 2MBGA 3R84B 5LHGB 4JI1T 2V7LA 5F8PA 2WWUA 2FJDA 3N2KE 2ACXA 1OEDA 5LB7B 1FJGT 4MLKA 2VKHA 5HEGA 1AJ3A 1WR6A 3PUVF 3N9MA 1D1CA 4DR5T 3ZSSA 2Y48B 1MIYA 2LHRA 3RI5A 4O4HE 2VVNA 3PTRB 2YDQA 2DWGA 3GWHA 4U3CA 5L3CB 3TLWA 2E9XC 5CGMA 3VU7H 2N2NA 4HWFA 4TWFA 3Q2MA 1OEDC 1OEDE 1W0AA 4ZZCA 2QRXA 4BJMA 1FMVA 1J5ET 2Q9QA 4JI2T 2SPCA 1BR1A 5L3DB 3CX6B 3ESLA 3Q9DA 2ODUA 4UVBB 5HXEA 4MBQA 4ZOLE 3BQIA 4A97A 5JQGE 3UQ7A 2EHOB 4IL9A 5LBQB 2L8KA 1W09A 4HFDA 5ABEA 3EDVA 3H37A 3LBXB 2ZM0A 4NXMT 5KDMC 4O2AE 2KNDA 5LG3A 3FZMB 3C51A 4H9NC 2CXDA 2V8SV 4X1IE 4X65T 5JDQA 2MYSA 2W66A 4IE7A 1NWMX 4CI2B 2CCQA 3MACA 4IDQA 5AQVB 3ZJ1A 3PV0F 5H6RB 4EB6E 5FVLA 3SOLA 2I6HA 2L3LA 4DR4T 3QC9A 5TAOA 3P4QA 2ZM2A 2V7MA 4EOZB 4DBQA 3N9QA 3ZMVB 2VURA 4YTMA 3AE5A 1HS7A 2XASB 3DJBA 3V5UA 3O4XE 3LFMA 4AQFA 5LGUB 2XAHB 3AA7B 3TKLB 5ABGA 2NR4A 4UVAB 1IBMT 3QB5K 1D0YA 4TN7B 4OHFA 5AQMB 1HG5A 4ZEYA 4N78D 3NKZA 1UCUA 2NOXA 1DU2A 5LJMA 2XZEA 4COFA 4YSZA 3RGLA 3ANWB 4YXDA 3ZT7A 1S94A 5HXRA 2CEAA 3A5XA 3T1YT 4IGUA 3QOFA 4QXHB 4JV5T 4AQFC 4YT0A 1Z0PA 1MNEA 2ZMAA 2CBIA 4LF8T 2XUEA 5FXXA 3AE1A 3C64A 4L9IA 4DV1T 2LSJA 3M65A 4UF0B 1YQ4A 5DQVA 3AECA 3WAJA 5LMNT 4GK5E 1N32T 4B3ST 2QYWA 4ISSA 5ADXL 4DV7T 5HXCA 3OBVE 2A72A 2XSBA 2UXNB 1IJ6A 4OK0A 2HPLA 3KV9A 4QHOA 2V6XA 4QXCB 3NRXA 4ISTA 2H3RA 4IL4A 2KSRA 3KDSE 4HFCA 3P4PA 2JMKA 1QUUA 1XMQT 3MK7C 2XM1A 1HNZT 1CHUA 4PW8A 3LK3B 3Q5DA 4XAXB 1W9RA 3ZMTB 4WW0A 4HFEA 4HFIA 4BA9A 1KK7A 4ZZBA 4ZS2A 4EGWA 3KINB 3AEDA 4AI6A 4JYAT 2V5DA 5JDMA 1X9BA 2B1EA 3I9YA 4ZI7E 4ANJA 3W15B 4E7SA 2VL0A 1FMWA 2VQFT 3AA0B 2LEHA 3RYHE 2PFVA 5LP6E 5AQTB 3UU4A 4IE6A 1YKEB 3ETUA 1YW0A 2CXLA 2LSKA 5ABFB 2XQ5A 3AE4A 3K3NA 4ADZA 2M67A 5HXHA 4DV2T 4HWCA 1SUMB 4IHJE 1W0BA 4EZHA 2W0GA 5HEHA 2X9YA 3A8YC 4HWHA 3RRCA 2XHEB 4IDOA 4IE4A 2WMNA 2VK9A 3VKHA 3LK42 4DO0A 3U3IA 2XQ6A 2NW7A 4HN9A 3RYCE 3ZYKA 2W62A 3IBPA 2V7IA 4O4IE 3UTKA 1HNXT 3UQ4A 2W4XA 5HYAA 2JRKA 5AQNB 3WAKA 4ZI2C 2ZLYA 5L3EB 3PUWF 4JI5T 4LFAT 4KMCA 3ZC1A 4Z90A 3I0QA 4V1Av 4ZXLA 2KZ7B 3H3AA 5ABHA 1VCTA 2I59A 3C4ZA 3MKDA 1KF6A 5L47A 3F31A 4CZZB 3N5LA 3KVBA 4LMJA 3RC8A 2HPJA 5HWXA 4Z8XA 5FY1A 3AXJB 3CQXC 2X9XA 3CPZA 3MXZA 1M62A 3AE7A 1BR2A 1ZHCA 3F2EA 5LYJE 3PJAJ 4UXNB 5IYZE 3AEAA 3CVRA 1VRBA 2WCAA 3CK6A 4G2AA 5CB4E 4JUYA 5JDLA 2L9QA 4AKHA 3QK6A 4M1PA 1OXZA 4PFOA 3AAAB 3E22E 4U31A 3UT5E 1CUNA 4TX5A 2IHR1 4YJ2E 3AEFA 4GKJT 2EHOA 3PUAA 2VKOA 1L0VA 4MHCA 2A3DA 3E0ZA 2E8IA 1OWAA 3AVRA 5FXVA 1X79A 3K3OA 3S4UA 2WM9A 3H3MA 4AQGA 3OTOT 3T8OA 1H7CA 2WY2A 3J7Yq 2X9HA 3EABA 2M6BA 3ONJA 2XQ9A 2OLTA 4IE5A 1HX1B 2BG9B 2AE9A 4Q25A 3AA6B 3MA9A 5AQLB 1M7KA 4U2YA 2H7VC 3BQLA 2EHOC 2CMRA 4AXPA 3EI0A 4X20E 2QGSA 3UULA 3PUXF 2H7OA 2E9XD 1IBKT 4E7ZA 1QSDA 2IC6A 3PUGA 5LNKA 4IDZA 2XTLA 2HH7A 1LVFA 5LHHB 2N1GA 2WAUA 3FB2A 4AKRB 5KX5E 2NW8A 5JR9B 1ZP0A 4IIJE 5AQQB 5AQJB 2LOSA 4PJJA 3K8PC 3N9OA 4GK0E 1GQEA 1D0ZA 4L0RA 2LE8A 4I4TE 4DUYT 3UUBA 5CA0E 2ODVA 2JJ9A 3TLSA 4PK5A 5BR8T 3UUNA 4UIGA 1G73A 1ZKEA 4DV6T 4LMLA 4OX9T 4YTNA 5KMGP 2IC9A 5HCJA 1WYCA 1G8XA 5LGTB 2R6GF 5FY0A 3UUMA 2XAJB 4UF0A 4QH4A 4MALA 3AEEA 4X64T 3CX8B 5FNVE 1SA0E 3ZCJA 3I9WA 2IIUA 2H89A 4LF4T 4BJNA 2UXCT 4JEHB 5FXZA 3JC6D 4JLEA 2C5JA 4CXWA 2LKHA 1V9DA 2X0YA 3OVUA 4JEUB 3KV6A 4TWDA 2FBWA 2Q9QC 4IDPA 3ZC0A 2QVAA 3GN5B 3RF1A 5AQIB 1E1HB 2CHOA 3EAMA 4I55E 3KBUA 3N2OA 2KT9A 3I1AA 4OFZA 3SWHA 2JQ9A 2QA7A 3F57A 3OKQA 1HF8A 3L8RA 5JDNA 4AKLA 4ZI3D 1FIOA 3PDYA 3C4XA 4ILCA 2D5UA 4EYYR 2CE7A 1B7TA 2A9UA 2VKJA 1O3XA 3WI3A 4LFCT 4QH5A 2XQ8A 3B5MA 5A1LA 3QB5A 3CKDA 4OYKA 5ABFA 3Q5EA 3KBTA 4FI5A 2E9XB 2YDSA 3JAFA 2Z6EA 2PG8A 5HEJA 4CQIA 2Y6XA 5HAXA 2JQQA 2AXDS 2LKGA 2XJ7A 3OYZA 2X0LB 5J0ZA 2JIWA 2UXXB 4DIDB 2VASA 3NZPA 3K1SA 3ZCIA 4CN6A 4YY3T 2WMOA 1XZYA 1HCIA 2X66A 4QKNA 3UU5A 2OV9A 1Y64B 1IZNB 4ZS3A 4YSXA 2LHNA 2OA5A 2CWOA 2MAWA 2XQ7A 1US7B 2K3WA 4PFPA 1D1AA 1MIVA 2LRKA 4DR2T 5JRCB 1Z8UA 3RQUA 3LK2B 5GONE 5IUXA 1MMDA 1BR0A 2LSIA 2VL8A 5FMNA 2BS4A 3ZT5A 5AQOB 4C91A 3N9LA 3HKEE 5FL0A 4EZ4A 