4PWUA

Crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
QQQEATLAIRPVGQGIGMPDGFSVWHHLDANGIRFKSITPQKDGLLIKFDSTAQGAAAKEVLGRALPHGYIIALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Modulator protein MzrA
publication title Crystal structure of a modulator protein MzrA (KPN_03524) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.45 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Signaling protein
total genus 16
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwuA00
2LQJA 2LVWA 2PC6A 3KWMA 4GO7X 3N0VA 5IT0A 2NYIA 3W7BA 2QMWA 2KO1A 4X84A 3AAWB 2PA3A 3DDNA 1UJ4A 3S1TA 3OFHA 1U8SA 1LK5A 3TUIC 2RE1A 4LUBA 2DT9A 5IT4A 3K5PA 3U7JA 4M8LA 3TUZC 3AB4B 1M0SA 3ENQA 1O8BA 3TUJC 4IO1A 4NMLA 3CEDA 3IBWA 2P9CA 1Y7PA 2FGCA 2MDAA 2QRRA 5T41A 2RQKA 1RWUA 3MTJA 4GMKA 2RQMA 1SC6A 4PWUA 1LKZA 2JOQA 3P96A 2QSWA 3O1LA 3ENVA 3AB2B 3IXQA 1PSDA 2I9SA 3HHEA 5IS2A 3ENWA 3L7OA 1YGYA 2CDQA 2F8MA 3DHWC 2F1FA 3MAHA 2ZHOA 3UW1A 3NRBA 1LK7A 2P9GA 2QMXA 3LOUA 5JJBA 1KS2A 3DC2A 3DHXA 1UJ5A 3OFEA 1UJ6A 2J0XA 1YBAA 2P9EA 1ZPVA 2DTJA 1XTZA 3OFGA 2JHEA 5FIIA 2J0WA 3LUYA 4GO5X 3OFFA 2H9ZA 3OBIA 3MWBA
chains in the Genus database with same CATH superfamily
4F02A 2BJ8A 5E7OB 1RT3A 3SSRA 3SSSA 4G6VB 3ENAA 3CCMS 2KRBA 1VLYA 1DFDA 3ELHA 5DGAA 1U48A 3MAAA 1X5OA 1X5TA 3KYLA 2FLLA 2P6SA 1RTIB 2DGUA 4EFAC 4BBYA 5M2UA 3K59A 1G2EA 1N32F 1VHIA 2UXCF 5J1PA 3CCSS 4ZVSB 2ZWOA 3RG6A 2PA8D 3J81j 2HEKA 5G0RA 3DMJB 1I94J 5L9NA 3I55S 4QYRA 1GXUA 4WIIA 2W4CA 1S9GA 3W60A 3Q86A 2CJKA 4ZMMA 1M5VC 4JUZA 1HL6A 3GMGA 2YKMA 4KGVB 3VTIA 2YKNB 2WHOA 4DV7J 1TK5A 5AXMA 5M2PA 1OY6A 3HM9A 2ZOGA 1SI9A 5K8NA 3FBCA 1IR0A 4F7VA 1SL0A 4P10A 2AF6A 2V2VA 5HLFA 2KB2A 1R6YA 5HANA 3VAFA 4DR4F 3FEYB 1APSA 3UO0A 2MEWA 4HDGA 3PR5B 4ZJOA 2G1DA 4K4XA 1WOPA 2Y9HA 4OV1A 2DJWA 2R2TA 3V4IA 2M2BA 4QIVA 2LEAA 5C25A 1S57A 3GLJA 3M6VA 2Y8YA 2KT5A 5EGYA 2LLZA 1ZTWA 1R3NA 2N4DA 3SDEA 1R0AA 2E5IA 2DGTA 4Q43A 1HW8A 1UVKA 2BJDA 4YDXA 4NWBA 3MM9A 1U0HB 2HQFA 1UPPA 4AL5A 1REVA 1L3VA 2WK4A 4JI2J 2ZH5A 1MWQA 3RBZA 2EFPA 2MSTA 1HNZJ 4B08A 5CD4A 4NI2A 3HPOA 3SSQA 3NGTA 3QSIA 3H5XA 4YS2A 1Y5IB 3ILOA 2I38A 2PMWA 2QL9B 2ZNYA 4KR0B 4CNYA 2QL7B 2ZH2A 1MN9A 4N7TA 5KFYA 1WEXA 2BZ2A 3KLHB 4ETXA 5L46A 5L1JA 4IKAA 2VD3A 2AEFA 2FZGB 1KWMA 4JI8F 1N5SA 2AZ1A 3TUPA 4QIGA 3KUHA 1GTHA 4PZVA 3BDPA 1S4EA 2HZCA 3DN9A 4DR5J 4Y3CA 4NXNF 5DM6Q 3L4BC 3H90A 2B8QA 4WE1A 4O3QA 2MYFA 2NYHA 3FJ2A 2HW3A 4B9UA 5BJRA 2VBYA 1NBEB 2XMMA 3RRHA 4WCEQ 2W8KA 1UZDA 2OAUA 2MKIA 3EGNA 1PCAA 4KT0C 3PYFA 4KGMA 2C2NA 4ALZA 3IP0A 1HBMB 5HBMA 2J0SD 3V81B 5EDWA 1S1WB 3EGWB 1S9EB 2KKHA 1Y11A 3OJSA 1WJ9A 4M5NA 5CCMA 1LXNA 4DR1F 3DKDA 1SUQA 3HD1A 2ZD1B 4DXLA 1HD0A 4OQJA 3DLHA 2ZHBA 3LH2S 5IT4A 1UPMB 1Y00A 4ZLLA 3AFGA 3VAMA 3HDSA 2MPUA 4O3NA 3A3PB 3OR2A 1S49A 4DV4J 2QYGA 2C3UA 1H2VZ 2XHWA 1ITPA 3THVA 4YHHF 3CJTA 3FCHA 4MYTA 2ZM6J 3M32A 1PIEA 2DNMA 5ETSA 1RSCA 3O2IA 4EI2A 5KFHA 5B0BA 1U1KA 3QRRA 4KB7A 3PZPA 2MKYA 2VIHA 1N5VA 1M90T 3VWSA 4ECXA 2J9CA 5DLFA 1FNMA 1R89A 4O4GB 4MH8A 1GXLA 2GGPA 4DR3F 4OX9F 4OZLA 3L09A 4DUTA 2WVDA 3OBIA 3D67A 4KGXB 2X1GA 1DTTB 1T02A 2HQDA 3AD7C 2EK6A 4IRCA 2XI2A 3IR6B 4YR3A 3G82A 3DOKB 3CCZA 2HNDA 4MJKA 1X4GA 3MUMP 2R8IA 1JB0C 3K5LA 4OMFG 5ETTA 2YPYA 2ZZNA 4YB5A 4ES1A 2CYYA 2VFVA 4KFBA 3HSDA 2AEMA 1C1CA 2XB2D 3CJKB 3SI8A 2BABA 5FLXY 5KFUA 2KG0A 2C2OB 3MD1A 3LPEA 1X7VA 4FF1A 2O67A 2P5VA 3CB4A 4V1Ak 4GVBA 4RWWA 2O01C 2AX1A 5A2QY 3R5AA 3CMES 2UXBF 2MQOA 1FRMA 5KT6A 5K14A 4FKXA 4DF4A 3E01A 2HSEB 3TW0A 3HI9A 3G9CA 1TUGB 4G1IA 3TA2A 2R7RA 1K8AT 1QSYA 2B4VA 4IFVA 2V94A 1IBMJ 2R7VA 3R5DA 5A6WA 4MT1A 2V4QA 3OVAA 3D7SB 3G6XA 1FJGF 1U1QA 1FJCA 4QW9A 2UUBJ 4ZLJA 1RA6A 4NMLA 1HBMA 3V81A 1S6PB 4TU9A 4GKKJ 1EQ0A 2IC3A 1S9EA 2VV5A 3KK3B 3I5CA 4PKDB 1RU1A 4FPIA 3T6JA 1UEVA 1NHUA 3D1QA 5IC4B 2MKCA 1VDHA 4X62F 4ITSA 4V19J 1Q81T 1T9YA 2Z57B 1RHMB 2LA6A 3JQKA 1SKUB 4GC6A 4NE9C 5K5MA 5D4LA 2W4PA 4FBUA 1GAOA 4K4SA 5THWA 5H9EK 1A0OB 2XY5A 4LSNA 2CG4A 2JVOA 1AT1B 1XR5A 3VVTA 4TQRA 3US5A 5BXIA 1IJFB 3PV8A 3OTEA 3OTOF 4DSIA 4LF8F 2BKNA 2QE5A 3BR8A 2BQRA 2V34A 2DIUA 2CNNB 4B9NA 3Q8QB 4CYUB 1JJ4A 4PQAA 2BRLA 3OTDA 4P74A 3QSYB 3HVWA 1C0UA 4WZMA 2EKYA 2JEFA 1JLBB 3QIPB 3CJ0A 3OPKA 2RQKA 5F0UA 3PIPQ 1VOMA 4G1PA 2JSXA 4N56A 2CIMA 2WB1D 1YSJA 2NSCA 2I1RA 1VRTB 2DNGA 2JZ5A 4PYAA 2OUGA 5IV3A 3H5YA 4LR7A 4G1QA 3PYDA 3MAHA 1LW0A 4YB1P 4MIWA 3JXOA 2AJFE 1WWHA 2F40A 5DETA 2ATCB 1U1OA 1WKKA 1ACMB 2YPZA 1N8RT 1KP6A 1ZYQA 2DNLA 2BQUA 1RCXB 4RUAA 3ONQA 3RR7A 1UVLA 1MMNA 4LFCF 3T5HA 4J90A 4NX9A 3SEOA 2KO1A 2DNZA 4DF8A 1VK3A 2MXYA 1Y3JA 2YWFA 1QAYA 5J2NA 1HBOB 2CPYA 2G2ZA 4P73A 2XO6A 3D1OA 5U47A 2NS1B 3NXZA 3RAXA 2C2RA 1TUVA 1GK8A 3PO5A 1SJ1A 1OWXA 3V4MA 5E3QA 4Q2MA 3MM5A 3HHNB 1DBDA 4CLWA 4ID5A 2QEXS 4PWUA 1S0VA 3KK1B 2V9KA 5DDQC 3GP9A 4C8YA 2V63A 2CDQA 1Q4RA 2F4VF 1JNRB 5IT9Y 1P1LA 3GCXP 2VFRA 2QT7A 3MMBB 4O44B 4ZJQA 2VBWA 2D69A 1MU2A 2VA3A 4K4ZA 3M2UA 2ZBPA 1FNXH 2C3PA 3PXGa 1ZH5A 5DQIA 1P8GA 1UP1A 4A46A 3V6DB 2Z56B 3KK3A 3R2DJ 4FYYB 3TX8A 4USWA 3CCTA 2HS0A 2XCAA 1CJUB 2JLGA 1ZTTA 2B4PA 