4PW8A

Human tryptophan 2,3-dioxygenase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
342
structure length
306
Chain Sequence
IYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSRYKVFVDLFNLSTYLIPRHWIPKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of human tryptophan 2,3-dioxygenase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
total genus 122
structure length 306
sequence length 342
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pw8A01
2NW8A 2V7JA 4PK5A 2NOXA 1YW0A 2V7MA 2D0UA 2X66A 4U74A 2D0TA 4HKAA 2NW7A 2NW9A 2V7LA 2X68A 5EK3A 5EK2A 5ETWA 1ZEEA 4U72A 3BK9A 5EK4A 2X67A 3E08A 2NWBA 2V7IA 2V7KA 4PK6A 4PW8A
chains in the Genus database with same CATH superfamily
3L8RA 4GYRA 2A2FX 2V6YA 2XASB 4KUMB 1ZP0A 1R8IA 2K48A 5HXSA 4KBMB 2EHOB 2C0SA 4EZ4A 5BMVE 2NOXA 4BAYB 3AEAA 4EIWA 4ERRA 3F2EA 3ZT5A 2Y6XA 3OYZA 3JADA 2BG9C 2WU2A 3W15B 2X9XA 3T8OA 4IIJE 3VKGA 3RGLA 2C5IT 1MMDA 3ZT6A 2XM1A 3DP7A 1MNEA 4A97A 3OBVE 4K0UA 4I43B 3ZYLA 5FXXA 3BQLA 2VK9A 2N1GA 3AXJA 3AA6B 5FY7A 1OEDA 1GQEA 5AQJB 1L0VA 2YU1A 2EHOC 1WFDA 4TNVA 3K3OA 2M6IA 4CI1B 5JR9C 4YHHT 4DR4T 2WSSV 3UULA 2CA5A 2LM9A 3GN5B 4CN4A 2LT3A 3ZMTB 3RRCA 2F4VT 2ACXA 2DL1A 2XAFB 5E0OA 4IL9A 3CQGB 2JIWA 2KSRA 3RQWA 3ZPOA 3AEEA 3HR0A 3PUVF 5C3JA 1BR1A 3GA8A 3UQ4A 3RX6A 5AQHB 1Y64B 4MALA 3KV4A 4HEAA 5AQRB 3FBLA 4WBOA 2XQ9A 2VWAA 3KVAA 4BJMA 5KMGP 5FY1A 3K8PC 4O4IE 5LHGB 5AQLB 4IE5A 4AKLA 1J5WA 3RYFE 5JR9B 5ABEA 1XDPA 3AE8A 3LJCA 4J2CA 4IE6A 5HXCA 3LFMA 5L3GB 3LBXA 2BG9A 3SFEA 2B76A 3I0QA 1W0BA 5EK3A 2JMHA 5HXRA 3EDUA 2YN6A 3CVRA 4JUYA 3K3QC 4ZZCA 1IJ5A 3ANWB 4NPPA 2A9UA 2W67A 1D0YA 2I59A 4OFZA 1KEYA 4PFPA 2Z6EA 3LDQB 5FXZA 5AFUL 3LK3B 5KX5E 3ZSTA 4JI6T 5HEOA 3P4QA 3RI5A 1HG2A 3OPCA 4WZXA 5L4HA 5J2UE 2LSJA 3AAAB 1MIYA 1QLBA 2BVMA 2XPKA 3PU8A 5A1LA 4DV0T 2PTFA 3UU8A 2BKOA 3ETVA 3RC8A 2Y8DA 3HI2A 2WMNA 4HFEA 3PUQA 4JI3T 2X9YA 4I55E 2YINA 3VU7H 1HX8A 3VR9A 5CGMA 3AEDA 4LF4T 4OX9T 3KV9A 4DIDB 2BBJA 2VQET 2X66A 4IDZA 4U74A 2ZM0A 3MA9A 4QX8B 4B3RT 3JAEA 4O2BE 4H9NC 4AXPA 3FZLB 3RIUA 2V7LA 3U78A 3ZC1A 4DV2T 3PJAA 1E2AA 4HFIA 4GKJT 2NTYA 3UUMA 5JRCB 3SWHA 2J1DG 3UUXB 1ZEEA 4DV4T 3R84B 5AQFB 2LRKA 1WR6A 4TN7B 2X0HA 1T72A 3FXDB 4H9RC 3ZYKA 5JQGE 1HNZT 5JDMA 3UTKA 3NWIA 4YJ3E 1NEKA 4QKNA 5FL0A 5HEGA 5LG3A 4H9OC 2DNXA 4PK6A 2IHR1 3O1HA 4PW8A 1XNRT 2V1DB 4EB6E 4F6RC 4U2ZA 2MBGA 2RP4A 2XY8B 2JQKA 1U5PA 3Q5EA 4G2AA 2MYSA 1YW0A 1J5ET 5KDMC 1FEWA 3CX6B 5DQVA 4B3TT 3LK2B 4CZZB 3ZEFB 3M65A 2NTXA 2WM9A 2CBJA 4UF0A 2CHNA 1D0XA 4IDNA 4YTPA 4P1NA 1BR4A 1N33T 4MFRA 4B6XA 3P4SA 2E9XA 5FXWA 5IWAT 2WP9A 1KNRA 4LF9T 4HE8A 2J62A 2XQ3A 4B3MT 4DUYT 3C4WA 5FY0A 4COFA 1N32T 4PJJA 2MOZA 3ESLA 3UUBA 2UXNB 1FMWA 2FJDA 4OHFA 2X0LB 3EI0A 2LSGA 4YJ2E 5LGNB 3TKLB 3I1AA 5ABHA 3AB3B 4O4HE 4IE7A 3B57A 2BS2A 4QX7B 5HXEA 4KHZF 1UX4A 5L3EB 3AA1B 1W0AA 2NW8A 3AECA 3RF1A 4AKRB 4AQFA 4ILUA 1WLXA 5LMUT 4QXHB 4LMJA 5AQPB 5AQNB 5TAOA 4CN1A 3X1DA 1UGOA 2YKSA 3C50A 3ZKRA 5LJNA 2DHRA 2W2UA 1IBLT 4GOUA 4JI4T 3EHZA 3I9WA 1SE7A 3CKDA 1XNQT 2M6BA 4YTMA 1M62A 2QRXA 1UURA 3PUXF 2KWIB 5GONE 2FJAA 2X9WA 2NW7A 2XAGB 2D9DA 3SRZA 5LXTE 1VOMA 2XHEB 5LP6E 4Z8XA 2Q9QC 3H3MA 4ZXLA 4X62T 2IIUA 3E22E 3QB5A 2W62A 5HEUA 2IDOB 2LHNA 3RPUA 2XAQB 3E08A 3B13A 2W61A 3EABA 4A98A 4ADZA 2BZBA 5HWYA 2BS3A 2KINB 3O1IA 1T8BA 2HPJA 1MMAA 3LK42 4YXDA 2LSKA 3RQUA 5C8YE 4DUZT 2E8IA 1M7KA 2YU2A 1CHUA 3AAEB 3KINB 4U2YA 4LFBT 5HCMA 5LJMA 2V7JA 5DJQC 2XM2A 4BA9A 2BS4A 2YDQA 2IUBA 2I6HA 3HKCE 3Q5DA 4ZS2A 5AQIB 2WWVA 4CQIA 4PJNA 5FL1A 4CI3B 4Z90A 3RKGA 2ES0A 4CXXA 2UUCT 2LSIA 1IZNB 4QH5A 3CQCB 4AISA 5JDHA 1KNZA 3Q9DA 5LBMA 4HKAA 4IE4A 4LF5T 1G73A 3AAIA 4UXNB 3C51A 3DJBA 2BVLA 2ODUA 3ZLIA 5HEJA 4YLHA 1MNDA 5F3JA 1UCUA 1X9BA 1BR0A 4ZOLE 3WI3A 4AKGA 2BG9E 2LRLA 4QWNB 2WDRA 3AVRA 5FYMA 2JQHA 3HA4A 4MLKA 4X20E 2L8KA 2ZM6T 1Z0PA 1QSDA 4DVDA 2XQ4A 4L5GA 5C2TA 2CEAA 2H89A 4YFSA 5FVKA 2VVSA 4X65T 3QK6A 2CLYC 2IC6A 3QNUA 4LFCT 2WZHA 2EHOD 3HL6A 5JVDE 3FZKB 3UQ7A 5J0ZA 3U3IA 3L3PA 1AJ3A 3BQIA 1WYCA 4LF8T 1HX1B 4NUVA 3ZMZB 4DO0A 1VCTA 4YTNA 4AQYT 2V5CA 1KFYA 4OYKA 1OWAA 2W66A 2OV9A 2VKDA 4NUUA 4YT0A 3RRWA 5LHHB 2M67A 4PFOA 4TV9E 5LGUB 4EAHA 2R6GF 4H63H 4WNKA 5LGTB 1VCSA 4JV5T 4KHPT 1XZYA 1D1CA 5JDGA 1UK5A 4XBFB 5LB7B 4HGAA 4HFDA 4JI2T 1HCIA 4O8SA 3UU6A 