4PWYA

Crystal structure of a calmodulin-lysine n-methyltransferase fragment
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
250
Chain Sequence
b'GSVRRFESFNLFSVTEGAWVQYTSIFCPEYSISLRHSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCFLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLILTKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-lysine N-methyltransferase
publication title Crystal structure of a Calmodulin-lysine N-methyltransferase fragment
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 250
sequence length 263
ec nomenclature ec 2.1.1.60: Calmodulin-lysine N-methyltransferase.
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pwyA00
2ZBPA 2VP3A 1EAMA 1G8AA 2YTZA 3GCZA 2XYVA 3LKZA 3TKAA 3CBGA 4AX8A 2VZ9A 3GRUA 1YUBA 7MHTA 4LWPA 2O07A 3DMFA 4RWZA 1R8YA 1YFJA 1WG8A 3FPGA 3EVAA 3FYDA 4E2XA 3FUUA 3GWZA 4KIFA 1R74A 1QYRA 1XJ5A 1UIRA 2I7CA 3GIWA 5CM2Z 4AZVA 4PONA 1QAQA 4KDRA 5DM2A 5FHQA 4PYLA 3M6VA 5ICFA 4YUZA 5DM4A 2G72A 4P7JA 2BZGA 5C0OE 2ZFUA 4C05A 3LBFA 4X60A 2PV0A 2JHPA 2PBFA 1QZZA 3HCFA 1VPTA 5CVEA 2Z6AA 1M6YA 2C7OA 3A4TA 5GWXA 3CCFA 3I58A 2NP7A 4XUCA 3B7PA 5HIJA 3D2LA 5CD1A 4RTOA 1R00A 2G8NA 2ZLBA 3PTAA 2AVDA 5GM2A 4M36A 2YX1A 4GBED 3IV6A 2ADMA 3KQQA 1FP1D 3G7UA 1XVAA 4GOOD 3NVMB 2EJTA 2AOXA 3R24A 4MIKA 3A7DA 5DPMA 2XYRA 4C06A 5CCBA 2O05A 2ZBQA 3LCCA 3HCAA 2ORED 4R05A 3LGAA 4MTLA 5CIYA 1BC5A 3NWBA 4GOMD 1UWVA 1ZGAA 4QTTB 1YF3A 1JG4A 3P71T 3T7SA 5E1BA 1TW3A 4E30A 5T6BA 3BWBA 5DX8A 5HIIA 4GEKA 1QAOA 4FR0A 4Z2YA 4DQ0A 2G1PA 3AXSA 3SX0A 4FT2A 1XDZA 3IYLW 4AZTA 4CKCA 2ERCA 1V39A 3PVCA 3UJDA 2OZVA 3UFBA 4KW7A 5K0LA 3CJQA 3EVCA 4BP1A 4A6DA 3EVDA 3BGIA 3HVIA 3KQOA 2E5WA 3EVGA 4EMSA 4YUXA 4RTPA 5K0NA 3EGIA 4YUYA 4OBXA 5EEHA 2G71A 2UYHA 3HA5A 3OPNA 3I53A 5FUBA 1R6AA 5CVVA 1N7IA 4EKIA 2IGTA 3ANXA 3KR9A 5B1SA 4RTKA 3NJRA 5EQJB 5EHIA 1XDUA 2ONZA 5DRYA 2AN3A 5E9QA 2HV9A 2NXEA 1U2ZA 3DULA 2V74B 5JUWA 1AV6A 2K4MA 4DMGA 4F86A 1L3IA 2AOTB 1XXLA 4IV0A 4FGZA 5F2OA 4HTFA 3KPJA 3B3JA 3EGEA 4EQZA 4ER3A 2QM3A 2VDVE 1NW7A 2GAFA 1X1AA 3LL7A 3OU2A 5DX1A 5LQNA 3BGVA 2EFJA 3CC8A 1X19A 4HC4A 3LCVB 3UJCA 4ATNA 3OE5A 4P7KA 4POOA 3LECA 3KQYA 2AOVA 3DXXA 3O31A 2Y1WA 4KDCA 3HCEA 3G2OA 2ZVJA 3GGDA 5EZQA 5HFJA 2OYRA 1KHHA 2WA1A 3HVHA 3REOA 4RVFA 1H1DA 3TRKA 2FK7A 3EVEA 4BLWA 3LX6A 5E1OA 2IDJA 4HRAA 5EMKA 1BOOA 5F2KA 8MHTA 2PX8A 2HWKA 1NE2A 4KIGA 3SR4A 2CKDA 3TLJA 2FYTA 2ZULA 4GUAA 2GLUA 3ORHA 3FPEA 3UJ9A 4CWAA 5K09A 1AQJA 1RJGA 5CUQA 5T64A 2OXTA 1L1EA 4L7VA 1F38A 3X0DA 3GRZA 2ZWVA 3MERA 1Y8CA 2FRXA 3FUVA 4A6EA 1YFLA 1YZ3A 2NP6A 3A25A 5LSAA 1NBIA 2PT9A 4HGYA 3KU1A 3TFWA 1SQFA 3K6RA 1BKYA 3DLCA 1SQGA 3P2EA 1PRYA 1VIDA 1XTPA 2UYCA 4PYNA 2P41A 3DOUA 3EEOA 4E70A 3FUWA 2OO3A 1I4WA 1FJXA 4RTRA 4X63A 2BH2A 5GP1A 4ZTBA 3GXOA 3MGGA 2A14A 2JH9A 5CVDA 4E2YA 1G8SA 1RJDA 4IWNA 4PIMA 3MQ2A 4GOLD 4RVDA 5EIFA 1M6EX 4RX1A 5EPEA 5EVJA 2P35A 1ZG3A 3JWHA 2ESRA 3VSEA 5EG5A 3FTEA 3OU7A 4C07A 1XDSA 3GJYA 3UA4A 3B5IA 3MB5A 4Y2HA 2OBFA 1R18A 4CKEA 3LDGA 4IV8A 5DM1A 4P58A 1DCTA 1B42A 1X1DA 3DLIA 5K8VA 4RVHA 1D2GA 2AZTA 5D1HA 4CTKA 2C7QA 5DWQA 2V7EA 3RIEA 2KW5A 3FRHA 2AOWA 4LWOA 4FP9A 3HTXA 3DXYA 2GA9A 3C6KA 3I64A 3OZSA 3HCDA 4LECA 3ERCA 3IHTA 5IH3A 3PLAE 1NV9A 3DH0A 3SMQA 3THSA 4LG1A 5K0CA 1VL5A 4ER5A 2R6ZA 5ICCA 1NV8A 1AQIA 4HG2A 2I9KA 1DL5A 4OQDA 1Q0TA 3HA3A 3GU3A 5FULA 3LHDA 1IY9A 3PFHA 2YXEA 4PYKA 4QDJA 4U7PB 5DXAA 1MHTA 2GB4A 3AXTA 10MHA 2YUIA 4JXJA 4HTFB 4X61A 5HIMA 1M0EA 3BWCA 2FCAA 4DM3A 1NW3A 2OY0A 4EKGA 4P7GA 5EZSA 4RTLA 3UBTA 5LQAA 2R3SA 2VS1A 4E33A 1WZNA 4P7FA 5DRTA 3THRA 5E2AA 2UYQA 2AN4A 3SSMA 3CGGA 3R9XB 4R6WA 1NW8A 2EG5A 4RTMA 4PNEA 3AJDA 3NW9A 3MTEA 2XYQA 4QQKA 3FYCA 2PGXA 3R3HA 2PVCA 3TOSA 3MHTA 2QE6A 1G60A 3HNRA 5EC8A 3LDFA 1Q0SA 4FSXA 2I6GA 5BW4A 1O9HA 2HTEA 3NMUF 2FK8A 5EHGA 2UZ4A 2AOUB 1L3BA 3CJTA 2QYOA 3U81A 2QY6A 2GPYA 3EPPA 2UYOA 1WXWA 4HSGA 5HILA 3A7EA 3T7TA 5K03A 1NBHA 3AY0A 4YV0A 3KQVA 1L9KA 5LQCA 3SGLA 1L3CA 3JWJA 5K01A 3BKXA 3BUSA 3WSTA 4CTJA 3M6XA 2ZZMA 1T43A 2NNWB 4OA8A 4M37A 5LQKA 1JSZA 4EK9A 2CL5A 3HM2A 5DT2A 1AF7A 5EMLA 5EIWA 3RW9A 3TMAA 3P9NA 1G6Q1 1O9GA 4GF5A 5K0FA 2H00A 2YXLA 3ELDA 4QDKA 3G2PA 5FWAA 3ME5A 5FCDA 3ELWA 2BR4A 3B3FA 4DF3A 5K0BA 2CMGA 4PYQA 2BR3A 4YUWA 1N2XA 1QAMA 4PYIA 5MHTA 3KPYA 1JQ3A 3KQTA 1JSXA 3HVJA 3O7WA 2WK1A 2PT6A 3KPUA 5H02A 3KR0A 5FA5A 1KYWA 3EMBA 2IP2A 2ZIEA 3EVFA 2PX2A 4GOND 4PGGA 2C7RA 2NXNA 5JR3A 4RTSA 3QV2A 4GC9A 2XBMA 4NECA 2PY6A 1VP9A 