4PW8A

Human tryptophan 2,3-dioxygenase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
342
structure length
306
Chain Sequence
IYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSRYKVFVDLFNLSTYLIPRHWIPKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Structural and functional analyses of human tryptophan 2,3-dioxygenase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 122
structure length 306
sequence length 342
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pw8A01
2NW8A 2NWBA 2NOXA 2X68A 2X67A 5EK2A 4PK6A 5EK3A 2NW9A 4U72A 1ZEEA 3E08A 2V7IA 4HKAA 5EK4A 2NW7A 2V7LA 4PW8A 4PK5A 2V7MA 5ETWA 2D0TA 4U74A 1YW0A 2X66A 2D0UA 2V7KA 2V7JA 3BK9A
chains in the Genus database with same CATH superfamily
3ONJA 4UV9B 5JTGA 3PV0F 4IE6A 4WYVA 5TAOA 3TLVA 3VR8A 4YSZA 4HFIA 3RYIE 1WR6A 2N2NA 1VOMA 2UXDT 2N1GA 5LG4A 2I59A 3M65A 2WBLA 5C8YE 3RH3A 4B6XA 4AQYT 4X1YE 3I0QA 4ZI7E 3WAJA 4AKHA 2CXDA 3VR9A 5BR8T 2LSKA 4EZ4A 2X9HA 2W66A 4NIQA 4AI6A 2BS4A 5CFBA 5LHIB 2EHOB 1ZKEA 5A1LA 4MBQA 4B3MT 1SHZC 3UFGA 4WNKA 3ZC1A 4DR6T 3IEEA 5JVDE 1UK5A 2IHR1 2KT9A 2YK0A 3ETVA 2CLYB 4GKJT 4UELA 1IZNB 4EEDA 3GWHA 2YKSA 3E22E 4H63H 5FMNA 3MKDA 4EYUA 3EDUA 1U5PA 5LBQB 4CI3B 2PG8A 1H7CA 4PNIA 4O4HE 4LMLA 3C98B 4QH1A 4O4JE 5AQIB 2N9DA 4LF9T 5FYMA 3SFEA 3IF8B 2YEVC 4P0AA 1ZV4X 5BMVE 3N9MA 2VASA 1FJGT 4NUUA 4YTPA 2XM1A 2LHNA 3CWZB 5FY0A 2LSGA 2BZBA 3QB5A 2C5IT 3CPZA 3O1IA 4EEBA 3LJCA 3LFMA 2Y48B 2DNXA 4P0BA 4NUVA 3RIFA 4ISSA 3CX8B 3J9X1 4OFZA 4GYSA 5LGNB 2Z6EA 2V8SV 2V7MA 3UU3A 2HHHT 4XZCA 1XWMA 2BBJA 3C4ZA 1HNXT 2NP9A 2XAHB 3EAMA 3LSVA 1D0XA 4BAYB 5JRCB 3W15B 2CMRA 4DR4T 4KI0F 2Q9QA 3Q2MA 4I43B 1YQ3A 2IC9A 4B3TT 2K24A 4JYAT 2BVLA 4IE7A 2NWBA 3FZLB 4ILBA 1BR4A 3LK2B 2PFVA 1OEDB 3RX6A 4N78D 2WCAA 2J1DG 2JMKA 3DP7A 2E2AA 2G0UA 5LGTB 2V6XA 4EYYR 2LHRA 2YN6A 5FNVE 4PFPA 4JI2T 3P50A 2J47A 2UUAT 4CI1B 4LF5T 4U7IA 1IJ6A 4JUYA 3ZN0B 2H88A 4K0UA 4J2CA 3QC9A 4X1KE 2H89A 5HXSA 2JIWA 3ETUA 2XQYA 1ZHCA 2XHEB 5DQWA 5HXEA 3FBZA 3ZJ2A 1VRBA 3P7IA 4QX8B 3VU7H 3LK42 3F57A 3AAEB 3MK7C 4TN7B 3RYHE 1KK7A 3GA8A 2MBGA 3PJAJ 5HCJA 2LSYA 5EK3A 3MA9A 5J2TE 2WZHA 5L4EA 4OX9T 2W61A 4ZHQE 2XJ7A 2WM9A 4JI6T 4EOZB 3R6NA 5HXCA 3RRCA 1HCIA 1QLBA 5FXXA 4HFBA 1IBMT 3EI0A 4DBRA 4KBMB 4G63A 5AQVB 1HFAA 3Q5WA 1JNRA 3I1AA 4B3RT 2CRBA 2I6HA 2HH7A 2CM0A 4I4TE 1T72A 3Q5DA 3C51A 1DU2A 3QOFA 3ANWB 4KHPT 5L3EB 4EIWA 2NW7A 1N32T 2LKHA 4X66T 3SRZA 3NBXX 4LF6T 4X65T 4EXTA 5AQSB 5L47A 2XAJB 5J0ZA 3ZT7A 2VL0A 2NW8A 4HWCA 2W2UA 4H9OC 1CUNA 2WDRA 5FKYA 3MZKB 2WDVA 3CQCB 3RI5A 4ERRA 3N2OA 2IIUA 3AE9A 1T98A 3FXEB 3L3PA 1S94A 4QWNB 4BJMA 3O1JA 4X5TA 4CQIA 5FXWA 4JEUB 5AQFB 3ZSTA 5AQPB 1N34T 4U33A 4CN4A 4ILCA 1MMAA 3QB5K 3OBVE 4BA9A 5LXTE 3N2KE 4IHJE 3P4SA 2NTXA 4A98A 5LCYA 5JR9C 3D0TA 3SWHA 3VKHA 2EHOC 2W0GA 2OV9A 4XBFB 4L5GA 1WRDA 4EZHA 2UXNB 3AE8A 2CHNA 1I6ZA 4G2AA 3KV4A 4GKKT 4P1NA 5L2LA 2XUEA 2CLYC 3R84B 3ZYLA 4F6RC 3NRXA 4UR9A 4ZI2D 2VK9A 2CBIA 4MLKA 5CB4E 5ABFA 4O2BE 4PAGA 4KX6A 2V7KA 5M4YA 2H7VC 3LDQB 1Y01A 2LJLA 2K48A 1LKXA 3AA1B 4H9PC 3N9QA 2IDOB 2WB5A 3TLTA 5LP6E 4DUZT 2QRXA 3RKOA 1ZOYA 4I55E 2XQ8A 4JV5T 3B5MA 1YXRA 2J4GA 4CXYA 4ZZCA 3CQGB 1X9BA 3M3ZB 2V7LA 2WU2A 5IHYA 5JDFA 2VWAA 5AQMB 4DBQA 3LG7A 2LOPA 5FXVA 3FZHB 2VVNA 2EHOD 5LNKA 3PTRB 3ZN1B 3S4UA 4DMVA 1G8XA 5AQGB 2IC6A 4A56A 2FJBA 4C91A 3AE7A 2JQQA 2JQHA 5LMUT 4I0UA 4HWFA 3HA4A 3NVOA 1KFYA 2L8KA 2WMOA 1OEDE 2D0TA 4OYKA 1MIVA 5FL0A 2MOZA 4OK0A 2WQYA 5HWXA 4O4LE 2XAQB 3N5LA 3PU8A 1VCSA 5AQUB 1VCTA 2P9BA 1B7TA 2AXDS 2XQ7A 1HTJF 3PUSA 3K3NA 5LA6E 2KINB 2BKOA 3AEFA 3NRYA 3UULA 3VRBA 4TNWA 2QGSA 3DJBA 5E0OA 2HPLA 3TLSA 4PFOA 1SE7A 4HFDA 1HR0T 1HG2A 3AB3B 3RC8A 4TNVA 3GMIA 2HN1A 4YTNA 4CXXA 3HKEE 2LKGA 2K5BB 4HE8A 2V26A 3MJXA 4DR5T 2BBHA 1WFDA 3PURA 3RRWA 2C5KT 3AE1A 3RKGA 2KXPB 2V5DA 2V7JA 5AQNB 2WZIA 3A5XA 2ACXA 2BDEA 2DHRA 2VVSA 4JI3T 4DV4T 1G73A 4JI1T 2D9DA 3FXDB 4ZZBA 1OWAA 3RF1A 1HS7A 1W9RA 2XSAA 5CA1E 2C5JA 3TLWA 2CBJA 2V7IA 1IJ5A 5EK4A 2FJEA 3PUVF 2V6YA 1XDPA 1XDOA 2LM2A 2XSBA 3ZC0A 2YDQA 1OXZA 4WBOA 3F31A 5DQVA 3LBXA 4QH5A 3UU6A 4WBNE 3FZFB 2JMHA 4U2ZA 5FVKA 2W00A 3FBLA 4DR1T 1EZ3A 3T1HT 2MPKA 2ZM0A 5EZYE 4HFEA 1BR1A 1E7PA 2E9XA 4ISTA 3GN5B 3AEEA 5AQHB 5CA0E 3MXZA 4IDPA 2WAUA 2CXLA 1W0BA 4YFSA 3RYCE 2LEHA 4DV7T 3UU8A 4DMWA 