1T8EA 1WF1A 2XSJB 1O5JA 1UVMA 4A8QA 3JQMA 2D3OR 3K5PA 1LEOA 3QGPA 1IUJA 3P4UB 3D54A 3UN2A 1ELOA 2Z4PA 2LECA 2GJIA 1XWLA 1N88A 3JQJA 1T05A 4FVCA 3TJ9A 2HNZA 2J8SA 1A7GE 4LF9F 3TQEA 4LF4J 3ZTRA 3M6UA 2XY7A 4F4ZA 4B02A 3KFWX 2XZDB 4C97A 2W9BB 5BYSA 1IWGA 2G2YA 3S7RA 3PFOA 2MJNA 1IQTA 4HDHA 2L48A 2FVPA 2FPHX 3F0NA 2POKA 3KMSA 4BWMA 2CQ3A 3H0PA 2YVSA 2UXCJ 1IKWA 3BPSP 3QIPA 2LFVA 1T7PA 2C2ZB 5KFRA 3NS7B 1AW0A 1N6QB 3MR7A 3NKYA 4JI4F 2FHKA 5CCLA 1SXLA 4CH1A 4RNHA 3MM6B 2HHTA 4A48A 3MM7A 5F8LA 2LXUA 1ULRA 4X4QA 3HJVA 3EDRB 1YDLA 2AJQA 4EK2A 4E0DA 4HI2A 4CO3A 3IR7B 1T95A 5B0AA 1KVJA 3M30B 1T03B 1CBKA 2RILA 4F2SA 4JYAF 2CNKB 5T14A 1UVNA 3EUNA 4OI3A 3G71S 5GAGU 3TR5A 4I68A 2I5JB 1PSDA 1S59A 2XYGB 2FVCA 1WD6A 3LP1A 2IRXA 4D3HA 2Z0GA 1TMMA 1GFWB 3SFGA 3TQ1A 4ZP7A 5LSOA 2BJ7A 2D7SA 2CJYB 3DDIA 3KHGA 2MLXA 4FS1A 2UVRA 2OSQA 5EHHA 4KTQA 2FHOB 2DH8A 2CZ4A 3W8PA 5LMNJ 4JI0F 1RAOA 1Q5VA 2HURA 1OQ3A 3M8PA 3KLIA 3HHLA 2VQEF 2G13A 1VQKS 1YRTA 1U02A 4L75A 1T11A 4ZP6A 5A8WB 5AXLA 3LAMA 1NZAA 3JSBA 2ZC4A 1N34F 4H4MB 3IS9B 2CJXB 3D4JA 3IWNC 1K47A 3EDQB 1BWVA 3TWZA 4KHPF 3W5ZA 4G3IA 2C28A 3JSYA 3W64A 2YKAA 1CJUA 2GVZB 1H7WA 2GHVC 3HZGA 1QUVA 4B3SF 4JI8J 2XCPA 2M4MA 3DYAA 4ECVA 4AT1B 4DSEA 4FXDA 4MTPA 1ZS6A 3OSPA 3DC2A 3BGUA 3BB5A 4LR8A 1NK6A 4NXNJ 1TKXA 4J9NA 1JJ2R 3KLVA 4URGA 2AJ1A 4CLPA 2RS2A 4ED5A 4BWJA 2IBOA 5CH7B 1B0TA 3Q89A 1RKJA 5CA5A 3ITHA 4F3QA 1SB6A 4YY3J 4L6V3 2R4FA 5EX0A 2HBQB 5EUHA 2XNQA 4B9MA 5MLCV 3GR0A 4A8FA 2RF2B 2DPIA 3QPIA 3PRVA 3FC9A 4KE5A 3GILA 2DXEA 4NLPA 2YKPA 3N79A 3BREA 3CTRA 1JLAA 1A6LA 2A1BA 4Z37A 1RWUA 1RHKB 4ECZA 1Q5YA 2DEJA 3ZNJ1 3HX9A 1RT4B 4LF6J 1U26A 1Y3KA 4AQYF 4K50A 1AB8A 2KHDA 1XR7A 3GR1A 1TK8A 5JXSA 5LOQA 2V5HG 1X4BA 1XTZA 2AU0A 3BN7A 3HVRA 3O6QA 3OUYB 1HYSA 4QR0A 3ISNC 4FN5A 1WKLA 3R9LA 1MROB 3NNAA 2DHSA 1S0MA 5KG4A 5B0CA 4RJVA 4ZCLA 1FVSA 2MKHA 4OHXA 1M5PC 2J6UA 1VGYA 1EP4A 1S1VA 3JAMY 2W2QP 4JI3F 3CUNA 4OHVA 1YZ7A 2EFOA 2VFSA 1E6YA 4O3OA 4HT5A 4DR3J 2CWKA 2KVQE 1VQLS 3JB9k 3BKFA 1GX6A 2IMOA 2JNJA 2K3IA 2B9YA 1WKJA 3ILLA 4D3GA 2OEMA 4UTGA 4DPWA 4FF4A 2YNGB 1SV5A 1N0UA 3HHLD 1UJ5A 4DJBA 3TX0A 3GYNA 1U8WA 4DPTA 2XMAA 5HN0A 3GV7B 3BJYA 2BE9B 2M0GB 4RO0A 4FDFA 4NLXA 4NCGA 1TL1A 3T1YF 1CS4A 4M5KA 1FKAF 3RR8A 2QMWA 3TZYA 4OX7A 4DEZA 2IM2A 2B3TB 1MN7A 4NEZA 4L74A 2EFGA 3RZAA 3Q8SB 1NSQA 1WC0A 3EX7B 1U1PA 2KFYA 2VQFF 2DHGA 1FJEB 2NR0A 1XIQA 1JQGA 2V67A 4PYDA 2H51B 2UXBJ 4LFAF 2VKRA 4DUZJ 1KD1T 3R97A 2K7JA 2QLBB 3ET6B 2N7YA 1HNIB 3QT8A 4CCHA 1U2CA 3TEHB 4NZ0A 1RXOB 2XMKA 2FHMA 1LXJA 4KO0B 3T41A 1BQNB 4ECTA 2E5LF 2Y1LB 3IWLA 1Q86T 3N01A 3CD7A 1KQKA 1NRKA 3EZUA 2CPXA 1FKOB 3GIMA 4K2JA 4KJIA 1Y4ZB 3RTVA 1UVJA 1NHKL 5GAEI 1RT5B 2MZSA 1ZM3A 4LF2A 2VG6B 1F60B 3PX0A 3OJUA 5DRKA 2GQQA 4C8MA 1HMVB 3HT0A 1DQ9A 5D0GA 4UQGA 4OHWA 1LFPA 1MLAA 1N54B 3NWGA 2IJNA 2CPHA 1S4FA 2DH9A 3AAWB 1EB0A 3ILIA 3H8YA 1VIXA 2HHVA 3IG1A 1NK0A 1RI7A 2OPSB 3L7PA 3EMTA 1FRLA 2E66A 1K1SA 1P9YA 2ZWPA 1IJEB 1RTJA 1VYAA 1RTZA 1YJVA 4PXCA 3BH6B 4MK9A 4ZLPA 3ZZPA 4P9SA 5FLXU 4OLOA 3DRSB 4ZVTB 5IZHA 3OTOJ 1MMDA 1RT6B 3OXFA 2HQIA 4Z7YA 4DQPA 4LSLB 1TK0A 5L9XA 3MEDA 4U8YA 5A2QU 3MXHP 4RNNA 1U1LA 4OYOA 4DV2F 1RKIA 2Y0BB 2PFDA 1JXLA 4PQUB 3H42A 4CLYA 5C42A 2RMLA 2WTFA 4PUOA 5ETKA 3ZZOA 3KLEB 3WX4A 5HL7Q 3TO8A 3QLHB 2NYIA 2IVYA 4O4RA 1LWEA 3UI3A 4CTAB 5D0EA 2Y8WA 4I7FB 4ZCMA 4J5OA 5KFFA 3QMQA 3C15B 1GTEA 1OPIA 5ETRA 3OLAA 3OFHA 2RSQA 2JEJA 3X1LB 3A4TA 2MGZA 1LWXA 2XI3A 5E0OA 1IQZA 1SKRA 3CO0P 4RW8B 4IFYB 4FXWA 3Q8VA 1LNQA 4F4WA 3SQGA 1JLFB 2GIFA 2Y3YA 4LF7J 5F8JA 2WRMA 4TXSA 4ATNA 4F04B 1LWCB 1Z4UA 5AJ3J 2B4OA 2QMXA 4DV6J 1VQPS 4Q44A 1FVQA 2BOPA 4K7QA 1WDTA 2KZZA 1SH0A 3HT3A 1EAYC 4DOZA 1UW4A 1KQSR 1FD2A 2EI5A 1NEEA 2R7SA 4K4UA 3J7Z5 5CYMB 2VONA 1YJUA 3NGUA 2A0FB 3GFZA 2OMLA 1RZMA 2CADA 2CJ9A 1NK5A 1F6TA 1F3FA 4LF5F 4CLKA 1RAGB 3PHTA 1FKOA 2IPOB 2F4VJ 3FBEA 4YR2A 4DS4A 3C6UA 2EEYA 2QA2A 3PHEA 4NASA 1RT7A 2K2PA 3QO9A 1S1XA 2PEHA 1O8BA 1FXRA 4C2MA 3W2VA 2FYXA 1V5IB 4CM0A 2DCUB 1TAQA 3NBPB 1T0TV 2WSEC 1ZBTA 2ZBCA 4RW6A 3C8YA 4N41A 2FJDB 1Q8KA 5KFMA 4ICLA 4UOHA 2OPQB 2VL1A 4V19X 4TU8A 2V8VA 1E6VA 3MEEA 4LRBA 3MAQA 3LOUA 1TL5A 1W2IA 4J9LA 5D4PA 3QBCA 3I56S 3Q2TC 3POTA 3IN5A 1Z2ZA 1GMVA 3E3XA 2KDOA 4IR1A 3CCRS 1AROP 2GIQA 2OH2A 1RT2A 5HROB 2OLWA 2HLUA 1BWEA 2VDIA 5K8MA 1RT6A 1TUWA 2WOMA 5E33A 1IBLF 3MEGB 4M5HA 1J27A 4Y6IA 4FYXB 3KHLA 3G96A 3CJSA 4DN9A 2HHHJ 1WELA 5KFXA 3DI6A 4I6YA 4RW7B 1FDDA 3PCOB 4UOFA 5KT3A 2HQGA 4UOCA 4IR9A 2BV3A 4OI1A 4AE5A 3KLFA 3GFHA 1OQ6A 1Q7LB 3MM8A 1KQFB 4ZPCA 3T1AA 4JI4J 5LL6d 2OFHX 4R5PA 3BQ2A 3CDAA 3P96A 4OYIA 4Q8FA 4DSKA 3F73A 1JK9B 2DVIA 4LRFA 5A0YA 4I4BA 2YQ3A 4DX8H 4NLWA 5HMWA 4HH1A 3TJAA 4DX5A 2W01A 4DSFA 4M5LA 3QRQA 3CWJA 1U24A 2W2PP 3M8QB 3RRGA 2R7XA 3HXMA 1JJCB 2YKOA 2FC8A 2HBYB 1O6XA 3M8WA 4JYAJ 3R7SB 3OL8A 2BA9A 3CJ3A 3KWMA 4JI7F 1U1NA 2VICA 4XIUA 4IOCQ 4BS2A 5D6GA 3F56A 2RKIB 2XQCA 5KFJA 1KONA 2CWXA 2IDLA 2I2YA 3MR2A 2YKQA 4QR1A 5DJBA 3CF5Q 2KFZA 2LP4A 2RS8A 3TZXA 2W24A 3H4BA 2ZH3A 1VLOA 3TUZC 4I2QA 2PMZD 3MR6A 2GO9A 1VRQC 3IBWA 4NLTA 2FJWA 