1YD8G 3UU3A 1T7SA 3CMLA 2J4GA 1WRDA 2M6IA 2DI4A 4U2ZA 5EZYE 2VWAA 4PJLA 4GYSA 3OPCA 1ZOYA 2CPTA 2FJEA 4JI7T 3LJCA 4O2BE 3J9X1 4JI3T 3AXJA 4PK6A 4WZXA 4CXXA 2E5VA 2RP4A 2I0MA 3RRWA 2XM2A 2JQHA 3RLFF 1XNQT 4NXNT 5M4YA 3T1HT 2YU1A 4G63A 1I94T 3FXEB 5AQGB 4NPPA 2JQKA 4GIWA 5JTGA 4H9PC 3NVOA 4TV8E 3FZLB 5KXJA 1D1BA 5LCYA 2CM0A 3AE6A 1Y01A 3RX6A 1KNZA 3DP7A 4TZ4C 2WDQA 5DABA 4LF9T 5E0OA 4EEDA 1UGOA 5HEOA 3NZQA 3FBZA 1BR4A 2KWHA 3PU3A 2BVLA 2WS3A 4TUYE 2BKPA 5CA1E 4X66T 4DMVA 3C4WA 2BBJA 3G06A 2WDRA 4TNVA 4NIQA 3ZKRA 5L4EA 4P0BA 3EDUA 2A2FX 4DR7T 3OYXA 2B76A 4EIWA 1LVKA 4NUUA 2NTXA 2WZIA 2FJAA 2UUCT 3AAEB 3RHWA 2PBIA 3RC3A 3BK9A 3N9PA 2BG9A 1J5WA 2C0SA 4O4JE 2WP9A 1E2AA 4KP3C 4AKIA 3HKCE 1SE7A 4DBRA 2LSYA 4CI1B 4LF7T 2BZBA 3PJAA 1YKHB 4QXBB 4I50E 1IAPA 1HFAA 4JI6T 4H9QC 1HG2A 4DR3T 2VB6A 4AKGA 3AB3B 4TV9E 5JR9A 2CLYC 3TLTA 5FL1A 3Q5XA 5J2TE 2BG9E 4JI8T 3O1JA 3HR0A 2PTFA 2VQET 4H9RC 2X68A 5F3JA 4HFVA 3QUJA 3L09A 1NEKA 2YK0A 4YLHA 3VRBA 4HFBA 5JDFA 4AIUA 4DUZT 1QLBA 4B3MT 4A56A 3ETVA 1ZV4X 4DMWA 5C2TA 4YTPA 4AISA 4YHHT 1KFYA 2MOZA 3FZKB 3P4RA 5CJ5A 4U7YA 3L3PA 4EAHA 1U5PA 5ETWA 4P0AA 3DTOA 4ERRA 4UEMA 2WB5A 5C3JA 3AEGA 3P50A 3M3ZB 4H9SE 3LBXA 4HTEA 2HN1A 2CA5A 4H63V 3K3QC 1MMGA 2FUPA 1UK5A 3ZT6A 3HKDE 4JBWF 1HTJF 3AA1B 5LXTE 5L3FB 4YHJA 1N34T 3GN5A 2V7KA 4KBMB 3KV5A 5AQHB 3JCFA 3NRYA 2F4VT 2N9DA 3VRAA 4DV5T 2NW9A 2J1DG 4NUVA 2D2SA 2W67A 3P4WA 5HCMA 2LOPA 4B6XA 2V6YB 3BQKA 1YXRA 3KV4A 3Q5WA 4TNWA 2UXBT 2UUBT 2X9WA 2LM2A 2C5KT 4L5GA 4UR9A 5FY7A 4U7IA 5BMVE 4GKKT 3C98B 2CBJA 2E9XA 2WWVA 2J62A 4U33A 3IHRA 1N36T 4EV6A 1MIWA 1WLXA 2BDEA 5FVKA 3ZLIA 3P8CD 2DHRA 4ILUA 3ANWA 2K9AA 3UU6A 5DQWA 2NWBA 5IWAT 5HWYA 4F6RC 2BVMA 1HX8A 2ZM6T 2V26A 1E7PA 4UV9B 3ZPOA 2LT3A 5FXWA 2Q9QD 5IHYA 3JADA 3B57A 1T98A 4C90A 2YN6A 5LOVE 2DCFA 3R6NA 2DWKA 2ES0A 5FP3A 5HXSA 2CXFA 2K48A 2UXDT 3RIAA 2XAGB 3N9NA 4YJ3E 2V7JA 2D9DA 5LMUT 4PK4A 3AE9A 3EHZA 4DV3T 5JRCA 3PE0A 2KWIB 1UX5A 4MFRA 2WQYA 3TLUA 4B3RT 2X51A 4LFBT 3CQCB 4IE0A 3RKOA 1VOMA 2XPKA 3ONXA 3O1IA 2PJQA 3O1HA 1R8IA 4JI4T 2HHHT 2BBHA 4WBOA 2H88A 2IW5B 1U4QA 5AQRB 1HR0T 1MMNA 4HWDA 3FZHB 4GYRA 1XDOA 3AE8A 5L2LA 5EK2A 1EZ3A 2JPFA 3ZYLA 2VVSA 3OJAA 2G0UA 4IDNA 3RIUA 4UELA 1HNWT 3ZYMA 5AQFB 4ASKA 5C8YE 4JI0T 3VHLA 3RH3A 3I0OA 3JC6C 3ZMZB 1OEDB 3RQWA 2DLRA 2KLQA 3VKGA 2E5LT 5CFBA 4YSYA 3KFWX 2LRLA 3B13A 3RYIE 4X1KE 3O9XA 3FHNA 2YKSA 4J2CA 2C5IT 4K0KT 5F5WA 3SRZA 5L3GB 4Z91A 3AEBA 3RIUC 2IMLA 5JVDE 2WDVA 2KINB 1YQ3A 4I0UA 3SFEA 3CQGB 4QX7B 4ZI3C 4ILBA 3FXDB 2FJBA 2CWYA
chains in the Genus database with same CATH topology
4OYJA 4BJMA 1FMVA 3NZQA 2Q9QA 3FBZA 1BR4A 4YJ2E 2SPCA 2KWHA 3PU3A 2BVLA 1BR1A 5L3DB 3CX6B 4I43B 1IJ5A 2EHOA 3ESLA 3Q9DA 3ZN0B 2ODUA 4TUYE 3PUAA 2VKOA 4YFSA 4MHCA 4UVBB 5CA1E 5HXEA 4DMVA 3C4WA 2A3DA 2Q9QB 2LSGA 4MBQA 4ZOLE 3KVAA 3FBLA 3BQIA 3E0ZA 5JQGE 2E8IA 1OWAA 2EHOB 4P0BA 2WBLA 5LBQB 2L8KA 3AVRA 5FXVA 3EDUA 2A2FX 3PU8A 1X79A 3OYXA 3K3OA 3S4UA 4EIWA 2WM9A 3EDVA 1LVKA 3H37A 4PJNA 4AQGA 3LBXB 4NUUA 5J1GA 2NTXA 3PUSA 2ZM0A 3T8OA 1H7CA 5KDMC 4O2AE 2KNDA 3ZN1B 3AAEB 3C51A 2PBIA 4H9NC 3RC3A 2CXDA 3BK9A 3J7Yq 4X1IE 3N9PA 5JDQA 2MYSA 2C0SA 5LA6E 2X9HA 4O4JE 4KP3C 4WBNE 4IE7A 1NWMX 4CI2B 2CCQA 4AKIA 3HL6A 3MACA 1S35A 3HKCE 2W00A 4IE5A 3V5SA 3ZJ1A 5H6RB 4DBRA 4EB6E 4H63H 2LSYA 3SOLA 2L3LA 3AA6B 5LG4A 5JDHA 3MA9A 4CI1B 2H7VC 3BQLA 2BZBA 2EHOC 2CMRA 4AXPA 2KXPB 2YU2A 3QC9A 1YKHB 2QGSA 4QXBB 4X20E 5TAOA 4I50E 5AFUL 1IAPA 3UULA 2YINA 1HFAA 4GOUA 2JMHA 4H9QC 1HG2A 2ZM2A 2H7OA 3NBXX 2V7MA 4EOZB 4DBQA 3N9QA 3ZMVB 2VB6A 3HA4A 2E9XD 3SS1A 4AKGA 3AB3B 4TV9E 4E7ZA 1HS7A 1QSDA 2IC6A 2XASB 3PUGA 5H6QB 5JR9A 3DJBA 4DNDA 5LNKA 3V5UA 4IDZA 2CLYC 3O4XE 2XTLA 2HH7A 3Q5XA 3LFMA 1LVFA 4AQFA 5J2TE 5LGUB 2N1GA 5LHHB 2XAHB 2WAUA 3FB2A 4AKRB 3O1JA 3AA7B 3HR0A 2NW8A 5KX5E 3HKBE 5JR9B 4H9RC 4IIJE 3TKLB 4UVAB 2X68A 3IF8B 5F3JA 4HFVA 3AAIA 3QUJA 2LOSA 4PJJA 3K8PC 3L09A 3N9OA 1D0YA 4GK0E 4TN7B 3EUHA 4OHFA 1D0ZA 2YK0A 4YLHA 4L0RA 1HG5A 