4XUEA 1RI1A 4O29A 1SUIA 3R0QA 1SG9A 3FTFA 4XUDA 3GDHA 5EKUA 1RI4A 1KP9A 1DUSA 3TKYA 3KKZA 4K6MA 4PYMA 2ZCJA 1NW5A 2I62A 4PCAA 3FUTA 1G38A 3MCTA 1WXXA 2AOUA 3BWMA 3OE4A 1JQDA 4QQNA 1EJ0A 1TPYA 3TM4A 5LQJA 2O57A 2N47A 2FHPA 3DMHA 1X1BA 4R8RA 4ER0A 2B3TA 4YMGA 2P7IA 3KHKA 1F3LA 5GOZA 1IM8A 3C3YA 1VLMA 5ICGA 1P1CA 3CJRA 4FS8A 1KIAA 1TW2A 5KQRA 4AZWA 2QRVA 3TPZA 3G8AA 1ZGJA 1BHJA 5G02A 2IH4A 3HP7A 3NVKI 2IDKA 2Q41A 2ZBRA 2WA2A 2PXAA 1INLA 1WY7A 3KQPA 4H0NA 4CXMA 2ZTHA 5EGSA 3SVZA 1XCLA 2YVLA 4DKJA 3ELYA 3DP7A 4DZRA 3G2QA 2YXDA 5ERGB 1ZHFA 3PT9A 1I9GA 2JH8A 2Z6QA 3UJBA 1KYZA 5BXYA 3I5UA 3E05A 1P1BA 2NXCA 4FSDA 3T7RA 1KPHA 2AR0A 4E31A 1ORHA 2Z6UA 4M7RA 5BW5A 1JR4A 5EKXA 2EJUA 5E1MA 4GC5A 3G5TA 2PX5A 3FPFA 3EGVA 3BZBA 3P9CA 3ER8A 5CCXA 3HEMA 5FTWA 1VP3A 2DPMA 4YV2A 2FPOA 2JHCA 3P2KA 4BY9E 3A26A 5DTRA 5LR6A 3OFJA 3UJAA 1IXKA 2PSSA 3C3PA 2VDWA 4R6XA 5ICEA 3K0BA 1KPGA 3JWGA 2F8LA 3UJ8A 4MWZA 4E2WA 2P7HA 1NW6A 2Y1XA 3GRYA 1D2CA 3PB3A 4C04A 3MCZA 4RVGA 5E2BA 3F4KA 1O54A 4C4AA 3ER9A 1RI5A 3GRRA 4DCGA 5HZMA 1ORIA 3FTDA 5KQSA 2B9EA 3M33A 4IKPA 3TQSA 3SSOA 2IBSA 4Y30A 5DXJA 2BM9A 3GRVA 3HVKA 5GIPE 3H2BA 5U4XA 3B3GA 2IH5A 2ZIFA 2G70A 5K0GA 4V0QA 2NXJA 2B2CA 2B25A 2IFTA 3E23A 3UWPA 4RTQA 3HCCA 4V0RA 1QANA 1ZKDA 3G5LA 2GS9A 1YB2A 4BP3A 3G89A 3TM5A 3KR1A 3MTIA 1YZHA 3BGDA 3QOWA 4M38A 2PLWA 1HMYA 5DTMA 3EEYA 3LDUA 4KVZA 3RODA 3TR6A 3BKWA 3R6TA 4PYOA 2EX4A 2VDUE 1OR8A 3UJ7A 4E2ZA 4WVLA 2O0LA 3LSTA 2JJQA 1G55A 1EG2A 4HGZA 1EQAA 1UFKA 1VQ1A 2ZW9A 2P3OA 5EMJA 1RI2A 3L8DA 3Q87B 2JG3A 5FHRA 1SVUA 3OCJA 4X1OA 5K0EA 4RV9A 5CVJA 3ELUA 1N7JA 2NYUA 1KR5A 2ZSUA 5HOQA 2IBTA 2AS0A 1FP2A 3PS9A 4B17A 3NDIA 1I1NA 3KQMA 2P3LA 5M5BA 3P9IA 1SKMA 2PWYA 4C08A 4QTUB 1JTEA 1EJ6A 2PWPA 3A27A 4GQBA 4BLVA 2XVMA 3T0IA 2GH1A 5LQUA 4R8SA 3M4XA 2QRVB 5HIKA 5K0JA 3DUWA 3G8BA 2PJDA 3FRIA 3E7PA 4X41A 4RYLA 5E8JA 5EMMA 3QOXA 3OU6A 5D1NA 5EEGA 5DLYA 2PXCA 4AZSA 2HR1A 4BLUA 3IEIA 1KPIA 5E9WA 2ZIGA 3NWEA 5F2NA 4OX9Y 3FTCA 2YR0A 3CVOA 2OKCA 4XCXA 3JWIA 5EOVA 3EVBA 5DM0A 2B78A 3VYWA 4KWCA 4UOEA 5GIOE 5GM1A 2ZWAA 3LBYA 1ZQ9A 4G56A 3GNLA 5GINE 2H11A 2BM8A 3C0KA 4QVKA 3DTNA 2IIPA 3G88A 2IPXA 2PX4A 4PCLA 3CKKA 2PKWA 3PX2A 4MQ4A 3KQSA 2HNKA 2BR5A 3AWIA 3O4FA 3OZRA 3HA7A 4PGHA 2ZZKA 3OZTA 3P2IA 2OPBA 2JHAA 3PFGA 4CKBA 1MJFA 3DMGA 5HEKA 5CVUA 3BWYA 3EVZA 5DTQA 4EVIA 3M6WA 2P1DA 1VBFA 4HH4A 3FPJA 3KR2A 4OQEA 4E32A 5T67A 5FA8A 3V8VA 1JG2A 1FPQA 2AVNA 1FBNA 4OA5A 1NKVA 3EMDA 3UZUA 4F85A 4YUVA 3G2MA 5KYGA 3KQWA 5E1DA 3SSNA 2LD4A 2P3QA 2PXXA 3BXOA 1Z3CA 4QPNA 3UA3A 3VC2A 4WXHA 2OB1A 3E8SA 5DX0A 2IH2A 4PYJA 5BP7A 2OB2A 3P9KA 4QVGA 3VC1A 4FT4A 5KVAA 2CMHA 5E9JA 3KPVA 1JG1A 5P8WA 3Q7EA 4PIPA 2XVAA 4AUKA 3OFKA 4RTNA 4RSRA 2DULA 1NT2A 1XCJA 4ER6A 3P97A 1KXZA 3B89A 1X1CA 3GO4A 4RTJA 1R8XA 1RJEA 1WS6A 3NDJA 9MHTA 4KRGA 5FQNA 4PINA 1HNNA 5FWDA 2HMYB 4YV1A 4FZVA 3FPHA 5IKMA 5LQRA 3LKDA 5FADA 3M6UA 2C7PA 1P91A 4PWYA 1VE3A 4F84A 4ER7A 1RI3A 3BT7A 3NTVA 5DSXA 5C9ZA 3FZGA 2H1RA 1RJFA 5FQOA 3SM3A 4DCMA 2AN5A 5C1IA 1D2HA 2YQZA 1PJZA 5KS2A 2P8JA 3LPMA 2O06A 3PX3A 4YMHA 3DR5A 1JTFA 3HCBA 4C03A 5K05A 3FUXA 3C6MA 3ID6C 3V97A 2AOTA 4QPPA 4MHTA 2CWWA 2P40A 3MAGA 4U7TB 1JG3A 4OBWA 3LCUA 5DSTA 1EIZA 2ZZNA 2ONYA 3DXZA 3I9FA 4ISCA 3M70A 3UJ6A 1JQEA 1P39A 5E8RA 3SXJA 4DA4A 1SUSA 3P8ZA 3S68A 3KPWA
chains in the Genus database with same CATH superfamily
1J2TA 2HA6A 2ZBPA 3GMIA 1JQAA 5I5GA 1ZCAA 3NDRA 3VR3A 3G0CA 3JQDA 2XZOA 2XGOA 3I73A 3AVXA 3CR3C 1NMQA 4KV7A 4GI7A 5HKKD 3ILSA 1ACLA 3K3PA 3SC4A 3HE3A 2E3JA 3TPFA 3E61A 1RZVA 2DFPA 2CYCA 1H0RA 4FE4A 5F77A 1NOIA 4D82A 4EW3A 4LGMA 4AZVA 5CDHA 5EYPB 2V6BA 2KX7A 5HG0A 3RTAA 3D4IA 1Z06A 3JX9A 2WJ6A 3I32A 1EP9A 1TAUA 1UBCA 3QU2A 3QU5A 4DCPA 3ZD7A 1P62B 1OASA 4OQPA 5KTKA 1JT9A 2B6NA 1X1SA 1WNTA 3RVSA 4CCWA 3JQEA 4L6CA 2PV7A 1OZHA 3V8PA 2WW8A 2G9NA 4PAWA 2EIXA 1N3LA 1MJGM 2POQX 1SC3A 5TEWA 2G9QA 3WC4A 4QT4A 3AOGA 2D0OB 1LS6A 2JKZA 3PJEA 1OXMA 2AG0A 5A3RA 1IJEA 7ABPA 1OH6A 2HIMA 3LT4A 2W2LA 2ZRPA 1AUOA 3CV3A 2DBVO 3VZPA 4IILA 4MTLA 2XCQA 4KXQA 4FBGA 2WKSA 2ZSFA 3FR8A 3P71T 4LYGA 2W6IA 1GRQA 3COWA 4LHVA 3W4KA 4FYHA 2FZ5A 5C8YA 4CMCA 2R6GA 1TQHA 2H5EA 2PRJA 3B48A 3BHIA 3E9YA 3AXSA 1YJCA 1DBWA 3NM4A 4R4JA 3LKVA 5IHPA 2ERCA 1V39A 3FJ1A 3ITEA 4MJXA 2Q7XA 4KW7A 2IEBA 5EIBC 4EPWA 1RHQA 1WO8A 3AY7A 3HS3A 1P75A 3L7MA 1ZI9A 3BGIA 3ND6A 4M99A 4X91A 1KDZA 5F9FA 1XJWA 4A2PA 3LQ4A 4CEJA 4JSTA 1JFFB 3O2NA 1MJ5A 5TE9A 3VH4A 1Y3AA 4QA9A 4XRGA 2ZWIA 2PUFA 