1TTHB 2UU9J 3QAEA 3H2VE 1VR6A 2V6AA 1LW2A 5FDLA 4UZBA 1ZA1B 2VOOA 5K8PA 4LIWA 2OFGX 3VCDA 3B4DA 3MD3A 4DPUA 3TRGA 2HIYA 1FKPB 3DLGA 1U6BA 4DCPB 1I94F 2JFDA 1F9EB 1Q82T 4KV8B 3B82A 3UDLA 4DR6J 5D15A 3PEJA 4KHPJ 3B6BA 2CJQA 2NXNA 4CT8A 2CNLB 4ER8A 4Q5VA 2H5EA 2R9LA 2QN6B 4F3OA 1TVRB 1FD8A 4ZVFA 3IA0A 3UN3A 2VJVA 4DV7F 1WTBA 1UJ4A 2VODA 3S1TA 4FVMA 1YK9A 4I2PB 1KSPA 2J6TA 3DLLQ 2Y1RI 3OHAA 1K1QA 4EYIB 3SV4A 2PSZA 2PDAA 4ELVA 4A8KA 1S6UA 1QLNA 5KFWA 1UWBB 1IBKJ 3BS9A 5EN1A 1LKZA 4QU6A 2BRKA 4QWDA 3I0SB 5G4DA 1X4AA 2BJ1A 4HL9A 4B3MF 3DRPA 3ZTOA 3TYTA 2MQNA 4LVOP 1DARA 4JI2F 2KT3A 2AX0A 4JV1A 5LXYA 4UUWA 3MMAA 2DK2A 4OIXA 1HNZF 1XK8A 2MZ1A 4EBCA 2DHHA 2BKOA 4KIAA 1HHQA 1RTDA 2EFNA 3WIUA 3M7VA 1VRUB 5FD1A 2AHOB 2HFVA 2IVMA 3N4WA 4FYWB 3M8RA 3NGRA 2H54B 2YWGA 1JXVA 3CT9A 3OTBA 2OHDA 4YB7A 3QNWB 4TVAB 2XYPB 4QJVA 4WU3A 2CPZA 2OO4A 3QZ7A 3W2WB 1Y5NB 2PI4A 1F5BA 2BJ9A 3AT1B 4OI4A 3K0JA 4DG1B 2LQ9A 3JSMA 1JMTA 4USJC 3DNCA 5IV4A 2VFUA 5ETVA 5C2CA 4DR5F 1IKYB 1GT8A 2B9EA 2IMWP 1DHMA 3H7HB 3VAHA 4ZVPB 4JI3J 2LDYA 1CLFA 2H65B 2W4DA 4X4PA 2OD4A 2F9JA 2DGQA 3WC0A 3MPVA 1C1BB 2DO4A 1S0OA 2GMHA 3G8QA 5IT0A 5I3UA 4MYUA 3CD5A 1AUDA 1EKRA 2DGSA 2GJ2A 4JOUA 3TARA 4OZ1A 2ZJRQ 2OPRA 2DRBA 2X51A 4P2FA 2E1CA 5KFAA 2MZJA 3WZ0A 3DLEA 1C4AA 2EFQA 3DGPB 3KJVB 1CJKB 3J81Y 4L3KA 4PXDA 3J7A1 4Y65A 2KL8A 2MTLA 4WP3A 3GV8B 3KK2B 1Y0HA 3GSDA 5A8KB 4DV4F 2KU7A 3QJJA 1EJ7L 1TL3A 3LQVA 2KJWA 3AD9C 2MZTA 1LWFB 1N33F 4QR2A 1B7YB 2XZTB 4RW4B 2ASLA 1BLUA 3B8HA 3LGMA 2CQIA 1S10A 2KN4A 5LJ5Y 2E5LJ 3UR0A 2BANA 3DRRB 2H48B 1XNQF 4ZVGA 2DRDA 2Q79A 3D3BJ 1KOOA 2RUSA 4OFZA 1R6VA 3UVJA 1NJYA 5LXRA 3JAMU 3MF5A 4UZCA 2QIFA 5KG0A 4M5DA 1S1TB 1MG7A 4CH7A 2HK3A 1M5HA 5IXUA 4JP8A 4DUYF 4H54A 2V2KA 1KVKA 1RWPB 3W9HA 4QW8A 4CLZA 2ROGA 2HVHA 4U8VA 4YMEA 5J1NA 3K58A 2GA7A 1WC6A 1N5QA 3H2UB 2J76E 2XNRA 1SJQA 3M6XA 4DV0F 1R8BA 2EG2A 2HVDA 2AIRB 3PX6A 2L9DA 4NLOA 4DMZA 4QIEA 3PW5A 4DX6A 1TKZA 5J2PB 4LR9A 4I0WA 3G6ES 2KXFA 1IKYA 1Q8BA 1HBNB 1SC1B 3AQOA 3JYTA 1EZZB 3DOLB 4USKA 2P6TA 4NLYA 2DR6A 3MOJB 4QYZJ 4ZPBA 1G6BA 2GO8A 1NK8A 3PRBA 3NCRA 3MECA 1K44A 5CXTA 3C16B 3ZTQA 3QT5A 3PR4A 2DNRA 4EGLA 3ISND 1NHVA 1YVFA 5BR8F 3HF5A 3L3CA 2QLWA 3BH7B 4YQWA 1RTHA 4LIRA 2V2QA 1RWMB 5F8MA 4ED8A 4HEA9 2E5JA 5B0DA 3R6LB 5J2MB 4GKKF 2ADBA 1B7FA 1R8HA 2JLEA 3C6TA 4OL8A 3S01A 1T9XA 1PC4A 1WC4A 2AWZA 2YY3A 3OHBA 2BDPA 2BEFA 3DXSX 3T9NA 4HVZA 1TQLA 5L1IA 4EBEA 2HGMA 2HRTA 1CULA 3AD8C 4C0BA 4P7TA 3M2VA 4KQZA 5E3CA 2XYHB 3VGTA 1TL7A 3OTCA 4C3MA 4H4OA 3G87A 4NOHA 3NAIA 1LK5A 4USMA 4RBVA 2XG8A 4PAAA 4QWCA 2EPIA 4ZVEA 3P5BP 2V4JA 3MAAB 3VF0B 4HYKA 2WZ1A 4OHZA 2PIIA 3BSNA 2HGNA 1HQEA 1XERA 1RHUB 4EO8A 1NXIA 3BN4A 3HSZA 5HJXA 2VBZA 5IS2A 4LF5J 3A12A 3AH6A 4QCLA 2ZBQA 4M95A 3QJLA 1BE4A 1VQ9S 3CCUS 1NB7A 2HMIA 1SCJB 4CWBA 4TYAA 5G0RB 1V3ZA 2JHEA 4URSA 1D9DA 4JI6J 1S9GB 2BOAA 1VISA 4TY9A 5GMEA 4DFPA 2ZH4A 1BXNA 1W7WA 4O3RA 2YKMB 3VV2B 1IVZA 1SL1A 2R7TA 4M1KA 2Z2ZA 2CUYA 4C8NA 3PKYA 2AV5A 4WFAQ 2U2FA 3H40A 3UPFA 3WBZA 2JJ4D 3Q8RB 3F41A 3EGZA 1R0BG 1FJ7A 1CC8A 3LP2A 2AYBA 5HLFB 2CNOB 3AJ1A 3UR3C 3NL0A 4FPRA 3LWLA 4MKVA 5ETQA 4J9RA 2DGOA 3MZIA 2IA0A 2KHCA 4P75A 3TZZA 5EWGA 8AT1B 3V4IB 1H73A 2CVIA 5JUMA 5HVGA 3PW4A 5C25B 2IIHA 2KRRA 4IUFA 4RW9A 2HVEA 2BM0A 3J7AN 3SDEB 1R0AB 4UY85 4DDFA 2H3EB 3MM9B 1GQEA 3MFHA 1S0NA 1REVB 2MKKA 2FJVA 4KPYA 1SJRA 4J91A 1R8AA 2U1AA 4CQ1A 4B9TA 2MZQA 2GAGC 1KTQA 1YITS 2KXHA 3KLGA 1YRUA 3PY8A 4NI2B 1M5KC 3PACA 2HRUA 4NRUA 1U1RA 3HHDA 1YZ6A 2L9NA 2IJRA 3R8YA 2HFZA 2HWIA 1KRPA 1D09B 4NYPA 3A3OB 2LU1A 3M1VA 2XLJA 4F2RA 1QD1A 5CABA 3RB4A 3CCWA 3ZC4A 1N48A 1DY3A 4CP5A 2F63A 4WKRA 1RWKB 1C2PA 3IC1A 2P9CA 1Y7PA 4LQ3A 5KFKA 2F3JA 4O0NA 4J9SA 4PG4A 3NEKA 2ZOFA 4NYOA 2CZVC 1K0TA 1F2GA 1RU2A 1IR2A 4BCAA 1X4EA 3QWUA 2LEPA 1HBUA 2HZAA 4ED4A 4AXJA 2Y1JA 2GCFA 2EW9A 3FGVA 5ETLA 1PAUB 2DPJA 1FO1A 2E5GA 4WE1B 2AJ2A 4LF4F 1HQ2A 2G0CA 4X66J 4ZN1A 3TP2A 4CLSA 1FTRA 3IM8A 3RB3A 1VBKA 3HK2A 3LP0A 4NEYA 3UDVA 2R2RA 2XHCA 3KJFB 5L39A 3I4PA 2DR5A 3PX4A 5HBMB 1U6ZA 1G7CB 4KKOA 2ZC3A 2V9WA 1X0FA 5I42A 1SUQB 1U2FA 2V8HA 2IVFB 3C19A 4DZDA 3OQ2A 1U45A 1URNA 3N6LA 4JI5J 4UW2A 5AE1A 4PABA 4DL5A 3I6PA 3OR2B 2V8PA 4ECYA 2DYAA 3UW1A 4RNFA 2HPUA 4RBTA 3M32B 1S6QA 5DDOC 1XBWA 2PN6A 1TV6A 2UV8A 3UN5A 3HSJA 4RKUC 3MCOA 3NGSA 2ASDA 4BLGA 4IDKA 5H1SV 5FIIA 2AKWB 4WTYA 2MJUA 1PYTA 2JWNA 4P72A 5IOLA 3HHLC 4TU7A 1IKXA 3RB0A 4JBCA 1A9NB 4B3MJ 2VG7A 1FT8A 1QVFR 5EWEA 1RE1B 2GGPB 1NJWA 2GHWA 1OY9A 1HNWJ 2OD6A 2QLFB 4KC5A 5JMNA 3BYPA 3R27A 5LMNF 1NSKL 4JV2A 4IH7A 5A8RA 1JLGA 4P2MA 4PWDA 4PR6A 1Q78A 4AXIA 3CDWA 3ULHA 2ZH8A 3EWGA 1TFYA 3G82B 3GIJA 2HHPA 4QPXA 4NA2A 2N4CA 3LPYA 1KHVA 3FMWA 3QATA 4PXBA 3JTOA 2HNDB 1UEKA 3IXQA 4K59A 2ZZTA 1SJFA 1NLKL 4FNHA 1Q8IA 4OJ1A 3FZ2A 5KT5A 2ZHOA 3FQLA 4KFBB 2D9OA 1C1CB 3HFKA 1FRXA 1DURA 2RDIA 1NAQA 1RYRA 3NLCA 2WVEA 1OPZA 3EE3A 1AYEA 3TA1A 3ZZYA 3M8SA 4DV3F 2EC2A 2KVIA 1PYOB 5CYQB 1QAIA 2F4FA 2OP5A 4GVBB 2R7WA 5HJYA 3D6FB 4DZ6A 4WWSA 2DNHA 3FRYA 1KDNA 1ROFA 4U6PA 5K14B 1FCAA 4Q2LA 3E01B 1B99A 2R3VA 1R0CB 3BYRA 