2LE8A 3IEEA 4I4TE 4N78D 5JDFA 5CA0E 2ODVA 2JJ9A 1UCUA 4PK5A 4U74A 2NOXA 4WNKA 5LJMA 3UUNA 4UIGA 1G73A 4XZCA 4A56A 3ETVA 1ZKEA 4ZI2D 1ZV4X 4DMWA 2V1DB 5KMGP 3ANWB 1S94A 2IC9A 2MOZA 5HXRA 1WYBA 5JH7E 2K24A 2CEAA 1WYCA 3A5XA 4IGUA 1G8XA 3RYFE 4QXHB 3ZEFB 3L3PA 2WSSV 5L3BB 5LGTB 4AQFC 1U5PA 5ETWA 4EAHA 4P0AA 5FYMA 3DTOA 4ERRA 1Z0PA 4UEMA 1MNEA 2ZMAA 5FY0A 2XAFB 3UUMA 2XAJB 3LG7A 4UF0A 4MALA 2XUEA 5FXXA 3C64A 4L9IA 4EXTA 2LSJA 4H9SE 3CX8B 5FNVE 3LBXA 1SA0E 4HTEA 3M65A 4UF0B 5DQVA 3ZCJA 3I9WA 2LJLA 3WAJA 2MTQA 4GK5E 2CA5A 1FEWA 4H63V 4EYUA 3AVSA 4BJNA 4HGAA 4ISSA 3K3QC 4XBFB 1MMGA 5ADXL 5HXCA 3OBVE 2A72A 4JEHB 5FXZA 1D0XA 3HKDE 3JC6D 2UXNB 1IJ6A 3UUXB 1HTJF 4JLEA 2C5JA 2HPLA 3AA1B 3KV9A 4OK0A 4CXWA 5L3FB 5LXTE 1V9DA 4YHJA 5EK4A 3PURA 4QHOA 4HE8A 3UFEA 4O8SA 4P09A 3GN5A 4JEUB 2V7KA 3KV6A 4QXCB 3NRXA 4ISTA 2H3RA 4BAYB 2Q9QC 4KBMB 3KV5A 3KDSE 4HKAA 3NRYA 3ZC0A 3RPUA 3GN5B 2JMKA 1QUUA 5LJNA 2N9DA 3EVYA 3MK7C 2NW9A 2J1DG 4PW8A 1E1HB 4NUVA 2LM9A 2D2SA 4CI3B 2LOPA 2Y8DA 3KBUA 4I55E 4B6XA 3N2OA 2KT9A 4KUMB 3I1AA 3LK3B 3BQKA 3KV4A 4XAXB 3MJXA 4OFZA 3Q5WA 3SWHA 3ZMTB 2W63A 2QA7A 2P9BA 4WW0A 1MMAA 2NTYA 3F57A 3OKQA 4BA9A 1HF8A 1KK7A 2X9WA 3HI2A 4ZS2A 5JDNA 4AKLA 3KINB 4ZI3D 1FIOA 2C5KT 4L5GA 5JREA 4AI6A 3PDYA 3C4XA 1LRZA 5JDMA 2D5UA 5FY7A 4EYYR 4DVDA 2B1EA 5BMVE 3I9YA 3GMIA 4ZI7E 2D0UA 3C98B 2CE7A 3U78A 1B7TA 4ANJA 2VKJA 1O3XA 5DJQC 1LKXA 3WI3A 2E9XA 3W15B 4E7SA 2YEVC 2NP9A 3IHRA 5A1LA 1FMWA 1MIWA 1WLXA 3CKDA 3AA0B 4OYKA 4PAGA 4UVCB 2LEHA 3RYHE 2GK9A 2K5BB 2E9XB 2PFVA 3KBTA 4FI5A 2BDEA 4H9OC 4X1YE 5LP6E 1MNDA 2Z6EA 2PG8A 3P8CD 3ZLIA 4IE6A 4PNIA 1YKEB 3ETUA 1YW0A 2DHRA 5LGNB 4ILUA 2CXLA 5J2UE 3ANWA 2IAKA 2LSKA 2K9AA 4QWNB 4CQIA 2Y6XA 1UX4A 5DQWA 2NWBA 5HAXA 4FJOA 2JQQA 2D0TA 3K3NA 5HWYA 4ADZA 2M67A 3E08A 3OYZA 4F6RC 2X0LB 2BVMA 1HX8A 2X67A 4QX8B 2V26A 2XQYA 5HXHA 5JR9C 1NAFA 2UXXB 4UV9B 2VASA 3ZPOA 2RA1A 3NZPA 3ZCIA 4IHJE 3P7IA 4CXYA 2LT3A 5FXWA 2Q9QD 5IHYA 4PJMA 3B57A 3N2GE 1T98A 4C90A 4EZHA 2WMOA 2DNXA 2EHOD 2W0GA 4K0UA 5LHIB 2X9YA 5LOVE 2DCFA 4HEAA 3RRCA 1HCIA 2DWKA 2X66A 3R6NA 3ZMUB 2ES0A 2XHEB 4QKNA 5FP3A 4IE4A 5HXSA 3CX7B 2CXFA 2K48A 5LBMA 1Y64B 2XAGB 2WMNA 3N9NA 4YJ3E 2V7JA 2VK9A 1IZNB 3VKHA 4ZS3A 2VKDA 4PK4A 2W61A 3LK42 2LHNA 5JRCA 4DO0A 4ZHQE 3U3IA 5JDGA 2OA5A 3PE0A 2ZM8A 2CWOA 4UV8B 2KWIB 1US7B 1UX5A 4MFRA 4PFPA 2NW7A 1D1AA 4HN9A 1MIVA 3C50A 2X51A 3RYCE 1ZEEA 3ZYKA 5JRCB 3LK2B 5GONE 3CQCB 3PUQA 2W62A 4IE0A 1MMDA 3IBPA 1BR0A 2V7IA 4O4IE 3RKOA 3UTKA 2LSIA 2VL8A 5FMNA 5HYAA 1VOMA 4U72A 3ONXA 3O1IA 5EK3A 2XAQB 2JRKA 2PJQA 3O1HA 3WAKA 4O4LE 4ZI2C 4C91A 2ZLYA 5L3EB 3N9LA 3HKEE 2CLYB 3GA8A 4KMCA 4WBOA 2KMFA 3D0TA 4EZ4A 1SHZC 1YD8G 2IW5B 3ZC1A 3CMLA 1U4QA 1WRDA 1MMNA 3I0QA 4V1Av 2DI4A 3MZKB 4GYRA 2KZ7B 3CWZB 5EZYE 5L2LA 2VWAA 5EK2A 1EZ3A 2JPFA 4PJLA 3H3AA 3ZJ2A 3ZYLA 3OJAA 2G0UA 4GYSA 2I59A 3C4ZA 3MKDA 3ZMSB 2MBGA 3F31A 4UELA 3LJCA 4O2BE 3J9X1 4CZZB 3ZYMA 3R84B 3N5LA 3KVBA 5LHGB 4PK6A 2V7LA 5F8PA 4CXXA 2WWUA 4ASKA 5C8YE 3N2KE 3VHLA 3RH3A 3RC8A 2HPJA 5HWXA 4Z8XA 2ACXA 3I0OA 3JC6C 4MLKA 3ZMZB 5FY1A 2RP4A 2VKHA 3CQXC 2X9XA 3CPZA 3MXZA 1AJ3A 3RRWA 1BR2A 1WR6A 1ZHCA 3F2EA 3N9MA 5LYJE 4UXNB 5IYZE 1D1CA 2Y48B 2DLRA 2KLQA 5M4YA 3VKGA 2YU1A 3CVRA 1MIYA 1VRBA 4G63A 3KFWX 3B13A 3RYIE 4X1KE 2LHRA 4G2AA 3O9XA 3FHNA 3FXEB 5CB4E 4J2CA 4GIWA 4O4HE 2C5IT 3PTRB 4JUYA 4H9PC 2L9QA 3SRZA 5JDLA 5L3GB 2DWGA 4TV8E 4AKHA 3QK6A 4M1PA 1OXZA 3GWHA 1D1BA 5LCYA 2CM0A 5JVDE 4PFOA 5L3CB 2E9XC 2KINB 3RX6A 1KNZA 3AAAB 3E22E 3DP7A 4TZ4C 5DABA 3UT5E 1CUNA 3CQGB 4QX7B 4ZI3C 3VU7H 3FXDB 4TX5A 2N2NA 5E0OA 2CWYA 3Q2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7J A;  2X67 A;  5EK2 A;  4U72 A;  4HKA A;  5EK3 A;  5ETW A;  4PK5 A;  4U74 A;  1YW0 A;  2NOX A;  2NW9 A;  3BK9 A;  2NW8 A;  4PW8 A;  2D0U A;  2NW7 A;  2X68 A;  5EK4 A;  2V7M A;  2X66 A;  2NWB A;  1ZEE A;  2D0T A;  4PK6 A;  2V7L A;  3E08 A;  2V7K A;  2V7I A; 
#chains in the Genus database with same CATH topology