1BR2A 3RYIE 1HF8A 4EXTA 2B1EA 4B3ST 3ZJ2A 3RIFA 3N2GE 4ZEYA 2JMKA 3N5LA 3N9QA 3TLSA 4MBQA 4WW0A 4XAXB 1B7TA 4ZI3D 4WBNE 1E7PA 4HWFA 2BBHA 4HWCA 2LHRA 3HKEE 4A5XA 2QYWA 4EV6A 1OEDB 2X51A 2JQQA 2VKHA 1MMGA 3ZSSA 4ZI7E 2ZM2A 2MPKA 2ZLYA 2D2SA 4ISTA 5HWXA 3LSVA 3JC6C 4IHJE 3ONJA 4UF0B 4Z91A 1DU2A 2KLQA 3PU3A 1LKXA 3AE9A 4H9PC 3J9X1 5H6RB 4NXNT 1IBKT 1MMNA 4IDQA 4QXBB 3C4ZA 2H88A 4UEMA 3ZMVB 4DBQA 2VQFT 1HNWT 3KV6A 4PJMA 2CRBA 5AQMB 2SPCA 4HWDA 4H9SE 2WQYA 2IC9A 3FXEB 3PURA 3IA3A 1ZKEA 5FVLA 3N2OA 1IAPA 3IEEA 4PAGA 2UUBT 3P4WA 2K3WA 4ASKA 2IAKA 1JNRA 1QUUA 4EEBA 2C5KT 1HR0T 1E1HB 4X66T 4DR3T 4KMCA 4LMLA 4X5TA 2JPFA 4FJOA 3HKBE 2V26A 4O2AE 2XQ5A 1X79A 4ILAA 5F8PA 3ZN1B 3RC3A 1YQ4A 4DV3T 5JRCA 4JBWF 5FP3A 2XQ7A 3P7IA 1H7CA 2WDQA 3IHRA 3G06A 2QVAA 3FBZA 4ZI2C 4QXCB 2WMOA 1SUMB 2KZ7B 3AE1A 3EUHA 2HHHT 3CMLA 1YQ3A 2X67A 5ABFA 4DBRA 2KXPB 1U4QA 3CWZB 1NWMX 2D5UA 4QH1A 2UU9T 4CXYA 2V7IA 3CK6A 4IE0A 1LRZA 2BG9B 2Q9QB 3EDVA 5LYJE 2AXDS 3WAKA 2V5DA 4CI2B 4TV8E 5JDFA 3PTRB 5JR9A 3QUJA 3RKOA 5LG4A 2PBIA 2LSYA 3RIUC 2CXLA 2XUEA 3P4PA 3JCFA 1IJ6A 3N2KE 2BKNA 4IT4A 3Q5XA 4YSXA 2XTLA 4HFVA 1LVFA 2V7MA 2Y48B 3CX8B 4LMKA 3ANWA 1XMOT 2QA7A 4EYYR 4I50E 2D0TA 4JI5T 4ZI2D 1S35A 2CXDA 2K9AA 1KK7A 3LBXB 2L3LA 4DMVA 2V8SV 2DI4A 2FJEA 3PE0A 3PDYA 1T98A 3GN5A 3KBTA 2UUAT 5L3FB 2VASA 2CHOA 3NZPA 4I4TE 2BDEA 1HNXT 4KI0F 4HWHA 3AXJB 4ZS3A 1Z8UA 2E9XB 2NWBA 4HFHA 1Y01A 1UUSA 2V6XA 3N9PA 3P8CD 4OYJA 2LE8A 4JEUB 4TX5A 1FIOA 3SFDA 4ZHQE 3O4XE 4TZ4C 1O3XA 4TWDA 3K1SA 1LVKA 1S94A 3KVBA 3UFGA 3ZCJA 4N78D 4YSYA 4PJLA 5J2TE 1KNPA 1SHZC 5HEHA 3UU4A 3O1JA 5LNKA 1JNZA 2WWUA 3N9NA 3QC9A 2W63A 2ZMAA 3O9XA 4AI6A 4JLEA 2KT9A 4ANJA 4DMWA 5BR8T 5J1GA 2XQ6A 4UV8B 2CMRA 4H9QC 3SOLA 4ZZBA 5L47A 4DR7T 3AE4A 1T7SA 3VRAA 3AA7B 5HAXA 2VVNA 5LCYA 4HWIB 4AIUA 4JEHB 3C4XA 3TLTA 1XWMA 2JJ9A 4P0BA 3MXZA 4GK5E 2QGSA 1N36T 3EAMA 3ZN0B 2UXCT 4GIWA 1UX5A 2XQ8A 3M3ZB 5JREA 2OA5A 4JI7T 3PJAJ 2EHOA 2KNDA 4HN9A 1EZ3A 5ABGA 1OEDC 3S4UA 2JRKA 2PJQA 4ZI3C 2V6YB 4UVAB 3UFEA 4DR5T 4IDPA 5LMNT 2W0GA 4CXWA 1MIWA 2NP9A 3KFWX 2WBLA 1WRDA 3ONXA 3VHLA 1YKEB 4HFBA 4PK5A 2UXXB 4U7IA 4V1Av 2LOPA 4UVCB 2DLRA 2P9BA 3NZQA 4TUYE 2DWGA 4UELA 1I94T 4DV1T 2XQAA 2DCFA 2K5BB 3MK7C 3ZT7A 4ILCA 3MACA 5IUXA 1IBMT 3T1HT 3VR8A 3P50A 3PUAA 4CN6A 2BKPA 2RA1A 4ILBA 2VL8A 3GMIA 4G63A 3SS1A 2C5JA 3ZJ1A 4M1PA 1SA0E 3P4RA 5AQOB 4DR1T 4O4LE 4U72A 4UVBB 3LG7A 1W09A 3ABVA 4QH4A 3TLUA 4DR6T 3ZMUB 3ETUA 3BQKA 1HG5A 2XAHB 3MKDA 4YSZA 5FMNA 2G0UA 3FZMB 5AQUB 1MIVA 3AE6A 3PUGA 1HS7A 5CFBA 2DWKA 1V9DA 2X9HA 2XQYA 3TLWA 3FZFB 2K24A 2LKGA 5DQWA 3AE7A 5ADXL 5L3CB 4F8HA 4KX6A 4EOZB 2RPAA 4GYSA 4WYVA 3N9OA 4C90A 3V5UA 2XSAA 3CX7B 2D0UA 5AQTB 5H6QB 1G8XA 3CPZA 1HFAA 3A5XA 3F57A 3ONLC 2CM0A 3RYHE 2WCAA 1US7B 3L39A 4JI0T 2YDRA 4H63V 5LA6E 4L0RA 2WZIA 3RH3A 2NR4A 3PUSA 3KBUA 4O4JE 4U33A 5AQGB 3UT5E 3NVOA 3E0ZA 1FMVA 4MHCA 1OXZA 3ZMSB 2KWHA 3OYXA 4U3CA 4PK4A 5ETWA 5L3DB 2H7OA 2IMLA 2FJBA 3WAJA 2N9DA 2Q9QD 2PFVA 3OVUA 1YXRA 3RLFF 5L2LA 4GK0E 2LKHA 1XMQT 4JI1T 2HPLA 1J1JA 2ACZA 3AE3A 3DTOA 3FB2A 3ZYMA 4AQGA 5JDQA 1XDOA 1D0ZA 3JAFA 2W4XA 4P0AA 4K0KT 3I9YA 5AQKB 1D1AA 2HH7A 1KF6A 2V7KA 4KP3C 4U7YA 5JTGA 2E2AA 1D1BA 2A3DA 3UUNA 2E5LT 2CE7A 4DNDA 2UXBT 2CWOA 3RYCE 4E7SA 3H37A 4UR9A 3R6NA 3NBXX 1YD8G 2L9QA 4EEDA 2E9XD 3AEGA 2XZEA 4FI5A 4GKKT 3NRXA 3N9LA 5JH7E 4XZCA 4NXMT 1NENA 3A7MA 3FHNA 4TWHA 5DABA 2VKOA 5FXVA 3EVYA 2NW9A 5CA1E 2YK0A 5CA0E 5LHIB 3PUZF 2X0YA 2FBWA 4TWFA 4X1YE 1OEDE 2OLTA 3K3NA 4IGUA 4HFCA 4X1IE 1WYBA 3CIRA 5EZYE 4EYUA 2H7VC 1W9RA 1ZHCA 2VB6A 3KV5A 2J47A 2JQ9A 2WDVA 2CPTA 3I0OA 2CCQA 5CJ5A 4QHOA 4DV7T 2YDSA 4AQFC 3JC6D 2H3RA 2PG8A 4AKHA 4E7ZA 3GWHA 2WAUA 4AKIA 4Q25A 1FJGT 3B5MA 3FZHB 5HYAA 4I0UA 3UU3A 5AQVB 2VL0A 4IDOA 4L9IA 2UXDT 4A56A 2LJLA 3PV0F 2XJ7A 5IHYA 4ISSA 2E9XC 3Q5WA 3A8YC 2VKJA 3AE2A 3NKZA 4P09A 3D0TA 2HN1A 2WY2A 4U31A 2E5VA 5M4YA 4JYAT 3OJAA 3MZKB 2VURA 5LOVE 4LF7T 5F5WA 3OTOT 4HTEA 3PUYF 2ODVA 2WB5A 5AQQB 5AQSB 4IREA 5HXHA 5L3BB 2W00A 3PUWF 3RHWA 2XSBA 5EK2A 4X1KE 3J7Yq 2I0MA 3HKDE 5KXJA 5EK4A 2CLYB 1CUNA 3N9MA 4LFAT 2FUPA 2CXFA 5FKYA 5HCJA 3H3AA 2WS3A 1VRBA 2WU5A 3AVSA 4YHJA 5JDLA 1NAFA 2CWYA 4C91A 1I6ZA 2LEHA 4DV6T 3F31A 5FNVE 3KDSE 3VKHA 2XAJB 1HTJF 3AE5A 2Q9QA 3IF8B 2GK9A 3CQXC 3IBPA 4TNWA 4DR2T 5CB4E 4X64T 2CBIA 3L09A 3C98B 2MTQA 3OKQA 4EZHA 2MAWA 5JDNA 5ABFB 2A72A 2ZM8A 1ZOYA 2AE9A 2YEVC 3AA0B 2KMFA 2LOSA 3AEBA 3Q2MA 3T1YT 2J4GA 1WR0A 2X68A 3ZC0A 1WCRA 5IYZE 2IW5B 5LBQB 3ZCIA 4YY3T 1N34T 4EGWA 1ZV4X 3BK9A 4OK0A 4DV5T 3UU5A 3QOFA 2HN2A 4NIQA 4LF6T 1YKHB 2LLYA 4PNIA 3AEFA 4JI8T 3QB5K 4UV9B 2YOEA 2LM2A 4UIGA 2N2NA 3RIAA 3NRYA 3V5SA 3MJXA 4BJNA 3VRBA 4IL4A 5L4EA 3C64A 3TLVA