4LUBA 4X4VA 4HTJA 1JWWA 1BD6A 2WSFC 2ILYA 5KFLA 3GE9A 4IFVB 2RD5C 1XMQJ 3IFEA 2FVSA 3RW6A 1RAJA 1YIJS 1EHWA 3OW2R 3MMCB 2NREA 3GG1A 4YY3F 2FY8A 1PJ6A 1V9OA 4ED6A 3VGSA 4ILRA 3NCQA 5KG7A 1QJHA 4NCBA 2ASYA 4E98A 3I0RA 2VPYB 2IC3B 1PJ5A 2KXNB 2K1RA 4JI1F 2XULA 5IQQA 3HVTA 1CC7A 1NM2A 3FUYA 1HWJA 4WFZA 1FESA 2YBVA 4DR2J 1G1XA 4LF6F 2Q3PA 5M2RA 1NCLA 2GFFA 4Y2KA 1FDAA 3N9UC 2R42A 1TU0B 1DQAA 3NAHA 4B17A 3BBBA 1U6FA 1VBXA 1XR6A 3T3FA 3FBBA 4RPFA 1Q95G 1QDUB 2AGOA 4XPEA 1RLCL 4LSNB 3TUIC 4J7CA 1WHVA 4ID8A 3OR1A 3LWMA 4LQ9A 3FSIA 1N33J 4TLQA 3C14A 3KG4A 3VAKA 2BW7A 5A6PA 3IGNA 4ZPDA 1HPZA 2FJAB 1SKSA 2GNKA 4U96A 3K8VA 4B3RJ 1Y10A 1QM9A 1NKEA 2P2CB 3I9ZA 5DM7Q 1C0UB 3O5TB 3B78A 4IG0A 3VR1A 4IG3A 3E8OA 1XNQJ 2YNHA 4WP8A 2GQCA 3N5FA 3IWXA 3PFEA 4OX6A 2B8PA 2JRSA 1N36J 1LK7A 2DGXA 4X4OA 3O44A 2FLNA 3QYYA 4E8UA 3BR9A 1NPKA 1RK8A 1AFIA 4G1QB 3AXMA 3I96A 1WNEA 1RYSA 1HNXJ 2Z2LA 4LT6A 4DUYJ 1LW0B 4I56A 2HQCA 1H0HB 3GG0A 2BX6A 1J5OA 1N56A 1IBCB 2ILZA 4J37A 4OZJA 3D6MB 1YJNS 1VQ8S 3RU0A 2FVRA 1XN9A 1S12A 2K06A 3JS9A 4LVNP 4CO2A 2R8HA 3RBXA 1Q16B 3TANA 1YJ7A 4DV0J 5C2GA 4WKYA 5CYQA 5J2NB 4C8OA 2H4YB 1DTQB 1JLQA 3V6KA 2RQMA 4W90B 3ZNUA 2R2SA 4PG6A 2CA9A 4ECWA 1RGVA 4F4XA 3THPA 2CQ4A 3FRZA 2B9WA 3TVKA 4LBPA 4DUZF 4F4KA 1RP5A 4ZVOB 3MM5B 1J5EF 1REGX 2GVDA 4ID5B 4MFBA 4ZOSA 2QMUB 4YOEA 2XMTA 5B0EA 2XTJP 3DM2B 3R7BB 3HZEA 4ZDNA 4JV5F 4GVLA 3KG1A 3MMCA 4TKTA 1GMWA 2DR7A 1CSJA 2LVWA 5BR8J 3NOGA 3HFZB 4K0KJ 2QZ8A 1MU2B 4X84A 4ECUA 1SIZA 3M2UB 3K5OA 4ED1A 3NNHA 2YNIA 1WDDA 4K5SA 2OIHA 3BQ0A 1G4CA 1KLMA 2AD9A 2DXFA 2ZDPA 4XPCA 2J9DA 2ROEA 3WHIA 2HNYA 2ZVSA 5ADZA 3S8SA 4ECQA 2PEBA 2DY9A 2CFXA 3RJMB 1FK9A 4CO0A 2PO4A 4F25A 2B5JB 3KUGA 2I9SA 2QO3A 3PJWA 2E7XA 3FBFA 1T05B 5DDPC 1HWLA 2F8MA 2R8KA 3KG0A 2O66A 2HNZB 2B6AA 5HATA 3QIDA 1GMUA 1S7IA 3F44A 3U1LA 4DPYA 1NK9A 3TAQA 3B54A 5KFGA 2HGLA 2HYIB 2HS3A 3N0VA 4LJMA 4QU7A 5D0HA 1ZAVA 2JX2A 1IKWB 3QT6A 2KT2A 2PT0A 1R31A 1WOSA 3U1NA 5LMUJ 1VC6A 4KY3A 4OJGA 4RNMA 3MOZA 2BE2A 3IM9A 3BZQA 4J9KA 4C7QA 2GV1A 1NNDA 4NLVA 4N5SA 3V2UC 4NXMJ 1SBRA 3MM7B 1MW7A 2NLWA 1RHQB 2ACMA 2DNOA 2JC1A 4FYVB 1SH2A 4H4KA 5KFDA 1HWKA 3KOAA 1KOHA 5KG6A 1WI6A 3A8JA 3BGRA 3IRXA 1ZOTA 2AGPA 3UD4P 4O3SA 2VPWB 4N8NA 4USHA 1SPBP 2LQ5A 1K0VA 3PJXA 4LF7F 1HD1A 3G8TA 3ZZUA 1OMSA 3NY0A 3LP1B 3K5NA 4FXVA 3K8WA 5AJ3F 1DTQA 4IYQA 4J9PA 3T1HF 1R7IA 1KBRA 2C1EB 4DV6F 4IOBA 2Z58B 1DLOA 5HSPA 4ZJLA 2ZUAA 1RADB 2M5YA 4QWBA 4NZ6A 2EBEA 2IHR1 3MMJA 4P71A 3HKWA 3ZXWA 3QZ8A 2UUTA 4J9UE 3KHHA 5KT7A 3DM2A 5KG1A 2JVRA 4NPOA 4J9VA 4NYZA 3M2RA 3BDEA 3M8PB 1EETA 3KLIB 3HHLB 5T41A 2G1HA 2AYEA 3SQOP 1AUSL 2JL9A 2VA2A 4L72B 1GMWD 5HP1A 4ZIVA 3G6YA 4F4YA 2D9PA 1JLEA 1Z2LA 2BACA 4MAKA 2UVUA 1I5OB 4F3MA 4DN0A 2J7UA 5D3GA 1BQMA 4HHJA 3DGVA 5IM0A 1N5YA 3DYAB 4I64A 4Y00A 2VC1A 4XDDA 2PC6A 3DU6A 5D0RA 4X65J 5KOXA 2B5JA 1VBZA 4RLEA 3IGVA 1WACA 2PA3A 1TKXB 2Y0SD 1FF2A 2L3MA 4PCQA 4XDCA 5KT2A 1X0PA 3AA8A 4C8ZA 3W62A 3ITHB 3LGHA 1VQSA 4B3OA 1I51B 3EZOA 1DZ5A 3PEHA 2HHSA 4Y2IA 2HHHF 1RAEB 2RQ4A 1DRZA 3VVUA 1K73T 2X7IA 4QQBA 1RT1A 5DG8A 3H25A 2IAJA 2D3UA 1NKCA 3W3SA 5ETMA 2C42A 2B9XA 5LSRA 4F0MA 3FDSA 3PW0A 1JLAB 2DBBA 4DQSA 4I1TA 4OYMA 3BGLA 1AFJA 2ZBIA 1ZM4A 3VGUA 1N5TA 2XMJA 3I5AA 2FZKB 2YX1A 2J5AA 5DZ6A 5F41A 3RGIA 4KGZB 4NLUA 4X2BA 3CW2C 3UCGA 1XEZA 2CXEA 2WB4A 4HT7A 5DQGA 1WG5A 2D3O1 2HVIA 2VG5A 1HYSB 1F0XA 2QTWA 1UW9A 3U7JA 2CPJA 3IR5B 3GPAA 1WSVA 2E7VA 3TAMA 4RUCA 4J9OA 2C3MA 3W8GA 3C3LA 3H98A 5L8RC 1EP4B 4EUVA 1S1VB 2F65A 4WTOB 2V4RA 2GC8A 3VAGA 4K5RA 3O1LA 1S9FA 2ZZMA 4Q7AA 4OI6A 2NXCA 1U1MA 3R1HA 2K3KA 1E6YB 2X3DA 1CJTA 2OPPA 5T7LA 2UU9F 4TY8A 4R0JA 2MQQA 3IRWP 3CCLS 4CNZA 4XO0A 2HFNA 3LALA 3GCWP 1X5SA 1FEEA 4DCOB 2LKZA 1NMEB 2G4BA 1HA1A 2CQCA 4UUXA 2OKQA 2J7KA 4Y0FA 1NSPA 3D0GE 1SV5B 4NCAA 3N6NA 4R8UA 4DS5A 4GO7X 2BM1A 3A8IA 4QPTA 1IKVA 1LV5A 5J1EA 3PYEA 3R5CA 5B09A 1B0VA 2FJEB 3QGGA 2OGUA 2ZDOA 1S1UA 4DR6F 4NLSA 3C66A 5KFIA 1SQFA 4NCGB 3QFWA 1XMOJ 1TL1B 2HHXA 1CS4B 1VHFA 3SCKE 3QT7A 3EXCX 4C3KA 1HNVA 2E1AA 3RW7A 7AT1B 2ACYA 4DV3J 3H5UA 2LXIA 1U25A 5F8GA 3EGVA 3NS6A 4ECSA 2ATLA 4EYHB 2GJFA 1SC4B 4IH6A 3FK4A 3V5RA 4F0HA 2ALZA 1X9MA 1CQNA 1URRA 4GKJJ 1YTYA 2UVVA 1N4LA 1D3WA 3GFYA 3LTOA 3OVBA 4OHYA 3NCPA 5BYQA 3TVZA 5A76A 5IC6B 1IBKF 2NXUA 2O5DA 2XGPA 5F0WA 3PDNA 2ADCA 5KG3A 1S6OA 3D5MA 5MAOA 4Q0BA 4CLTA 4Y34A 1M1GA 1ZAWA 2MMYA 2YWEA 5LT5A 2DITA 2NXEA 2H5IB 2E1MC 2DR8A 4WFNQ 2MKJA 1UA1A 4PWWA 2FLOA 1S77D 3AJ2A 3PYGA 1KNZA 3E51A 2WONA 2VJUA 1WUUA 4JI1J 1D8ZA 4EO6A 3CGIA 1C0TA 3EPIA 2IA6A 4I6AA 2JDJA 4BDPA 4LBIA 3IG1B 3ZFVA 4HLBA 1YJ9S 1ICEB 2HS4A 3Q24A 3RAQA 3D0HE 4FKYA 1VK8A 3OD2A 4OYWA 5CZVA 5B7WA 4TNOA 2J8AA 1HQUA 3VQSA 2VPZB 2E9TA 2LA4A 3Q2SC 1RTJB 2BJEA 4LRCA 3H4DA 2UUCJ 1AZSA 4CRJA 3SCLE 1WHYA 4IRKA 1YRXA 1I3OB 3GTYX 4UT4A 2VC0A 3PG9A 3QFHA 2M7SA 1UFWA 4NA1A 1RLDA 2OEKA 3QGIA 1FFSB 4NLQA 3DOMA 3GIKA 3MEDB 7FD1A 3DLJA 4DFJA 2RRAA 1GH8A 5IFMA 1JLCA 1RA7A 2ZE2A 1FXLA 3BEGB 2QGFB 5E41A 3FFIA 5C42B 3M6WA 1N52B 5C24A 5D8HB 3ZZRA 4PUOB 3D9BA 3DLKA 3GIIA 1X60A 2PGCA 3IAS9 1RISA 1U4BA 