 4OYJ A;  1KNR A;  1J1J A;  2HN2 A;  1VCS A;  4I43 B;  1IJ5 A;  3ZN0 B;  4YFS A;  2J47 A;  2Q9Q B;  2LSG A;  3NWI A;  3KVA A;  3FBL A;  2WBL A;  4B3T T;  1IBL T;  2E2A A;  3PU8 A;  2WU2 A;  5AQP B;  4KI0 F;  4PJN A;  5J1G A;  3PUS A;  3RIF A;  3ZN1 B;  3CIR A;  1XNR T;  5LA6 E;  4WBN E;  2XQA A;  3HL6 A;  1S35 A;  2V5C A;  2W00 A;  4KHZ F;  5AQU B;  1KNP A;  3V5S A;  4H63 H;  4DV0 T;  5LG4 A;  5JDH A;  4EEB A;  4A5X A;  2KXP B;  2YU2 A;  3UFG A;  3UU8 A;  5AFU L;  3SFD A;  1WR0 A;  2YIN A;  1T72 A;  4GOU A;  2JMH A;  3NBX X;  3IA3 A;  3HA4 A;  3L39 A;  3SS1 A;  2MPK A;  2BS2 A;  4IT4 A;  5H6Q B;  4DND A;  2ACZ A;  4DR1 T;  4WYV A;  4IRE A;  2UUA T;  3HKB E;  2IUB A;  4HWI B;  3IF8 B;  3AAI A;  2YDR A;  1JNR A;  3EUH A;  3IEE A;  5HEU A;  4U74 A;  1XDP A;  4WNK A;  4XZC A;  2XY8 B;  4ZI2 D;  4X62 T;  2V1D B;  1WYB A;  3JAE A;  5JH7 E;  2K24 A;  3RYF E;  3ZEF B;  5L3B B;  2WSS V;  5FYM A;  2DL1 A;  2XAF B;  3LG7 A;  2BKO A;  3FZF B;  4EXT A;  3AE3 A;  2CHN A;  5AQS B;  4P1N A;  3QNU A;  4F8H A;  2LJL A;  2MTQ A;  1FEW A;  3VR8 A;  2XSA A;  4EYU A;  3AVS A;  4HGA A;  4XBF B;  2W2U A;  3ONL C;  1XWM A;  1D0X A;  2XQ4 A;  3UUX B;  2X0H A;  1UUR A;  5EK4 A;  3PUR A;  1NEN A;  4HE8 A;  3UFE A;  4ILA A;  4O8S A;  4P09 A;  1JNZ A;  2UU9 T;  2BS3 A;  4BAY B;  1I6Z A;  4HKA A;  3RPU A;  2V6Y A;  5FKY A;  5LJN A;  3EVY A;  4QH1 A;  2LM9 A;  4LF6 T;  4CI3 B;  3RKG A;  4KX6 A;  2Y8D A;  4KUM B;  3LSV A;  4DR6 T;  1T8B A;  3MJX A;  2XQ3 A;  2W63 A;  2P9B A;  1MMA A;  2NTY A;  3HI2 A;  1WCR A;  5JRE A;  1KEY A;  1LRZ A;  2BKN A;  4DVD A;  2BG9 C;  3ABV A;  3GMI A;  2D0U A;  3U78 A;  5DJQ C;  1LKX A;  2WU5 A;  2YEV C;  2NP9 A;  3TLV A;  4CN4 A;  4UVC B;  2YOE A;  4PAG A;  2GK9 A;  2K5B B;  4H9O C;  4X1Y E;  1MND A;  3ZST A;  4LMK A;  4PNI A;  5LGN B;  2LLY A;  5J2U E;  2IAK A;  4QWN B;  1UX4 A;  4FJO A;  2D0T A;  3E08 A;  4A98 A;  4KHP T;  3PUZ F;  2X67 A;  4QX8 B;  5JR9 C;  2XQY A;  1NAF A;  2RA1 A;  3P7I A;  4CXY A;  4AQY T;  4PJM A;  1WFD A;  3N2G E;  2DNX A;  2EHO D;  4K0U A;  5LHI B;  3ZMU B;  2WZH A;  4HEA A;  3CX7 B;  5LBM A;  2VKD A;  2W61 A;  3P4S A;  4HFH A;  3VR9 A;  4ZHQ E;  1UUS A;  5JDG A;  3X1D A;  2ZM8 A;  4UV8 B;  4X5T A;  3C50 A;  2CRB A;  1XMO T;  1ZEE A;  4TWH A;  5L4H A;  3PUQ A;  4U72 A;  5EK3 A;  4CN1 A;  2XAQ B;  4O4L E;  3AE2 A;  2CLY B;  3GA8 A;  2IDO B;  5AQK B;  4DV4 T;  2KMF A;  3D0T A;  1SHZ C;  3LDQ B;  3MZK B;  3CWZ B;  3PUY F;  1N33 T;  3ZJ2 A;  2RPA A;  4LF5 T;  3A7M A;  3ZMS B;  2MBG A;  3R84 B;  5LHG B;  4JI1 T;  2V7L A;  5F8P A;  2WWU A;  2FJD A;  3N2K E;  2ACX A;  1OED A;  5LB7 B;  1FJG T;  4MLK A;  2VKH A;  5HEG A;  1AJ3 A;  1WR6 A;  3PUV F;  3N9M A;  1D1C A;  4DR5 T;  3ZSS A;  2Y48 B;  1MIY A;  2LHR A;  3RI5 A;  4O4H E;  2VVN A;  3PTR B;  2YDQ A;  2DWG A;  3GWH A;  4U3C A;  5L3C B;  3TLW A;  2E9X C;  5CGM A;  3VU7 H;  2N2N A;  4HWF A;  4TWF A;  3Q2M A;  1OED C;  1OED E;  1W0A A;  4ZZC A;  2QRX A;  4BJM A;  1FMV A;  1J5E T;  2Q9Q A;  4JI2 T;  2SPC A;  1BR1 A;  5L3D B;  3CX6 B;  3ESL A;  3Q9D A;  2ODU A;  4UVB B;  5HXE A;  4MBQ A;  4ZOL E;  3BQI A;  4A97 A;  5JQG E;  3UQ7 A;  2EHO B;  4IL9 A;  5LBQ B;  2L8K A;  1W09 A;  4HFD A;  5ABE A;  3EDV A;  3H37 A;  3LBX B;  2ZM0 A;  4NXM T;  5KDM C;  4O2A E;  2KND A;  5LG3 A;  3FZM B;  3C51 A;  4H9N C;  2CXD A;  2V8S V;  4X1I E;  4X65 T;  5JDQ A;  2MYS A;  2W66 A;  4IE7 A;  1NWM X;  4CI2 B;  2CCQ A;  3MAC A;  4IDQ A;  5AQV B;  3ZJ1 A;  3PV0 F;  5H6R B;  4EB6 E;  5FVL A;  3SOL A;  2I6H A;  2L3L A;  4DR4 T;  3QC9 A;  5TAO A;  3P4Q A;  2ZM2 A;  2V7M A;  4EOZ B;  4DBQ A;  3N9Q A;  3ZMV B;  2VUR A;  4YTM A;  3AE5 A;  1HS7 A;  2XAS B;  3DJB A;  3V5U A;  3O4X E;  3LFM A;  4AQF A;  5LGU B;  2XAH B;  3AA7 B;  3TKL B;  5ABG A;  2NR4 A;  4UVA B;  1IBM T;  3QB5 K;  1D0Y A;  4TN7 B;  4OHF A;  5AQM B;  1HG5 A;  4ZEY A;  4N78 D;  3NKZ A;  1UCU A;  2NOX A;  1DU2 A;  5LJM A;  2XZE A;  4COF