3ZMTB 3PUAA 3AE3A 3X1DA 4PJMA 4DVDA 4UV8B 4ZS2A 4YHHT 4LF8T 4EV6A 1FIOA 5L3BB 2KWHA 4UXNB 3P4PA 1R8IA 2WWVA 5LHGB 1KEYA 4QXCB 3RGLA 4AQFA 4EAHA 3ZMVB 4DR2T 2X51A 1QSDA 4YSXA 1V9DA 4X62T 4NXNT 3TLUA 1I94T 4OYJA 3HI2A 4H9NC 3T1YT 2YDRA 2X9XA 4COFA 2W63A 5JDHA 2UXBT 5JR9A 2PJQA 2EHOA 1NWMX 2X0YA 3KV5A 4Z8XA 2UUBT 3AXJA 3VRAA 1YW0A 2XQ5A 1D1AA 1JNZA 3P4QA 3EHZA 3UUBA 5AQRB 2JRKA 1LRZA 3LK3B 3BQKA 3CK6A 2YU1A 5F3JA 4HGAA 1LVKA 4IE5A 1WR0A 5JDGA 1BR2A 3ABVA 1N33T 4IDNA 3KDSE 4H9QC 4QKNA 2K9AA 4LMJA 3SS1A 4V1Av 4H9SE 3AA6B 2V5CA 2A3DA 5FY7A 3KINB 1AJ3A 1KNZA 4LFCT 3K3QC 2NR4A 5J2UE 4ZI3C 4IGUA 4U72A 1WLXA 5AQQB 5CGMA 3K1SA 4ZS3A 4DIDB 5GONE 1MNEA 4Z91A 3ZMUB 2BG9B 4YY3T 4CXWA 2BKPA 5JDLA 1Z8UA 2B76A 3HKBE 4UF0B 4ZI2C 3JC6D 1NEKA 3ZJ1A 2A72A 5ADXL 4JI0T 4LF4T 5JDNA 4U2YA 2X0LB 3PUZF 4BJNA 2CE7A 3AEDA 2RP4A 1NENA 5IUXA 2XASB 2JPFA 4TWHA 2ACZA 1UX4A 2VKHA 5DJQC 1XMOT 3PUXF 3UU5A 2OLTA 2XQ6A 2LSJA 3O1HA 4CN6A 3UFEA 2CHOA 2I0MA 3ESLA 2LRLA 5F5WA 4DV2T 1UX5A 2YDSA 1MIYA 4O8SA 3JAFA 2XQ9A 2ZM6T 3NZQA 4IREA 3CMLA 1J5WA 1J1JA 1YKHB 5HEUA 5ABGA 1UCUA 3V5SA 4ZI3D 2PTFA 2DLRA 1T8BA 5DABA 5AFUL 5LJNA 4TV9E 1XMQT 4TV8E 3FZMB 2WU5A 2NOXA 1WCRA 3KBTA 3N9PA 1XNRT 4PJLA 4E7ZA 4F8HA 5HEHA 3SFDA 4Q25A 3IBPA 3NZPA 2VB6A 3PUQA 2X9WA 5L4HA 3OYXA 5F8PA 4MALA 3QK6A 3O9XA 5AQLB 4HWDA 2W62A 2W67A 1L0VA 4JI7T 4L0RA 3KV9A 4JI5T 4DNDA 3UUNA 4KUMB 2WY2A 2VQET 4P09A 4U31A 4HFVA 3KFWX 3AA0B 2QVAA 5HCMA 4MHCA 2V6YB 3AE2A 2SPCA 3AVRA 5LBMA 4GYRA 4KMCA 3SOLA 4TWDA 3C4WA 3Q5EA 1D1BA 2M6IA 4DV0T 4AKRB 3ZLIA 2XTLA 2RA1A 3DTOA 3F2EA 3ZT5A 4ZXLA 1XNQT 3NWIA 5KMGP 3L09A 4X1IE 2E9XB 2NTYA 2L3LA 1UURA 3QNUA 4QHOA 3B57A 2Q9QB 4C90A 3AVSA 2PBIA 1HG5A 2FBWA 2YU2A 3A8YC 4TUYE 3UQ4A 2OA5A 2JQ9A 1KNPA 5H6QB 2XM2A 4A97A 2IAKA 4KHZF 3JCFA 2BS3A 1E1HB 2IW5B 2VL8A 3ONXA 1OEDC 2VQFT 3CQXC 2MTQA 4HFHA 3RQWA 5L3FB 4GOUA 1SUMB 2M6BA 4X64T 4AKGA 1FMVA 2CXFA 5ABEA 3QUJA 4O4IE 3VHLA 5C2TA 4DR3T 4M1PA 2KNDA 2XQAA 4IL9A 2UXCT 5HEOA 2LE8A 2LSIA 2X67A 2VURA 2LOSA 3OVUA 3I9WA 3ZKRA 1SA0E 4ILAA 2KWIB 2E5VA 2W4XA 3CIRA 2FJDA 2VKOA 3A7MA 5HEGA 3JAEA 3ONLC 4DO0A 4NPPA 1O3XA 2DCFA 4NXMT 5JR9B 2LT3A 4AQGA 2X0HA 5L3GB 4YHJA 4PK6A 4DV6T 3KV6A 3AXJB 3FHNA 3CVRA 3PDYA 2K3WA 3EUHA 4AIUA 1N36T 3V5UA 2KSRA 4PW8A 4PJJA 2M67A 5ETWA 1HNWT 2VKJA 3I0OA 3ZEFB 5LHHB 3UU4A 3WAKA 1Y64B 3BK9A 2H3RA 2CCQA 4XAXB 4WZXA 2JJ9A 2ODUA 4UVAB 2E5LT 5JDMA 3RLFF 3UUMA 2RPAA 2Y6XA 1MNDA 4U74A 4UVCB 2GK9A 4L9IA 2BS2A 3JADA 2BG9E 3TKLB 3RIUC 5FP3A 3PUGA 4FJOA 4HTEA 4AXPA 1E2AA 4K0KT 4X20E 2BG9C 1XZYA 4MFRA 1HNZT 2UUCT 3PJAA 2DL1A 4ZOLE 4AKIA 1D1CA 2DI4A 3BQLA 2KZ7B 2CEAA 1W0AA 4DR7T 2ZM2A 2C0SA 3AAIA 5C3JA 3H3MA 3H3AA 3L8RA 5LJMA 1WYCA 3ZSSA 4QXHB 2V1DB 1YQ4A 4GK0E 5KX5E 2FUPA 3C50A 1MMNA 5FXZA 4QH4A 1HF8A 4UIGA 5H6RB 3N9NA 4ZEYA 3HKCE 4CZZB 2XAFB 3EDVA 2XY8B 3ZCJA 3N9OA 5EK2A 2FJAA 2R6GF 1X79A 3EABA 2ODVA 1FEWA 3FB2A 1T7SA 2QYWA 1S35A 3K3OA 5AQOB 1MMGA 3AECA 2BKNA 4HFCA 3AAAB 3RYFE 3PE0A 4WW0A 4EB6E 3OJAA 2XZEA 1ZP0A 3JC6C 5HXHA 4ADZA 5HXRA 1ZEEA 2H7OA 5LGUB 3UQ7A 3J7Yq 1M7KA 3O4XE 3UT5E 1J5ET 3CX7B 4IE4A 2A2FX 1IAPA 2DWGA 3OPCA 1YKEB 3KBUA 4YLHA 3I9YA 3IHRA 3P4WA 5CJ5A 4QXBB 4YXDA 4GIWA 5ABFB 2D5UA 1BR0A 2KLQA 3VKGA 2B1EA 2UU9T 4YT0A 4FI5A 2BVMA 3CKDA 5JDQA 2X68A 4B3ST 4OHFA 4IT4A 2NW9A 3E08A 2ES0A 4ILUA 5L3DB 2CA5A 3ZPOA 3U3IA 4JEHB 1WYBA 3AA7B 2JQKA 4TZ4C 3RPUA 2L9QA 4TWFA 5LYJE 2J62A 3AEBA 3UTKA 3HR0A 4CI2B 3OTOT 3OKQA 1UGOA 3B13A 1MIWA 1FMWA 3L39A 2HN2A 4HN9A 2XPKA 4UVBB 3UUXB 2E9XC 3IA3A 5J1GA 3AE5A 4PK5A 2MYSA 3BQIA 2WSSV 4H63V 1W09A 2Q9QC 1QUUA 4Z90A 5IWAT 2WWUA 3PUYF 2XQ3A 4DUYT 2VKDA 1LVFA 2IMLA 3E0ZA 5HEJA 5JREA 3P8CD 3ZYMA 4IDQA 2D2SA 1KNRA 2IUBA 2X66A 5HYAA 2Y8DA 3OYZA 4LF7T 4ASKA 1HX1B 2WMNA 2KMFA 3RQUA 2E8IA 3N2GE 3Q5XA 3KVBA 5AQJB 3GN5A 4IDOA 3G06A 3FZKB 3ZT6A 5HAXA 4LFAT 3AEAA 5JRCA 4AQFC 1D0ZA 3ZYKA 3EVYA 1NAFA 4CN1A 5AQTB 1M62A 3MACA 4JI8T 3HKDE 3ZMZB 2CPTA 4YTMA 2UXXB 1IBLT 4LMKA 4KP3C 4EGWA 3PU3A 2ZMAA 1HX8A 2X9YA 3N9LA 3CX6B 1OEDA 5KXJA 5LG3A 4DV5T 2MAWA 2HPJA 4HWIB 4IE0A 2LRKA 1GQEA 3WI3A 2QA7A 4HEAA 2XAGB 4LFBT 4AISA 2LM9A 1UUSA 5FY1A 5FVLA 2E9XD 2D0UA 2CWYA 1US7B 2XQ4A 2ZLYA 3T8OA 4U3CA 2Q9QD 5L3CB 4IDZA 4HKAA 4I50E 2WDQA 5HWYA 3PUWF 3P4RA 4IL4A 1CHUA 4TX5A 4JI4T 4AKLA 3AE4A 3AE6A 3HL6A 4PK4A 4A5XA 4PJNA 4JBWF 3U78A 5LMNT 5LB7B 4UEMA 4E7SA 2DWKA 4ANJA 2WS3A 3C4XA 4IIJE 3K8PC 3LBXB 4H9RC 4DV3T 2CWOA 3H37A 5LOVE 5AQKB 3NKZA 2ZM8A 1IBKT 2A9UA 5KDMC 4YJ2E 5ABHA 1YD8G 4QX7B 3KVAA 1KF6A 3RIUA 2LLYA 3ANWA 3AEGA 4O2AE 3RC3A 4YSYA 4JLEA 3ZCIA 2BG9A 1MMDA 1D0YA 4YJ3E 4U7YA 3RHWA 5FL1A 4UF0A 1Z0PA 4DV1T 2YINA 3C64A 4HWHA 5JQGE 2AE9A 3ZMSB 2F4VT 2WP9A 5IYZE 3RIAA 2YOEA 4GK5E 1U4QA 3Q9DA 5JH7E