4B3IA 1JG6A 1DAEA 1X8XA 4BMYA 3H16A 4FCWA 5AJTA 5BMVA 3JD3A 3VC3A 1XOIA 1YVUA 1XAJA 4PO8A 4PZEA 4QE3A 5LU9A 2JZOA 2QN8A 4Z4IA 3DXFA 1E3SA 4BUZA 2AN3A 2G77B 2Q28A 3VDQA 1MA0A 4J07A 4F3YA 2XSZD 5HGXA 5AI6A 1H6BA 4QLBA 5B4TA 5CLJA 4KPGA 5L3QA 3QTBA 1Y8QA 4MVXA 4MHOA 2QD5A 3JWEA 2Y1KA 4KPUB 3E1GA 3IT0A 4O2RA 2Q3MA 1QHSA 1O2DA 2FSGA 2J87A 4U7FA 3ZVRA 4DCTA 3P2OA 5A3JA 4ENVA 2ZJFA 3D2BA 4QDZA 1VHLA 2K5UA 1RLUA 3ZIAD 5LQNA 1GQFA 2GBLA 2WT4A 3WFZA 1Q0PA 2P6OA 1ND6A 4DLZA 1MV5A 2VQEB 3O94A 3HCEA 5D3ZA 1HV8A 5EKTA 1GXSA 5EZQA 3F2IA 3MD9A 1ZK3A 3IUMA 2JHGA 4KQXA 2O48X 5EXTA 5BN1A 2O50A 2HWKA 3LRXA 1WRBA 1VZ3A 1Z25A 2E1PA 2H17A 4TV8A 4DKXA 5IDWA 2ZULA 4G0YA 1I3CA 5B3AA 1B6SA 1U80A 2D2IA 2PUAA 4N7MA 1F38A 1UF9A 2LBPA 2EZTA 1SCQA 2FRXA 2QY9A 3MERA 1NU8A 3QYJA 4LISA 1KBZA 1MQ9A 1QX4A 2XW6A 3H9CA 3KOYA 4HB2A 4WCFA 3S6JA 3BZUA 4H3HB 3MSCA 1CEQA 2G9VA 3CX4A 4IZOA 1ZM2A 4QTXA 3TOVA 2M1XA 4M22A 1QUFA 3ZDZB 3DOUA 1JU9A 5BORA 3WNCA 1FJXA 5EN4A 1R3UA 2YDYA 3QVLA 4L3OA 5GP1A 4H31A 1NVFA 1ZXLA 2JJYA 2WIAA 3TE6A 3EDYA 1LUAA 3HC7A 4I9UA 3O38A 4IFEA 1OXSC 5CLGA 1EK2A 3DCJA 4TXMA 2D1FA 3O75A 4PIMA 3AEQB 3OIGA 1M6EX 4KAFA 4FFLA 2UUBB 2ESRA 4RANA 1D6NA 4LS3A 5EG5A 2QSYA 1GTZA 3D54D 3ITKA 4FFVA 2ZJ1A 1GITA 1R18A 5ARBA 4H7FA 5DHUA 1XP8A 2PZ8A 4OHYA 4GR4A 3C7DB 1T5DX 3F1KA 3HYLA 3RE1A 1OBOA 4BX0A 1YA6A 1Y5NA 1WB9A 1YS2X 2FOIA 1P4AA 1PR4A 2NGRA 4J43A 4BUCA 1ZVKA 2FMHA 3TLKA 3JD0A 3HXTA 4RS3A 5A62A 2HWWA 1PEDA 4ZN6A 1Z15A 2HA2A 1RWPA 1Z7BA 3JATB 4DRXB 1NV9A 3IPLA 4YRRA 4G01B 3SMQA 1NQUA 3A6GA 4WIAA 4NYMR 5IULC 3HFRA 3QQ5A 3GVXA 1ZGHA 3S99A 4XIGS 3ZIDA 2H5IA 1PZXA 3MS2A 4DWVA 4JJKA 2VTDA 1GG8A 5IAAA 3V4SA 3QF4A 1QFXA 3IDSA 1KDVA 3L5KA 1P60A 1RM4A 1OWPA 1YWGO 2YXEA 4U7PB 4BBJA 3BGWA 1VLQA 3RF7A 4BVAA 4H1HA 5E6SA 4CL0A 2IW1A 4JJ8A 4BRWA 1UOPA 4B2YA 2QAIA 4YFVA 4ZREA 2RFLA 1DO8A 4FKBA 3G0IA 3QI7A 1AD2A 2Q5JA 3NHZA 4YYZA 5D5PA 1A8HA 1P9OA 1LRKA 2ZT6A 3FOAA 3QYFA 3PSHA 1JIJA 4QRHA 4W8OA 3VOBA 2PVCA 3MHTA 4JXKA 1NC1A 2FPKA 3Q5DA 1S2GA 2PSFA 4YP9A 3KZKA 5AK4A 5FUWA 1C80A 1VYUA 1EK1A 4GYWA 1IMJA 4YXWD 5LZ9A 4UXIA 1AKEA 3R23A 5EJ9A 2QYSA 1G21A 4ZQGA 1KYYA 2J3HA 3J7TA 2HBZA 5CFPA 3Q10A 3T7TA 2E4AA 4P2BA 2ODAA 2J5XA 2IXAA 3WJ2A 4S0XA 3WWDA 1YRYE 2RC6A 4CUJA 4BRZA 1T43A 1NJ5A 1Y3DE 4OA8A 4C6TB 2PKXA 2CL5A 2XNHA 3HM2A 3REQA 4BMZA 3T5CA 1NBME 2KSQA 3GEHA 1DBIA 3WOHA 4ENPA 1V8PA 3QVGB 4NCNA 4RMGA 2RHOA 4KE9A 4G8CA 3G2PA 3UFXB 3U4AA 3JQBC 2Q46A 1GWNA 1T4CA 1VBKA 1YBMA 2LWIA 3PPYA 1EXVA 3OF2A 2XDAA 4I1RA 1GZ5A 4HR7A 4PYIA 4X6XA 5EQFA 3T06B 3TO5A 3VR6A 4F9GA 1HY3A 1JSXA 4MULA 5C3UA 2GRJA 4FCCA 3ENKA 1IZ0A 2PFSA 3BXZA 4GYJA 1WIWA 4LHXA 4OK5A 4PGGA 4ZVQA 3I72A 4EEZA 2O2HA 2GFHA 3IS3A 3NHFA 4URHA 1B14A 1NPTO 4BNNA 1KO4A 1S7CA 3DLAA 3IUEA 2QD2A 3GN2A 3GBPA 5FEMA 5TB5A 3TZKA 5CVTA 4Z6KA 2G5GX 4WOBA 2X7JA 5DCLA 1NFQA 4MCAA 3OPVA 1TYZA 1DXHA 3TJMA 3VPDA 1W6UA 2YMMA 3THXA 5JJLA 3KNZA 4LHWA 1B6GA 3ICWA 3ENVA 1LLFA 4LSGA 4KB5A 4Q9AA 1YCDA 4GLBA 3H8JA 4Y2PA 1SG6A 3L7DA 5TNXA 3FLBA 4US1R 2OQRA 2W9XA 1MMFB 3DMHA 4K9QA 2IPLA 1MRZA 1OF1A 1W2WB 1ZGCA 3CNBA 4I3GA 4R8RA 1RR6A 4EARA 3GFRA 3OTQA 5LMNB 2XY4A 4IXMA 4EL5A 1NXQA 4L8GA 4S35A 5KNDD 3Q3CA 4AZWA 1UOEA 2VYQA 4TTPA 1SJ9A 3SQNA 1RBZA 2PZEA 1NMZA 3H75A 3KRTA 2ZBRA 2WA2A 3KJQA 3JVEA 3MJVA 1W0CA 3GLFA 4I8DA 1P2BA 5LA6F 5EGSA 2INGX 2HCJB 2KQUA 3DP7A 3DMTC 3MSXA 4TUYB 5L7TA 1GZVA 2HCRA 2V97A 3F96A 4NATA 1E0KA 1PV1A 2AF4C 3PT9A 4FE7A 1QF7A 1MEOA 1T9DA 2YWDA 3M83A 1A96A 5IDYA 4F8EA 5JY6A 3L8EA 2DFKB 4PICA 5JYDA 3W2HA 3N53A 1NMSA 2WIGA 2XGSA 3H17A 1MX9A 3UPUA 5K8CA 3PWTA 3JQCA 2JIDA 4G4SP 3CVYA 2A9OA 5B3LA 2HA7A 2JAHA 2X42A 4GRIA 3SDBA 4RVOA 1ID8A 4BKMA 1EGVB 2MSDB 2O0JA 1YDMA 2VP6A 4CKWB 4V0KA 3OPYA 3OZFA 4YMVA 1PO7A 1IXKA 5ICEA 2Y67A 4HDNB 4NS1A 1KZHA 4Q3CA 5LZ5A 1UBJS 1SXHA 2OP1A 1E3MA 2J3LA 1Y5MA 3D2CA 3IJRA 1PYOA 2DPYA 2HLNA 2WU3A 4HLNA 3GRRA 3H2ZA 3SR0A 4IKPA 1B1AA 2JA2A 2QRUA 1AK2A 4S24A 5DXJA 3RUDA 2JI6A 5WRFA 3WK4A 3H2BA 2DHEA 2ZBUA 5U4XA 3SX2A 3KHTA 2WMOB 4GBJA 4I9FA 3UB4A 2QAGC 2XITA 3F5MA 1X7ZA 1N2OA 1XMPA 1LDYA 2PMDA 1DQZA 3EEIA 3G5LA 4H2DA 5CPBA 4BV2A 2H1OA 1YS1X 2P9CA 2ZB3A 1JEAA 2HBYA 5JS8A 1Q0HA 2A3NA 4JLKA 1L8AA 5CU7A 3UBMA 3ZWOA 1EUQA 4UBIA 1E7RA 2AXPA 2ZJBA 5CTJA 3H99A 2ZYUX 4UQPA 1HFWA 4JLBA 5AKHA 3GCGA 1BWQA 3A1CA 2C2HA 3UJ7A 2NIPA 2E6UX 2Q8PA 4Q9KA 3TCKA 1V5IA 4CU2A 3IAAA 2VJAA 4ISBA 3RIHA 4HLUC 2E4ZA 2ZW9A 1A9YA 3PWZA 3AEXA 5LYJF 2NO1A 4O2BF 4PZAA 4CKBB 4P08A 1AGPA 3JSXA 4MHSA 