A;  4YSZ A;  3RGL A;  3ANW B;  4YXD A;  3ZT7 A;  1S94 A;  5HXR A;  2CEA A;  3A5X A;  3T1Y T;  4IGU A;  3QOF A;  4QXH B;  4JV5 T;  4AQF C;  4YT0 A;  1Z0P A;  1MNE A;  2ZMA A;  2CBI A;  4LF8 T;  2XUE A;  5FXX A;  3AE1 A;  3C64 A;  4L9I A;  4DV1 T;  2LSJ A;  3M65 A;  4UF0 B;  1YQ4 A;  5DQV A;  3AEC A;  3WAJ A;  5LMN T;  4GK5 E;  1N32 T;  4B3S T;  2QYW A;  4ISS A;  5ADX L;  4DV7 T;  5HXC A;  3OBV E;  2A72 A;  2XSB A;  2UXN B;  1IJ6 A;  4OK0 A;  2HPL A;  3KV9 A;  4QHO A;  2V6X A;  4QXC B;  3NRX A;  4IST A;  2H3R A;  4IL4 A;  2KSR A;  3KDS E;  4HFC A;  3P4P A;  2JMK A;  1QUU A;  1XMQ T;  3MK7 C;  2XM1 A;  1HNZ T;  1CHU A;  4PW8 A;  3LK3 B;  3Q5D A;  4XAX B;  1W9R A;  3ZMT B;  4WW0 A;  4HFE A;  4HFI A;  4BA9 A;  1KK7 A;  4ZZB A;  4ZS2 A;  4EGW A;  3KIN B;  3AED A;  4AI6 A;  4JYA T;  2V5D A;  5JDM A;  1X9B A;  2B1E A;  3I9Y A;  4ZI7 E;  4ANJ A;  3W15 B;  4E7S A;  2VL0 A;  1FMW A;  2VQF T;  3AA0 B;  2LEH A;  3RYH E;  2PFV A;  5LP6 E;  5AQT B;  3UU4 A;  4IE6 A;  1YKE B;  3ETU A;  1YW0 A;  2CXL A;  2LSK A;  5ABF B;  2XQ5 A;  3AE4 A;  3K3N A;  4ADZ A;  2M67 A;  5HXH A;  4DV2 T;  4HWC A;  1SUM B;  4IHJ E;  1W0B A;  4EZH A;  2W0G A;  5HEH A;  2X9Y A;  3A8Y C;  4HWH A;  3RRC A;  2XHE B;  4IDO A;  4IE4 A;  2WMN A;  2VK9 A;  3VKH A;  3LK4 2;  4DO0 A;  3U3I A;  2XQ6 A;  2NW7 A;  4HN9 A;  3RYC E;  3ZYK A;  2W62 A;  3IBP A;  2V7I A;  4O4I E;  3UTK A;  1HNX T;  3UQ4 A;  2W4X A;  5HYA A;  2JRK A;  5AQN B;  3WAK A;  4ZI2 C;  2ZLY A;  5L3E B;  3PUW F;  4JI5 T;  4LFA T;  4KMC A;  3ZC1 A;  4Z90 A;  3I0Q A;  4V1A v;  4ZXL A;  2KZ7 B;  3H3A A;  5ABH A;  1VCT A;  2I59 A;  3C4Z A;  3MKD A;  1KF6 A;  5L47 A;  3F31 A;  4CZZ B;  3N5L A;  3KVB A;  4LMJ A;  3RC8 A;  2HPJ A;  5HWX A;  4Z8X A;  5FY1 A;  3AXJ B;  3CQX C;  2X9X A;  3CPZ A;  3MXZ A;  1M62 A;  3AE7 A;  1BR2 A;  1ZHC A;  3F2E A;  5LYJ E;  3PJA J;  4UXN B;  5IYZ E;  3AEA A;  3CVR A;  1VRB A;  2WCA A;  3CK6 A;  4G2A A;  5CB4 E;  4JUY A;  5JDL A;  2L9Q A;  4AKH A;  3QK6 A;  4M1P A;  1OXZ A;  4PFO A;  3AAA B;  3E22 E;  4U31 A;  3UT5 E;  1CUN A;  4TX5 A;  2IHR 1;  4YJ2 E;  3AEF A;  4GKJ T;  2EHO A;  3PUA A;  2VKO A;  1L0V A;  4MHC A;  2A3D A;  3E0Z A;  2E8I A;  1OWA A;  3AVR A;  5FXV A;  1X79 A;  3K3O A;  3S4U A;  2WM9 A;  3H3M A;  4AQG A;  3OTO T;  3T8O A;  1H7C A;  2WY2 A;  3J7Y q;  2X9H A;  3EAB A;  2M6B A;  3ONJ A;  2XQ9 A;  2OLT A;  4IE5 A;  1HX1 B;  2BG9 B;  2AE9 A;  4Q25 A;  3AA6 B;  3MA9 A;  5AQL B;  1M7K A;  4U2Y A;  2H7V C;  3BQL A;  2EHO C;  2CMR A;  4AXP A;  3EI0 A;  4X20 E;  2QGS A;  3UUL A;  3PUX F;  2H7O A;  2E9X D;  1IBK T;  4E7Z A;  1QSD A;  2IC6 A;  3PUG A;  5LNK A;  4IDZ A;  2XTL A;  2HH7 A;  1LVF A;  5LHH B;  2N1G A;  2WAU A;  3FB2 A;  4AKR B;  5KX5 E;  2NW8 A;  5JR9 B;  1ZP0 A;  4IIJ E;  5AQQ B;  5AQJ B;  2LOS A;  4PJJ A;  3K8P C;  3N9O A;  4GK0 E;  1GQE A;  1D0Z A;  4L0R A;  2LE8 A;  4I4T E;  4DUY T;  3UUB A;  5CA0 E;  2ODV A;  2JJ9 A;  3TLS A;  4PK5 A;  5BR8 T;  3UUN A;  4UIG A;  1G73 A;  1ZKE A;  4DV6 T;  4LML A;  4OX9 T;  4YTN A;  5KMG P;  2IC9 A;  5HCJ A;  1WYC A;  1G8X A;  5LGT B;  2R6G F;  5FY0 A;  3UUM A;  2XAJ B;  4UF0 A;  4QH4 A;  4MAL A;  3AEE A;  4X64 T;  3CX8 B;  5FNV E;  1SA0 E;  3ZCJ A;  3I9W A;  2IIU A;  2H89 A;  4LF4 T;  4BJN A;  2UXC T;  4JEH B;  5FXZ A;  3JC6 D;  4JLE A;  2C5J A;  4CXW A;  2LKH A;  1V9D A;  2X0Y A;  3OVU A;  4JEU B;  3KV6 A;  4TWD A;  2FBW A;  2Q9Q C;  4IDP A;  3ZC0 A;  2QVA A;  3GN5 B;  3RF1 A;  5AQI B;  1E1H B;  2CHO A;  3EAM A;  4I55 E;  3KBU A;  3N2O A;  2KT9 A;  3I1A A;  4OFZ A;  3SWH A;  2JQ9 A;  2QA7 A;  3F57 A;  3OKQ A;  1HF8 A;  3L8R A;  5JDN A;  4AKL A;  4ZI3 D;  1FIO A;  3PDY A;  3C4X A;  4ILC A;  2D5U A;  4EYY R;  2CE7 A;  1B7T A;  2A9U A;  2VKJ A;  1O3X A;  3WI3 A;  4LFC T;  4QH5 A;  2XQ8 A;  3B5M A;  5A1L A;  3QB5 A;  3CKD A;  4OYK A;  5ABF A;  3Q5E A;  3KBT A;  4FI5 A;  2E9X B;  2YDS A;  3JAF A;  2Z6E A;  2PG8 A;  5HEJ A;  4CQI A;  2Y6X