2F7VA 4CT9A 1LWEB 1ZZNA 1L3TA 3M8YA 5LSLA 9RUBA 3CMQA 3AJDA 5DQHA 2WBRA 4ZK7M 3T5KA 3CJRA 1RWWB 2YNFA 1B70B 1QE1B 2XO7A 3KJQB 1AA1B 2MGZB 2JOQA 3D66A 5HVHA 1UFKA 1R27B 4C11A 1RAAB 4DL4A 1FHTA 4HACA 4EMDA 4C8KA 3SQGB 1J2VA 3IBCB 4WYLA 3FMBA 2FIUA 3PW7A 1SQGA 2KJVA 2WW8A 3W65A 4QYZK 2R7OA 5DDRC 2Q6BA 1RTIA 4EWTA 1T9TA 1F1BB 4F0KA 5DG7A 2RJZA 1BUXA 2E5HA 2CQ2A 3AY0A 1J5EJ 1CJVB 1VMBA 3KUEA 1F3VA 5KFCA 3U02A 3X3UA 3DMJA 4JV5J 2A18A 4IO1A 5SZTA 1NH7A 2MDAA 2RAQA 3CO9A 1MSWD 4DR7F 1NUEA 4ETZA 3C6UB 2J0QD 1RT7B 3RRKA 5IWAJ 2ZBRA 3QO9B 1S1XB 2YKNA 4KSEB 4YFUA 3W2VB 4DCJB 4NLDA 4MKAA 1RHJB 4BHQA 5KFOA 2YTCA 1QTMA 1X4HA 2MHEA 2HLTA 5E5NA 4RW6B 2KM8C 4M5GA 3KNAA 1ZPVA 1U0SA 4ICLB 4F50A 3IBFB 1E6VB 3MEEB 4KH0B 4HHUA 5DLGA 4PEOA 3PO4A 3M9OB 2NSBA 4LSZB 4ANCA 2R7QA 1PYSB 4RU2A 1HARA 1V3SA 3POTB 3W5XA 3J80Y 1U0HA 2HQ3A 1PC5A 1RT2B 1X9SA 4AL7A 4WP9A 3OSNA 4J9QA 2WOMB 1HIYA 4CLFA 3QJPA 2CRLA 3CPWR 4A8SA 3J7YU 5L1KA 2VF3A 4WK1A 1FDNA 2PFFB 3D6TB 2HG4A 3DI6B 1Q1KA 1TL4A 5DG9A 4B9VA 1Q7YT 3KLFB 1YBTA 2MZRA 3MM8B 2B7CB 5GMDA 2BR0A 1FRKA 4R5PB 4OLPA 3KLHA 4ZS6A 4CZCA 4FP9A 4ES3A 1CVJA 3W66A 2LEBA 4ZVRB 1XNRJ 1QAXA 3W1YC 5A0YB 4RZRA 4FF3A 3GJQB 1QE1A 2IBKA 1RDRA 2E44A 4BC9A 4PPZA 3FCWA 4MKBA 2CKWA 4F8RA 1ZA2B 1B4SA 2DY1A 5AE2A 1VQ4S 4ZVUB 1M5OC 2RDJA 1IXKA 1UAWA 4P6QA 3ADAC 4YDDB 2HHQA 4U95A 3G4SS 2ZKTA 1D9AA 1U8SA 1FFWB 1C4CA 3T19A 3KNGA 5IQ6A 1FNOA 2QFIA 4P7VA 2EC0A 2W7PA 2JFKA 2M9KA 1K9MT 2F8EX 5B0FA 3D68A 4DV5J 4Y2MA 2NQPA 3T1HJ 3NWRA 3QWPA 4I2QB 2QLXA 3BSOA 1RAHB 3JTPA 4N76A 2HBRB 4PXEA 3EM1A 1S1WA 1TFWA 2D3ZA 4KHMA 5GAHU 1CJVA 2HRYA 3ZZZA 1YLXA 5E3AA 2CAJA 3UCUP 4ERDA 2VKZG 2HKEA 1PGZA 2UUAF 4DWIA 1EX8A 2BYCA 2NUHA 1LW2B 5FDLB 4ELTA 1DQ8A 2X1BA 2ZD1A 5CZXA 4L76A 2SXLA 4O3PA 4LRAA 1UL3A 1W25A 4FNIA 1T9VA 5RUBA 3KKFA 4OI2A 2RH3A 3R7NB 3OT9A 1FRJA 3DLGB 1BMQB 1KN6A 1FERA 4DSJA 5KFPA 3CE8A 4JI6F 4HI1A 4ECRA 3GJRB 3WQPA 1NZ8A 2KG1A 1JKHB 1FE0A 2CG8A 1HI1A 3THTA 2IYGA 2BKPA 4YN3B 1XJWB 1VQYA 1UKUA 4GRSA 3VQTA 2BVZA 3CDEA 1TR0A 4ZN3A 1WI8A 4AYBD 4O4GA 1MMLA 1RJJA 2N3OA 3Q83A 2XBPA 1JIHA 3ETMA 2B4UA 2P9GA 4WFXA 1DTTA 1KS2A 2FB0A 3I82A 1RAIB 2BMBA 4B3TJ 1UZHA 1HW9A 3FCVA 2HFOA 3DOKA 3DRPB 2ZH7A 4X64J 5ETNA 4IOAQ 1RQ0A 2NPFA 2AT1B 3VALA 3AOAA 1WF2A 3I9V9 2HK2A 1WG4A 2IJFA 6FD1A 1SC3B 3MMAB 1IWAA 3M4XA 5CAAA 5F9NA 2KH9A 2HZVA 2DT9A 1RTDB 3CJKA 3BGFA 1HWUA 1WHWA 3A13A 3ICLA 4ENOA 3OXLA 2A6OA 1HR0F 4KBIA 2AGQA 2GS8A 5IT9U 3D0IE 2VFTA 4QWEA 2ZNZA 5KFSA 3FVYA 3MCNA 3DRXA 1QY7A 3N6MA 1YI2S 2A2CA 3FSYA 2ERRA 3HHEA 5D4NA 3V6JA 3T5JA 2AJ4A 3CIZA 2RB7A 4RUBA 4HKQA 3I4HX 2WSCC 3D3CJ 1SL2A 1NDLA 2MQPA 4C98A 4F26A 5F8HA 2FGOA 3LO3A 3DHXA 4OYAA 2VOPA 4AL6A 3RAMA 3JSMB 2ZHAA 1EIYB 1RB0A 2QA1A 1LQ9A 1UWAA 3NNCA 1WSRA 4Y28C 2LQJA 2W1BA 4OYBA 2XWXA 3W61A 2XZWA 1H3DA 1B0PA 5B08A 4X66F 2RQCA 1KQGB 1S6PA 4AUKA 1I1GA 3LANA 2Q66A 4LF1A 3CD0A 2UXDJ 3FEXB 3PM9A 5I3UB 1U49A 3R2CJ 4LMZA 4I6WA 4OX8A 2WVBA 2N82B 2OPRB 1JX4A 1YWXA 4WF9Q 3W5YA 3Q8PB 1RWXB 5EX3A 3DLEB 1P27B 3R1LA 1F2HA 3DXBA 4M5JA 2AJ0A 3CNQP 3O8WA 2DGWA 5CQGA 3MR3A 2YH0A 2VDHA 1WF0A 1FWLA 1IN0A 1JKHA 4JI5F 3GJSB 4QWAA 4TLRA 3RYLA 1H6KX 1GEHA 2RRNA 2W7OA 5HI7A 2MLZA 4CYUA 1TL3B 3IAM9 3BQ1A 4Z2XA 3MFIA 4IQMA 4OV6A 3OL6A 3GQCA 6FDRA 2ZITA 3QAUA 4ZPWR 1RBLA 2I8EA 1VQ7S 1N32J 1JLBA 4TN2A 4IQXA 3CCJS 2F9DA 4ZHRB 4ED0A 2NZ4A 2N3LA 3MTKA 1QSLA 4ILLA 2RRBA 2RHSB 3DLBA 2N7CA 3KXDA 1VRTA 1T94A 1JJHA 3PRDA 4QBUA 2BANB 5H9FJ 2W7AA 3CVKA 1HNWF 3UVJB 1T3NA 4YUDA 4ED7A 4Z7CA 5L38A 1R8PA 3VAJA 4M5DB 4OZNA 2W2MP 1U47A 1YX2A 2HAFA 2QC3A 3VZHA 4FYDA 1YJTA 5KFQA 2Z2MA 3OFEA 4USTA 1YBAA 3M9NB 4DFKA 4DR4J 1PILA 3HJFA 5JVHQ 1HBOA 4L3NA 2C2MB 2V8DA 2QFJA 5E3PA 4OI0A 2EKNA 3R5GA 3DRYA 5HVFA 2Y1IA 4E2FB 1IR1A 5D4OA 3H20A 1RWNB 3RB6A 4IO9Q 2KM8B 5KFEA 5F8NA 3KK1A 1RACB 1TKZB 1FX4A 1PKUA 3ETOA 4LBHA 4TYBA 3CC2S 1VQOS 3JYTB 1VBYA 4OZ3A 3H59A 2I0XA 4ZIWA 3MMBA 4O44A 1U7LA 4YP3A 4JV0A 3G2XA 4KHRA 2J7WA 5J2QB 3ENWA 3MECB 1XMQF 4W98A 3CC7S 5E3RA 2DHAA 2BXJA 2Q43A 3DU5A 2OEJA 2MY7A 4DV1F 3V6DA 2PE8A 1RTHB 5HMZA 2DTJA 1KFDA 4WXOA 4ES2A 5ITHA 2CQDA 5AE3A 1TMJA 5HQLA 2XSJA 4R0EA 1FDBA 2MLYA 3C6TB 5K8OA 2GHPA 3MPWA 4DR2F 2VUGA 1H74A 5F3TA 5GADI 2C22A 1CULB 3NMAA 5E2QA 3M2VB 1UEUA 2W9BA 1UMJA 2A3JA 1TL7B 3OV7A 4K2XA 4H4OB 1TAUA 3G6VA 2ZKUA 3OL7A 3PTWA 3CD6S 2HHUA 1B64A 2CQ1A 1X4CA 1WC3A 1VCTA 4C6AA 3WIVA 3MGJA 3FNNA 2V4JB 2BUNA 4XAKA 3CCVS 4ZHRA 3KMQA 1VIOA 3EVMA 4WXWA 4B3RF 2G0JA 1HQEB 1N6QA 4YR0A 4NL5A 4DR1J 4NMXA 3MM6A 2AEJA 1HHSA 2CPDA 2WBMA 4DR7J 2H9ZA 2QL5B 4KYZA 4WFBQ 3VAIA 2B0GA 3UNYA 1N36F 3W63A 3EZ5A 2HMIB 3DFEA 4EU0A 1BC6A 3M30A 2CZ9A 4ZP8A 1T03A 3P45B 4YHHJ 3FEZA 1HNXF 1H2UX 4F36A 4WZQA 4C0OC 3I32A 2H5JB 3BBFA 2I5JA 3K17A 3EPGA 3L9ZA 1BGXT 1LOUA 4ANEA 3AODA 1Q53A 6AT1B 1NB2A 1Q8LA 3Q22A 3LP2B 1RBAA 5I3QA 1VI7A 5KG5A 3GJTB 4URQU 3M9MB 4ELUA 1NDPA 2MQLA 4RR5A 4OX9J 2QJ3A 2FLPA 3OXGA 3NRBA 3CJQA 3BSAA 3TAPA 3TI0A 4RW9B 3OFGA 2DIVA 1WHXA 1R8CA 2IM1A 1KVIA 2D1CA 4HR2A 5A8WA 4R25A 4WIQA 4BC7A 1NK4A 4H4MA 4XTTA 3IS9A 5J2QA 4LREA 2XSFA 5CD4H 2HFUA 5KOWA 2FJXA 