chains in the Genus database with same CATH topology
2DI4A 2EHOC 1LRZA 3LK3B 4UV9B 3BQKA 5F3JA 2YU1A 3BQLA 4IE6A 2W0GA 4HGAA 1LVKA 2KZ7B 2CEAA 4IE5A 4XBFB 5TAOA 4L5GA 1WRDA 2ZM2A 1BR2A 5JDGA 4EZHA 3KDSE 4H9QC 4QKNA 2K9AA 2C0SA 2UXNB 3SS1A 3AAIA 4V1Av 4H9SE 3AA6B 3H3AA 4G2AA 2A3DA 3KV4A 3RYIE 5FY7A 1WR6A 2XUEA 2CLYC 2N2NA 1VOMA 5L2LA 3R84B 3KINB 2N1GA 5LJMA 1WYCA 1AJ3A 4QXHB 2V1DB 5LG4A 1KNZA 3K3QC 4GK0E 5KX5E 5J2UE 3C50A 3ZYLA 2I59A 4ZI3C 1MMNA 4IGUA 4F6RC 3M65A 4U72A 3NRXA 5FXZA 1WLXA 4ZS3A 4ZI2D 2WBLA 5GONE 1HF8A 1MNEA 5C8YE 3ZMUB 2VK9A 4MLKA 3RH3A 4B6XA 4CXWA 5CB4E 4O2BE 4X1YE 4PAGA 4UIGA 3I0QA 5H6RB 3N9NA 4ZI7E 3WAJA 5JDLA 4AKHA 2CXDA 3HKCE 4CZZB 2V7KA 2XAFB 2H7VC 3EDVA 5M4YA 2LSKA 4EZ4A 2X9HA 3HKBE 3ZCJA 4UF0B 3N9OA 5EK2A 4AI6A 2LJLA 2K48A 4ZI2C 1LKXA 1X79A 3AA1B 2EHOB 3JC6D 5LHIB 2ODVA 3ZJ1A 1FEWA 1ZKEA 3FB2A 5A1LA 4MBQA 4H9PC 3N9QA 2A72A 1S35A 1SHZC 3K3OA 5ADXL 4WNKA 3ZC1A 3IEEA 1MMGA 5JVDE 5LP6E 3AAAB 3RKOA 4I55E 3RYFE 2KT9A 3PE0A 4WW0A 2YK0A 3ETVA 3OJAA 4EB6E 2CLYB 3JC6C 5HXHA 4UELA 5JDNA 2X0LB 1IZNB 3GWHA 3E22E 4H63H 5FMNA 3MKDA 5HXRA 4ADZA 4EYUA 1ZEEA 3EDUA 2H7OA 4BJNA 2CE7A 5LGUB 1U5PA 2RP4A 4CXYA 5LBQB 4CI3B 3CQGB 2PG8A 2XASB 1H7CA 2JPFA 4PNIA 2V7LA 3J7Yq 3O4XE 3UT5E 4O4HE 1UX4A 2VKHA 5DJQC 5IHYA 5JDFA 2VWAA 3C98B 4DBQA 3CX7B 3LG7A 4IE4A 2A2FX 2LSJA 4O4JE 1IAPA 2LOPA 2N9DA 2DWGA 3O1HA 5FYMA 1YKEB 3KBUA 3IF8B 5FXVA 3UFEA 2YEVC 2EHOD 3I9YA 3IHRA 4YLHA 4P0AA 1ZV4X 5LNKA 3PTRB 3ZN1B 4QXBB 5BMVE 3ESLA 3S4UA 4GIWA 4DMVA 2D5UA 1G8XA 1BR0A 2KLQA 2IC6A 1UX5A 4A56A 3N9MA 2VASA 3VKGA 2B1EA 4C91A 4NUUA 1MIYA 4O8SA 2JQQA 3NZQA 4FI5A 2BVMA 2LHNA 3CKDA 5JDQA 3CWZB 5FY0A 3CMLA 2LSGA 2X68A 2BZBA 1YKHB 4OHFA 4AKIA 2NW9A 2C5IT 1UCUA 3E08A 3HA4A 2ES0A 4ILUA 3CPZA 2L8KA 3O1IA 5L3DB 3V5SA 2CA5A 3LJCA 3ZPOA 4ZI3D 3U3IA 3LFMA 4JEHB 2WMOA 1WYBA 2DLRA 5DABA 5AFUL 5LJNA 3AA7B 2Y48B 2D0TA 4OYKA 4TV9E 1MIVA 2DNXA 4TZ4C 3RPUA 2MOZA 2L9QA 4P0BA 4TV8E 4OK0A 5JH7E 4NUVA 5LYJE 2NOXA 5HWXA 4ISSA 4O4LE 3KBTA 2XAQB 3N5LA 3CX8B 3J9X1 3N9PA 3PU8A 4PJLA 3UTKA 4E7ZA 4OFZA 3HR0A 4CI2B 2P9BA 3OKQA 1B7TA 4GYSA 5LGNB 2Z6EA 1HTJF 2V7MA 3PUSA 3K3NA 3IBPA 3NZPA 5LA6E 3B13A 1MIWA 2KINB 2VB6A 3PUQA 4XZCA 3NRYA 2X9WA 3UULA 3C4ZA 2NP9A 1FMWA 2XAHB 3OYXA 2QGSA 3DJBA 5E0OA 5F8PA 4MALA 1D0XA 2HPLA 4PFOA 3QK6A 4HN9A 4BAYB 5JRCB 3O9XA 3W15B 2CMRA 1HG2A 4UVBB 2W62A 2Q9QA 3Q2MA 4I43B 3UUXB 3AB3B 2E9XC 5J1GA 2IC9A 4PK5A 3RC8A 2MYSA 3BQIA 3KV9A 2WSSV 4L0RA 4DNDA 2K24A 3GMIA 3UUNA 4KUMB 4P09A 4H63V 2BVLA 2Q9QC 4HFVA 4IE7A 3KFWX 1QUUA 2NWBA 3AA0B 4CXXA 1BR4A 3HKEE 4MHCA 2K5BB 4HE8A 2V26A 2WWUA 2SPCA 3MJXA 3LK2B 2PFVA 3AVRA 5LBMA 4GYRA 3RX6A 4N78D 4KMCA 2VKDA 3SOLA 2J1DG 2JMKA 1LVFA 3DP7A 3E0ZA 2G0UA 3C4WA 4EYYR 5LGTB 5JREA 2LHRA 3P8CD 5FNVE 4PFPA 3ZYMA 1D1BA 2D2SA 3PURA 3RRWA 2C5KT 2X66A 4CI1B 5HYAA 1IJ6A 4JUYA 2KXPB 3ZN0B 2Y8DA 3OYZA 2V7JA 4K0UA 4J2CA 3QC9A 4AKRB 3A5XA 2ACXA 4X1KE 2BDEA 4ASKA 2WMNA 2XTLA 2KMFA 2RA1A 3DTOA 3F2EA 3ZLIA 2E8IA 5HXSA 2DHRA 3N2GE 3ETUA 3Q5XA 3KVBA 3GN5A 2XQYA 5KMGP 1ZHCA 1G73A 5HAXA 2XHEB 3L09A 5DQWA 5JRCA 5HXEA 4AQFC 3FBZA 4X1IE 1D0ZA 3ZJ2A 2E9XB 1VRBA 2NTYA 2L3LA 3ZYKA 3EVYA 1NAFA 3P7IA 4QX8B 3VU7H 3FXDB 3LK42 3MACA 3F57A 3AAEB 3HKDE 3ZMZB 3MK7C 4TN7B 3RYHE 1KK7A 3GA8A 1OWAA 2MBGA 2UXXB 1HS7A 4QHOA 3B57A 2Q9QB 5CA1E 4C90A 2LSYA 3AVSA 5EK3A 3MA9A 2C5JA 2PBIA 2V7IA 4KP3C 1IJ5A 1HG5A 5EK4A 5J2TE 3PU3A 2ZMAA 2YU2A 1HX8A 4TUYE 2X9YA 2W61A 4ZHQE 2OA5A 3N9LA 2WM9A 3CX6B 3ZC0A 5H6QB 4EOZB 3R6NA 2IAKA 1OXZA 4WBOA 3F31A 5DQVA 3LBXA 5HXCA 2HPJA 4IE0A 3RRCA 1HCIA 1E1HB 2IW5B 2VL8A 5FXXA 3WI3A 3ONXA 2QA7A 4HEAA 4WBNE 2JMHA 2MTQA 3CQXC 4DBRA 5L3FB 2XAGB 4G63A 4KBMB 1HFAA 4GOUA 3Q5WA 4AKGA 1FMVA 2CXFA 3I1AA 2W00A 2LM9A 3QUJA 3FBLA 4O4IE 1EZ3A 5FY1A 3VHLA 2E9XD 2HH7A 2CM0A 2D0UA 4I4TE 2KNDA 2ZM0A 4M1PA 5EZYE 2CWYA 1BR1A 3C51A 1US7B 2ZLYA 3T8OA 2E9XA 2LE8A 2LSIA 2X67A 