chains in the Genus database with same CATH topology
4GYRA 2A2FX 2XASB 4KUMB 5HXSA 2K48A 4KBMB 2EHOB 2C0SA 4EZ4A 5BMVE 2NOXA 4BAYB 4EIWA 4ERRA 3F2EA 2Y6XA 3OYZA 3W15B 2X9XA 3T8OA 4IIJE 3VKGA 2C5IT 1MMDA 3DP7A 1MNEA 3OBVE 4K0UA 4I43B 3ZYLA 5FXXA 3BQLA 2VK9A 2N1GA 5FY7A 3AA6B 2YU1A 2EHOC 3K3OA 4CI1B 5JR9C 2WSSV 3UULA 2CA5A 2LM9A 3GN5B 2LT3A 3ZMTB 3RRCA 2ACXA 2XAFB 5E0OA 4P0AA 3CQGB 3ZPOA 3HR0A 1BR1A 3GA8A 3RX6A 1Y64B 4MALA 3KV4A 4HEAA 3FBLA 4WBOA 2VWAA 3KVAA 4BJMA 5LHGB 5FY1A 3K8PC 4O4IE 4IE5A 4AKLA 3RYFE 5JR9B 3LJCA 4J2CA 4IE6A 5HXCA 3LFMA 5L3GB 3LBXA 3I0QA 5EK3A 5HXRA 2JMHA 3EDUA 3CVRA 4JUYA 3K3QC 1IJ5A 3ANWB 4OFZA 1D0YA 2I59A 4PFPA 5FXZA 2Z6EA 5AFUL 3LK3B 5KX5E 1HG2A 5J2UE 2LSJA 3AAAB 1MIYA 2BVMA 3PU8A 5A1LA 3ETVA 3RC8A 2Y8DA 3HI2A 2WMNA 3PUQA 2X9YA 4I55E 2YINA 3VU7H 1HX8A 3KV9A 2X66A 4IDZA 4U74A 2ZM0A 3MA9A 4QX8B 4O2BE 4AXPA 4H9NC 2V7LA 3U78A 3ZC1A 2NTYA 3UUMA 5JRCB 3SWHA 2J1DG 3UUXB 1ZEEA 3R84B 1WR6A 4TN7B 4H9RC 3ZYKA 3FXDB 5JQGE 5JDMA 3UTKA 4YJ3E 4QKNA 4H9OC 2DNXA 4PK6A 3O1HA 4PW8A 2V1DB 4EB6E 4F6RC 2MBGA 2RP4A 4G2AA 1U5PA 2MYSA 1YW0A 5KDMC 1FEWA 3CX6B 5DQVA 3LK2B 4CZZB 3ZEFB 3M65A 2NTXA 2WM9A 4UF0A 1D0XA 1BR4A 4MFRA 4B6XA 2E9XA 5FXWA 4HE8A 3C4WA 5FY0A 4PJJA 2MOZA 3ESLA 2UXNB 1FMWA 4OHFA 2X0LB 2LSGA 4YJ2E 5LGNB 3TKLB 3I1AA 3AB3B 4O4HE 4IE7A 3B57A 4QX7B 5HXEA 5L3EB 1UX4A 3AA1B 2NW8A 4AKRB 4AQFA 4ILUA 1WLXA 4QXHB 5TAOA 5LJNA 3C50A 2DHRA 4GOUA 3I9WA 3CKDA 5GONE 2KWIB 2X9WA 2NW7A 2XAGB 3SRZA 5LXTE 1VOMA 2XHEB 5LP6E 4Z8XA 2Q9QC 3E22E 2W62A 2LHNA 3RPUA 2XAQB 3E08A 3B13A 2W61A 4ADZA 2BZBA 5HWYA 2KINB 3O1IA 2HPJA 3LK42 1MMAA 2LSKA 5C8YE 2E8IA 3KINB 2YU2A 3AAEB 5LJMA 2V7JA 5DJQC 4BA9A 3HKCE 4ZS2A 4CQIA 4PJNA 4CI3B 4CXXA 2ES0A 2LSIA 1IZNB 3CQCB 5JDHA 1KNZA 3Q9DA 5LBMA 4HKAA 4IE4A 1G73A 3AAIA 4UXNB 3C51A 3DJBA 2BVLA 2ODUA 3ZLIA 4YLHA 1MNDA 5F3JA 1UCUA 1BR0A 4ZOLE 3WI3A 4AKGA 4QWNB 3AVRA 5FYMA 3HA4A 4MLKA 4X20E 2L8KA 1Z0PA 1QSDA 4DVDA 4L5GA 2CEAA 4YFSA 3QK6A 2CLYC 2IC6A 3HL6A 2EHOD 5JVDE 3U3IA 3L3PA 1AJ3A 3BQIA 1WYCA 3ZMZB 4NUVA 4DO0A 4OYKA 1OWAA 4NUUA 2VKDA 3RRWA 5LHHB 2M67A 4PFOA 4TV9E 5LGUB 4EAHA 4WNKA 4H63H 5LGTB 1D1CA 5JDGA 4HGAA 1HCIA 4O8SA 4EXTA 1BR2A 3RYIE 1HF8A 2B1EA 3ZJ2A 3N2GE 2JMKA 3N5LA 3N9QA 4MBQA 4WW0A 4XAXB 1B7TA 4ZI3D 4WBNE 2LHRA 3HKEE 2X51A 2JQQA 2VKHA 1MMGA 4ZI7E 2ZM2A 2ZLYA 4ISTA 2D2SA 5HWXA 3JC6C 4IHJE 4UF0B 2KLQA 3PU3A 1LKXA 4H9PC 3J9X1 5H6RB 1MMNA 4QXBB 4DBQA 3C4ZA 3ZMVB 4UEMA 3KV6A 4PJMA 2SPCA 4H9SE 2IC9A 3FXEB 3PURA 1ZKEA 3N2OA 1IAPA 3IEEA 4PAGA 4ASKA 2IAKA 1QUUA 2C5KT 1E1HB 4KMCA 2JPFA 4FJOA 3HKBE 2V26A 4O2AE 3ZN1B 1X79A 5F8PA 3RC3A 5JRCA 5FP3A 3P7IA 1H7CA 3IHRA 3FBZA 4ZI2C 4QXCB 2WMOA 2KZ7B 3EUHA 3CMLA 2X67A 4DBRA 2KXPB 1U4QA 3CWZB 1NWMX 2D5UA 4CXYA 2V7IA 4IE0A 1LRZA 2Q9QB 3EDVA 5LYJE 3WAKA 4CI2B 4TV8E 5JDFA 3PTRB 5JR9A 3QUJA 3RKOA 5LG4A 2PBIA 2LSYA 2CXLA 2XUEA 1IJ6A 3N2KE 3Q5XA 2XTLA 4HFVA 1LVFA 2V7MA 2Y48B 3CX8B 3ANWA 2QA7A 4EYYR 4I50E 2D0TA 4ZI2D 1S35A 2CXDA 2K9AA 1KK7A 3LBXB 2L3LA 4DMVA 2DI4A 3PE0A 3PDYA 1T98A 3GN5A 3KBTA 5L3FB 2VASA 3NZPA 4I4TE 2BDEA 4ZS3A 2E9XB 2NWBA 4OYJA 3P8CD 4TX5A 3N9PA 4ZHQE 2LE8A 4JEUB 1FIOA 3O4XE 4TZ4C 1O3XA 3ZCJA 1LVKA 1S94A 3KVBA 4N78D 4PJLA 5J2TE 1SHZC 3O1JA 5LNKA 2WWUA 3N9NA 3QC9A 2W63A 2ZMAA 3O9XA 4AI6A 4JLEA 2KT9A 4ANJA 4DMWA 4XBFB 5J1GA 4UV8B 2CMRA 4H9QC 3SOLA 3AA7B 5HAXA 5LCYA 4JEHB 3C4XA 2JJ9A 4P0BA 3MXZA 4GK5E 2QGSA 3ZN0B 4GIWA 1UX5A 5JREA 2OA5A 2EHOA 2KNDA 4HN9A 1EZ3A 3S4UA 5KMGP 2JRKA 2PJQA 4ZI3C 3UFEA 4UVAB 2W0GA 4CXWA 1MIWA 2NP9A 3KFWX 2WBLA 1WRDA 3ONXA 3VHLA 1YKEB 4V1Av 4PK5A 2UXXB 2LOPA 4UVCB 2DLRA 2P9BA 3NZQA 4TUYE 2DWGA 4UELA 2DCFA 2K5BB 3MK7C 3MACA 3PUAA 2RA1A 2VL8A 3GMIA 4G63A 3SS1A 2C5JA 3ZJ1A 4M1PA 1SA0E 4O4LE 4U72A 4UVBB 3LG7A 3ZMUB 3ETUA 3BQKA 1HG5A 2XAHB 3MKDA 5FMNA 2G0UA 1MIVA 3PUGA 1HS7A 2DWKA 1V9DA 2XQYA 2X9HA 2K24A 5DQWA 5ADXL 5L3CB 4EOZB 4GYSA 4C90A 3N9OA 3V5UA 5H6QB 3CX7B 