4K4WA 2FC9A 3KLGB 3CJ2A 2FD2A 2W9CB 3B4MA 3V6HA 3E2EA 3QGHA 2ZJPQ 2QV6A 2X1FA 4K0KF 2GVZA 3A1YG 1Y5LB 5KFZA 2XMUA 4DSLA 1I6JA 3J7ZT 3EJMA 3M1VB 2LYVA 3GYXB 3DCAA 4OZ2A 4O23A 3P5TL 1VFJA 4QIFA 1NJZA 1D1UA 4ED3A 1OJ4A 2KYXA 1PBUA 4KPCA 3EXYA 3QRPA 1KC8T 4X4UA 3GV5B 1YKWA 3GZ7A 3BBCA 1ZAXA 2KFNA 4J9MA 3HULA 4KRWA 3UQSA 1HBUB 2RT3A 1JXEA 4I69A 4Y2AA 2E1PA 2E9RX 4G65A 1VQ6S 3MHYA 3SYZA 2FDNA 4OJ3A 2GIRA 1FJGJ 1S7HA 2FJBB 5GMKa 4DL7A 2C2EA 1OSDA 4Q8EA 1PAEX 2RF2A 2W2NP 8RUCA 2FQQB 3DDNA 1HI8A 3J80U 1PBAA 3SCJE 5HQMA 3W9IA 2ASJA 2YWWA 1X9WA 4B9LA 3CULA 2DISA 3LP0B 1YBUA 4HH0A 2UUAJ 3I31A 3GSIA 4ZCIA 3K5MA 3IMQJ 4AFFA 3CEDA 4X4SA 1RT4A 3NGDA 1OYDA 3OL9A 4X62J 2C2DA 3N28A 2HAIA 3GFXA 5AT1B 4H4KC 4WFYA 1X5PA 4KKOB 2CDRB 5LMUF 4K8RA 1GNKA 2PI5A 2CQ0A 2EK1A 5I42B 3MPUB 4DL6A 1RABB 4PG8A 1CPZA 1XQIA 4PPDA 2C2KB 4CLLA 1G3OA 1HHTP 4NXMF 4RUHA 4USVA 1FTCA 3EVWA 3OUYA 2L41A 1S76D 2AP6A 4CH0S 1BQXA 1MROA 4QOTA 3NGKA 5CHCB 2F8HA 4LF8J 1V5VA 1FWKA 4A47A 3ILJA 2ZFHA 3NMRA 3MURP 4WPAA 1H98A 5C5JA 1S6QB 3W7BA 3EYZA 1TV6B 4OYXA 1YHQS 1SVDA 2RUGA 4IDKB 4FS2A 1PO6A 2DO0A 3MDFA 2COLA 2DNKA 4M8LA 1IKXB 3BV8A 3K7RA 3LAKA 1PJ7A 2YWHA 2ZVIA 2GMJA 4DLGA 2VG7B 3SXLA 4DHVA 4K4YA 2HHWA 2CQBA 2CQGA 2YNGA 4DL0C 4EZ6A 3M05A 3TVYA 5A8RB 1JLGB 4PWDB 2GAHC 2JLFA 4M5MA 1MWYA 3L7OA 3A8EA 1L3SA 1H38A 2RHQB 3Q8YA 1L5UA 2W9CA 4L73A 4LFCJ 2YQ0A 2M3DA 4QIWD 1UJ6A 1VJQA 2J0XA 1FRHA 5JVGQ 2VHGA 1HR0J 1XMBA 3U1MA 3H2LA 5LM7E 4W4MA 3HD2A 2WW4A 1HKAA 3FZBA 2OTJS 1EQMA 2XMVA 3LF0A 3R5BA 3UD5A 4CM2A 4MK7A 2HVZA 3ET6A 4K4TA 2JH3A 1HNIA 1TKTB 5H9EJ 4LFBF 4X65F 3AB4B 2QX0A 5AXKA 2OJ3A 1VJWA 4KO0A 1OO0B 1RWVB 3ENQA 1BQNA 3UCZP 2AW0A 2QRRA 4YB6A 3ZZTA 2DRAA 2QA4G 1SJ4P 3I87A 5AXNA 2CPEA 2L9WA 2RDDA 1ZZFA 3ENVA 1B3TA 4CLUA 3MPDA 2HFSA 1RT5A 2XWYA 3WX8A 3NG8A 2VG6A 3OLBA 1YGYA 5B0GA 1HMVA 3FQKA 3HHKA 4FBTA 4YEAA 2XS2A 3HO1A 2MQ8A 1GXTA 3MI7X 1S72S 3AHPA 3LUYA 2APOA 3I0RB 3P6YC 1NDCA 2OPSA 2OTLS 5F3ZA 5KFBA 1NU4A 2K1RB 2DXDA 3AA9A 3LA0A 3R5JB 5L1LA 1CQMA 5K20B 3HVTB 1OY8A 2E9ZA 2BE7D 5DO2A 1YJRA 2D41A 2RNEA 2ZH1A 4WK3A 1ZETA 2QA4S 4U9RA 2DNNA 2ZUGA 4LF9J 3P8BB 4ILMA 1WC1A 3KDOA 4NLGA 3DRSA 2GX8A 2RVJA 1P9QC 2DCLA 4DPOA 3TJ8A 3P49B 3GIRA 2FGCA 3ZZ0A 2OSRA 4LSLA 1SH3A 2JEGA 3MTJA 5HMXA 3CDUA 3BPDA 3OR1B 5KG2A 1UFLA 3PW2A 1L3KA 3C14B 2GMLA 1O51A 2Q1LA 4DL2A 3CIMA 4PQUA 4HHHA 3O3LA 2EWHA 1HPZB 4CIOA 8ATCB 2W25A 3KLEA 2KTQA 2X1AA 3QLHA 1FI4A 2IY5B 4IG0B 3I5BA 3SV3A 4CTAA 4I7FA 4IG3B 2QG9B 3C15A 4PG7A 2VPXB 2EXUA 2J0WA 2YNHB 1UTAA 4A8OA 2W2OP 2V2ZA 1Q0NA 2M8HA 1RCOB 2EG1A 2C3OA 3T5LA 3PVXA 2ABYA 4RBUA 3SBMA 4NRTA 2V69A 4RW8A 4ZKAA 3NS5A 1FFGB 1SIWB 4IFYA 2GQ2A 1NKBA 5DGBA 1RBOB 1JLFA 3A3NB 1FXDA 2CJAA 3VZIA 5KFNA 2RE1A 2XM3A 2J9EA 1ZM2A 3MCSA 4RWXA 3FKBA 2V0NA 1J5OB 2V8GA 1JNZB 1D8YA 4M5IA 3K57A 3TA0A 1LWCA 4M63A 4U67Q 4OZ5A 1XMOF 3BKUA 2L08A 4P2SA 4ZPTR 4F67A 2H1YA 3AB2B 1NK7A 3U27A 4ZLNA 3S6EA 2YWKA 2HBZB 4EBDA 1OSCA 1M1KT 4ZP9A 4N77A 5KT4A 5F9LA 5CYMA 1JLQB 1TKTA 4JI0J 5JJBA 1KLNA 2FHJA 4ANDA 3MUVP 2FUG9 2BJ3A 4GKJF 3TEGA 4OZ0A 2VQEJ 1UETA 1LFWA 1RUSA 5KFVA 1N34J 1BY9A 2GVDB 2W8LA 1UCNA 5I4MA 3H5SA 4MFBB 1R43A 4C48A 4RL1A 4DFMA 2UP1A 3GB0A 1YG0A 2BW2A 3NP5A 2QYCA 3BO4A 3HP6A 3C2PA 4DU7A 4PRFA 3NBPA 4DV1J 2QSFA 4DI6A 2CQHA 1HI0P 3LW5C 2BBEA 5KFTA 1M0SA 3D1HA 2OPQA 2VBXA 2B43A 4N47A 1NJIT 4B3SJ 4DQRA 1H2TZ 2K8GA 2W9AA 4C0HA 4DBQA 4P2XA 2YNIB 4O0IA 2R2UA 1KLMB 2ZOMA 4ZCKA 1NPRA 2HNYB 2F1FA 1VQNS 2C3YA 3J7YI 1VQ5S 1KFSA 3AQPA 3MR5A 5SUHA 2A6MA 4NZ7A 1PG5B 5HROA 1FK9B 2VASA 1RHRB 3L7UA 4RNOA 4JB8B 1VS3A 1F5CA 2UZAA 1D0EA 1MNEA 3MEGA 4KH1B 2XC9A 2UUCF 2B6AB 5ETPA 4RW7A 4Y2CA 2M70A 5BYRA 1YJWS 5HMYA 2MKSA 1FEHA 2KZMA 1V6HA 1QUPA 1P6TA 5DS7A 1OYEA 4WBFA 4ZITA 3CC4S 4A8XA 3PKMA 1VC0A 3Q23A 2NZCA 2AMCB 2ALYB 2AZ3A 3C46A 4AQYJ 3ZTPA 4RU9A 3NOCA 4UQTA 4U7UD 2DH7A 2BE2B 4C4WA 4N8OA 3M8QA 1WG1A 3D6HB 1TP7A 1Q79A 9ATCB 3R3TA 2V50A 2DEIA 1QAJA 1T9WA 2MB0B 3D2WA 2RKIA 1S79A 3UE2A 5EWFA 4GO5X 3BGRB 3OFFA 3IRXB 2YX4A 1S99A 2R7UA 5GAHI 3PJ9A 1NSAA 3RUBL 1FA0A 5ETOA 3J81U 1F9FA 2IYIA 3VGVA 1CG2A 2R8GA 4M94A 2E29A 2LQBA 3CMAS 4WJBA 3CJ4A 4U7CA 4TQSA 1QTNB 3KDNA 1FX2A 4W92B 5HK4A 4X4TA 4UOGA 5FJ4A 2DD8S 2YQ1A 1DLOB 1YQHA 3MCMA 1V3RA 3GWCA 2EBGA 2FHJD 3TOQA 2ZH6A 1S97A 1WORA 2P8IA 2PMHA 3CSKA 2J6SA 4GC7A 1FKPA 3JSRA 4CO1A 5C7PA 2MY8A 4KV8A 4B9SA 3M2RB 1EETB 3DHWC 2OMOA 1BHNA 1WEZA 4RX6A 4DL3A 3T1YJ 4WU2A 2F5GA 3SCIE 2LXFA 1TVRA 5IWAF 1GX5A 2P9EA 2VH7A 5HP1B 1IM6A 3HFVA 1JLEB 2KI2A 2FVQA 1N0VC 2VQFJ 5D77A 2B56A 2GZOA 2ZH9A 4I2PA 3MWBA 2DHXA 1D9FA 1EARA 4C9DA 2ZM6F 2QLJB 2Z2YB 2X3GA 3AOCA 1HLWA 4DPXA 4IH5A 3ZTSA 4LFAJ 5D3GB 1BQMB 4USUA 3SZ2A 5IM0B 2IFXA 4USIA 1N5YB 2LMIA 1W2BR 1UWBA 1NPPA 3ZO7A 2CJBA 2YX7A 3RBEA 3T9ZA 3KTQA 3I0SA 4MK8A 1X4FA 1KTVA 3TUJC 3IO1A 1TZ0A 3VHQA 1FWPA 3HKZD 1VQMS 3MPYA 3D28A 4CI0B 3BF4A 4C3LA 2CQPA 2QSWA 3AOBA 1FE4A 3GYGA 3K89A 3K2YA 4B3OB 2DB1A 2IRUA 1EKSA 3QQCD 4MIAA 4UF4A 4HTIA 4DLEA 4PG5A 5GADU 1P1TA 2IM0A 1VRUA 1RT1B 2IAJB 1U09A 1OS5A 1WOOA 3A8KA 2HIQA 4CDIA 1RAFB 2BQ3A 2V68A 2EVZA 3CCES 2I6WA 