A;  5HAX A;  2JQQ A;  2AXD S;  2LKG A;  2XJ7 A;  3OYZ A;  2X0L B;  5J0Z A;  2JIW A;  2UXX B;  4DID B;  2VAS A;  3NZP A;  3K1S A;  3ZCI A;  4CN6 A;  4YY3 T;  2WMO A;  1XZY A;  1HCI A;  2X66 A;  4QKN A;  3UU5 A;  2OV9 A;  1Y64 B;  1IZN B;  4ZS3 A;  4YSX A;  2LHN A;  2OA5 A;  2CWO A;  2MAW A;  2XQ7 A;  1US7 B;  2K3W A;  4PFP A;  1D1A A;  1MIV A;  2LRK A;  4DR2 T;  5JRC B;  1Z8U A;  3RQU A;  3LK2 B;  5GON E;  5IUX A;  1MMD A;  1BR0 A;  2LSI A;  2VL8 A;  5FMN A;  2BS4 A;  3ZT5 A;  5AQO B;  4C91 A;  3N9L A;  3HKE E;  5FL0 A;  4EZ4 A;  1YD8 G;  3UU3 A;  1T7S A;  3CML A;  2J4G A;  1WRD A;  2M6I A;  2DI4 A;  4U2Z A;  5EZY E;  2VWA A;  4PJL A;  4GYS A;  3OPC A;  1ZOY A;  2CPT A;  2FJE A;  4JI7 T;  3LJC A;  4O2B E;  3J9X 1;  4JI3 T;  3AXJ A;  4PK6 A;  4WZX A;  4CXX A;  2E5V A;  2RP4 A;  2I0M A;  3RRW A;  2XM2 A;  2JQH A;  3RLF F;  1XNQ T;  4NXN T;  5M4Y A;  3T1H T;  2YU1 A;  4G63 A;  1I94 T;  3FXE B;  5AQG B;  4NPP A;  2JQK A;  4GIW A;  5JTG A;  4H9P C;  3NVO A;  4TV8 E;  3FZL B;  5KXJ A;  1D1B A;  5LCY A;  2CM0 A;  3AE6 A;  1Y01 A;  3RX6 A;  1KNZ A;  3DP7 A;  4TZ4 C;  2WDQ A;  5DAB A;  4LF9 T;  5E0O A;  4EED A;  1UGO A;  5HEO A;  3NZQ A;  3FBZ A;  1BR4 A;  2KWH A;  3PU3 A;  2BVL A;  2WS3 A;  4TUY E;  2BKP A;  5CA1 E;  4X66 T;  4DMV A;  3C4W A;  2BBJ A;  3G06 A;  2WDR A;  4TNV A;  4NIQ A;  3ZKR A;  5L4E A;  4P0B A;  3EDU A;  2A2F X;  4DR7 T;  3OYX A;  2B76 A;  4EIW A;  1LVK A;  4NUU A;  2NTX A;  2WZI A;  2FJA A;  2UUC T;  3AAE B;  3RHW A;  2PBI A;  3RC3 A;  3BK9 A;  3N9P A;  2BG9 A;  1J5W A;  2C0S A;  4O4J E;  2WP9 A;  1E2A A;  4KP3 C;  4AKI A;  3HKC E;  1SE7 A;  4DBR A;  2LSY A;  4CI1 B;  4LF7 T;  2BZB A;  3PJA A;  1YKH B;  4QXB B;  4I50 E;  1IAP A;  1HFA A;  4JI6 T;  4H9Q C;  1HG2 A;  4DR3 T;  2VB6 A;  4AKG A;  3AB3 B;  4TV9 E;  5JR9 A;  2CLY C;  3TLT A;  5FL1 A;  3Q5X A;  5J2T E;  2BG9 E;  4JI8 T;  3O1J A;  3HR0 A;  2PTF A;  2VQE T;  4H9R C;  2X68 A;  5F3J A;  4HFV A;  3QUJ A;  3L09 A;  1NEK A;  2YK0 A;  4YLH A;  3VRB A;  4HFB A;  5JDF A;  4AIU A;  4DUZ T;  1QLB A;  4B3M T;  4A56 A;  3ETV A;  1ZV4 X;  4DMW A;  5C2T A;  4YTP A;  4AIS A;  4YHH T;  1KFY A;  2MOZ A;  3FZK B;  3P4R A;  5CJ5 A;  4U7Y A;  3L3P A;  4EAH A;  1U5P A;  5ETW A;  4P0A A;  3DTO A;  4ERR A;  4UEM A;  2WB5 A;  5C3J A;  3AEG A;  3P50 A;  3M3Z B;  4H9S E;  3LBX A;  4HTE A;  2HN1 A;  2CA5 A;  4H63 V;  3K3Q C;  1MMG A;  2FUP A;  1UK5 A;  3ZT6 A;  3HKD E;  4JBW F;  1HTJ F;  3AA1 B;  5LXT E;  5L3F B;  4YHJ A;  1N34 T;  3GN5 A;  2V7K A;  4KBM B;  3KV5 A;  5AQH B;  3JCF A;  3NRY A;  2F4V T;  2N9D A;  3VRA A;  4DV5 T;  2NW9 A;  2J1D G;  4NUV A;  2D2S A;  2W67 A;  3P4W A;  5HCM A;  2LOP A;  4B6X A;  2V6Y B;  3BQK A;  1YXR A;  3KV4 A;  3Q5W A;  4TNW A;  2UXB T;  2UUB T;  2X9W A;  2LM2 A;  2C5K T;  4L5G A;  4UR9 A;  5FY7 A;  4U7I A;  5BMV E;  4GKK T;  3C98 B;  2CBJ A;  2E9X A;  2WWV A;  2J62 A;  4U33 A;  3IHR A;  1N36 T;  4EV6 A;  1MIW A;  1WLX A;  2BDE A;  5FVK A;  3ZLI A;  3P8C D;  2DHR A;  4ILU A;  3ANW A;  2K9A A;  3UU6 A;  5DQW A;  2NWB A;  5IWA T;  5HWY A;  4F6R C;  2BVM A;  1HX8 A;  2ZM6 T;  2V26 A;  1E7P A;  4UV9 B;  3ZPO A;  2LT3 A;  5FXW A;  2Q9Q D;  5IHY A;  3JAD A;  3B57 A;  1T98 A;  4C90 A;  2YN6 A;  5LOV E;  2DCF A;  3R6N A;  2DWK A;  2ES0 A;  5FP3 A;  5HXS A;  2CXF A;  2K48 A;  2UXD T;  3RIA A;  2XAG B;  3N9N A;  4YJ3 E;  2V7J A;  2D9D A;  5LMU T;  4PK4 A;  3AE9 A;  3EHZ A;  4DV3 T;  5JRC A;  3PE0 A;  2KWI B;  1UX5 A;  4MFR A;  2WQY A;  3TLU A;  4B3R T;  2X51 A;  4LFB T;  3CQC B;  4IE0 A;  3RKO A;  1VOM A;  2XPK A;  3ONX A;  3O1I A;  2PJQ A;  3O1H A;  1R8I A;  4JI4 T;  2HHH T;  2BBH A;  4WBO A;  2H88 A;  2IW5 B;  1U4Q A;  5AQR B;  1HR0 T;  1MMN A;  4HWD A;  3FZH B;  4GYR A;  1XDO A;  3AE8 A;  5L2L A;  5EK2 A;  1EZ3 A;  2JPF A;  3ZYL A;  2VVS A;  3OJA A;  2G0U A;  4IDN A;  3RIU A;  4UEL A;  1HNW T;  3ZYM A;  5AQF B;  4ASK A;  5C8Y E;  4JI0 T;  3VHL A;  3RH3 A;  3I0O A;  3JC6 C;  3ZMZ B;  1OED B;  3RQW A;  2DLR A;  2KLQ A;  3VKG A;  2E5L T;  5CFB A;  4YSY A;  3KFW X;  2LRL A;  3B13 A;  3RYI E;  4X1K E;  3O9X A;  3FHN A;  2YKS A;  4J2C A;  2C5I T;  4K0K T;  5F5W A;  3SRZ A;  5L3G B;  4Z91 A;  3AEB A;  3RIU C;  2IML A;  5JVD E;  2WDV A;  2KIN B;  1YQ3 A;  4I0U A;  3SFE A;  3CQG B;  4QX7 B;  4ZI3 C;  4ILB A;  3FXD B;  2FJB A;  2CWY A; 