2D0UA 1G8XA 3CPZA 1HFAA 3A5XA 3F57A 3RYHE 2CM0A 1US7B 4H63V 5LA6E 4L0RA 3UT5E 3RH3A 3PUSA 4O4JE 3KBUA 3E0ZA 1FMVA 4MHCA 1OXZA 3ZMSB 2KWHA 3OYXA 4PK4A 5ETWA 5L3DB 2H7OA 3WAJA 2N9DA 2Q9QD 2PFVA 5L2LA 4GK0E 2HPLA 3DTOA 5JDQA 3FB2A 4AQGA 3ZYMA 1D0ZA 3I9YA 1D1AA 2HH7A 2V7KA 4KP3C 1D1BA 2A3DA 3UUNA 2CE7A 4DNDA 2CWOA 3RYCE 4E7SA 3H37A 3R6NA 3NBXX 1YD8G 2L9QA 2E9XD 4FI5A 3NRXA 3N9LA 5JH7E 4XZCA 5FXVA 3FHNA 5DABA 2VKOA 2NW9A 3EVYA 5CA1E 5LHIB 2YK0A 5CA0E 4X1YE 3K3NA 4IGUA 4X1IE 1WYBA 5EZYE 4EYUA 2H7VC 1ZHCA 2VB6A 3KV5A 3I0OA 2CCQA 4QHOA 4AQFC 3JC6D 2H3RA 2PG8A 4AKHA 4E7ZA 3GWHA 2WAUA 4AKIA 5HYAA 4L9IA 4A56A 2LJLA 5IHYA 4ISSA 2E9XC 3Q5WA 2VKJA 4P09A 3D0TA 5M4YA 3OJAA 3MZKB 5LOVE 4HTEA 2ODVA 5L3BB 5HXHA 2W00A 3J7Yq 5EK2A 4X1KE 3HKDE 5EK4A 2CLYB 1CUNA 3N9MA 2CXFA 3H3AA 3AVSA 1VRBA 4YHJA 5JDLA 1NAFA 2CWYA 4C91A 2LEHA 3F31A 5FNVE 3KDSE 3VKHA 2XAJB 1HTJF 3IF8B 2Q9QA 2GK9A 3CQXC 3IBPA 5CB4E 3L09A 3OKQA 3C98B 2MTQA 4EZHA 5JDNA 2A72A 2ZM8A 2YEVC 3AA0B 2KMFA 2LOSA 3Q2MA 2X68A 3ZC0A 5IYZE 2IW5B 5LBQB 3ZCIA 1ZV4X 3BK9A 4OK0A 1YKHB 4PNIA 4UV9B 4UIGA 2N2NA 4BJNA 3NRYA 3V5SA 3MJXA 3C64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW8 A;  2V7J A;  4PK5 A;  2NOX A;  1YW0 A;  2V7M A;  2D0U A;  2X66 A;  4U74 A;  2D0T A;  4HKA A;  2NW7 A;  2NW9 A;  2V7L A;  2X68 A;  5EK3 A;  5EK2 A;  5ETW A;  1ZEE A;  4U72 A;  3BK9 A;  5EK4 A;  2X67 A;  3E08 A;  2NWB A;  2V7I A;  2V7K A;  4PK6 A;  4PW8 A; 
#chains in the Genus database with same CATH topology
 3L8R A;  4GYR A;  2A2F X;  2V6Y A;  2XAS B;  4KUM B;  1ZP0 A;  1R8I A;  2K48 A;  5HXS A;  4KBM B;  2EHO B;  2C0S A;  4EZ4 A;  5BMV E;  2NOX A;  4BAY B;  3AEA A;  4EIW A;  4ERR A;  3F2E A;  3ZT5 A;  2Y6X A;  3OYZ A;  3JAD A;  2BG9 C;  2WU2 A;  3W15 B;  2X9X A;  3T8O A;  4IIJ E;  3VKG A;  3RGL A;  2C5I T;  1MMD A;  3ZT6 A;  2XM1 A;  3DP7 A;  1MNE A;  4A97 A;  3OBV E;  4K0U A;  4I43 B;  3ZYL A;  5FXX A;  3BQL A;  2VK9 A;  2N1G A;  3AXJ A;  3AA6 B;  5FY7 A;  1OED A;  1GQE A;  5AQJ B;  1L0V A;  2YU1 A;  2EHO C;  1WFD A;  4TNV A;  3K3O A;  2M6I A;  4CI1 B;  5JR9 C;  4YHH T;  4DR4 T;  2WSS V;  3UUL A;  2CA5 A;  2LM9 A;  3GN5 B;  4CN4 A;  2LT3 A;  3ZMT B;  3RRC A;  2F4V T;  2ACX A;  2DL1 A;  2XAF B;  5E0O A;  4IL9 A;  3CQG B;  2JIW A;  2KSR A;  3RQW A;  3ZPO A;  3AEE A;  3HR0 A;  3PUV F;  5C3J A;  1BR1 A;  3GA8 A;  3UQ4 A;  3RX6 A;  5AQH B;  1Y64 B;  4MAL A;  3KV4 A;  4HEA A;  5AQR B;  3FBL A;  4WBO A;  2XQ9 A;  2VWA A;  3KVA A;  4BJM A;  5KMG P;  5FY1 A;  3K8P C;  4O4I E;  5LHG B;  5AQL B;  4IE5 A;  4AKL A;  1J5W A;  3RYF E;  5JR9 B;  5ABE A;  1XDP A;  3AE8 A;  3LJC A;  4J2C A;  4IE6 A;  5HXC A;  3LFM A;  5L3G B;  3LBX A;  2BG9 A;  3SFE A;  2B76 A;  3I0Q A;  1W0B A;  5EK3 A;  2JMH A;  5HXR A;  3EDU A;  2YN6 A;  3CVR A;  4JUY A;  3K3Q C;  4ZZC A;  1IJ5 A;  3ANW B;  4NPP A;  2A9U A;  2W67 A;  1D0Y A;  2I59 A;  4OFZ A;  1KEY A;  4PFP A;  2Z6E A;  3LDQ B;  5FXZ A;  5AFU L;  3LK3 B;  5KX5 E;  3ZST A;  4JI6 T;  5HEO A;  3P4Q A;  3RI5 A;  1HG2 A;  3OPC A;  4WZX A;  5L4H A;  5J2U E;  2LSJ A;  3AAA B;  1MIY A;  1QLB A;  2BVM A;  2XPK A;  3PU8 A;  5A1L A;  4DV0 T;  2PTF A;  3UU8 A;  2BKO A;  3ETV A;  3RC8 A;  2Y8D A;  3HI2 A;  2WMN A;  4HFE A;  3PUQ A;  4JI3 T;  2X9Y A;  4I55 E;  2YIN A;  3VU7 H;  1HX8 A;  3VR9 A;  5CGM A;  3AED A;  4LF4 T;  4OX9 T;  3KV9 A;  4DID B;  2BBJ A;  2VQE T;  2X66 A;  4IDZ A;  4U74 A;  2ZM0 A;  3MA9 A;  4QX8 B;  4B3R T;  3JAE A;  4O2B E;  4H9N C;  4AXP A;  3FZL B;  3RIU A;  2V7L A;  3U78 A;  3ZC1 A;  4DV2 T;  3PJA A;  1E2A A;  4HFI A;  4GKJ T;  2NTY A;  3UUM A;  5JRC B;  3SWH A;  2J1D G;  3UUX B;  1ZEE A;  4DV4 T;  3R84 B;  5AQF B;  2LRK A;  1WR6 A;  4TN7 B;  2X0H A;  1T72 A;  3FXD B;  4H9R C;  3ZYK A;  5JQG E;  1HNZ T;  5JDM A;  3UTK A;  3NWI A;  4YJ3 E;  1NEK A;  4QKN A;  5FL0 A;  5HEG A;  5LG3 A;  4H9O C;  2DNX A;  4PK6 A;  2IHR 1;  3O1H A;  4PW8 A;  1XNR T;  2V1D B;  4EB6 E;  4F6R C;  4U2Z A;  2MBG A;  2RP4 A;  2XY8 B;  2JQK A;  1U5P A;  3Q5E A;  4G2A A;  2MYS A;  1YW0 A;  1J5E T;  5KDM C;  1FEW A;  3CX6 B;  5DQV A;  4B3T T;  3LK2 B;  4CZZ B;  3ZEF B;  3M65 A;  2NTX A;  2WM9 A;  2CBJ A;  4UF0 A;  2CHN A;  1D0X A;  4IDN A;  4YTP A;  4P1N A;  1BR4 A;  1N33 T;  4MFR A;  4B6X A;  3P4S