3JQ7A 2BN4A 2BGMA 1HQYE 4UNNA 1LF0A 1NXSA 1ZMXA 1DUVG 1XBTA 2G88A 2WDPA 3PQDA 5AJUA 1KOLA 5HQ3B 3KO8A 4MAAA 1DZIA 1AMNA 4B17A 2CBZA 1GTJ1 1N0UA 4J1NA 4CRWB 5ITZA 1BTOA 1N25A 2LCQA 4FDMA 1QNLA 4KX3A 4RXMA 2PWPA 3P19A 1EFKA 1U7PA 4JROA 4O4LA 4PSAA 3FSJX 4PSVA 4RAQA 5AK3A 3QIVA 1Y34E 4Q4CA 6Q21A 2C77A 2AKEA 1T8RA 3QVMA 1Q91A 3Q8KA 2FN7A 3G8BA 2ECQA 3ZWVA 3ZLUA 3QXJA 2P6UA 4I2NA 2Q5IA 3KDSE 1C50A 2V0CA 2Z5LA 3B6KA 3NNSA 1IJBA 4RPGA 3ZGVA 4UPEA 3DOHA 2D4HA 4H7PA 1EUDA 3ITNA 4DFDA 3RTCA 2QTGA 3B36A 3D6VA 3LU1A 4UU1A 3COZA 4CM1A 2RK4A 5TMDA 3FTCA 4PTLA 3CVUA 1QQAA 2DRIA 5ENDA 2H1WA 2I3ZA 3ROZA 3PIRA 1X38A 2X0IA 4OO3A 2BONA 2F90A 3T5PA 3ONEA 4TGLA 2FOXA 5H5JA 3ZX4A 1HR0B 3W79A 1BFUA 5ICSA 1DTWB 1MPTA 1SCIA 4CV1A 4ZYZA 1CUSA 4WY2A 4AM8A 3ZWCA 1UFVA 4DUPA 5I7EA 2RHDA 3TOXA 4NFLA 2I4TA 4Q4HB 3CKKA 3NNDA 3O3NB 4B32A 3H4MA 4BYGA 5KX5A 1JPVA 5FL3A 3CLUD 4H6PA 4J76A 5JCZA 4IG9A 3LPNA 3V7NA 1MJFA 2A5LA 5SZJA 4CLDA 4G5SA 4PVCA 1CZKA 3BWYA 3WGKA 4EVIA 5HRUA 3AHIA 3UJHA 1U7OA 3V8VA 3R8XA 3UUGA 3OECA 1YZVA 2HF8A 2HU2A 2MHCA 4KGVA 5DIFA 5EE0A 2XE6A 3C45A 5FAXA 1OAKA 2HRBA 3GZ4A 3OX1A 3GUVA 1YRLA 2IH2A 3VJKA 1SBZA 3VR1A 1GPDG 5E9JA 2A4MA 3NUZA 5DLQC 2AUMA 5EESA 4DA7A 5C81A 9LDBA 4LF4B 1XL0A 1ZW1A 3EIEA 1IBKB 3A1SA 1V3VA 1UJ5A 2CLEB 3P9ZA 1OVGA 3NC4A 4PHGA 2WUFA 3QY0A 3AVWA 1NF9A 2VWPA 4EA6A 3Q9UA 4LSWA 3B89A 3K0SA 1X1CA 4CIYA 1MP0A 2BT4A 1WS6A 2AFHB 3AERA 2AUNA 4TYWA 3CZ5A 4LOKA 3TXAA 1ENPA 1L5FA 3MWYW 1UWLA 2HMYB 4MVJH 3ADKA 1Z2PX 3JVDA 4FZVA 4Y0AA 1P91A 1LDNA 2VA8A 1RXIA 3ZI0A 3EOBI 2P5YA 3FAZA 3RC1A 2DQKA 1G0NA 5FQOA 1I80A 3UUWA 5H3CA 2AN5A 4JIGA 4XYLA 5KNBH 4QOEA 2ETVA 1EXDA 1T5HX 2O06A 1UBGA 2X9LA 3E1SA 5K05A 3OM0A 3MTDA 5I9TA 4NMHA 1JDNA 2EV9A 1OREA 2VHTA 3HBAA 4P8RA 4UTVA 5BN4A 4FFSA 5K4AA 4ESVA 3CM0A 5C35A 1GSAA 1Q1ZA 1HEIA 2PH7A 2PVSA 4CM6A 4RORA 3O8QB 2CNKA 4JI1B 5FUMA 4HNVA 3QKRA 4UAVA 1W44A 2P9BA 3KPWA 1QYWA 4BBPA 5IKXA 2V7BA 3E7WA 1EAMA 1G8AA 2AWNA 3I34X 1QYIA 3I76A 3L6CA 4I1UA 3WXBA 4DSUA 1JH8A 2R7LA 3B2NA 4ZCQA 4M1OA 3ZHSA 3GPLA 3DAYA 1PBNA 4RPJA 1FUIA 3CUSA 1J9EA 5TIIA 5BYAA 3BPSA 3CSSA 1LVHA 3PNOA 1IZYA 3RWBA 5HZMA 3AL0C 1F7VA 4YUZA 4Y2GA 3D0OA 2ZG6A 1WDLA 4YBRA 3P9SA 1FSPA 3K32A 5JNSA 3I2KA 4JVOA 5FA6A 5BN5A 3ZIUA 5HOEA 4YO8A 2BBSA 2ZPAA 1QKIA 3HLYA 2UVPB 5A3VA 9LDTA 3F6SA 4N65A 4RKRA 4H17A 4RWEA 3S7TA 3FMPB 3MTBA 2PZBA 4FKZA 3BBLA 1L4UA 3D2LA 3GUCA 4QXMA 2H3EA 2NV0A 3PTAA 5HMLA 1HDRA 4B46A 3UT5B 4EG1A 3DJFA 5AHOA 4AAYA 3O6VA 3DFFA 3MLBA 1X3LA 3FSGA 3O9VA 5AKYA 1YFZA 5I7AA 4UE2A 3PXUA 3M3HA 3PJDA 2VNHA 3C5WP 4D0GA 2X22A 5BWOA 4A1OA 3WBJA 1O5OA 4BWVA 2CZGA 4JVNA 5CCBA 1FTYA 2DQ4A 2X19A 4HGOA 1JW9B 4BQIA 1QK3A 4OGLA 1JN0A 2GWRA 1QBKC 4BTEA 1NNUA 1TW3A 5ITWA 4RDIA 1S2LA 1U9IC 3AUTA 3KWLA 2O6HA 5DX8A 5BSHA 1Y1KE 4TMFA 4FT2A 4ESHA 4NCAA 4TKVB 1KOFA 2LVBA 1JEJA 2AEMA 5AKXA 2GZHA 2PD3A 1ENOA 3EVDA 5JWRA 2FPGB 1CFZA 1VKNA 3JASB 4FE3A 5K0NA 1E9CA 4BRUA 2CVOA 3S2IA 4OBXA 2G71A 1XF1A 3OJ0A 3OPNA 3L4EA 3NEAA 4G1MB 4PQRA 4WVFA 5F2EA 5FKJA 5IK2A 3R7BA 3TRJA 3W8EA 3LLMA 4LCJA 2K2QB 4LDRA 5IW8A 4D0LB 5LP6A 4YC7A 4CV0A 4C3VA 4TLDA 4PCVA 3HR8A 3H1GA 5KZMB 4IJKA 4I8IA 2JATA 3PC8C 4I36A 4B7XA 1XQ6A 1AV6A 5COQA 3PK0A 2DY0A 4RSHA 5DCWA 2WAMA 4DLRA 1VKJA 1ULAA 2GZSA 2WJIA 1EDDA 4J9UE 4KACA 4YRLA 5KOHA 4Z9YA 5TPZD 4RHXA 4LUCA 5FLKA 3GUHA 3JYOA 1DG9A 3QFRA 4B8ZA 4UMFA 2BLNA 2Y68A 4CNQA 5JAUA 1Q2XA 3GBVA 3MD0A 1LSSA 4R2JA 2HJRA 2BKVA 2HU5A 2VT2A 3CZRA 5EJ7A 1FRFS 2RIRA 2W71A 4O4JF 4CGYA 3A2NA 3FHCB 3E9MA 3GT4A 2AQKA 4MYHA 1E59A 5GY7A 2Z83A 4P3XA 1XROA 3OEEA 4ZOLB 1SBTA 1L4GA 3LX6A 5I3CA 5CK4A 5EMKA 2ZAGA 4RQUA 4C0HA 1EFHA 1EBFA 4B3XA 3ZBQA 2WVHA 5BQ3A 1WLSA 2HEGA 1OTYA 3OFND 1WF6A 5DASA 4JVSB 1GNPA 4YAIA 1AQJA 3QMVA 1K0UA 3H5TA 4TYMA 3BG5A 3ASYA 2HXGA 3H3JA 1K0FA 3FUVA 2CC2A 4G67A 4QYIA 2R00A 4OB6A 5UKDA 2NP6A 3K0CA 1JIXA 3ND5A 3AUJB 1XD8A 1YAHA 2GBFA 2JLWA 3KJEA 4G36A 1H9BA 4ERNA 1FP4A 3TFWA 3ZCPA 3CZPA 2VIIA 3UWKA 4EO4A 4HLDA 3ZPXA 4YRSA 2BYTA 1VIDA 2CBGA 2HQRA 3W2TA 1CVIA 1YS9A 1U0BB 3R1IA 3JVVA 2QNRA 1DIRA 4LV8B 5J63A 2PZMA 4DEVA 4OHPA 3HZHA 2PUDA 3F90A 3N8NA 3SFVA 2C8JA 4ARZB 2M9MA 4JL5A 4KLRA 3SZRA 1P5RA 4I19A 2RB5A 3L0PA 3LBIA 2BTOA 3MQ2A 3S44A 1SUCA 4M9UA 1K6IA 1GG9A 1NR1A 5B37A 1G291 1HFJA 4LRTB 4CUZA 3GJYA 1GGMA 2YYZA 1ONNA 2FN9A 3GVIA 3OJCA 4MV6A 5EIAA 4EELA 5KNBA 2C29D 3ZC3A 1N6NA 3TN7A 1FNBA 3GFFA 4ZRNA 4IDFA 1CR4A 4H27A 1NJSA 4JHLA 3WL7A 2PZGA 1U5AA 4ZCMA 5K8VA 4KBYA 4LKOA 3MYYA 5JFGA 2CJFA 