3OVSA 2CPIA 4UY8T 4ED2A 3LGNA 3BKTA 4QZVB 2VU5A 1FRIA 2NXJA 1OIAA 2LU2A 1XNRF 3N5BA 4FF2A 3P3DA 3HSGA 3R6GB 1DJ0A 3W2WA 4XK8C 2XEXA 4X4NA 4C8LA 3L95X 4DG1A 2EFVA 3GONA 3CJ5A 2GW8A 1QVGR 2CVEA 1U2RA 2J9DE 2VG5B 4K4VA 4U7UK 2NCKL 5D78A 1SC6A 4OYPA 4DQIA 1S48A 2ROPA 4ZPAA 4DV2J 3TAMB 2M52A 4DU8A 2XS7A 4F4AA 3Q8UA 1IBMF 4CO5A 1C1BA 4DV5F 1KEKA 2PD1A 2UUWA 4ZPVR 3MEKA 7FDRA 1KR4A 2M8DB 1F5AA 2DNPA 1NO8A 2UUBF 1RWOB 2Z30B 1W26A 2NUUG 3BO3A 2VZ9A 1CJTB 2OPPB 5T7LB 4TY8B 4A8YA 1X4DA 5HQ8A 3G8SA 3KHRA 1X31C 4MKYA 2XLIA 3DGPA 1TKDA 2MHNA 3KJVA 4FZVA 1CJKA 5LJ3Y 3EVOA 3TNVA 3GU0A 2FY1A 4R8UB 2IDEA 2WAQD 3KK2A 5K9FA 1IKVB 4A4JA 2AYMA 3HVAA 2NPIA 5J1EB 3HMJG 1IM4A 1H72C 1UA0A 1MWZA 3TZWA 4I67A 5A8KA 3JTNA 2LQ8A 1S1UB 2D74B 4CO4A 2G9OA 3SFUA 1LWFA 1RT3B 1WTFA 1HNVB 3W9JA 1WEYA 3Q0AA 3BGOP 2IM3A 2KYZA 2G0IA 2O1PA 1CEZA 2DNYA 4EEYA 4RW4A 2XGQA 2HWHA 2M88A 4MMOA 3RBDA 4LFBJ 4OYZA 1NDKA 1O0PA 1QSSA 3DRRA 1L3UA 2B51A 2UVWA 2RU9A 3M8ZA 5CYJA 3ISZA 3UFCX 5KAKA 5GAGI 4B3TF 1S1TA 4A8MP 4WYWA 3UDCA 4Q0BB 5KTQA 1SQEA 4LRDA 2DR9A 4X64F 4S0MA 2DKOB 1SJ3P 2ZEJA 1DAXA 2IRYA 2A2DA 1S5ZA 3CDBA 4EZ9A 2ZJQQ 2DNQA 2OELA 5HAOA 4KAIA 2WONB 2AQ4A 1WC5A 3G86A 3UDEA 1KKHA 2XLKA 2FTRA 3SIPB 1H7XA 1AXQA 1C0TB 3SMZA 2K7KA 5GAEU 2XY6A 2Q6CA 3PNIA 2HWTA 2A10A 2FZCB 3KJNB 3BSCA 3HCXA 2DGVA 4OJHA 3BO2A 3CJ8A 3FSXA 2CPFA 1HFEL 5DZ7A 1HQUB 3UWTA 5J2PA 3MUTP 1UVIA 1IBLJ 1HBNA 1Y9OA 4DX7A 3T6BA 1AZSB 3DOLA 5F8IA 1NJXA 2XS5A 1ZM9A 1TELA 5H9FK 2XMWA 4A8WA 3BM7A 3DDKA 2UV8G 2O3DA 1ZPWX 1T9UA 3WC2A 3C16A 3DOMB 4ZVQB 4NA3A 4IRDA 2LDIA 2H4WB 2MQMA 4Q45A 2WVFA 3EICA 2YH1A 1T3OA 2WCXA 1JLCB 3HLUA 3PIOQ 4X4RA 1M5SA 2ZE2B 3CCQS 4AD6A 2E1RA 2AYGA 3FFIB 1F9HA 4NLRA 5C24B 5J2MA 2R8JA 3UD3P 1Z1ZA 4GMKA 1XC9A 1VC5A 2OI2A 2VB6A 1NH8A 2UXDF 3AXKA 3DLKB 1HWIA 2G2OA 2RIJA 3UNGC 2JC0A 4ZVHA 4P52A 2WVCA 5GVQA 2B7BB 2E7WA 4MIBA 2MSSA 1X8DA 5I3PA 2YXLA 2Z8QA 2YNFB 3CXCR 4JI7J 4KGKA 4DQQA 2JEIA 5HO4A 2LCWA 4ZA1A 4C11B 1KHWA 4HACB 3WDOA 1M1HA 1SKWA 2RU3A
chains in the Genus database with same CATH topology
2DR7A 4K4UA 1CSJA 2LVWA 3J7Z5 5CYMB 4F02A 3C6TB 5E7OB 1RT3A 5K8OA 3SSRA 3SSSA 4G6VB 2GHPA 3CCMS 2VONA 1YJUA 2KRBA 1VLYA 1DFDA 3MPWA 3GFZA 2QZ8A 1MU2B 2OMLA 4X84A 4ECUA 1SIZA 2CJ9A 5DGAA 1U48A 1NK5A 3M2UB 1X5OA 1X5TA 3KYLA 3K5OA 4LF5F 4DR2F 2VUGA 4ED1A 2FLLA 1FKOA 2P6SA 1RTIB 5F3TA 2DGUA 5GADI 3NNHA 4YR2A 2C22A 4DS4A 3C6UA 2QA2A 3PHEA 1RT7A 2YNIA 2K2PA 4K5SA 4EFAC 2OIHA 4BBYA 5M2UA 3K59A 3BQ0A 1G2EA 3QO9A 1S1XA 1KLMA 2AD9A 3NMAA 5E2QA 3M2VB 2PEHA 1O8BA 1UEUA 2ZDPA 1FXRA 4C2MA 2J9DA 2ROEA 3W2VA 4XPCA 1UMJA 2W9BA 2A3JA 2UXCF 2HNYA 5J1PA 2ZVSA 3OV7A 4K2XA 5ADZA 4H4OB 3S8SA 3CCSS 4ECQA 2DCUB 1TAQA 3NBPB 1TAUA 3G6VA 2PA8D 2WSEC 2ZKUA 1ZBTA 2CFXA 1FK9A 3OL7A 2ZBCA 3CD6S 2HHUA 1B64A 4CO0A 2CQ1A 1X4CA 2PO4A 4RW6A 3C8YA 4N41A 2FJDB 4F25A 2B5JB 5G0RA 3DMJB 2I9SA 3MGJA 5L9NA 5KFMA 4QYRA 3I55S 2QO3A 3FNNA 4ICLA 2V4JB 3PJWA 1GXUA 2E7XA 1T05B 5DDPC 2OPQB 2BUNA 1HWLA 2VL1A 4WIIA 4XAKA 2F8MA 3CCVS 2R8KA 4V19X 2W4CA 1S9GA 4ZHRA 3KMQA 1VIOA 4TU8A 2V8VA 3KG0A 2CJKA 2O66A 4ZMMA 2HNZB 1E6VA 2B6AA 3MEEA 4WXWA 4B3RF 1HQEB 3MAQA 3LOUA 3QIDA 1TL5A 1M5VC 4JUZA 1HL6A 3GMGA 1N6QA 2YKMA 1W2IA 4YR0A 4J9LA 5D4PA 3F44A 4NL5A 3I56S 3VTIA 3U1LA 3MM6A 2YKNB 2WHOA 1NK9A 3Q2TC 1TK5A 1HHSA 5AXMA 2CPDA 5M2PA 3TAQA 5KFGA 3POTA 2WBMA 3IN5A 1Z2ZA 2H9ZA 2HGLA 2ZOGA 1SI9A 3HM9A 5K8NA 4WFBQ 3E3XA 1IR0A 3VAIA 2KDOA 4IR1A 3CCRS 2HYIB 2HS3A 2B0GA 1AROP 1SL0A 2GIQA 2OH2A 1N36F 1RT2A 5HROB 3N0VA 2AF6A 2OLWA 3EZ5A 5HLFA 2HLUA 1BWEA 2HMIB 4LJMA 4QU7A 3DFEA 5K8MA 1RT6A 2KB2A 1ZAVA 4EU0A 2WOMA 2JX2A 1IKWB 1R6YA 5E33A 3VAFA 1IBLF 3FEYB 4DR4F 1APSA 3MEGB 1BC6A 3PR5B 4HDGA 4Y6IA 2G1DA 3KHLA 3M30A 3G96A 4K4XA 4ZP8A 2KT2A 4DN9A 1T03A 3FEZA 1HNXF 1WELA 4OV1A 2PT0A 2DJWA 2R2TA 1R31A 3U1NA 5KFXA 3V4IA 1H2UX 1VC6A 4OJGA 2M2BA 3DI6A 4I6YA 4QIVA 4RNMA 3MOZA 2LEAA 1FDDA 4RW7B 5C25A 4WZQA 4C0OC 2BE2A 3M6VA 3I32A 2KT5A 5KT3A 3BZQA 4J9KA 4C7QA 5EGYA 2LLZA 2GV1A 1NNDA 2I5JA 4UOCA 4IR9A 2BV3A 3EPGA 1ZTWA 1R3NA 2N4DA 4NLVA 4OI1A 3SDEA 4AE5A 4N5SA 3V2UC 3KLFA 1SBRA 1R0AA 3GFHA 2E5IA 2DGTA 3MM7B 4Q43A 1OQ6A 1Q7LB 1BGXT 1HW8A 1LOUA 1UVKA 2BJDA 1MW7A 3MM8A 4YDXA 1KQFB 4ZPCA 3T1AA 4NWBA 3MM9A 2NLWA 1Q53A 4AL5A 1REVA 1Q8LA 1L3VA 3Q22A 5LL6d 2OFHX 2WK4A 3LP2B 2DNOA 2JC1A 3CDAA 4R5PA 2ZH5A 3BQ2A 3P96A 5I3QA 1VI7A 4Q8FA 4DSKA 3F73A 1JK9B 5KG5A 1SH2A 2DVIA 4H4KA 5KFDA 4URQU 3M9MB 1HWKA 2EFPA 2MSTA 4ELUA 3KOAA 2MQLA 1KOHA 5A0YA 1WI6A 5KG6A 3BGRA 3IRXA 1ZOTA 2AGPA 4I4BA 2YQ3A 4B08A 4DX8H 3UD4P 2FLPA 4NLWA 5HMWA 3OXGA 4HH1A 4DSFA 4O3SA 3NRBA 2VPWB 4N8NA 4USHA 3BSAA 3HPOA 3SSQA 2LQ5A 1K0VA 3TAPA 3TI0A 3PJXA 4LF7F 3CWJA 3H5XA 1HD1A 3G8TA 1U24A 3ZZUA 1Y5IB 4RW9B 3M8QB 3OFGA 2DIVA 2I38A 3RRGA 2R7XA 3HXMA 2ZNYA 1WHXA 3LP1B 2YKOA 4KR0B 1R8CA 2FC8A 2IM1A 4CNYA 2ZH2A 1KVIA 3K5NA 2D1CA 4FXVA 3K8WA 5A8WA 5AJ3F 4R25A 4BC7A 1DTQA 5KFYA 1WEXA 4IYQA 3OL8A 2BA9A 3CJ3A 3KWMA 4J9PA 3T1HF 4JI7F 1R7IA 1U1NA 1NK4A 4H4MA 2BZ2A 4XIUA 4IOBA 4DV6F 3IS9A 3KLHB 4ETXA 4IOCQ 4BS2A 5D6GA 5J2QA 1DLOA 3F56A 4IKAA 5L1JA 