A;  2E9X A;  5FXW A;  5IWA T;  2WP9 A;  1KNR A;  4LF9 T;  4HE8 A;  2J62 A;  2XQ3 A;  4B3M T;  4DUY T;  3C4W A;  5FY0 A;  4COF A;  1N32 T;  4PJJ A;  2MOZ A;  3ESL A;  3UUB A;  2UXN B;  1FMW A;  2FJD A;  4OHF A;  2X0L B;  3EI0 A;  2LSG A;  4YJ2 E;  5LGN B;  3TKL B;  3I1A A;  5ABH A;  3AB3 B;  4O4H E;  4IE7 A;  3B57 A;  2BS2 A;  4QX7 B;  5HXE A;  4KHZ F;  1UX4 A;  5L3E B;  3AA1 B;  1W0A A;  2NW8 A;  3AEC A;  3RF1 A;  4AKR B;  4AQF A;  4ILU A;  1WLX A;  5LMU T;  4QXH B;  4LMJ A;  5AQP B;  5AQN B;  5TAO A;  4CN1 A;  3X1D A;  1UGO A;  2YKS A;  3C50 A;  3ZKR A;  5LJN A;  2DHR A;  2W2U A;  1IBL T;  4GOU A;  4JI4 T;  3EHZ A;  3I9W A;  1SE7 A;  3CKD A;  1XNQ T;  2M6B A;  4YTM A;  1M62 A;  2QRX A;  1UUR A;  3PUX F;  2KWI B;  5GON E;  2FJA A;  2X9W A;  2NW7 A;  2XAG B;  2D9D A;  3SRZ A;  5LXT E;  1VOM A;  2XHE B;  5LP6 E;  4Z8X A;  2Q9Q C;  3H3M A;  4ZXL A;  4X62 T;  2IIU A;  3E22 E;  3QB5 A;  2W62 A;  5HEU A;  2IDO B;  2LHN A;  3RPU A;  2XAQ B;  3E08 A;  3B13 A;  2W61 A;  3EAB A;  4A98 A;  4ADZ A;  2BZB A;  5HWY A;  2BS3 A;  2KIN B;  3O1I A;  1T8B A;  2HPJ A;  1MMA A;  3LK4 2;  4YXD A;  2LSK A;  3RQU A;  5C8Y E;  4DUZ T;  2E8I A;  1M7K A;  2YU2 A;  1CHU A;  3AAE B;  3KIN B;  4U2Y A;  4LFB T;  5HCM A;  5LJM A;  2V7J A;  5DJQ C;  2XM2 A;  4BA9 A;  2BS4 A;  2YDQ A;  2IUB A;  2I6H A;  3HKC E;  3Q5D A;  4ZS2 A;  5AQI B;  2WWV A;  4CQI A;  4PJN A;  5FL1 A;  4CI3 B;  4Z90 A;  3RKG A;  2ES0 A;  4CXX A;  2UUC T;  2LSI A;  1IZN B;  4QH5 A;  3CQC B;  4AIS A;  5JDH A;  1KNZ A;  3Q9D A;  5LBM A;  4HKA A;  4IE4 A;  4LF5 T;  1G73 A;  3AAI A;  4UXN B;  3C51 A;  3DJB A;  2BVL A;  2ODU A;  3ZLI A;  5HEJ A;  4YLH A;  1MND A;  5F3J A;  1UCU A;  1X9B A;  1BR0 A;  4ZOL E;  3WI3 A;  4AKG A;  2BG9 E;  2LRL A;  4QWN B;  2WDR A;  3AVR A;  5FYM A;  2JQH A;  3HA4 A;  4MLK A;  4X20 E;  2L8K A;  2ZM6 T;  1Z0P A;  1QSD A;  4DVD A;  2XQ4 A;  4L5G A;  5C2T A;  2CEA A;  2H89 A;  4YFS A;  5FVK A;  2VVS A;  4X65 T;  3QK6 A;  2CLY C;  2IC6 A;  3QNU A;  4LFC T;  2WZH A;  2EHO D;  3HL6 A;  5JVD E;  3FZK B;  3UQ7 A;  5J0Z A;  3U3I A;  3L3P A;  1AJ3 A;  3BQI A;  1WYC A;  4LF8 T;  1HX1 B;  4NUV A;  3ZMZ B;  4DO0 A;  1VCT A;  4YTN A;  4AQY T;  2V5C A;  1KFY A;  4OYK A;  1OWA A;  2W66 A;  2OV9 A;  2VKD A;  4NUU A;  4YT0 A;  3RRW A;  5LHH B;  2M67 A;  4PFO A;  4TV9 E;  5LGU B;  4EAH A;  2R6G F;  4H63 H;  4WNK A;  5LGT B;  1VCS A;  4JV5 T;  4KHP T;  1XZY A;  1D1C A;  5JDG A;  1UK5 A;  4XBF B;  5LB7 B;  4HGA A;  4HFD A;  4JI2 T;  1HCI A;  4O8S A;  3UU6 A;  1BR2 A;  3RYI E;  1HF8 A;  4EXT A;  2B1E A;  4B3S T;  3ZJ2 A;  3RIF A;  3N2G E;  4ZEY A;  2JMK A;  3N5L A;  3N9Q A;  3TLS A;  4MBQ A;  4WW0 A;  4XAX B;  1B7T A;  4ZI3 D;  4WBN E;  1E7P A;  4HWF A;  2BBH A;  4HWC A;  2LHR A;  3HKE E;  4A5X A;  2QYW A;  4EV6 A;  1OED B;  2X51 A;  2JQQ A;  2VKH A;  1MMG A;  3ZSS A;  4ZI7 E;  2ZM2 A;  2MPK A;  2ZLY A;  2D2S A;  4IST A;  5HWX A;  3LSV A;  3JC6 C;  4IHJ E;  3ONJ A;  4UF0 B;  4Z91 A;  1DU2 A;  2KLQ A;  3PU3 A;  1LKX A;  3AE9 A;  4H9P C;  3J9X 1;  5H6R B;  4NXN T;  1IBK T;  1MMN A;  4IDQ A;  4QXB B;  3C4Z A;  2H88 A;  4UEM A;  3ZMV B;  4DBQ A;  2VQF T;  1HNW T;  3KV6 A;  4PJM A;  2CRB A;  5AQM B;  2SPC A;  4HWD A;  4H9S E;  2WQY A;  2IC9 A;  3FXE B;  3PUR A;  3IA3 A;  1ZKE A;  5FVL A;  3N2O A;  1IAP A;  3IEE A;  4PAG A;  2UUB T;  3P4W A;  2K3W A;  4ASK A;  2IAK A;  1JNR A;  1QUU A;  4EEB A;  2C5K T;  1HR0 T;  1E1H B;  4X66 T;  4DR3 T;  4KMC A;  4LML A;  4X5T A;  2JPF A;  4FJO A;  3HKB E;  2V26 A;  4O2A E;  2XQ5 A;  1X79 A;  4ILA A;  5F8P A;  3ZN1 B;  3RC3 A;  1YQ4 A;  4DV3 T;  5JRC A;  4JBW F;  5FP3 A;  2XQ7 A;  3P7I A;  1H7C A;  2WDQ A;  3IHR A;  3G06 A;  2QVA A;  3FBZ A;  4ZI2 C;  4QXC B;  2WMO A;  1SUM B;  2KZ7 B;  3AE1 A;  3EUH A;  2HHH T;  3CML A;  1YQ3 A;  2X67 A;  5ABF A;  4DBR A;  2KXP B;  1U4Q A;  3CWZ B;  1NWM X;  2D5U A;  4QH1 A;  2UU9 T;  4CXY A;  2V7I A;  3CK6 A;  4IE0 A;  1LRZ A;  2BG9 B;  2Q9Q B;  3EDV A;  5LYJ E;  2AXD S;  3WAK A;  2V5D A;  4CI2 B;  4TV8 E;  5JDF A;  3PTR B;  5JR9 A;  3QUJ A;  3RKO A;  5LG4 A;  2PBI A;  2LSY A;  3RIU C;  2CXL A;  2XUE A;  3P4P A;  3JCF A;  1IJ6 A;  3N2K E;  2BKN A;  4IT4 A;  3Q5X A;  4YSX A;  2XTL A;  4HFV A;  1LVF A;  2V7M A;  