4Y6QA 2FUNB 1TMGE 2KPOA 3IOEA 5EUBA 4ZO6A 3P20A 2J4FA 6LDHA 1USKA 3EWNA 2ZB2A 4LWOA 2C8VA 2Z4TA 2JASA 3C6KA 1A97A 3ZWBA 4LECA 2X7XA 2CNWA 2I03A 4WN9B 1NG9A 5BSMA 1XLVA 2BKEA 3TLYA 3C3MA 4TL6A 4DV6B 1YR1A 2WHYA 3E7XA 4D92A 1NVWQ 3PVSA 3HDVA 4NWIA 3T9FA 5JZVA 3ZNQA 3QXGA 3VDRA 3L7BA 1L7MA 2NTEA 1EFAA 1HK7A 4EQ6A 5AQ1A 5C1OA 4ND8B 3NHPA 4QDJA 3RS5A 2R7AA 2HIAA 3WV4A 1Q14A 4IVQA 2YWCA 3HKDA 5C8YF 1O6FA 2Z2IA 2GRUA 2HV8A 4JZYA 1PG5A 4HB4A 1CZUA 4ND1A 4MI6A 5C5EA 2RK6A 3R7NA 3LK7A 5EZYA 4ZFNA 5J4KA 4C2AA 4EA7A 2WWTA 3ZGZA 4B81A 2HNBA 4C5BA 2H9AA 2OZLA 4LWZA 3RUEA 3PUHA 4A5OA 3KKEA 2XB8A 2C84A 1A2OA 5LXTF 1V8OA 2WFLA 1W7AA 2GILA 1ZUHA 5BMVF 2NUPB 1G8JA 4JJAA 4F4CA 1DDGA 1Z5NA 3L93A 4IXDA 2I6GA 3PHLA 1N6IA 5AI5A 5H0IA 1G5FA 4TV9A 3B1VA 5TQ2B 4ZI7B 4CETA 4GKVA 3DE0X 1ISMA 2DKOA 1Q22A 4J7XA 4HB0A 3DL7A 1F8YA 3QITA 4PC2A 2HFJA 4GOXA 1L5VA 1V1JA 1V5FA 3QJYA 5GJBA 1IXSB 1B0ZA 3P0IA 421PA 1EVYA 5B4UA 3NAMA 2Q3EA 5KQPA 4FFMA 5K6TA 5CW2A 3ZDCA 4EK9A 3JSAA 5KHLB 1M34B 1Z5ZA 2V0NA 4HPWA 3H65A 3FYUA 4GYKA 3GGOA 3MGBA 2QORA 3IESA 3RU7A 1YA4A 3I39X 3QTLA 1RCTE 5AOVA 5JXHA 1EP2B 1M2HA 4YWHA 1P7ZA 2D2FA 3DMPA 5JDCA 4JCCA 3QF7A 4ZODA 1O4VA 5FPKA 3PKIA 4URXR 4TV8F 1GU7A 2R0QC 1W4CA 1PX2A 1TM1E 4BMDA 1Q0LA 3Q6IA 1ZD2P 4YAJA 3KR0A 4A26A 1Z5UA 1NAHA 1K6XA 1L6RA 1ZH6A 1X7WA 3WRXC 3AP1A 5I01A 5JAIA 3VR0A 1CE8B 2EFYA 3E9EA 1Z56C 4EWLA 1WB4A 2XTAA 1GZUA 3BC1A 4IJWA 4IRXA 3LVQE 4WFQA 4ZYVA 3R0QA 1WULS 2J5QA 2K2WA 4J16A 5DOVA 2WTBA 1CS0B 1RI4A 1MXFA 1FTSA 4ZAGA 2PAFA 4IIHA 1TJ3A 2I1WA 3Q0IA 1RLMA 2FF5A 3DAOA 1KS2A 4G5RA 1RXCA 3CY6A 1EFRA 2CD9A 2ODWA 3BDVA 3DCNA 4TXHA 4CV2A 4EO7A 5EIBD 1RMYA 2Y9PB 2ZRCA 3G1TA 1OH7A 3F6BX 1PV4A 2G36A 1ARZA 3LPAA 3PEEA 1X1BA 1FMTA 2SECE 5F5LA 2MJLA 1CP3A 3U4GA 4NJEA 4MW6A 2PM8A 1DXQA 1TM3E 2GCIA 3K5PA 2F2TA 2H65A 3AV3A 5E4TA 3QXSA 2VTKA 2NZUG 2PYZA 4TT8A 4GPD1 1GZSA 5LP1A 4RELA 3HP7A 1H8HA 2Q41A 5ANRB 1NI3A 2AJLI 2WM9B 4MYRA 4LJSA 4TZKA 1IPHA 3WTBA 4BQFA 1II9A 2QIOA 2C9MA 1EP3B 2XWBF 4MQ5A 5JZMA 3BK7A 3SXUB 2PX3A 2Q21A 1KYQA 1VSBA 2VSXA 2A1UA 3EH1A 4UXHA 4JOSA 3TUIC 4D3YA 3D8RA 1HEUA 1T5TA 2BHTA 2IHVA 4MW7A 2RD2A 1SXQA 3OT4A 4G26A 3NP9A 3TLGA 2PGIA 2NXCA 3T7RA 4NRDA 5EWMB 3OTIA 3PE3A 3RKSA 2B9VA 1DEHA 4YGYA 4CEIA 4JP2A 2RE8A 4AZ0A 1SCUA 1I7PA 1K92A 2RG7A 4B73A 3W5DA 2HM7A 2DUJA 1F60A 3G5TA 3EGVA 1DFIA 4TS9A 3ER8A 4OG2A 4ZAFA 1N32B 2EZ9A 5FTWA 1NYQA 3SD7A 3DOCA 2HCTA 3QU7A 1A1SA 1L5SA 1Z35A 2XWSA 1IEQA 3GP3A 4D4KA 4FMCB 1D1TA 2XUOA 2PSSA 1GPAA 2GEJA 4GM1A 3PI7A 3ZJUA 3TQIA 4HQNA 3UJ8A 5ED4A 3OCYA 4MWTA 5CP8A 5DGHA 5DOZA 2Z1MA 3UQZA 3SSAA 4C4AA 1KK3A 1JDVA 3UPDA 3V00A 3NHUA 3I28A 3SSOA 5JJ5A 4LSZA 5BR1A 2VWHA 5TC4A 4KQCA 4D25A 4Y2JA 3KE8A 4D3DA 2F9FA 3FJYA 5E4FA 1SBHA 3HCCA 1ZKDA 1RWOA 1QE0A 2JJ2D 1XWWA 4OI1A 1AU9A 3MWKA 3SK0A 1KH2A 2HAEA 3W2EA 1O8BA 4BMNA 4B7ZA 5JNWA 4Q6BA 1XA3A 3D3KA 4XDGA 2G5TA 2AD5A 2IYOA 2ZVQX 1JDUA 2Q3DA 3WZLA 2C5SA 1R4NA 1Z18A 3F8SA 1S3FA 2QF7A 3VJMA 4JYBA 2G4VA 1RP1A 2QTTA 1DBRA 3GFVA 3MQ4A 3UJPA 5BSVA 4D5GA 4GLFA 1MABB 4BASA 2E9SA 1Q0ZA 2QG9A 3E03A 1OOEA 3P52A 1NVVR 3WLTA 1QIJA 1F4VA 4X95A 3WGZA 5ADWA 5C52B 4XD7D 1L4YA 1VSVA 1BXZA 4F2PA 2M98A 1XVVA 2P0EA 4QTUB 5EWLA 2X0EA 1HDZA 4F56A 5ILOA 1ETHA 3KXKA 4DDHA 1WW2A 2BJVA 4NU6A 1KK2A 3LFHA 4G0PA 1OAAA 1JBQA 3AG6A 2ASVA 5JE8A 2I1LA 5GGXA 2Q5EA 2YMLA 2JGLA 4C0LA 1TFRA 1GA4A 4MQBA 4KSBA 2I6XA 3W3ZB 4DC0A 3FY4A 5DLYA 3UQYS 5JQGA 1OB2A 1OLSA 3JARA 5E9WA 4LQLA 5KJEA 1ZS9A 1IQ0A 2G9UA 2XVYA 4ZKDA 1HDGO 2FFBA 5FX2A 3ESAA 2JLAA 3EVBA 3BL8A 4AO7A 4AI6A 4DJDC 2QU7A 1Y6ZA 3A3NA 3ENWA 3FWZA 1EDOA 4NENB 5DHTA 4D9BA 1DBPA 1QH1B 1ADBA 3F6RA 1AY0A 2XMRA 3CCBA 4I08A 5B55A 2NYVA 4KQ2A 4KQEA 4WDQA 1P4GA 1Z2OX 4RABA 1H1LA 4MW5A 3RWOA 4BN5A 2E2WA 1VA5A 3I6IA 3MS7A 3TBHA 5JIBA 2A9JA 5DXFA 4Z7NB 1PQ4A 2ZUEA 5J4LA 4MQ4A 2VOJA 1EEXB 2NN3C 1BMTA 3WL6A 4PGHA 2M1ZA 3C8DA 3OZWA 4REMA 4BPRA 1XRMA 2VT7A 3CRW1 2EFEB 3L6RA 5B1HA 1G6OA 5C80A 1OMOA 1AO0A 2R68A 3DNPA 1W30A 4HPJB 5TMBA 4AF7A 2AEFA 3RUAA 1YFKA 1A9TA 3R6DA 4QXQA 5AM5A 1GTL1 4DTIA 1T0JB 1OWOA 4FJ2A 1AK1A 1RS0A 3K6SB 1O4WA 3ZYZA 4B48A 2FLVA 1HC7A 4C7OB 1RNLA 3IELA 2NO9A 1B6TA 1GPLA 1XC7A 4U3JA 1HGXA 1OHHD 3CKMA 4ZGBA 3KPVA 3ZQKA 1RP7A 3ET4A 2UZ1A 3AX6A 4D4IA 1UDAA 4GKAA 3BIJA 1KI7A 4GFDA 1NT2A 1XCJA 1Y1QA 4KUEA 5ALSA 2QNBA 3RJZA 2Q3BA 1OH8A 1R8XA 4AWXA 3AVTA 4XH9B 2E48A 2JFUA 3O1HB 4KRGA 1BDIA 3PFIA 2JI8A 5ECYA 1UKYA 1IHYA 1USWA 1X13A 5HBGA 1CQIB 2FVXA 4LPSA 1UZAA 1ATIA 1Z16A 5KYTA 