4ISTA 2LOSA 3GN5B 3I9WA 2Q9QD 5L3CB 4IDZA 3ANWB 1SA0E 4HKAA 5L3EB 2KWIB 4EIWA 2NW7A 3MXZA 4I50E 5CA0E 2WAUA 5HWYA 2CXLA 3SRZA 3NBXX 2VKOA 4YFSA 3RYCE 2LEHA 4EXTA 4TX5A 4AKLA 2XAJB 4DMWA 3ZMTB 4DO0A 1O3XA 3PUAA 3HL6A 2DCFA 4PK4A 4PJNA 2NW8A 3U78A 5JR9B 2LT3A 4AQGA 4H9OC 4PJMA 4YHJA 5L3GB 4PK6A 1CUNA 3KV6A 4DVDA 4UEMA 4E7SA 4UV8B 4ZS2A 3MZKB 3FHNA 2DWKA 1FIOA 3CVRA 3PDYA 4ANJA 3EUHA 3CQCB 5L3BB 3V5UA 4PW8A 3C4XA 4ERRA 2KWHA 2M67A 4IIJE 4PJJA 3N2OA 4UXNB 5ETWA 3K8PC 3LBXB 1T98A 3FXEB 2VKJA 3I0OA 3ZEFB 4H9RC 5LHHB 2CWOA 3L3PA 1S94A 4QWNB 3WAKA 5LHGB 3H37A 4BJMA 1Y64B 4QXCB 3O1JA 5LOVE 3BK9A 2ZM8A 4CQIA 2H3RA 5FXWA 5KDMC 4YJ2E 2CCQA 4JEUB 4AQFA 4XAXB 4EAHA 1YD8G 3ZMVB 2JJ9A 2ODUA 2X51A 1QSDA 4UVAB 5JDMA 4QX7B 3UUMA 3KVAA 3ANWA 2Y6XA 1V9DA 1MNDA 4O2AE 4U74A 3RC3A 4UVCB 4JLEA 2GK9A 4L9IA 3ZCIA 1MMDA 1MMAA 4OYJA 3TKLB 3HI2A 4H9NC 5FP3A 3OBVE 1D0YA 4BA9A 3PUGA 4FJOA 4YJ3E 5LXTE 3N2KE 2X9XA 4HTEA 5JDHA 2W63A 4AXPA 4IHJE 4UF0A 5JR9A 4X20E 1Z0PA 2PJQA 3C64A 2YINA 2EHOA 1NWMX 2NTXA 3KV5A 4Z8XA 4MFRA 5JQGE 3ZMSB 5IYZE 5LCYA 1YW0A 1D1AA 5JR9C 3D0TA 1U4QA 4GK5E 3SWHA 3VKHA 4ZOLE 3Q9DA 1D1CA 2JRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW8 A;  2NWB A;  2NOX A;  2X68 A;  2X67 A;  5EK2 A;  4PK6 A;  5EK3 A;  2NW9 A;  4U72 A;  1ZEE A;  3E08 A;  2V7I A;  4HKA A;  5EK4 A;  2NW7 A;  2V7L A;  4PW8 A;  4PK5 A;  2V7M A;  5ETW A;  2D0T A;  4U74 A;  1YW0 A;  2X66 A;  2D0U A;  2V7K A;  2V7J A;  3BK9 A; 
#chains in the Genus database with same CATH topology
 3ONJ A;  4UV9 B;  5JTG A;  3PV0 F;  4IE6 A;  4WYV A;  5TAO A;  3TLV A;  3VR8 A;  4YSZ A;  4HFI A;  3RYI E;  1WR6 A;  2N2N A;  1VOM A;  2UXD T;  2N1G A;  5LG4 A;  2I59 A;  3M65 A;  2WBL A;  5C8Y E;  3RH3 A;  4B6X A;  4AQY T;  4X1Y E;  3I0Q A;  4ZI7 E;  3WAJ A;  4AKH A;  2CXD A;  3VR9 A;  5BR8 T;  2LSK A;  4EZ4 A;  2X9H A;  2W66 A;  4NIQ A;  4AI6 A;  2BS4 A;  5CFB A;  5LHI B;  2EHO B;  1ZKE A;  5A1L A;  4MBQ A;  4B3M T;  1SHZ C;  3UFG A;  4WNK A;  3ZC1 A;  4DR6 T;  3IEE A;  5JVD E;  1UK5 A;  2IHR 1;  2KT9 A;  2YK0 A;  3ETV A;  2CLY B;  4GKJ T;  4UEL A;  1IZN B;  4EED A;  3GWH A;  2YKS A;  3E22 E;  4H63 H;  5FMN A;  3MKD A;  4EYU A;  3EDU A;  1U5P A;  5LBQ B;  4CI3 B;  2PG8 A;  1H7C A;  4PNI A;  4O4H E;  4LML A;  3C98 B;  4QH1 A;  4O4J E;  5AQI B;  2N9D A;  4LF9 T;  5FYM A;  3SFE A;  3IF8 B;  2YEV C;  4P0A A;  1ZV4 X;  5BMV E;  3N9M A;  2VAS A;  1FJG T;  4NUU A;  4YTP A;  2XM1 A;  2LHN A;  3CWZ B;  5FY0 A;  2LSG A;  2BZB A;  3QB5 A;  2C5I T;  3CPZ A;  3O1I A;  4EEB A;  3LJC A;  3LFM A;  2Y48 B;  2DNX A;  4P0B A;  4NUV A;  3RIF A;  4ISS A;  3CX8 B;  3J9X 1;  4OFZ A;  4GYS A;  5LGN B;  2Z6E A;  2V8S V;  2V7M A;  3UU3 A;  2HHH T;  4XZC A;  1XWM A;  2BBJ A;  3C4Z A;  1HNX T;  2NP9 A;  2XAH B;  3EAM A;  3LSV A;  1D0X A;  4BAY B;  5JRC B;  3W15 B;  2CMR A;  4DR4 T;  4KI0 F;  2Q9Q A;  3Q2M A;  4I43 B;  1YQ3 A;  2IC9 A;  4B3T T;  2K24 A;  4JYA T;  2BVL A;  4IE7 A;  2NWB A;  3FZL B;  4ILB A;  1BR4 A;  3LK2 B;  2PFV A;  1OED B;  3RX6 A;  4N78 D;  2WCA A;  2J1D G;  2JMK A;  3DP7 A;  2E2A A;  2G0U A;  5LGT B;  2V6X A;  4EYY R;  2LHR A;  2YN6 A;  5FNV E;  4PFP A;  4JI2 T;  3P50 A;  2J47 A;  2UUA T;  4CI1 B;  4LF5 T;  4U7I A;  1IJ6 A;  4JUY A;  3ZN0 B;  2H88 A;  4K0U A;  4J2C A;  3QC9 A;  4X1K E;  2H89 A;  5HXS A;  2JIW A;  3ETU A;  2XQY A;  1ZHC A;  2XHE B;  5DQW A;  5HXE A;  3FBZ A;  3ZJ2 A;  1VRB A;  3P7I A;  4QX8 B;  3VU7 H;  3LK4 2;  3F57 A;  3AAE B;  3MK7 C;  4TN7 B;  3RYH E;  1KK7 A;  3GA8 A;  2MBG A;  3PJA J;  5HCJ A;  2LSY A;  5EK3 A;  3MA9 A;  5J2T E;  2WZH A;  5L4E A;  4OX9 T;  2W61 A;  4ZHQ E;  2XJ7 A;  2WM9 A;  4JI6 T;  4EOZ B;  3R6N A;  5HXC A;  3RRC A;  1HCI A;  1QLB A;  5FXX A;  4HFB A;  1IBM T;  3EI0 A;  4DBR A;  4KBM B;  4G63 A;  5AQV B;  1HFA A;  3Q5W A;  1JNR A;  3I1A A;  4B3R T;  2CRB A;  2I6H A;  2HH7 A;  2CM0 A;  4I4T E;  1T72 A;  3Q5D A;  3C51 A;  1DU2 A;  3QOF A;  3ANW B;  4KHP T;  5L3E B;  4EIW A;  2NW7 A;  1N32 T;  2LKH A;  4X66 T;  3SRZ A;  3NBX X;  4LF6 T;  4X65 T;  4EXT A;  5AQS B;  5L47 A;  2XAJ B;  5J0Z A;  3ZT7 A;  2VL0 A;  2NW8 A;  4HWC A;  2W2U A;  4H9O C;  1CUN A;  2WDR A;  5FKY A;  3MZK B;  2WDV A;  3CQC B;  3RI5 A;  4ERR A;  3N2O A;  2IIU A;  3AE9 A;  1T98 A;  