2Y48 B;  3CX8 B;  4LMK A;  3ANW A;  1XMO T;  2QA7 A;  4EYY R;  4I50 E;  2D0T A;  4JI5 T;  4ZI2 D;  1S35 A;  2CXD A;  2K9A A;  1KK7 A;  3LBX B;  2L3L A;  4DMV A;  2V8S V;  2DI4 A;  2FJE A;  3PE0 A;  3PDY A;  1T98 A;  3GN5 A;  3KBT A;  2UUA T;  5L3F B;  2VAS A;  2CHO A;  3NZP A;  4I4T E;  2BDE A;  1HNX T;  4KI0 F;  4HWH A;  3AXJ B;  4ZS3 A;  1Z8U A;  2E9X B;  2NWB A;  4HFH A;  1Y01 A;  1UUS A;  2V6X A;  3N9P A;  3P8C D;  4OYJ A;  2LE8 A;  4JEU B;  4TX5 A;  1FIO A;  3SFD A;  4ZHQ E;  3O4X E;  4TZ4 C;  1O3X A;  4TWD A;  3K1S A;  1LVK A;  1S94 A;  3KVB A;  3UFG A;  3ZCJ A;  4N78 D;  4YSY A;  4PJL A;  5J2T E;  1KNP A;  1SHZ C;  5HEH A;  3UU4 A;  3O1J A;  5LNK A;  1JNZ A;  2WWU A;  3N9N A;  3QC9 A;  2W63 A;  2ZMA A;  3O9X A;  4AI6 A;  4JLE A;  2KT9 A;  4ANJ A;  4DMW A;  5BR8 T;  5J1G A;  2XQ6 A;  4UV8 B;  2CMR A;  4H9Q C;  3SOL A;  4ZZB A;  5L47 A;  4DR7 T;  3AE4 A;  1T7S A;  3VRA A;  3AA7 B;  5HAX A;  2VVN A;  5LCY A;  4HWI B;  4AIU A;  4JEH B;  3C4X A;  3TLT A;  1XWM A;  2JJ9 A;  4P0B A;  3MXZ A;  4GK5 E;  2QGS A;  1N36 T;  3EAM A;  3ZN0 B;  2UXC T;  4GIW A;  1UX5 A;  2XQ8 A;  3M3Z B;  5JRE A;  2OA5 A;  4JI7 T;  3PJA J;  2EHO A;  2KND A;  4HN9 A;  1EZ3 A;  5ABG A;  1OED C;  3S4U A;  2JRK A;  2PJQ A;  4ZI3 C;  2V6Y B;  4UVA B;  3UFE A;  4DR5 T;  4IDP A;  5LMN T;  2W0G A;  4CXW A;  1MIW A;  2NP9 A;  3KFW X;  2WBL A;  1WRD A;  3ONX A;  3VHL A;  1YKE B;  4HFB A;  4PK5 A;  2UXX B;  4U7I A;  4V1A v;  2LOP A;  4UVC B;  2DLR A;  2P9B A;  3NZQ A;  4TUY E;  2DWG A;  4UEL A;  1I94 T;  4DV1 T;  2XQA A;  2DCF A;  2K5B B;  3MK7 C;  3ZT7 A;  4ILC A;  3MAC A;  5IUX A;  1IBM T;  3T1H T;  3VR8 A;  3P50 A;  3PUA A;  4CN6 A;  2BKP A;  2RA1 A;  4ILB A;  2VL8 A;  3GMI A;  4G63 A;  3SS1 A;  2C5J A;  3ZJ1 A;  4M1P A;  1SA0 E;  3P4R A;  5AQO B;  4DR1 T;  4O4L E;  4U72 A;  4UVB B;  3LG7 A;  1W09 A;  3ABV A;  4QH4 A;  3TLU A;  4DR6 T;  3ZMU B;  3ETU A;  3BQK A;  1HG5 A;  2XAH B;  3MKD A;  4YSZ A;  5FMN A;  2G0U A;  3FZM B;  5AQU B;  1MIV A;  3AE6 A;  3PUG A;  1HS7 A;  5CFB A;  2DWK A;  1V9D A;  2X9H A;  2XQY A;  3TLW A;  3FZF B;  2K24 A;  2LKG A;  5DQW A;  3AE7 A;  5ADX L;  5L3C B;  4F8H A;  4KX6 A;  4EOZ B;  2RPA A;  4GYS A;  4WYV A;  3N9O A;  4C90 A;  3V5U A;  2XSA A;  3CX7 B;  2D0U A;  5AQT B;  5H6Q B;  1G8X A;  3CPZ A;  1HFA A;  3A5X A;  3F57 A;  3ONL C;  2CM0 A;  3RYH E;  2WCA A;  1US7 B;  3L39 A;  4JI0 T;  2YDR A;  4H63 V;  5LA6 E;  4L0R A;  2WZI A;  3RH3 A;  2NR4 A;  3PUS A;  3KBU A;  4O4J E;  4U33 A;  5AQG B;  3UT5 E;  3NVO A;  3E0Z A;  1FMV A;  4MHC A;  1OXZ A;  3ZMS B;  2KWH A;  3OYX A;  4U3C A;  4PK4 A;  5ETW A;  5L3D B;  2H7O A;  2IML A;  2FJB A;  3WAJ A;  2N9D A;  2Q9Q D;  2PFV A;  3OVU A;  1YXR A;  3RLF F;  5L2L A;  4GK0 E;  2LKH A;  1XMQ T;  4JI1 T;  2HPL A;  1J1J A;  2ACZ A;  3AE3 A;  3DTO A;  3FB2 A;  3ZYM A;  4AQG A;  5JDQ A;  1XDO A;  1D0Z A;  3JAF A;  2W4X A;  4P0A A;  4K0K T;  3I9Y A;  5AQK B;  1D1A A;  2HH7 A;  1KF6 A;  2V7K A;  4KP3 C;  4U7Y A;  5JTG A;  2E2A A;  1D1B A;  2A3D A;  3UUN A;  2E5L T;  2CE7 A;  4DND A;  2UXB T;  2CWO A;  3RYC E;  4E7S A;  3H37 A;  4UR9 A;  3R6N A;  3NBX X;  1YD8 G;  2L9Q A;  4EED A;  2E9X D;  3AEG A;  2XZE A;  4FI5 A;  4GKK T;  3NRX A;  3N9L A;  5JH7 E;  4XZC A;  4NXM T;  1NEN A;  3A7M A;  3FHN A;  4TWH A;  5DAB A;  2VKO A;  5FXV A;  3EVY A;  2NW9 A;  5CA1 E;  2YK0 A;  5CA0 E;  5LHI B;  3PUZ F;  2X0Y A;  2FBW A;  4TWF A;  4X1Y E;  1OED E;  2OLT A;  3K3N A;  4IGU A;  4HFC A;  4X1I E;  1WYB A;  3CIR A;  5EZY E;  4EYU A;  2H7V C;  1W9R A;  1ZHC A;  2VB6 A;  3KV5 A;  2J47 A;  2JQ9 A;  2WDV A;  2CPT A;  3I0O A;  2CCQ A;  5CJ5 A;  4QHO A;  4DV7 T;  2YDS A;  4AQF C;  3JC6 D;  2H3R A;  2PG8 A;  4AKH A;  4E7Z A;  3GWH A;  2WAU A;  4AKI A;  4Q25 A;  1FJG T;  3B5M A;  3FZH B;  5HYA A;  4I0U A;  3UU3 A;  5AQV B;  2VL0 A;  4IDO A;  4L9I A;  2UXD T;  4A56 A;  2LJL A;  3PV0 F;  2XJ7 A;  5IHY A;  4ISS A;  2E9X C;  3Q5W A;  3A8Y C;  2VKJ A;  3AE2 A;  3NKZ A;  4P09 A;  3D0T A;  2HN1 A;  2WY2 A;  4U31 A;  2E5V A;  5M4Y A;  4JYA T;  3OJA A;  3MZK B;  2VUR A;  5LOV E;  4LF7 T;  5F5W A;  3OTO T;  4HTE A;  3PUY F;  2ODV A;  2WB5 A;  5AQQ B;  5AQS B;  4IRE A;  5HXH A;  5L3B B;  2W00 A;  3PUW F;  3RHW A;  2XSB A;  