2A5JA 2DEUA 3NH9A 4PBSA 1OFTA 5EP2A 1ISJA 3DZIA 1A9SA 2HDNB 5E9AA 3VPAA 3UK0A 1QTRA 3WGMA 3WLAA 4OQMA 3IPXA 3R7WB 2AOTA 5AUNB 2X1HA 3L49A 3R7FA 4DARA 3QEMA 3FOZA 2CLKB 2P1ZA 3RAJA 2HSGA 1CQJB 1EIZA 2F1RA 2M6LA 2ONYA 3I9FA 2AHRA 3LIIA 5E8RA 3LUDA 1YBVA 2CLIB 3N86A 1DUIA 1IZZA 2JEOA 2DM6A 3S2GA 5SY9A 3MINB 2DHQA 1E3EA 3NETA 2JAXA 3FDZB 4EFMA 4EGCB 7MHTA 2PGOA 2E5FA 4CT5A 3DV0A 3ETCA 3RT1A 2TRSB 3WHKA 3WQSB 4I66A 4Q7EA 3VA7A 3D4PA 4D8YA 2GAIA 1L7DA 2GN1A 4OHCA 1QS0A 2X5OA 5DM2A 2QTNA 2BFPA 3VM6A 3OBIA 3V6MA 4O4LF 2Q6TA 1P0QA 3EASA 3GLHE 5AESA 2C8LA 4ZXFA 3UMFA 1CDOA 2EJBA 3IT1A 2RIPA 2C5AA 2I8LA 3VSCA 2CUTA 3LQQA 2Z6AA 4QFCA 3G2IA 1YZFA 3QXCA 3U9TA 1U0JA 3CO0S 1W47A 3STWA 2O9JA 5HIJA 5I47A 2IU0A 3R7LA 1LK7A 2ZLBA 1D6JA 5CDSA 2AVDA 4EY7A 3ELBA 4L3VA 1L8XA 3ZE2B 4P81A 4LBYA 5B2EA 5BWCA 1US8B 5DO9A 1AKNA 1N0IA 2VQFB 3DDNA 5CT4A 4YI3A 1GHTA 4Z5XA 3RU2A 5TF0A 1B1CA 2JBWA 1H42A 1ZL2A 2PUHA 2XYRA 3PC7A 4UVIA 4AP5A 3EB9A 1GR1A 4TWJA 4DV2B 5I7RA 4MV4A 1TM4E 2DBYA 1O9BA 1SOVA 2QMHA 3A1VA 3KVYA 3Q3EA 3X2EA 5BT8A 5E1BA 3PUWA 1KEPA 4OTZA 3QFHA 4C5AA 1G59A 1XWIA 1MB4A 3BWBA 3VKWA 3BULA 3DS8A 5DP1A 1BWSA 5KX5F 5IXYA 1RZRA 2V7WA 3UJDA 5DBHX 2OFWA 2OZVA 5BN3A 4FHEA 1BD3A 3I5YA 2P2LA 2QX9A 1WABA 4FONA 1Z4IA 2X58A 1W48A 3EGCA 3V8RA 1EQ2A 1N1EA 1TF2A 2D62A 5EYPA 3ZGOA 5JC8A 3KLPX 4XDHA 2AFHE 1HWYA 1TLLA 4BS9A 3CUUA 2W8BB 3D8HA 3QYAA 3RQIA 1WCIA 4V0NA 1AA6A 4ABTA 3ANXA 1QLHA 4RTKA 3AJ9A 4DLWA 1ZMRA 1KERA 4UMVA 2RKBA 3N3BC 4WW0A 3T3HA 1K1EA 3RJMA 3K9NA 2GEKA 2KM1A 4X6YA 5EHIA 3T5GA 1YQWA 3A31A 4XGNA 1ZOLA 4DMGA 1BA2A 3BK1A 4UJ5A 3T4PA 4DPLA 4RADA 4O33A 3SBDA 2FN4A 4IG4A 2PU5A 3WK7A 2R1TB 4YRKA 1GCUA 4N3BA 1Y5RA 2B34A 4YT4A 2QPTA 1GAWA 2GAFA 3WWYA 3A9CA 1RWVA 1YAJA 2BSXA 4U8GA 3T7JA 4BBAA 4GBGA 4B6GA 4NNPA 1P7CA 3GJ8A 3L7NA 3NIFB 1ODIA 4PNZA 2P9JA 1I1HA 2VDJA 2VLBA 2YY5A 3EZGA 3LCVB 3KQYA 1ULZA 2QP9X 1VHQA 4WTOA 3G49A 3OOYA 3H6GA 4IKEA 3LA6A 1XTTA 1XVUA 1YDGA 1N4AA 4NMWA 2Y4OA 2WIJA 3ST7A 4AJKA 5C8VA 3TLZA 4U5QA 2FPUA 3LT0A 1N2CE 2FMKA 4QJIA 1X39A 5KVVA 1RYDA 1E2PA 1G5TA 3U4QB 1RJGA 2OXTA 1K68A 1Z6TA 3ROTA 5HDQA 1JFFA 2P6NA 2JFFA 2H52A 3E35A 4ZCTA 5F52A 3ZW7A 1NRIA 4K26A 3MUEA 1T9AA 3RU3A 2Y4NA 3HKBA 1DC6A 3WKCA 2IYEA 5K6AC 3HJCA 4UBKA 5B5SA 3LGSA 5TDHA 3UANA 1VG9B 4KCGA 3CEHA 3TJZA 4LJ5A 4DLYA 1Z73A 4E2FA 2C9OA 1E1KA 4G07A 5H4GA 4L5BA 5CVDA 1T35A 3G0HA 4CLXA 2XDQA 4KPUA 1WCWA 4K1LA 1KMHB 4D9EA 5AI4A 2OP0A 3KJFA 4DREA 3INRA 4M8IA 1K9VF 5E7IA 4O1HA 5ELXA 5ABPA 1H0KA 4FB5A 2D5IA 2XNDA 3H11B 4YMUA 3CT6A 4U02A 3EZXA 3JQQA 3KXLA 5F7XA 2CV2A 1UK6A 2C4TA 4JJZA 2PBLA 2HQSA 3TX2A 4IH1A 4UCQA 3TD6A 3I9MA 4TMXA 4Y9SA 1D2GA 1R0XA 3CKYA 3URKA 3NNNA 4G89A 3L79A 4OK3A 2A3RA 2PG3A 4B43A 2KW5A 3V6LA 1ISHA 4BEWA 4FQ5A 1JFTA 2FLKA 5AVJA 3VOSA 4NYIQ 1E5DA 4L1KA 5A7FA 2GPSA 4KJZA 4HNUA 1YCFA 2AC4A 2G06A 1SIBE 4XLZA 3G79A 1ZR2A 4ND6A 1XU9A 3CPSA 2I9KA 2X77A 3WICA 1Q0TA 2ANBA 1SCAA 3BTSA 3HR7A 1E0DA 4RPLA 1IY9A 2HJGA 2B3DA 2VRCA 4KUGA 5AVQA 4JB3A 4DSZA 4R8VA 3AXTA 3RAGA 2ZTLA 2WMYA 4RSMA 4TKLA 3CG4A 4CLRB 4AJ4A 4ZYYA 4DM3A 3IQEA 1N2IA 2CJXA 4IZHA 2Q6IA 1LI5A 1SC1A 4YCLA 2WT8A 2WZCA 1L7EA 4NE7A 3TD2A 8OHMA 1K4YA 3Q9SA 3L5OA 3KWFA 4LZNA 4QUIA 3THRA 4TM7A 5DSZA 1ZN7A 3TDMA 4Z7OB 2JK1A 3PG5A 1HXHA 4WGGA 5DK6A 4YO7A 5ED0A 2C9DA 3R5XA 3AEQA 5KPJA 1ZW6A 1N4DA 4DPKA 2IYAA 3INNA 3NW9A 1CJTC 4XWOA 2LGJA 1JLHA 3UUFA 5LP6F 2X8BA 3W4IA 4XB2A 4G0UA 1WUKS 4FSXA 2IJGX 4OJTA 3ZDFA 4B79A 1YDHA 4B7UA 4DQKA 1ULTA 1FVFA 1TEHA 2HU7A 4MIEA 4UUPA 2G5CA 4YASA 3UCEA 4D0SA 4JH0A 1MQSA 3GEIA 3EPJA 1JR3A 3GGGA 4L51A 4MGYR 1QTQA 4X85A 2WHXA 1VGQA 1ZMBA 1TMOA 4ZT4A 3OIVA 1HBJA 2R97A 4H3VA 5LQCA 1Q12A 3JWJA 1ZK1A 2DFLA 3BKXA 4PXSA 4CTJA 5K01A 2WKQA 5KDDA 1XPJA 5JG7A 3DQQA 1SXJD 5BRJA 1ZWKA 2WMDA 1XRLA 3FCYA 4UVEA 2RAVA 3QPBA 4DEXA 3ZE7A 1ZYUA 4JYCA 4GM4A 4RF4A 4MDHA 1ESNA 2OAP1 4JR1A 4JFAA 2GYWA 4YQZA 3W6OA 4DUGD 3MZ0A 5THXA 4E5DA 1MIOB 1HRKA 2JGAA 3DTYA 2HRQA 1Q17A 3E4CA 3HUTA 4Y18A 2NT4A 1WCV1 4AF8A 3NBUA 1W76A 3D0KA 3EAQA 1L5NA 3KQTA 1KP2A 3Q4GA 1KZGB 1Q7GA 5DN6D 4B3BA 2XUAA 2ZIEA 4JYMA 2B8TA 2WVAA 3TNLA 3H0KA 3QKSB 4S3MA 4I1OA 3RVPA 1ISGA 5HSGA 4CKEB 1CF2O 1P0IA 2FW9A 4NBTA 3R7AA 4P4NA 3UMRA 5THQA 4A15A 1SUIA 2VRBA 1YB5A 2PYDA 3ZJYA 1SG9A 1P9WA 2R6CA 2WWGA 1EEHA 2FPIB 1AKTA 2FB9A 4EAQA 1BU8A 3EEBA 3K9CA 1PFQA 3JTEA 4AY2A 2RGUA 4NYJR 4A7PA 5JSKA 1Z4NA 3VV3A 2WWRA 2GVDC 3AJRA 2O3UA 4B3CA 2Z2KA 1KO7A 3OE4A 4B76A 5A5GA 5JBNA 1S4MA 4IIXA 1G3RA 4L4XA 5I7HA 