#chains in the Genus database with same CATH homology
 4OYJ A;  4BJM A;  1FMV A;  3NZQ A;  2Q9Q A;  3FBZ A;  1BR4 A;  4YJ2 E;  2SPC A;  2KWH A;  3PU3 A;  2BVL A;  1BR1 A;  5L3D B;  3CX6 B;  4I43 B;  1IJ5 A;  2EHO A;  3ESL A;  3Q9D A;  3ZN0 B;  2ODU A;  4TUY E;  3PUA A;  2VKO A;  4YFS A;  4MHC A;  4UVB B;  5CA1 E;  5HXE A;  4DMV A;  3C4W A;  2A3D A;  2Q9Q B;  2LSG A;  4MBQ A;  4ZOL E;  3KVA A;  3FBL A;  3BQI A;  3E0Z A;  5JQG E;  2E8I A;  1OWA A;  2EHO B;  4P0B A;  2WBL A;  5LBQ B;  2L8K A;  3AVR A;  5FXV A;  3EDU A;  2A2F X;  3PU8 A;  1X79 A;  3OYX A;  3K3O A;  3S4U A;  4EIW A;  2WM9 A;  3EDV A;  1LVK A;  3H37 A;  4PJN A;  4AQG A;  3LBX B;  4NUU A;  5J1G A;  2NTX A;  3PUS A;  2ZM0 A;  3T8O A;  1H7C A;  5KDM C;  4O2A E;  2KND A;  3ZN1 B;  3AAE B;  3C51 A;  2PBI A;  4H9N C;  3RC3 A;  2CXD A;  3BK9 A;  3J7Y q;  4X1I E;  3N9P A;  5JDQ A;  2MYS A;  2C0S A;  5LA6 E;  2X9H A;  4O4J E;  4KP3 C;  4WBN E;  4IE7 A;  1NWM X;  4CI2 B;  2CCQ A;  4AKI A;  3HL6 A;  3MAC A;  1S35 A;  3HKC E;  2W00 A;  4IE5 A;  3V5S A;  3ZJ1 A;  5H6R B;  4DBR A;  4EB6 E;  4H63 H;  2LSY A;  3SOL A;  2L3L A;  3AA6 B;  5LG4 A;  5JDH A;  3MA9 A;  4CI1 B;  2H7V C;  3BQL A;  2BZB A;  2EHO C;  2CMR A;  4AXP A;  2KXP B;  2YU2 A;  3QC9 A;  1YKH B;  2QGS A;  4QXB B;  4X20 E;  5TAO A;  4I50 E;  5AFU L;  1IAP A;  3UUL A;  2YIN A;  1HFA A;  4GOU A;  2JMH A;  4H9Q C;  1HG2 A;  2ZM2 A;  2H7O A;  3NBX X;  2V7M A;  4EOZ B;  4DBQ A;  3N9Q A;  3ZMV B;  2VB6 A;  3HA4 A;  2E9X D;  3SS1 A;  4AKG A;  3AB3 B;  4TV9 E;  4E7Z A;  1HS7 A;  1QSD A;  2IC6 A;  2XAS B;  3PUG A;  5H6Q B;  5JR9 A;  3DJB A;  4DND A;  5LNK A;  3V5U A;  4IDZ A;  2CLY C;  3O4X E;  2XTL A;  2HH7 A;  3Q5X A;  3LFM A;  1LVF A;  4AQF A;  5J2T E;  5LGU B;  2N1G A;  5LHH B;  2XAH B;  2WAU A;  3FB2 A;  4AKR B;  3O1J A;  3AA7 B;  3HR0 A;  2NW8 A;  5KX5 E;  3HKB E;  5JR9 B;  4H9R C;  4IIJ E;  3TKL B;  4UVA B;  2X68 A;  3IF8 B;  5F3J A;  4HFV A;  3AAI A;  3QUJ A;  2LOS A;  4PJJ A;  3K8P C;  3L09 A;  3N9O A;  1D0Y A;  4GK0 E;  4TN7 B;  3EUH A;  4OHF A;  1D0Z A;  2YK0 A;  4YLH A;  4L0R A;  1HG5 A;  2LE8 A;  3IEE A;  4I4T E;  4N78 D;  5JDF A;  5CA0 E;  2ODV A;  2JJ9 A;  1UCU A;  4PK5 A;  4U74 A;  2NOX A;  4WNK A;  5LJM A;  3UUN A;  4UIG A;  1G73 A;  4XZC A;  4A56 A;  3ETV A;  1ZKE A;  4ZI2 D;  1ZV4 X;  4DMW A;  2V1D B;  5KMG P;  3ANW B;  1S94 A;  2IC9 A;  2MOZ A;  5HXR A;  1WYB A;  5JH7 E;  2K24 A;  2CEA A;  1WYC A;  3A5X A;  4IGU A;  1G8X A;  3RYF E;  4QXH B;  3ZEF B;  3L3P A;  2WSS V;  5L3B B;  5LGT B;  4AQF C;  1U5P A;  5ETW A;  4EAH A;  4P0A A;  5FYM A;  3DTO A;  4ERR A;  1Z0P A;  4UEM A;  1MNE A;  2ZMA A;  5FY0 A;  2XAF B;  3UUM A;  2XAJ B;  3LG7 A;  4UF0 A;  4MAL A;  2XUE A;  5FXX A;  3C64 A;  4L9I A;  4EXT A;  2LSJ A;  4H9S E;  3CX8 B;  5FNV E;  3LBX A;  1SA0 E;  4HTE A;  3M65 A;  4UF0 B;  5DQV A;  3ZCJ A;  3I9W A;  2LJL A;  3WAJ A;  2MTQ A;  4GK5 E;  2CA5 A;  1FEW A;  4H63 V;  4EYU A;  3AVS A;  4BJN A;  4HGA A;  4ISS A;  3K3Q C;  4XBF B;  1MMG A;  5ADX L;  5HXC A;  3OBV E;  2A72 A;  4JEH B;  5FXZ A;  1D0X A;  3HKD E;  3JC6 D;  2UXN B;  1IJ6 A;  3UUX B;  1HTJ F;  4JLE A;  2C5J A;  2HPL A;  3AA1 B;  3KV9 A;  4OK0 A;  4CXW A;  5L3F B;  5LXT E;  1V9D A;  4YHJ A;  5EK4 A;  3PUR A;  4QHO A;  4HE8 A;  3UFE A;  4O8S A;  4P09 A;  3GN5 A;  4JEU B;  2V7K A;  3KV6 A;  4QXC B;  3NRX A;  4IST A;  2H3R A;  4BAY B;  2Q9Q C;  4KBM B;  3KV5 A;  3KDS E;  4HKA A;  3NRY A;  3ZC0 A;  3RPU A;  3GN5 B;  2JMK A;  1QUU A;  5LJN A;  2N9D A;  3EVY A;  3MK7 C;  2NW9 A;  2J1D G;  4PW8 