5EK2 A;  4X1K E;  3J7Y q;  2I0M A;  3HKD E;  5KXJ A;  5EK4 A;  2CLY B;  1CUN A;  3N9M A;  4LFA T;  2FUP A;  2CXF A;  5FKY A;  5HCJ A;  3H3A A;  2WS3 A;  1VRB A;  2WU5 A;  3AVS A;  4YHJ A;  5JDL A;  1NAF A;  2CWY A;  4C91 A;  1I6Z A;  2LEH A;  4DV6 T;  3F31 A;  5FNV E;  3KDS E;  3VKH A;  2XAJ B;  1HTJ F;  3AE5 A;  2Q9Q A;  3IF8 B;  2GK9 A;  3CQX C;  3IBP A;  4TNW A;  4DR2 T;  5CB4 E;  4X64 T;  2CBI A;  3L09 A;  3C98 B;  2MTQ A;  3OKQ A;  4EZH A;  2MAW A;  5JDN A;  5ABF B;  2A72 A;  2ZM8 A;  1ZOY A;  2AE9 A;  2YEV C;  3AA0 B;  2KMF A;  2LOS A;  3AEB A;  3Q2M A;  3T1Y T;  2J4G A;  1WR0 A;  2X68 A;  3ZC0 A;  1WCR A;  5IYZ E;  2IW5 B;  5LBQ B;  3ZCI A;  4YY3 T;  1N34 T;  4EGW A;  1ZV4 X;  3BK9 A;  4OK0 A;  4DV5 T;  3UU5 A;  3QOF A;  2HN2 A;  4NIQ A;  4LF6 T;  1YKH B;  2LLY A;  4PNI A;  3AEF A;  4JI8 T;  3QB5 K;  4UV9 B;  2YOE A;  2LM2 A;  4UIG A;  2N2N A;  3RIA A;  3NRY A;  3V5S A;  3MJX A;  4BJN A;  3VRB A;  4IL4 A;  5L4E A;  3C64 A;  3TLV A; 
#chains in the Genus database with same CATH homology
 4GYR A;  2A2F X;  2XAS B;  4KUM B;  5HXS A;  2K48 A;  4KBM B;  2EHO B;  2C0S A;  4EZ4 A;  5BMV E;  2NOX A;  4BAY B;  4EIW A;  4ERR A;  3F2E A;  2Y6X A;  3OYZ A;  3W15 B;  2X9X A;  3T8O A;  4IIJ E;  3VKG A;  2C5I T;  1MMD A;  3DP7 A;  1MNE A;  3OBV E;  4K0U A;  4I43 B;  3ZYL A;  5FXX A;  3BQL A;  2VK9 A;  2N1G A;  5FY7 A;  3AA6 B;  2YU1 A;  2EHO C;  3K3O A;  4CI1 B;  5JR9 C;  2WSS V;  3UUL A;  2CA5 A;  2LM9 A;  3GN5 B;  2LT3 A;  3ZMT B;  3RRC A;  2ACX A;  2XAF B;  5E0O A;  4P0A A;  3CQG B;  3ZPO A;  3HR0 A;  1BR1 A;  3GA8 A;  3RX6 A;  1Y64 B;  4MAL A;  3KV4 A;  4HEA A;  3FBL A;  4WBO A;  2VWA A;  3KVA A;  4BJM A;  5LHG B;  5FY1 A;  3K8P C;  4O4I E;  4IE5 A;  4AKL A;  3RYF E;  5JR9 B;  3LJC A;  4J2C A;  4IE6 A;  5HXC A;  3LFM A;  5L3G B;  3LBX A;  3I0Q A;  5EK3 A;  5HXR A;  2JMH A;  3EDU A;  3CVR A;  4JUY A;  3K3Q C;  1IJ5 A;  3ANW B;  4OFZ A;  1D0Y A;  2I59 A;  4PFP A;  5FXZ A;  2Z6E A;  5AFU L;  3LK3 B;  5KX5 E;  1HG2 A;  5J2U E;  2LSJ A;  3AAA B;  1MIY A;  2BVM A;  3PU8 A;  5A1L A;  3ETV A;  3RC8 A;  2Y8D A;  3HI2 A;  2WMN A;  3PUQ A;  2X9Y A;  4I55 E;  2YIN A;  3VU7 H;  1HX8 A;  3KV9 A;  2X66 A;  4IDZ A;  4U74 A;  2ZM0 A;  3MA9 A;  4QX8 B;  4O2B E;  4AXP A;  4H9N C;  2V7L A;  3U78 A;  3ZC1 A;  2NTY A;  3UUM A;  5JRC B;  3SWH A;  2J1D G;  3UUX B;  1ZEE A;  3R84 B;  1WR6 A;  4TN7 B;  4H9R C;  3ZYK A;  3FXD B;  5JQG E;  5JDM A;  3UTK A;  4YJ3 E;  4QKN A;  4H9O C;  2DNX A;  4PK6 A;  3O1H A;  4PW8 A;  2V1D B;  4EB6 E;  4F6R C;  2MBG A;  2RP4 A;  4G2A A;  1U5P A;  2MYS A;  1YW0 A;  5KDM C;  1FEW A;  3CX6 B;  5DQV A;  3LK2 B;  4CZZ B;  3ZEF B;  3M65 A;  2NTX A;  2WM9 A;  4UF0 A;  1D0X A;  1BR4 A;  4MFR A;  4B6X A;  2E9X A;  5FXW A;  4HE8 A;  3C4W A;  5FY0 A;  4PJJ A;  2MOZ A;  3ESL A;  2UXN B;  1FMW A;  4OHF A;  2X0L B;  2LSG A;  4YJ2 E;  5LGN B;  3TKL B;  3I1A A;  3AB3 B;  4O4H E;  4IE7 A;  3B57 A;  4QX7 B;  5HXE A;  5L3E B;  1UX4 A;  3AA1 B;  2NW8 A;  4AKR B;  4AQF A;  4ILU A;  1WLX A;  4QXH B;  5TAO A;  5LJN A;  3C50 A;  2DHR A;  4GOU A;  3I9W A;  3CKD A;  5GON E;  2KWI B;  2X9W A;  2NW7 A;  2XAG B;  3SRZ A;  5LXT E;  1VOM A;  2XHE B;  5LP6 E;  4Z8X A;  2Q9Q C;  3E22 E;  2W62 A;  2LHN A;  3RPU A;  2XAQ B;  3E08 A;  3B13 A;  2W61 A;  4ADZ A;  2BZB A;  5HWY A;  2KIN B;  3O1I A;  2HPJ A;  3LK4 2;  1MMA A;  2LSK A;  5C8Y E;  2E8I A;  3KIN B;  2YU2 A;  3AAE B;  5LJM A;  2V7J A;  5DJQ C;  4BA9 A;  3HKC E;  4ZS2 A;  4CQI A;  4PJN A;  4CI3 B;  4CXX A;  2ES0 A;  2LSI A;  1IZN B;  3CQC B;  5JDH A;  1KNZ A;  3Q9D A;  5LBM A;  4HKA A;  4IE4 A;  1G73 A;  3AAI A;  4UXN B;  3C51 A;  3DJB A;  2BVL A;  2ODU A;  3ZLI A;  4YLH A;  1MND A;  5F3J A;  1UCU A;  1BR0 A;  4ZOL E;  3WI3 A;  4AKG A;  4QWN B;  3AVR A;  5FYM A;  3HA4 A;  4MLK A;  4X20 E;  2L8K A;  1Z0P A;  1QSD A;  4DVD A;  4L5G A;  2CEA A;  4YFS A;  3QK6 A;  2CLY C;  2IC6 A;  3HL6 A;  2EHO D;  5JVD E;  3U3I A;  3L3P A;  1AJ3 A;  3BQI A;  1WYC A;  3ZMZ B;  4NUV A;  4DO0 A;  4OYK A;  1OWA A;  4NUU A;  2VKD A;  3RRW A;  5LHH B;  2M67 A;  4PFO A;  4TV9 E;  5LGU B;  4EAH A;  4WNK A;  4H63 H;  5LGT B;  1D1C A;  5JDG A;  4HGA A;  1HCI A;  4O8S A;  4EXT A;  1BR2 A;  3RYI E;  1HF8 A;  2B1E A;  3ZJ2 