3RVJA 4WMLA 3GPBA 4NC9A 2LRHA 5M5BA 5EA2A 2N47A 4MVJF 3VKUA 4ER0A 4X1KB 1BE8A 1KIAA 1OBVA 5KNDH 4KN5A 1LV7A 3I1YA 3SJUA 3TPZA 3WIOA 2JCBA 3KSBC 2WWXA 5LBTA 1TL7C 5ADHA 4BVKA 1T8SA 3NGLA 4H0NA 3WFIA 1XZDA 2OMKA 4LSMA 1LQUA 4N03A 4YFYA 1N5MA 3UFXA 3N8HA 3N58A 4MB0A 4WLEA 2AXQA 2L2QA 4XOUA 4ZQHA 4HWPA 4K8RB 4QGAA 4ZO7A 5IEBA 1UXJA 2QRNA 3RADC 4A1FA 2X4DA 1JVBA 2FLWA 1E4OA 2PL1A 3E05A 1KY4A 4W5TA 4FHDA 4TYNA 1DJMA 3NM6B 1UZLA 1ODFA 4M1QA 4DDUA 3HN7A 1NA5A 1XELA 1WBBA 1I1QB 4C22A 3KSDO 2W2TA 4E1BA 3BBPA 1JZTA 3DBLB 1PF7E 2EL7A 3AR7A 4YPFA 3FPFA 4FGKA 3JAMA 4N7BA 4HN2A 1UINA 1P3DA 2Y93A 1DRKA 1MFPA 4B33A 5AM1A 3LFUA 4OD0A 1FQJA 1HOTA 5KYYB 1Z5PA 5KTRA 1P72A 1U28C 5DISB 5JCJA 5LR6A 1MTOA 1WQ1R 3UJAA 2KLBA 2J3IA 2CFRA 3I37X 3U7IA 3TLMA 1U2DA 4OXNA 5IVDA 1FC0A 4C04A 3NBQA 2YOGA 3BMNB 4IVRA 2OHFA 5DMXA 5E2BA 1YVPA 2WG0A 4H7KA 2ECPA 1OU4A 2HPHA 2J85A 3PQ4A 2ZQZA 4NPCA 4IPTA 1E6EA 3CUYA 5ERYA 3B1FA 2EF0A 4HY3A 2FETA 4F2WA 4Y30A 1N5KA 2H29A 3K1JA 3NR2A 1L5LA 3WB2A 3CLKA 2FUCA 1HFEL 1SBCA 2FWJA 3OC0A 1PWYE 2NXJA 4TV9F 1XNHA 5A4FS 2FU5C 3LO5A 1KTVA 2GK7A 4M21A 1UJNA 5FNVA 3KOXA 1QFZA 1SXJB 1DVRA 1QHNA 2OHXA 2R62A 5JTUA 1KA9H 2A1TS 3OPXA 2ZEJA 4PZZA 4UC0A 4C4XA 1TMYA 2P9YA 3B3AA 1COZA 3AT1A 3JR7A 2BHSA 2I7VA 3AR5A 2O5VA 4IHJB 1YC2A 3FKSA 3N8IA 4M38A 3EEYA 4EHAA 5LNK1 1M2VB 1H2WA 3IODA 4PBTA 4TT3A 4UATA 3EIXA 1E5QA 4E2ZA 2NWQA 1J22A 1EVQA 2O0LA 1DNPA 1V4BA 3FBWA 3FSEA 2ACWA 4JKIA 2Y1OA 1JA0A 4I8XA 5KDLA 3IQWA 4CR8A 2QVZX 3C3XA 3C43A 3GT7A 4X1OA 5HZGA 1QCZA 1KR5A 2WICA 4OXQA 4FNAA 4KDEA 4MW9A 1V3QE 4L95C 2CV0A 3KTAB 1C2YA 2GNAA 2I1VB 4G8JA 1Y6QA 3U48A 2YWJA 2YWEA 4RMJA 5HTKA 3RFCA 3W7BA 3WK9A 3WLLA 5K45A 4I0WB 1M5RA 3O83A 3IOMA 4E15A 2Q4TA 2PJDA 4BQQA 2WFZA 3OE7A 4DVJA 1W581 2XJ4A 3AIKA 2K7ZA 4KLZA 3L1KA 4F4HA 3OIFA 3D5TA 3PV0A 5CK5A 3D31A 3STUA 1P4RA 1V1RA 4KU4A 4ZZ3A 4LF6B 1V9LA 1G9TA 1GCGA 3IAHA 2EXXA 2I87A 2VP4A 1T6BY 3ND7A 4IICA 3ZUGA 2Y8EA 3SZOA 5CLHA 1IBSA 3TB4A 1NDUA 3TZ6A 4H4DA 5DM0A 1NBOA 5GIOE 5FNVF 1DKLA 2VHZA 3T3EA 2AFIB 4B35A 3HFJA 4KI7A 2JCSA 4ZV4A 2PGJA 2BFNA 4N3AA 1V3UA 5EUMA 2YN4A 3DL0A 4RZXA 1JLKA 5B3JA 1ZO8A 3PDUA 2OORA 4GSKA 3BSSA 3DPIA 4FC6A 5SYMA 5A0TA 3FFBA 2YHIB 1PSDA 1QX3A 3PX2A 4FWTA 1F0NA 2BR5A 2HNKA 4IGEA 3H2IA 2UUPA 3V2HA 3NORA 2C7VA 4CKBA 3DGFC 4OUDB 2J0UB 3AVPA 121PA 2YIMA 5TJHA 4DQLA 1RMQA 3KDAA 4CF4A 3BB3A 5EWJA 2ZUDA 4MW4A 1U04A 1ZRHA 3LZDA 1T9HA 5HRAA 4Z4EA 1W0KA 2V59A 3PPWA 3EMDA 4IIGA 3TB6A 2QZ4A 4PQGA 2WM2A 2PEZA 5JS7A 4B31A 1TFUA 3GEBA 4DXAA 1DKOA 3L0BA 1ZXBA 2CZCA 3AINA 2CMHA 1CUGA 3B2EA 3WLJA 2FG6C 2H85A 1Z6AA 4K2AA 4UFOA 4Y2RA 3GPCA 4FK8A 5P8WA 3WLOA 4DE5A 5A6SA 1KBOA 2JIRA 1NWCA 2NOAA 3EZYA 3ZHUA 1G66A 3QBEA 1D2EA 2QZJA 3DW3X 4FMDB 4RD2A 5JMOA 3FWYA 3OQNA 1IK4A 1NXXA 3GO4A 4DEYA 2FHSA 1L5RA 3ABZA 1VKHA 2IOFA 4QATA 8LDHA 3LOPA 2ZE8A 5ALWA 3R8CA 1ENZA 1DTWA 2QVBA 4OF4A 4BWGA 4F7DA 5LQRA 4YB8A 4MZDA 3MCUA 5IVHA 4Z9BA 1GFSA 3IP7A 4IS3A 4UTNA 3DE3X 3HHPA 4RHEA 5DNWA 5I9BA 2I3DA 3IMCA 1PJBA 2PCLA 1RRPA 1TCUA 2C1XA 2E49A 1L7NA 2X76A 1RXYA 2MYPA 4PHCA 4Q4HA 4U2KA 4YT5A 2IHNA 1XNQB 4DMKA 3O03A 4YMHA 1VM6A 3DR5A 1JMVA 3IRUA 3RS8A 1XDGA 1IUPA 4XJXA 1WXQA 2XZDA 1XO1A 1RLTA 3COPA 4RCYA 3KJGA 3RYIB 1IM2A 3CEJA 3E7DA 3OJFA 3KZNA 2DY1A 1NP6A 2YUTA 2QZSA 5I7WA 2ZB8A 3EIUA 3I6ZA 3EUWA 2YTZA 4II2A 4Q3DA 3S7ZA 5HTOA 3L8CA 5M7EA 2E4VA 4KMRA 4BZWA 4LWPA 1JSLA 1K2VN 3HEAA 4HSEA 1A4RA 3EVAA 3R3WA 4HX9A 3K16A 4JB2A 4M1TA 3FVVA 4E2XA 2R25B 2I7CA 5C34B 1QAQA 2VHEA 3VQTA 5HS4A 2JLRA 2D00A 4KK4A 1HUQA 2Z4RA 3NRBA 2IHJA 4EL0A 2W83A 4CEHB 3SQXA 4XM1A 3JZMA 5EJ6A 3T7EA 4EYEA 5J59A 1B00A 2YXNA 5DI3A 5JPDA 3ANSA 1O5TA 5ALLA 5DWVA 4WXYB 1USUA 5EUQB 4R54A 4ITRC 5JC1A 3BAZA 2XCRB 5JQGF 4EJSB 4JI8B 1JF8A 4OQQA 2R8BA 4GBED 2JFYA 1E98A 3R3VA 4O4HB 3I30X 4I1SA 3I01A 1QQ6A 1XVAA 2CXNA 1F6DA 2CK3D 3C4QA 3KKNA 5DPMA 3NLLA 3UGTA 1B2RA 3IPRA 4MGKR 5ENVA 3HCAA 2MDTA 4RY2A 2NYRA 5CIYA 1HNZB 1MV8A 3O8QA 4GOMD 4MQLA 4P53A 1PQPA 2DWCA 3LUGA 3QRWA 4DV3B 1XWFA 1ZLYA 3H9GA 4FR2A 1JHZA 3E70C 3EZ2A 3NT4A 4RQBA 4BLOA 3RBXA 2W00A 3F0TA 1LDBA 3H0EA 2OWDA 4KIWA 2QQ5A 3RRYA 4YYEA 4MIYA 4BP1A 3KQOA 4Y6GB 2VZ8A 1ABFA 3SFZA 3K8YA 3BWXA 5F21A 4YUYA 1Z6QA 4KYTA 2H07A 4WADA 5JROA 2UYHA 2QEQA 2ZS9A 1D2RA 2ZRFA 5I4CA 5L4NA 2P2GA 1UMCB 4Z54A 3KR9A 1NGSA 3DDUA 1VE6A 3NJRA 1EWKA 1L4BA 2V4MA 2RGBA 2E1RA 2RCYA 4M0UA 4CKZA 4MVJM 4N18A 4AQ7A 1IDN1 1U2ZA 4Y6OA 5KNCH 4F8JA 5JD6A 1L3IA 3GNQA 1NBWB 4IS2A 1U1CA 3FYSA 4ZT2A 2K7FA 