2RKIB 2XSFA 5KFJA 5CD4H 1KONA 2VD3A 5KOWA 2I2YA 2FJXA 3MR2A 2YKQA 2M5YA 4QR1A 5DJBA 4K4WA 4QWBA 3CF5Q 2FC9A 2KFZA 4JI8F 3KLGB 4NZ6A 2EBEA 2RS8A 2IHR1 1N5SA 3MMJA 3CJ2A 3HKWA 2FD2A 2W9CB 4QIGA 2W24A 3QZ8A 3B4MA 3H4BA 2UUTA 3V6HA 3E2EA 2ZH3A 3KHHA 3QGHA 2ZJPQ 5KT7A 3TUZC 4I2QA 3DM2A 2QV6A 1GTHA 5KG1A 2JVRA 2X1FA 4NPOA 3BDPA 2PMZD 3MR6A 4NYZA 4K0KF 2HZCA 3A1YG 1Y5LB 2GO9A 5KFZA 3DN9A 2XMUA 3IBWA 4NLTA 4Y3CA 3M2RA 3BDEA 3M8PB 1EETA 3KLIB 3HHLB 4NXNF 2FJWA 4DSLA 5T41A 5DM6Q 1I6JA 3J7ZT 2AYEA 3M1VB 2LYVA 3GYXB 3QAEA 3DCAA 2JL9A 3H2VE 4WE1A 4O3QA 4O23A 2VA2A 2MYFA 3P5TL 1VFJA 1LW2A 4L72B 4QIFA 3FJ2A 2HW3A 5FDLA 5HP1A 4B9UA 3G6YA 4F4YA 2D9PA 1NJZA 1D1UA 1JLEA 5K8PA 4ED3A 4LIWA 2VOOA 2KYXA 5BJRA 2OFGX 2VBYA 3EXYA 1KC8T 2XMMA 3VCDA 3RRHA 4WCEQ 4X4UA 1Z2LA 2W8KA 3GV5B 2BACA 2OAUA 4MAKA 2UVUA 2MKIA 3EGNA 3GZ7A 1ZAXA 3B4DA 3MD3A 2KFNA 4KT0C 3TRGA 4F3MA 4DN0A 1FKPB 3DLGA 4J9MA 1U6BA 4KGMA 4KRWA 2J7UA 3UQSA 5D3GA 1I94F 2JFDA 1BQMA 1HBUB 2RT3A 4ALZA 1Q82T 4KV8B 1HBMB 1JXEA 3B82A 4HHJA 4I69A 5HBMA 4Y2AA 3UDLA 5EDWA 3V81B 2J0SD 5IM0A 3PEJA 2E9RX 1S1WB 1N5YA 2CJQA 1VQ6S 3DYAB 3MHYA 4CT8A 3EGWB 3SYZA 4I64A 2FDNA 4OJ3A 2GIRA 4Y00A 1S7HA 2FJBB 2VC1A 4Q5VA 1S9EB 5GMKa 2H5EA 4XDDA 2PC6A 2R9LA 4DL7A 2C2EA 4F3OA 2KKHA 1TVRB 3DU6A 3OJSA 5KOXA 1FD8A 4ZVFA 1OSDA 4Q8EA 3IA0A 2B5JA 1VBZA 4RLEA 5CCMA 3IGVA 1LXNA 4DR1F 1WACA 2PA3A 1SUQA 2RF2A 4DV7F 1WTBA 3DDNA 1HI8A 2ZD1B 1TKXB 1UJ4A 1HD0A 2VODA 3S1TA 2Y0SD 3SCJE 4FVMA 4OQJA 1FF2A 2L3MA 4I2PB 2ASJA 1KSPA 2J6TA 1X9WA 3DLHA 4PCQA 2ZHBA 4B9LA 3CULA 2DISA 3LH2S 4XDCA 5IT4A 3DLLQ 5KT2A 2Y1RI 3LP0B 1X0PA 3OHAA 3AA8A 4HH0A 1K1QA 1Y00A 3I31A 4C8ZA 4EYIB 3SV4A 4ZCIA 3VAMA 3K5MA 3ITHB 1VQSA 2PSZA 2MPUA 3HDSA 4O3NA 4B3OA 2PDAA 4AFFA 3CEDA 3OR2A 1RT4A 1S49A 4X4SA 3NGDA 1DZ5A 3PEHA 4ELVA 2C3UA 4A8KA 1H2VZ 3OL9A 2HHSA 2XHWA 3THVA 2C2DA 1S6UA 4Y2IA 3N28A 4YHHF 2HHHF 2HAIA 3GFXA 1QLNA 3FCHA 4MYTA 5KFWA 2RQ4A 4H4KC 4WFYA 1X5PA 1UWBB 4KKOB 5LMUF 3M32A 1DRZA 3BS9A 5EN1A 1GNKA 1LKZA 1K73T 4QU6A 2PI5A 2BRKA 4QQBA 2CQ0A 1RT1A 2EK1A 5DG8A 3H25A 2IAJA 2D3UA 2DNMA 5I42B 1NKCA 4DL6A 3O2IA 5KFHA 3I0SB 4QWDA 5B0BA 5G4DA 1U1KA 1X4AA 4PG8A 4KB7A 3PZPA 1CPZA 3W3SA 4HL9A 4PPDA 1G3OA 2C42A 1HHTP 2B9XA 4B3MF 5LSRA 4NXMF 3DRPA 3FDSA 3PW0A 1JLAB 1N5VA 2DBBA 4RUHA 1FTCA 3OUYA 1M90T 2L41A 3TYTA 2MQNA 4DQSA 3VWSA 1S76D 4ECXA 2AP6A 2J9CA 4CH0S 4I1TA 1BQXA 1MROA 4LVOP 4QOTA 5DLFA 1DARA 3BGLA 1AFJA 2ZBIA 3NGKA 4JI2F 2KT3A 2AX0A 5CHCB 1ZM4A 4JV1A 5LXYA 1N5TA 2F8HA 1FNMA 4UUWA 2XMJA 3MMAA 2DK2A 1R89A 3I5AA 4O4GB 4OIXA 4A47A 2ZFHA 3NMRA 2YX1A 1GXLA 4MH8A 2GGPA 1HNZF 2J5AA 1XK8A 3MURP 4DR3F 2MZ1A 4OX9F 4OZLA 5F41A 3L09A 4EBCA 3OBIA 1H98A 4KIAA 5C5JA 1RTDA 2X1GA 1DTTB 4NLUA 2EFNA 1S6QB 4X2BA 3W7BA 1VRUB 3EYZA 1TV6B 5FD1A 1T02A 3UCGA 1XEZA 1YHQS 2WB4A 2EK6A 4IRCA 4HT7A 2RUGA 4IDKB 5DQGA 4FS2A 2XI2A 3IR6B 4YR3A 2IVMA 3N4WA 3DOKB 1WG5A 2HVIA 3M8RA 2YWGA 2VG5A 1HYSB 3CCZA 3CT9A 1F0XA 3OTBA 2DO0A 1PO6A 3MDFA 3U7JA 2CPJA 3IR5B 4YB7A 2COLA 2DNKA 4M8LA 1IKXB 2HNDA 4MJKA 1X4GA 3K7RA 3LAKA 2YWHA 3TAMA 4RUCA 3MUMP 2R8IA 2GMJA 4J9OA 2C3MA 4DLGA 2VG7B 1JB0C 3SXLA 3K5LA 4OMFG 4QJVA 4WU3A 2CPZA 4DHVA 3H98A 5L8RC 3C3LA 2ZZNA 4YB5A 4ES1A 2CYYA 4K4YA 2OO4A 2HHWA 2CQBA 2VFVA 3W2WB 3QZ7A 2CQGA 2YNGA 4DL0C 1EP4B 4EUVA 4EZ6A 1S1VB 4KFBA 1Y5NB 2PI4A 1F5BA 3M05A 4OI4A 3K0JA 1C1CA 3TVYA 2V4RA 5A8RB 2XB2D 3CJKB 3SI8A 2GC8A 1JLGB 2BABA 5FLXY 4DG1B 3VAGA 4PWDB 5KFUA 2LQ9A 4K5RA 3O1LA 2KG0A 2JLFA 3MD1A 1S9FA 2ZZMA 4Q7AA 3JSMA 1JMTA 4OI6A 4USJC 3DNCA 1MWYA 2VFUA 1X7VA 3L7OA 1U1MA 3A8EA 2K3KA 3R1HA 1E6YB 4DR5F 1L3SA 2O67A 4FF1A 2P5VA 1IKYB 1GT8A 3CB4A 2IMWP 1H38A 1DHMA 3VAHA 2OPPA 5T7LA 2UU9F 4TY8A 4R0JA 2MQQA 4RWWA 1L5UA 2W9CA 3IRWP 2LDYA 3CCLS 4CNZA 2O01C 2AX1A 5A2QY 2M3DA 1CLFA 4QIWD 4XO0A 3R5AA 3CMES 2HFNA 3LALA 1UJ6A 2J0XA 1X5SA 1FEEA 2UXBF 1FRHA 2LKZA 2W4DA 5JVGQ 4X4PA 2G4BA 2OD4A 2F9JA 2DGQA 2MQOA 1FRMA 1HA1A 1XMBA 2CQCA 5KT6A 5K14A 3WC0A 4UUXA 3MPVA 3E01A 1C1BB 2OKQA 3U1MA 4DF4A 3TW0A 2DO4A 2J7KA 3HI9A 4Y0FA 3H2LA 3D0GE 3G9CA 1S0OA 2GMHA 1SV5B 4NCAA 3N6NA 4G1IA 4R8UA 4DS5A 3TA2A 4GO7X 2BM1A 3G8QA 4QPTA 5IT0A 5I3UA 1IKVA 2R7RA 1K8AT 1LV5A 5J1EA 1QSYA 4MYUA 3R5CA 3CD5A 1AUDA 5B09A 1B0VA 2B4VA 4IFVA 2V94A 2DGSA 2FJEB 2GJ2A 2R7VA 3QGGA 3FZBA 2OTJS 2ZDOA 1S1UA 2XMVA 3LF0A 3R5BA 3R5DA 4JOUA 5A6WA 4MK7A 3TARA 4OZ1A 2ZJRQ 4NLSA 4DR6F 2HVZA 2OPRA 3C66A 5KFIA 2V4QA 4NCGB 4K4TA 3OVAA 2DRBA 2X51A 2JH3A 1TL1B 2HHXA 3G6XA 2E1CA 1FJGF 1HNIA 1TKTB 5KFAA 1U1QA 1FJCA 1VHFA 3SCKE 5H9EJ 4QW9A 3EXCX 4LFBF 4C3KA 4X65F 1RA6A 3AB4B 1HNVA 2MZJA 2E1AA 5AXKA 2OJ3A 3RW7A 3WZ0A 1VJWA 3DLEA 4KO0A 1C4AA 1OO0B 2EFQA 3ENQA 2ACYA 1BQNA 3KJVB 4NMLA 3UCZP 2AW0A 1HBMA 3H5UA 3J81Y 3V81A 1S6PB 4TU9A 2LXIA 2QRRA 4YB6A 3ZZTA 1U25A 5F8GA 2DRAA 2QA4G 4PXDA 2IC3A 3J7A1 4Y65A 3NS6A 4ECSA 2ATLA 1SJ4P 1S9EA 4EYHB 3I87A 5AXNA 2CPEA 2VV5A 2L9WA 3GV8B 4IH6A 3KK2B 1Y0HA 3V5RA 3KK3B 1ZZFA 3ENVA 2ALZA 3I5CA 1X9MA 1CQNA 1URRA 4PKDB 1RT5A 2XWYA 1YTYA 2UVVA 3NG8A 2VG6A 3T6JA 3OLBA 3GSDA 1UEVA 1YGYA 5B0GA 5A8KB 4DV4F 1NHUA 3D1QA 1N4LA 2MKC<