A;  3N2G E;  2JMK A;  3N5L A;  3N9Q A;  4MBQ A;  4WW0 A;  4XAX B;  1B7T A;  4ZI3 D;  4WBN E;  2LHR A;  3HKE E;  2X51 A;  2JQQ A;  2VKH A;  1MMG A;  4ZI7 E;  2ZM2 A;  2ZLY A;  4IST A;  2D2S A;  5HWX A;  3JC6 C;  4IHJ E;  4UF0 B;  2KLQ A;  3PU3 A;  1LKX A;  4H9P C;  3J9X 1;  5H6R B;  1MMN A;  4QXB B;  4DBQ A;  3C4Z A;  3ZMV B;  4UEM A;  3KV6 A;  4PJM A;  2SPC A;  4H9S E;  2IC9 A;  3FXE B;  3PUR A;  1ZKE A;  3N2O A;  1IAP A;  3IEE A;  4PAG A;  4ASK A;  2IAK A;  1QUU A;  2C5K T;  1E1H B;  4KMC A;  2JPF A;  4FJO A;  3HKB E;  2V26 A;  4O2A E;  3ZN1 B;  1X79 A;  5F8P A;  3RC3 A;  5JRC A;  5FP3 A;  3P7I A;  1H7C A;  3IHR A;  3FBZ A;  4ZI2 C;  4QXC B;  2WMO A;  2KZ7 B;  3EUH A;  3CML A;  2X67 A;  4DBR A;  2KXP B;  1U4Q A;  3CWZ B;  1NWM X;  2D5U A;  4CXY A;  2V7I A;  4IE0 A;  1LRZ A;  2Q9Q B;  3EDV A;  5LYJ E;  3WAK A;  4CI2 B;  4TV8 E;  5JDF A;  3PTR B;  5JR9 A;  3QUJ A;  3RKO A;  5LG4 A;  2PBI A;  2LSY A;  2CXL A;  2XUE A;  1IJ6 A;  3N2K E;  3Q5X A;  2XTL A;  4HFV A;  1LVF A;  2V7M A;  2Y48 B;  3CX8 B;  3ANW A;  2QA7 A;  4EYY R;  4I50 E;  2D0T A;  4ZI2 D;  1S35 A;  2CXD A;  2K9A A;  1KK7 A;  3LBX B;  2L3L A;  4DMV A;  2DI4 A;  3PE0 A;  3PDY A;  1T98 A;  3GN5 A;  3KBT A;  5L3F B;  2VAS A;  3NZP A;  4I4T E;  2BDE A;  4ZS3 A;  2E9X B;  2NWB A;  4OYJ A;  3P8C D;  4TX5 A;  3N9P A;  4ZHQ E;  2LE8 A;  4JEU B;  1FIO A;  3O4X E;  4TZ4 C;  1O3X A;  3ZCJ A;  1LVK A;  1S94 A;  3KVB A;  4N78 D;  4PJL A;  5J2T E;  1SHZ C;  3O1J A;  5LNK A;  2WWU A;  3N9N A;  3QC9 A;  2W63 A;  2ZMA A;  3O9X A;  4AI6 A;  4JLE A;  2KT9 A;  4ANJ A;  4DMW A;  4XBF B;  5J1G A;  4UV8 B;  2CMR A;  4H9Q C;  3SOL A;  3AA7 B;  5HAX A;  5LCY A;  4JEH B;  3C4X A;  2JJ9 A;  4P0B A;  3MXZ A;  4GK5 E;  2QGS A;  3ZN0 B;  4GIW A;  1UX5 A;  5JRE A;  2OA5 A;  2EHO A;  2KND A;  4HN9 A;  1EZ3 A;  3S4U A;  5KMG P;  2JRK A;  2PJQ A;  4ZI3 C;  3UFE A;  4UVA B;  2W0G A;  4CXW A;  1MIW A;  2NP9 A;  3KFW X;  2WBL A;  1WRD A;  3ONX A;  3VHL A;  1YKE B;  4V1A v;  4PK5 A;  2UXX B;  2LOP A;  4UVC B;  2DLR A;  2P9B A;  3NZQ A;  4TUY E;  2DWG A;  4UEL A;  2DCF A;  2K5B B;  3MK7 C;  3MAC A;  3PUA A;  2RA1 A;  2VL8 A;  3GMI A;  4G63 A;  3SS1 A;  2C5J A;  3ZJ1 A;  4M1P A;  1SA0 E;  4O4L E;  4U72 A;  4UVB B;  3LG7 A;  3ZMU B;  3ETU A;  3BQK A;  1HG5 A;  2XAH B;  3MKD A;  5FMN A;  2G0U A;  1MIV A;  3PUG A;  1HS7 A;  2DWK A;  1V9D A;  2XQY A;  2X9H A;  2K24 A;  5DQW A;  5ADX L;  5L3C B;  4EOZ B;  4GYS A;  4C90 A;  3N9O A;  3V5U A;  5H6Q B;  3CX7 B;  2D0U A;  1G8X A;  3CPZ A;  1HFA A;  3A5X A;  3F57 A;  3RYH E;  2CM0 A;  1US7 B;  4H63 V;  5LA6 E;  4L0R A;  3UT5 E;  3RH3 A;  3PUS A;  4O4J E;  3KBU A;  3E0Z A;  1FMV A;  4MHC A;  1OXZ A;  3ZMS B;  2KWH A;  3OYX A;  4PK4 A;  5ETW A;  5L3D B;  2H7O A;  3WAJ A;  2N9D A;  2Q9Q D;  2PFV A;  5L2L A;  4GK0 E;  2HPL A;  3DTO A;  5JDQ A;  3FB2 A;  4AQG A;  3ZYM A;  1D0Z A;  3I9Y A;  1D1A A;  2HH7 A;  2V7K A;  4KP3 C;  1D1B A;  2A3D A;  3UUN A;  2CE7 A;  4DND A;  2CWO A;  3RYC E;  4E7S A;  3H37 A;  3R6N A;  3NBX X;  1YD8 G;  2L9Q A;  2E9X D;  4FI5 A;  3NRX A;  3N9L A;  5JH7 E;  4XZC A;  5FXV A;  3FHN A;  5DAB A;  2VKO A;  2NW9 A;  3EVY A;  5CA1 E;  5LHI B;  2YK0 A;  5CA0 E;  4X1Y E;  3K3N A;  4IGU A;  4X1I E;  1WYB A;  5EZY E;  4EYU A;  2H7V C;  1ZHC A;  2VB6 A;  3KV5 A;  3I0O A;  2CCQ A;  4QHO A;  4AQF C;  3JC6 D;  2H3R A;  2PG8 A;  4AKH A;  4E7Z A;  3GWH A;  2WAU A;  4AKI A;  5HYA A;  4L9I A;  4A56 A;  2LJL A;  5IHY A;  4ISS A;  2E9X C;  3Q5W A;  2VKJ A;  4P09 A;  3D0T A;  5M4Y A;  3OJA A;  3MZK B;  5LOV E;  4HTE A;  2ODV A;  5L3B B;  5HXH A;  2W00 A;  3J7Y q;  5EK2 A;  4X1K E;  3HKD E;  5EK4 A;  2CLY B;  1CUN A;  3N9M A;  2CXF A;  3H3A A;  3AVS A;  1VRB A;  4YHJ A;  5JDL A;  1NAF A;  2CWY A;  4C91 A;  2LEH A;  3F31 A;  5FNV E;  3KDS E;  3VKH A;  2XAJ B;  1HTJ F;  3IF8 B;  2Q9Q A;  2GK9 A;  3CQX C;  3IBP A;  5CB4 E;  3L09 A;  3OKQ A;  3C98 B;  2MTQ A;  4EZH A;  5JDN A;  2A72 A;  2ZM8 A;  2YEV C;  3AA0 B;  2KMF A;  2LOS A;  3Q2M A;  2X68 A;  3ZC0 A;  5IYZ E;  2IW5 B;  5LBQ B;  3ZCI A;  1ZV4 X;  3BK9 A;  4OK0 A;  1YKH B;  4PNI A;  4UV9 B;  4UIG A;  2N2N A;  4BJN A;  3NRY A;  3V5S A;  3MJX A;  3C64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...