A;  1E1H B;  4NUV A;  2LM9 A;  2D2S A;  4CI3 B;  2LOP A;  2Y8D A;  3KBU A;  4I55 E;  4B6X A;  3N2O A;  2KT9 A;  4KUM B;  3I1A A;  3LK3 B;  3BQK A;  3KV4 A;  4XAX B;  3MJX A;  4OFZ A;  3Q5W A;  3SWH A;  3ZMT B;  2W63 A;  2QA7 A;  2P9B A;  4WW0 A;  1MMA A;  2NTY A;  3F57 A;  3OKQ A;  4BA9 A;  1HF8 A;  1KK7 A;  2X9W A;  3HI2 A;  4ZS2 A;  5JDN A;  4AKL A;  3KIN B;  4ZI3 D;  1FIO A;  2C5K T;  4L5G A;  5JRE A;  4AI6 A;  3PDY A;  3C4X A;  1LRZ A;  5JDM A;  2D5U A;  5FY7 A;  4EYY R;  4DVD A;  2B1E A;  5BMV E;  3I9Y A;  3GMI A;  4ZI7 E;  2D0U A;  3C98 B;  2CE7 A;  3U78 A;  1B7T A;  4ANJ A;  2VKJ A;  1O3X A;  5DJQ C;  1LKX A;  3WI3 A;  2E9X A;  3W15 B;  4E7S A;  2YEV C;  2NP9 A;  3IHR A;  5A1L A;  1FMW A;  1MIW A;  1WLX A;  3CKD A;  3AA0 B;  4OYK A;  4PAG A;  4UVC B;  2LEH A;  3RYH E;  2GK9 A;  2K5B B;  2E9X B;  2PFV A;  3KBT A;  4FI5 A;  2BDE A;  4H9O C;  4X1Y E;  5LP6 E;  1MND A;  2Z6E A;  2PG8 A;  3P8C D;  3ZLI A;  4IE6 A;  4PNI A;  1YKE B;  3ETU A;  1YW0 A;  2DHR A;  5LGN B;  4ILU A;  2CXL A;  5J2U E;  3ANW A;  2IAK A;  2LSK A;  2K9A A;  4QWN B;  4CQI A;  2Y6X A;  1UX4 A;  5DQW A;  2NWB A;  5HAX A;  4FJO A;  2JQQ A;  2D0T A;  3K3N A;  5HWY A;  4ADZ A;  2M67 A;  3E08 A;  3OYZ A;  4F6R C;  2X0L B;  2BVM A;  1HX8 A;  2X67 A;  4QX8 B;  2V26 A;  2XQY A;  5HXH A;  5JR9 C;  1NAF A;  2UXX B;  4UV9 B;  2VAS A;  3ZPO A;  2RA1 A;  3NZP A;  3ZCI A;  4IHJ E;  3P7I A;  4CXY A;  2LT3 A;  5FXW A;  2Q9Q D;  5IHY A;  4PJM A;  3B57 A;  3N2G E;  1T98 A;  4C90 A;  4EZH A;  2WMO A;  2DNX A;  2EHO D;  2W0G A;  4K0U A;  5LHI B;  2X9Y A;  5LOV E;  2DCF A;  4HEA A;  3RRC A;  1HCI A;  2DWK A;  2X66 A;  3R6N A;  3ZMU B;  2ES0 A;  2XHE B;  4QKN A;  5FP3 A;  4IE4 A;  5HXS A;  3CX7 B;  2CXF A;  2K48 A;  5LBM A;  1Y64 B;  2XAG B;  2WMN A;  3N9N A;  4YJ3 E;  2V7J A;  2VK9 A;  1IZN B;  3VKH A;  4ZS3 A;  2VKD A;  4PK4 A;  2W61 A;  3LK4 2;  2LHN A;  5JRC A;  4DO0 A;  4ZHQ E;  3U3I A;  5JDG A;  2OA5 A;  3PE0 A;  2ZM8 A;  2CWO A;  4UV8 B;  2KWI B;  1US7 B;  1UX5 A;  4MFR A;  4PFP A;  2NW7 A;  1D1A A;  4HN9 A;  1MIV A;  3C50 A;  2X51 A;  3RYC E;  1ZEE A;  3ZYK A;  5JRC B;  3LK2 B;  5GON E;  3CQC B;  3PUQ A;  2W62 A;  4IE0 A;  1MMD A;  3IBP A;  1BR0 A;  2V7I A;  4O4I E;  3RKO A;  3UTK A;  2LSI A;  2VL8 A;  5FMN A;  5HYA A;  1VOM A;  4U72 A;  3ONX A;  3O1I A;  5EK3 A;  2XAQ B;  2JRK A;  2PJQ A;  3O1H A;  3WAK A;  4O4L E;  4ZI2 C;  4C91 A;  2ZLY A;  5L3E B;  3N9L A;  3HKE E;  2CLY B;  3GA8 A;  4KMC A;  4WBO A;  2KMF A;  3D0T A;  4EZ4 A;  1SHZ C;  1YD8 G;  2IW5 B;  3ZC1 A;  3CML A;  1U4Q A;  1WRD A;  1MMN A;  3I0Q A;  4V1A v;  2DI4 A;  3MZK B;  4GYR A;  2KZ7 B;  3CWZ B;  5EZY E;  5L2L A;  2VWA A;  5EK2 A;  1EZ3 A;  2JPF A;  4PJL A;  3H3A A;  3ZJ2 A;  3ZYL A;  3OJA A;  2G0U A;  4GYS A;  2I59 A;  3C4Z A;  3MKD A;  3ZMS B;  2MBG A;  3F31 A;  4UEL A;  3LJC A;  4O2B E;  3J9X 1;  4CZZ B;  3ZYM A;  3R84 B;  3N5L A;  3KVB A;  5LHG B;  4PK6 A;  2V7L A;  5F8P A;  4CXX A;  2WWU A;  4ASK A;  5C8Y E;  3N2K E;  3VHL A;  3RH3 A;  3RC8 A;  2HPJ A;  5HWX A;  4Z8X A;  2ACX A;  3I0O A;  3JC6 C;  4MLK A;  3ZMZ B;  5FY1 A;  2RP4 A;  2VKH A;  3CQX C;  2X9X A;  3CPZ A;  3MXZ A;  1AJ3 A;  3RRW A;  1BR2 A;  1WR6 A;  1ZHC A;  3F2E A;  3N9M A;  5LYJ E;  4UXN B;  5IYZ E;  1D1C A;  2Y48 B;  2DLR A;  2KLQ A;  5M4Y A;  3VKG A;  2YU1 A;  3CVR A;  1MIY A;  1VRB A;  4G63 A;  3KFW X;  3B13 A;  3RYI E;  4X1K E;  2LHR A;  4G2A A;  3O9X A;  3FHN A;  3FXE B;  5CB4 E;  4J2C A;  4GIW A;  4O4H E;  2C5I T;  3PTR B;  4JUY A;  4H9P C;  2L9Q A;  3SRZ A;  5JDL A;  5L3G B;  2DWG A;  4TV8 E;  4AKH A;  3QK6 A;  4M1P A;  1OXZ A;  3GWH A;  1D1B A;  5LCY A;  2CM0 A;  5JVD E;  4PFO A;  5L3C B;  2E9X C;  2KIN B;  3RX6 A;  1KNZ A;  3AAA B;  3E22 E;  3DP7 A;  4TZ4 C;  5DAB A;  3UT5 E;  1CUN A;  3CQG B;  4QX7 B;  4ZI3 C;  3VU7 H;  3FXD B;  4TX5 A;  2N2N A;  5E0O A;  2CWY A;  3Q2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...