3FXE B;  3L3P A;  1S94 A;  4QWN B;  4BJM A;  3O1J A;  4X5T A;  4CQI A;  5FXW A;  4JEU B;  5AQF B;  3ZST A;  5AQP B;  1N34 T;  4U33 A;  4CN4 A;  4ILC A;  1MMA A;  3QB5 K;  3OBV E;  4BA9 A;  5LXT E;  3N2K E;  4IHJ E;  3P4S A;  2NTX A;  4A98 A;  5LCY A;  5JR9 C;  3D0T A;  3SWH A;  3VKH A;  2EHO C;  2W0G A;  2OV9 A;  4XBF B;  4L5G A;  1WRD A;  4EZH A;  2UXN B;  3AE8 A;  2CHN A;  1I6Z A;  4G2A A;  3KV4 A;  4GKK T;  4P1N A;  5L2L A;  2XUE A;  2CLY C;  3R84 B;  3ZYL A;  4F6R C;  3NRX A;  4UR9 A;  4ZI2 D;  2VK9 A;  2CBI A;  4MLK A;  5CB4 E;  5ABF A;  4O2B E;  4PAG A;  4KX6 A;  2V7K A;  5M4Y A;  2H7V C;  3LDQ B;  1Y01 A;  2LJL A;  2K48 A;  1LKX A;  3AA1 B;  4H9P C;  3N9Q A;  2IDO B;  2WB5 A;  3TLT A;  5LP6 E;  4DUZ T;  2QRX A;  3RKO A;  1ZOY A;  4I55 E;  2XQ8 A;  4JV5 T;  3B5M A;  1YXR A;  2J4G A;  4CXY A;  4ZZC A;  3CQG B;  1X9B A;  3M3Z B;  2V7L A;  2WU2 A;  5IHY A;  5JDF A;  2VWA A;  5AQM B;  4DBQ A;  3LG7 A;  2LOP A;  5FXV A;  3FZH B;  2VVN A;  2EHO D;  5LNK A;  3PTR B;  3ZN1 B;  3S4U A;  4DMV A;  1G8X A;  5AQG B;  2IC6 A;  4A56 A;  2FJB A;  4C91 A;  3AE7 A;  2JQQ A;  2JQH A;  5LMU T;  4I0U A;  4HWF A;  3HA4 A;  3NVO A;  1KFY A;  2L8K A;  2WMO A;  1OED E;  2D0T A;  4OYK A;  1MIV A;  5FL0 A;  2MOZ A;  4OK0 A;  2WQY A;  5HWX A;  4O4L E;  2XAQ B;  3N5L A;  3PU8 A;  1VCS A;  5AQU B;  1VCT A;  2P9B A;  1B7T A;  2AXD S;  2XQ7 A;  1HTJ F;  3PUS A;  3K3N A;  5LA6 E;  2KIN B;  2BKO A;  3AEF A;  3NRY A;  3UUL A;  3VRB A;  4TNW A;  2QGS A;  3DJB A;  5E0O A;  2HPL A;  3TLS A;  4PFO A;  1SE7 A;  4HFD A;  1HR0 T;  1HG2 A;  3AB3 B;  3RC8 A;  4TNV A;  3GMI A;  2HN1 A;  4YTN A;  4CXX A;  3HKE E;  2LKG A;  2K5B B;  4HE8 A;  2V26 A;  3MJX A;  4DR5 T;  2BBH A;  1WFD A;  3PUR A;  3RRW A;  2C5K T;  3AE1 A;  3RKG A;  2KXP B;  2V5D A;  2V7J A;  5AQN B;  2WZI A;  3A5X A;  2ACX A;  2BDE A;  2DHR A;  2VVS A;  4JI3 T;  4DV4 T;  1G73 A;  4JI1 T;  2D9D A;  3FXD B;  4ZZB A;  1OWA A;  3RF1 A;  1HS7 A;  1W9R A;  2XSA A;  5CA1 E;  2C5J A;  3TLW A;  2CBJ A;  2V7I A;  1IJ5 A;  5EK4 A;  2FJE A;  3PUV F;  2V6Y A;  1XDP A;  1XDO A;  2LM2 A;  2XSB A;  3ZC0 A;  2YDQ A;  1OXZ A;  4WBO A;  3F31 A;  5DQV A;  3LBX A;  4QH5 A;  3UU6 A;  4WBN E;  3FZF B;  2JMH A;  4U2Z A;  5FVK A;  2W00 A;  3FBL A;  4DR1 T;  1EZ3 A;  3T1H T;  2MPK A;  2ZM0 A;  5EZY E;  4HFE A;  1BR1 A;  1E7P A;  2E9X A;  4IST A;  3GN5 B;  3AEE A;  5AQH B;  5CA0 E;  3MXZ A;  4IDP A;  2WAU A;  2CXL A;  1W0B A;  4YFS A;  3RYC E;  2LEH A;  4DV7 T;  3UU8 A;  4DMW A;  3ZMT B;  3PUA A;  3AE3 A;  3X1D A;  4PJM A;  4DVD A;  4UV8 B;  4ZS2 A;  4YHH T;  4LF8 T;  4EV6 A;  1FIO A;  5L3B B;  2KWH A;  4UXN B;  3P4P A;  1R8I A;  2WWV A;  5LHG B;  1KEY A;  4QXC B;  3RGL A;  4AQF A;  4EAH A;  3ZMV B;  4DR2 T;  2X51 A;  1QSD A;  4YSX A;  1V9D A;  4X62 T;  4NXN T;  3TLU A;  1I94 T;  4OYJ A;  3HI2 A;  4H9N C;  3T1Y T;  2YDR A;  2X9X A;  4COF A;  2W63 A;  5JDH A;  2UXB T;  5JR9 A;  2PJQ A;  2EHO A;  1NWM X;  2X0Y A;  3KV5 A;  4Z8X A;  2UUB T;  3AXJ A;  3VRA A;  1YW0 A;  2XQ5 A;  1D1A A;  1JNZ A;  3P4Q A;  3EHZ A;  3UUB A;  5AQR B;  2JRK A;  1LRZ A;  3LK3 B;  3BQK A;  3CK6 A;  2YU1 A;  5F3J A;  4HGA A;  1LVK A;  4IE5 A;  1WR0 A;  5JDG A;  1BR2 A;  3ABV A;  1N33 T;  4IDN A;  3KDS E;  4H9Q C;  4QKN A;  2K9A A;  4LMJ A;  3SS1 A;  4V1A v;  4H9S E;  3AA6 B;  2V5C A;  2A3D A;  5FY7 A;  3KIN B;  1AJ3 A;  1KNZ A;  4LFC T;  3K3Q C;  2NR4 A;  5J2U E;  4ZI3 C;  4IGU A;  4U72 A;  1WLX A;  5AQQ B;  5CGM A;  3K1S A;  4ZS3 A;  4DID B;  5GON E;  1MNE A;  4Z91 A;  3ZMU B;  2BG9 B;  4YY3 T;  4CXW A;  2BKP A;  5JDL A;  1Z8U A;  2B76 A;  3HKB E;  4UF0 B;  4ZI2 C;  3JC6 D;  1NEK A;  3ZJ1 A;  2A72 A;  5ADX L;  4JI0 T;  4LF4 T;  5JDN A;  4U2Y A;  2X0L B;  3PUZ F;  4BJN A;  2CE7 A;  3AED A;  2RP4 A;  1NEN A;  5IUX A;  2XAS B;  2JPF A;  4TWH A;  2ACZ A;  1UX4 A;  2VKH A;  5DJQ C;  1XMO T;  3PUX F;  3UU5 A;  2OLT A;  2XQ6 A;  2LSJ A;  3O1H A;  4CN6 A;  3UFE A;  2CHO A;  2I0M A;  3ESL A;  2LRL A;  5F5W A;  4DV2 T;  1UX5 A;  2YDS A;  1MIY A;  4O8S A;  3JAF A;  2XQ9 A;  2ZM6 T;  3NZQ A;  4IRE A;  3CML A;  1J5W A;  1J1J A;  1YKH B;  5HEU A;  5ABG A;  1UCU A;  3V5S A;  4ZI3 D;  2PTF A;  2DLR A;  1T8B A;  5DAB A;  5AFU L;  5LJN A;  4TV9 E;  1XMQ T;  4TV8 E;  3FZM B;  2WU5 A;  2NOX A;  1WCR A;  3KBT A;  3N9P A;  1XNR T;  4PJL A;  4E7Z A;  4F8H A;  5HEH A;  3SFD A;  4Q25 A;  3IBP A;  3NZP A;  2VB6 A;  3PUQ A;  2X9W A;  5L4H A;  3OYX A;  5F8P A;  4MAL A;  3QK6 A;  3O9X A;  5AQL B;  4HWD A;  2W62 A;  2W67 A;  1L0V A;  4JI7 T;  4L0R A;  3KV9 A;  4JI5 T;  4DND A;  3UUN A;  4KUM B;  2WY2 A;  2VQE T;  4P09 A;  4U31 A;  4HFV A;  3KFW X;  3AA0 B;  2QVA A;  5HCM A;  4MHC A;  2V6Y B;  3AE2 A;  2SPC A;  3AVR A;  5LBM A;  4GYR A;  4KMC A;  3SOL A;  4TWD A;  3C4W A;  3Q5E A;  1D1B A;  2M6I A;  4DV0 T;  4AKR B;  3ZLI A;  2XTL A;  2RA1 A;  3DTO A;  3F2E A;  3ZT5 A;  4ZXL A;  1XNQ T;  3NWI A;  5KMG P;  3L09 A;  4X1I E;  2E9X B;  2NTY A;  2L3L A;  1UUR A;  3QNU A;  4QHO A;  3B57 A;  2Q9Q B;  4C90 A;  3AVS A;  2PBI A;  1HG5 A;  2FBW A;  2YU2 A;  3A8Y C;  4TUY E;  3UQ4 A;  2OA5 A;  2JQ9 A;  1KNP A;  5H6Q B;  2XM2 A;  4A97 A;  2IAK A;  4KHZ F;  3JCF A;  2BS3 A;  1E1H B;  2IW5 B;  2VL8 A;  3ONX A;  1OED C;  2VQF T;  3CQX C;  2MTQ A;  4HFH A;  3RQW A;  5L3F B;  4GOU A;  1SUM B;  2M6B A;  4X64 T;  4AKG A;  1FMV A;  2CXF A;  5ABE A;  3QUJ A;  4O4I E;  3VHL A;  5C2T A;  4DR3 T;  4M1P A;  2KND A;  2XQA A;  4IL9 A;  2UXC T;  5HEO A;  2LE8 A;  2LSI A;  2X67 A;  2VUR A;  2LOS A;  3OVU A;  3I9W A;  3ZKR A;  1SA0 E;  4ILA A;  2KWI B;  2E5V A;  2W4X A;  3CIR A;  2FJD A;  2VKO A;  3A7M A;  5HEG A;  3JAE A;  3ONL C;  4DO0 A;  4NPP A;  1O3X A;  2DCF A;  4NXM T;  5JR9 B;  2LT3 A;  4AQG A;  2X0H A;  5L3G B;  4YHJ A;  4PK6 A;  4DV6 T;  3KV6 A;  3AXJ B;  3FHN A;  3CVR A;  3PDY A;  2K3W A;  3EUH A;  4AIU A;  1N36 T;  3V5U A;  2KSR A;  4PW8 A;  4PJJ A;  2M67 A;  5ETW A;  1HNW T;  2VKJ A;  3I0O A;  3ZEF B;  5LHH B;  3UU4 A;  3WAK A;  1Y64 B;  3BK9 A;  2H3R A;  2CCQ A;  4XAX B;  4WZX A;  2JJ9 A;  2ODU A;  4UVA B;  2E5L T;  5JDM A;  3RLF F;  3UUM A;  2RPA A;  2Y6X A;  1MND A;  4U74 A;  4UVC B;  2GK9 A;  4L9I A;  2BS2 A;  3JAD A;  2BG9 E;  3TKL B;  3RIU C;  5FP3 A;  3PUG A;  4FJO A;  4HTE A;  4AXP A;  1E2A A;  4K0K T;  4X20 E;  2BG9 C;  1XZY A;  4MFR A;  1HNZ T;  2UUC T;  3PJA A;  2DL1 A;  4ZOL E;  4AKI A;  1D1C A;  2DI4 A;  3BQL A;  2KZ7 B;  2CEA A;  1W0A A;  4DR7 T;  2ZM2 A;  2C0S A;  3AAI A;  5C3J A;  3H3M A;  3H3A A;  3L8R A;  5LJM A;  1WYC A;  3ZSS A;  4QXH B;  2V1D B;  1YQ4 A;  4GK0 E;  5KX5 E;  2FUP A;  3C50 A;  1MMN A;  5FXZ A;  4QH4 A;  1HF8 A;  4UIG A;  5H6R B;  3N9N A;  4ZEY A;  3HKC E;  4CZZ B;  2XAF B;  3EDV A;  2XY8 B;  3ZCJ A;  3N9O A;  5EK2 A;  2FJA A;  2R6G F;  1X79 A;  3EAB A;  2ODV A;  1FEW A;  3FB2 A;  1T7S A;  2QYW A;  1S35 A;  3K3O A;  5AQO B;  1MMG A;  3AEC A;  2BKN A;  4HFC A;  3AAA B;  3RYF E;  3PE0 A;  4WW0 A;  4EB6 E;  3OJA A;  2XZE A;  1ZP0 A;  3JC6 C;  5HXH A;  4ADZ A;  5HXR A;  1ZEE A;  2H7O A;  5LGU B;  3UQ7 A;  3J7Y q;  1M7K A;  3O4X E;  3UT5 E;  1J5E T;  3CX7 B;  4IE4 A;  2A2F X;  1IAP A;  2DWG A;  3OPC A;  1YKE B;  3KBU A;  4YLH A;  3I9Y A;  3IHR A;  3P4W A;  5CJ5 A;  4QXB B;  4YXD A;  4GIW A;  5ABF B;  2D5U A;  1BR0 A;  2KLQ A;  3VKG A;  2B1E A;  2UU9 T;  4YT0 A;  4FI5 A;  2BVM A;  3CKD A;  5JDQ A;  2X68 A;  4B3S T;  4OHF A;  4IT4 A;  2NW9 A;  3E08 A;  2ES0 A;  4ILU A;  5L3D B;  2CA5 A;  3ZPO A;  3U3I A;  4JEH B;  1WYB A;  3AA7 B;  2JQK A;  4TZ4 C;  3RPU A;  2L9Q A;  4TWF A;  5LYJ E;  2J62 A;  3AEB A;  3UTK A;  3HR0 A;  4CI2 B;  3OTO T;  3OKQ A;  1UGO A;  3B13 A;  1MIW A;  1FMW A;  3L39 A;  2HN2 A;  4HN9 A;  2XPK A;  4UVB B;  3UUX B;  2E9X C;  3IA3 A;  5J1G A;  3AE5 A;  4PK5 A;  2MYS A;  3BQI A;  2WSS V;  4H63 V;  1W09 A;  2Q9Q C;  1QUU A;  4Z90 A;  5IWA T;  2WWU A;  3PUY F;  2XQ3 A;  4DUY T;  2VKD A;  1LVF A;  2IML A;  3E0Z A;  5HEJ A;  5JRE A;  3P8C D;  3ZYM A;  4IDQ A;  2D2S A;  1KNR A;  2IUB A;  2X66 A;  5HYA A;  2Y8D A;  3OYZ A;  4LF7 T;  4ASK A;  1HX1 B;  2WMN A;  2KMF A;  3RQU A;  2E8I A;  3N2G E;  3Q5X A;  3KVB A;  5AQJ B;  3GN5 A;  4IDO A;  3G06 A;  3FZK B;  3ZT6 A;  5HAX A;  4LFA T;  3AEA A;  5JRC A;  4AQF C;  1D0Z A;  3ZYK A;  3EVY A;  1NAF A;  4CN1 A;  5AQT B;  1M62 A;  3MAC A;  4JI8 T;  3HKD E;  3ZMZ B;  2CPT A;  4YTM A;  2UXX B;  1IBL T;  4LMK A;  4KP3 C;  4EGW A;  3PU3 A;  2ZMA A;  1HX8 A;  2X9Y A;  3N9L A;  3CX6 B;  1OED A;  5KXJ A;  5LG3 A;  4DV5 T;  2MAW A;  2HPJ A;  4HWI B;  4IE0 A;  2LRK A;  1GQE A;  3WI3 A;  2QA7 A;  4HEA A;  2XAG B;  4LFB T;  4AIS A;  2LM9 A;  1UUS A;  5FY1 A;  5FVL A;  2E9X D;  2D0U A;  2CWY A;  1US7 B;  2XQ4 A;  2ZLY A;  3T8O A;  4U3C A;  2Q9Q D;  5L3C B;  4IDZ A;  4HKA A;  4I50 E;  2WDQ A;  5HWY A;  3PUW F;  3P4R A;  4IL4 A;  1CHU A;  4TX5 A;  4JI4 T;  4AKL A;  3AE4 A;  3AE6 A;  3HL6 A;  4PK4 A;  4A5X A;  4PJN A;  4JBW F;  3U78 A;  5LMN T;  5LB7 B;  4UEM A;  4E7S A;  2DWK A;  4ANJ A;  2WS3 A;  3C4X A;  4IIJ E;  3K8P C;  3LBX B;  4H9R C;  4DV3 T;  2CWO A;  3H37 A;  5LOV E;  5AQK B;  3NKZ A;  2ZM8 A;  1IBK T;  2A9U A;  5KDM C;  4YJ2 E;  5ABH A;  1YD8 G;  4QX7 B;  3KVA A;  1KF6 A;  3RIU A;  2LLY A;  3ANW A;  3AEG A;  4O2A E;  3RC3 A;  4YSY A;  4JLE A;  3ZCI A;  2BG9 A;  1MMD A;  1D0Y A;  4YJ3 E;  4U7Y A;  3RHW A;  5FL1 A;  4UF0 A;  1Z0P A;  4DV1 T;  2YIN A;  3C64 A;  4HWH A;  5JQG E;  2AE9 A;  3ZMS B;  2F4V T;  2WP9 A;  5IYZ E;  3RIA A;  2YOE A;  4GK5 E;  1U4Q A;  3Q9D A;  5JH7 E; 
#chains in the Genus database with same CATH homology
 2DI4 A;  2EHO C;  1LRZ A;  3LK3 B;  4UV9 B;  3BQK A;  5F3J A;  2YU1 A;  3BQL A;  4IE6 A;  2W0G A;  4HGA A;  1LVK A;  2KZ7 B;  2CEA A;  4IE5 A;  4XBF B;  5TAO A;  4L5G A;  1WRD A;  2ZM2 A;  1BR2 A;  5JDG A;  4EZH A;  3KDS E;  4H9Q C;  4QKN A;  2K9A A;  2C0S A;  2UXN B;  3SS1 A;  3AAI A;  4V1A v;  4H9S E;  3AA6 B;  3H3A A;  4G2A A;  2A3D A;  3KV4 A;  3RYI E;  5FY7 A;  1WR6 A;  2XUE A;  2CLY C;  2N2N A;  1VOM A;  5L2L A;  3R84 B;  3KIN B;  2N1G A;  5LJM A;  1WYC A;  1AJ3 A;  4QXH B;  2V1D B;  5LG4 A;  1KNZ A;  3K3Q C;  4GK0 E;  5KX5 E;  5J2U E;  3C50 A;  3ZYL A;  2I59 A;  4ZI3 C;  1MMN A;  4IGU A;  4F6R C;  3M65 A;  4U72 A;  3NRX A;  5FXZ A;  1WLX A;  4ZS3 A;  4ZI2 D;  2WBL A;  5GON E;  1HF8 A;  1MNE A;  5C8Y E;  3ZMU B;  2VK9 A;  4MLK A;  3RH3 A;  4B6X A;  4CXW A;  5CB4 E;  4O2B E;  4X1Y E;  4PAG A;  4UIG A;  3I0Q A;  5H6R B;  3N9N A;  4ZI7 E;  3WAJ A;  5JDL A;  4AKH A;  2CXD A;  3HKC E;  4CZZ B;  2V7K A;  2XAF B;  2H7V C;  3EDV A;  5M4Y A;  2LSK A;  4EZ4 A;  2X9H A;  3HKB E;  3ZCJ A;  4UF0 B;  3N9O A;  5EK2 A;  4AI6 A;  2LJL A;  2K48 A;  4ZI2 C;  1LKX A;  1X79 A;  3AA1 B;  2EHO B;  3JC6 D;  5LHI B;  2ODV A;  3ZJ1 A;  1FEW A;  1ZKE A;  3FB2 A;  5A1L A;  4MBQ A;  4H9P C;  3N9Q A;  2A72 A;  1S35 A;  1SHZ C;  3K3O A;  5ADX L;  4WNK A;  3ZC1 A;  3IEE A;  1MMG A;  5JVD E;  5LP6 E;  3AAA B;  3RKO A;  4I55 E;  3RYF E;  2KT9 A;  3PE0 A;  4WW0 A;  2YK0 A;  3ETV A;  3OJA A;  4EB6 E;  2CLY B;  3JC6 C;  5HXH A;  4UEL A;  5JDN A;  2X0L B;  1IZN B;  3GWH A;  3E22 E;  4H63 H;  5FMN A;  3MKD A;  5HXR A;  4ADZ A;  4EYU A;  1ZEE A;  3EDU A;  2H7O A;  4BJN A;  2CE7 A;  5LGU B;  1U5P A;  2RP4 A;  4CXY A;  5LBQ B;  4CI3 B;  3CQG B;  2PG8 A;  2XAS B;  1H7C A;  2JPF A;  4PNI A;  2V7L A;  3J7Y q;  3O4X E;  3UT5 E;  4O4H E;  1UX4 A;  2VKH A;  5DJQ C;  5IHY A;  5JDF A;  2VWA A;  3C98 B;  4DBQ A;  3CX7 B;  3LG7 A;  4IE4 A;  2A2F X;  2LSJ A;  4O4J E;  1IAP A;  2LOP A;  2N9D A;  2DWG A;  3O1H A;  5FYM A;  1YKE B;  3KBU A;  3IF8 B;  5FXV A;  3UFE A;  2YEV C;  2EHO D;  3I9Y A;  3IHR A;  4YLH A;  4P0A A;  1ZV4 X;  5LNK A;  3PTR B;  3ZN1 B;  4QXB B;  5BMV E;  3ESL A;  3S4U A;  4GIW A;  4DMV A;  2D5U A;  1G8X A;  1BR0 A;  2KLQ A;  2IC6 A;  1UX5 A;  4A56 A;  3N9M A;  2VAS A;  3VKG A;  2B1E A;  4C91 A;  4NUU A;  1MIY A;  4O8S A;  2JQQ A;  3NZQ A;  4FI5 A;  2BVM A;  2LHN A;  3CKD A;  5JDQ A;  3CWZ B;  5FY0 A;  3CML A;  2LSG A;  2X68 A;  2BZB A;  1YKH B;  4OHF A;  4AKI A;  2NW9 A;  2C5I T;  1UCU A;  3E08 A;  3HA4 A;  2ES0 A;  4ILU A;  3CPZ A;  2L8K A;  3O1I A;  5L3D B;  3V5S A;  2CA5 A;  3LJC A;  3ZPO A;  4ZI3 D;  3U3I A;  3LFM A;  4JEH B;  2WMO A;  1WYB A;  2DLR A;  5DAB A;  5AFU L;  5LJN A;  3AA7 B;  2Y48 B;  2D0T A;  4OYK A;  4TV9 E;  1MIV A;  2DNX A;  4TZ4 C;  3RPU A;  2MOZ A;  2L9Q A;  4P0B A;  4TV8 E;  4OK0 A;  5JH7 E;  4NUV A;  5LYJ E;  2NOX A;  5HWX A;  4ISS A;  4O4L E;  3KBT A;  2XAQ B;  3N5L A;  3CX8 B;  3J9X 1;  3N9P A;  3PU8 A;  4PJL A;  3UTK A;  4E7Z A;  4OFZ A;  3HR0 A;  4CI2 B;  2P9B A;  3OKQ A;  1B7T A;  4GYS A;  5LGN B;  2Z6E A;  1HTJ F;  2V7M A;  3PUS A;  3K3N A;  3IBP A;  3NZP A;  5LA6 E;  3B13 A;  1MIW A;  2KIN B;  2VB6 A;  3PUQ A;  4XZC A;  3NRY A;  2X9W A;  3UUL A;  3C4Z A;  2NP9 A;  1FMW A;  2XAH B;  3OYX A;  2QGS A;  3DJB A;  5E0O A;  5F8P A;  4MAL A;  1D0X A;  2HPL A;  4PFO A;  3QK6 A;  4HN9 A;  4BAY B;  5JRC B;  3O9X A;  3W15 B;  2CMR A;  1HG2 A;  4UVB B;  2W62 A;  2Q9Q A;  3Q2M A;  4I43 B;  3UUX B;  3AB3 B;  2E9X C;  5J1G A;  2IC9 A;  4PK5 A;  3RC8 A;  2MYS A;  3BQI A;  3KV9 A;  2WSS V;  4L0R A;  4DND A;  2K24 A;  3GMI A;  3UUN A;  4KUM B;  4P09 A;  4H63 V;  2BVL A;  2Q9Q C;  4HFV A;  4IE7 A;  3KFW X;  1QUU A;  2NWB A;  3AA0 B;  4CXX A;  1BR4 A;  3HKE E;  4MHC A;  2K5B B;  4HE8 A;  2V26 A;  2WWU A;  2SPC A;  3MJX A;  3LK2 B;  2PFV A;  3AVR A;  5LBM A;  4GYR A;  3RX6 A;  4N78 D;  4KMC A;  2VKD A;  3SOL A;  2J1D G;  2JMK A;  1LVF A;  3DP7 A;  3E0Z A;  2G0U A;  3C4W A;  4EYY R;  5LGT B;  5JRE A;  2LHR A;  3P8C D;  5FNV E;  4PFP A;  3ZYM A;  1D1B A;  2D2S A;  3PUR A;  3RRW A;  2C5K T;  2X66 A;  4CI1 B;  5HYA A;  1IJ6 A;  4JUY A;  2KXP B;  3ZN0 B;  2Y8D A;  3OYZ A;  2V7J A;  4K0U A;  4J2C A;  3QC9 A;  4AKR B;  3A5X A;  2ACX A;  4X1K E;  2BDE A;  4ASK A;  2WMN A;  2XTL A;  2KMF A;  2RA1 A;  3DTO A;  3F2E A;  3ZLI A;  2E8I A;  5HXS A;  2DHR A;  3N2G E;  3ETU A;  3Q5X A;  3KVB A;  3GN5 A;  2XQY A;  5KMG P;  1ZHC A;  1G73 A;  5HAX A;  2XHE B;  3L09 A;  5DQW A;  5JRC A;  5HXE A;  4AQF C;  3FBZ A;  4X1I E;  1D0Z A;  3ZJ2 A;  2E9X B;  1VRB A;  2NTY A;  2L3L A;  3ZYK A;  3EVY A;  1NAF A;  3P7I A;  4QX8 B;  3VU7 H;  3FXD B;  3LK4 2;  3MAC A;  3F57 A;  3AAE B;  3HKD E;  3ZMZ B;  3MK7 C;  4TN7 B;  3RYH E;  1KK7 A;  3GA8 A;  1OWA A;  2MBG A;  2UXX B;  1HS7 A;  4QHO A;  3B57 A;  2Q9Q B;  5CA1 E;  4C90 A;  2LSY A;  3AVS A;  5EK3 A;  3MA9 A;  2C5J A;  2PBI A;  2V7I A;  4KP3 C;  1IJ5 A;  1HG5 A;  5EK4 A;  5J2T E;  3PU3 A;  2ZMA A;  2YU2 A;  1HX8 A;  4TUY E;  2X9Y A;  2W61 A;  4ZHQ E;  2OA5 A;  3N9L A;  2WM9 A;  3CX6 B;  3ZC0 A;  5H6Q B;  4EOZ B;  3R6N A;  2IAK A;  1OXZ A;  4WBO A;  3F31 A;  5DQV A;  3LBX A;  5HXC A;  2HPJ A;  4IE0 A;  3RRC A;  1HCI A;  1E1H B;  2IW5 B;  2VL8 A;  5FXX A;  3WI3 A;  3ONX A;  2QA7 A;  4HEA A;  4WBN E;  2JMH A;  2MTQ A;  3CQX C;  4DBR A;  5L3F B;  2XAG B;  4G63 A;  4KBM B;  1HFA A;  4GOU A;  3Q5W A;  4AKG A;  1FMV A;  2CXF A;  3I1A A;  2W00 A;  2LM9 A;  3QUJ A;  3FBL A;  4O4I E;  1EZ3 A;  5FY1 A;  3VHL A;  2E9X D;  2HH7 A;  2CM0 A;  2D0U A;  4I4T E;  2KND A;  2ZM0 A;  4M1P A;  5EZY E;  2CWY A;  1BR1 A;  3C51 A;  1US7 B;  2ZLY A;  3T8O A;  2E9X A;  2LE8 A;  2LSI A;  2X67 A;  4IST A;  2LOS A;  3GN5 B;  3I9W A;  2Q9Q D;  5L3C B;  4IDZ A;  3ANW B;  1SA0 E;  4HKA A;  5L3E B;  2KWI B;  4EIW A;  2NW7 A;  3MXZ A;  4I50 E;  5CA0 E;  2WAU A;  5HWY A;  2CXL A;  3SRZ A;  3NBX X;  2VKO A;  4YFS A;  3RYC E;  2LEH A;  4EXT A;  4TX5 A;  4AKL A;  2XAJ B;  4DMW A;  3ZMT B;  4DO0 A;  1O3X A;  3PUA A;  3HL6 A;  2DCF A;  4PK4 A;  4PJN A;  2NW8 A;  3U78 A;  5JR9 B;  2LT3 A;  4AQG A;  4H9O C;  4PJM A;  4YHJ A;  5L3G B;  4PK6 A;  1CUN A;  3KV6 A;  4DVD A;  4UEM A;  4E7S A;  4UV8 B;  4ZS2 A;  3MZK B;  3FHN A;  2DWK A;  1FIO A;  3CVR A;  3PDY A;  4ANJ A;  3EUH A;  3CQC B;  5L3B B;  3V5U A;  4PW8 A;  3C4X A;  4ERR A;  2KWH A;  2M67 A;  4IIJ E;  4PJJ A;  3N2O A;  4UXN B;  5ETW A;  3K8P C;  3LBX B;  1T98 A;  3FXE B;  2VKJ A;  3I0O A;  3ZEF B;  4H9R C;  5LHH B;  2CWO A;  3L3P A;  1S94 A;  4QWN B;  3WAK A;  5LHG B;  3H37 A;  4BJM A;  1Y64 B;  4QXC B;  3O1J A;  5LOV E;  3BK9 A;  2ZM8 A;  4CQI A;  2H3R A;  5FXW A;  5KDM C;  4YJ2 E;  2CCQ A;  4JEU B;  4AQF A;  4XAX B;  4EAH A;  1YD8 G;  3ZMV B;  2JJ9 A;  2ODU A;  2X51 A;  1QSD A;  4UVA B;  5JDM A;  4QX7 B;  3UUM A;  3KVA A;  3ANW A;  2Y6X A;  1V9D A;  1MND A;  4O2A E;  4U74 A;  3RC3 A;  4UVC B;  4JLE A;  2GK9 A;  4L9I A;  3ZCI A;  1MMD A;  1MMA A;  4OYJ A;  3TKL B;  3HI2 A;  4H9N C;  5FP3 A;  3OBV E;  1D0Y A;  4BA9 A;  3PUG A;  4FJO A;  4YJ3 E;  5LXT E;  3N2K E;  2X9X A;  4HTE A;  5JDH A;  2W63 A;  4AXP A;  4IHJ E;  4UF0 A;  5JR9 A;  4X20 E;  1Z0P A;  2PJQ A;  3C64 A;  2YIN A;  2EHO A;  1NWM X;  2NTX A;  3KV5 A;  4Z8X A;  4MFR A;  5JQG E;  3ZMS B;  5IYZ E;  5LCY A;  1YW0 A;  1D1A A;  5JR9 C;  3D0T A;  1U4Q A;  4GK5 E;  3SWH A;  3VKH A;  4ZOL E;  3Q9D A;  1D1C A;  2JRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...