5FTJA 4N5LA 4J0EA 3TQCA 1UK7A 3O93A 4KRFA 2EAUA 4FEEA 3QPWA 2P62A 1U8AA 2OVFA 4E13A 4R0MA 1SOMA 2D0PB 1IUKA 3AFHA 1SVLA 1ZK2A 3CIOA 3IQDB 3IV9A 3K0HA 1YMUA 3OU2A 7YASA 1A7AA 1PFUA 1YR7A 4ATNA 4BU0A 3N9IA 3L8GA 1RADA 2Y0PA 4P7KA 3T7CA 4AG6A 2BGUA 5A1TA 3O8OB 3SHFA 2I4OA 4U2FA 1GJRA 1W2HA 2C3MA 2WBLC 1H1DA 3CWQA 3MELA 4PLZA 5FJIA 1CY4A 2GETA 3KT3A 2IDJA 4AJOA 5CCDA 1MDFA 1QGUA 1SHJA 3EA0A 5EIHA 4HNAB 2O2ZA 3UHAA 1JXMA 4R9UC 3PFCA 2HPAA 5JSFA 2IRWA 1II8B 5JPIA 3SR4A 3RSQA 1G4AE 4TKVA 1GRRA 1JHVA 3WHLA 1RXSA 4K9KA 4Q93A 4WOPA 1L1EA 2ID9A 2FPGA 4M98A 4NULA 5K9ZA 3MPUA 1UM9B 3WNZA 3A25A 1QP0A 1RAIA 4LK3A 4XQ0A 2HZBA 2HHJA 1TUEA 1RYNA 1U6IA 2I4RA 4FZ3A 4GL4A 1RRCA 3OOWA 3DLPX 1F8XA 1TDJA 1U2EA 1M6HA 2CL6X 3NC0C 1Y48E 4IP0A 2FRVA 1HE5A 2QT1A 1D5CA 1WHTA 1D7OA 3CHYA 1VE1A 4MV9A 5BQ5A 1GQQA 3HUUA 3LH5A 5SICE 2W6OA 1I2MA 5DYGA 4N5DA 4S1NA 2JH9A 1RYHA 2VJBA 3K5IA 3TVTA 1BFKA 3T3GA 3AETA 1RKQA 2Z2JA 1FS5A 3KOOA 3N59A 1NUSA 3M4YA 2NYAA 2VSQA 3DFMA 1MC1A 2AR7A 1WY5A 3CB2A 4XQ9A 2Z08A 2PZAA 1L9XA 3GLTA 3OZEA 1A9QA 3IUJA 5CCEA 4OYRA 2H2HA 1U3GA 3LDGA 4Q9LA 5G2OA 3LSYA 2JA1A 5KSPA 4EHKA 3G02A 3V4VB 2ZXUA 2XOKD 2YMQA 4HDCA 1BXGB 1LFAA 2PKRA 3CUTA 3VU9B 2MSEB 1U5BA 3LQKA 3GCXA 2QLLA 2Z95A 3TMKA 2OWEA 4BNZA 2UZAA 2BY4A 4DSOA 3IUPA 2QPOA 4M9SA 2VPPA 3ND9A 4G3XA 5JAPA 2ZAIA 3A9SA 3H3XA 4O25A 1BN7A 1XVTA 4OLFA 2H2FA 2VCEA 3KYJB 5DNVA 3QKTA 5DWDA 4CCYB 4HG2A 3C3WA 4BLRA 4IDBA 4Q21A 3INTA 1QXSA 2EW2A 2OCLA 1N8NA 1EWRA 4R81A 4RIEA 3SR3A 2JFOA 4RIGA 4ACAA 3KEOA 4LXGA 3THYA 1UIMA 4DRYA 1F0PA 2HSZA 3SZ3A 2I7DA 1NVXQ 1W25A 3KHUA 4X61A 5L6MB 4CGZA 4UARA 2QZPA 1A77A 3RSGA 1MU0A 1VC2A 4ML3A 5EZSA 1VJ0A 2GCPA 4AYWA 3RGGA 4XPIB 2P9GA 5LVAA 1W2GA 1YJXA 3U80A 4AJ2A 3R9XB 1YONA 3VDNB 3UCXA 1JDPA 5AVRA 2B6HA 1LW6E 3QJ5A 3U0BA 3SYMA 2BBWA 3DBVO 3TZCA 4ENWA 5GVRA 4TL8A 1VL0A 4ZJYA 1OROA 3FYCA 2C4HA 5KVCA 5DBEX 1TUGA 1HMPA 2NVOA 1W0JD 3RARA 1JV2B 3ANTA 3RVKA 1LKZA 2HTEA 5TQ0A 1FDTA 2CLOB 3N5CA 4IOJA 1XZKA 3ZY2A 3BL6A 3K2EA 4HATA 3ZBTA 4UTRA 3LDAA 3ORYA 4BNTA 2C57A 4U9UA 5E7JA 3RR2A 1U0OC 2ZRBA 2WJZB 4LHEA 2Q5CA 4LJ9A 5DHFA 1OWNA 1J8QA 2BL4A 3BM5A 2QVYX 3MJSA 1G2PA 3KQVA 3DO6A 3PHGA 3EDRA 3IUBA 4RVNA 4I99A 4Q12A 4WN9A 2W6JA 1ZJYA 4X7MA 3T34A 2YL2A 1T10A 3EOZA 1J42A 2W48A 1WBDA 2WT9A 2Y27A 4ZAYA 4OIMA 2WLTA 3H3FA 3VGPA 4F3RA 2RAUA 2BKLA 1D1QA 2H9YA 1WUIS 2RGXA 2IUYA 4ONEA 1RQXA 5CJ2A 2POCA 3RYHB 3EFOB 4WOCA 4CR7A 2D2EA 4IEFB 1K7YA 3UWDA 4YY3B 4PANA 1SU7A 4OKIA 3MT7A 3A6FA 3F5QA 4R1PA 5T8KA 5FR1A 3LL4A 4B6RA 4CN8A 5BWNA 3WA7A 3TIXB 2ZP1A 3A58B 1JECA 5J4YA 3NBMA 4YJFB 2WFMA 4FDAA 2WSSA 3UG6A 4D96A 4CQNA 5BR8B 5KNCA 4JUDX 3UY4A 5B57C 3P94A 3A2MA 1YU6A 5AXBA 1CJMA 2Q2QA 2ZTSA 4YMLA 4HVAA 3AJ8A 3AKEA 3I05A 3T5TA 4WGFA 2Q1SA 3U44A 2OG1A 3A28A 5TQ2A 1F3OA 1VE5A 1REQB 2VDWB 1T9CA 4WBNA 2WTAA 4YDQA 2ZAOA 4R9RA 1F6BA 1V41E 4M4SA 1FFCA 2A78A 3SNHA 3HXMA 1W96A 2ZT5A 3ZH2A 3DT9A 2FPPB 3L07A 4JSYA 3MOIA 4OIFA 3G9TA 3CYFA 3QUCA 3KHKA 3UHJA 3ZWXA 5EJ8A 3QWFA 1L4KA 3VRHA 5ICGA 3GN1A 1B2LA 1DEXA 3WO0A 4EDHA 4XFDA 1LY1A 1Y5LA 1ZMTA 2NZ8A 2QRVA 1S8FA 2VYND 3ILXA 3PE4A 2HMSA 5E6UB 1O7JA 1M34A 3BFVA 4RGQA 2GF2A 2G6BA 1M1ZA 2VDNB 4YCNA 3P27A 3DHYA 5L51A 2F48A 1SUDA 4V3BA 4BBZA 2YVLA 4EGJA 2K87A 4H0CA 3EIOA 5A03A 1SD2A 1WMEA 2YWGA 4RD4A 5ERGB 1D07A 4HDOB 1QYXA 5D84A 3GAFA 2OMEA 1O0SA 1XVIA 5BXYA 2WJPA 3I5UA 2YHSA 1P1BA 2IWHA 3EXEB 1FFSA 1QMPA 1Y9JA 3CVXA 3DDSA 4E6EA 1UBSB 4LNUB 4MR8B 1V11B 3V9AA 5KU7A 3Q6MA 1BMFD 2ZETA 2DKFA 1AE1A 1CE8A 2CXOA 3LDHA 2QTWB 1SBQA 4H4EA 4UW9A 5IJ0B 1PJ2A 1NG1A 3DNFA 1LTQA 4YJ3A 4QTYA 1JHUA 2VJQA 5CCXA 2PS1A 4ZXPA 4BQOA 2YNMD 3D6MA 1UQRA 1NI4B 4MYDA 2FP4A 2OCYC 2JHCA 1JE0A 3B6EA 1LPAB 3LHSA 5DKFA 1M1YB 2C4KA 1ORWA 3FGZA 3HYSA 4QU9A 4R6XA 3TI7A 5BUCA 1K06A 2PVPA 5CG2A 1UJ4A 1WE2A 5L9AA 4IR7A 3IP3A 1YB1A 4MPTA 4OXRA 3LP5A 4RKQA 4EATA 1JSCA 1UXKA 1E1CB 3VTKA 4BNYA 1TTHA 4C3OB 2PL3A 1CEEA 1F8GA 4YQYA 3NT2A 1RYFA 4IXWA 1L8OA 1H2XA 2CLFB 1AV7A 2G70A 1J1IA 3C7AA 4QSMA 2HXSA 3K09A 4C9BA 1EAYA 2VSYA 4W1QA 4P86A 4R41A 2VPXA 4ZI5A 4EI7A 3HL4A 2CWDA 2IYRA 4O6VA 4ZMRA 1CK4A 3TM5A 5LC1A 5A5DA 2WKWA 4I1VA 2NSYA 3LY8A 3FNHA 2PRKA 1T1GA 2X4LA 3DEAA 5CAEB 1TCAA 2AC7A 2NUTA 3GZNB 3TRHA 4EZBA 4BTVA 4KBFA 1QIMA 3H19A 1DE0A 3CW8X 3EWSA 2R44A 4P36A 5EWMA 3OEWA 2HJWA 2AV6A 4OYLA 4OAQA 1XLWA 2IC5A 5KYUA 4KC0A 5FFMA 3VTFA 3U7QA 4RIIA 1GV1A 2F9MA 3EBOA 4A0HA 2H7YA 3A10A 1P7WA 2CVHA 5E0KB 3IFSA 1P9RA 2PMFA 3LZ6A 5IFLA 3QEAZ 2Y0CA 4HAWA 3ZR4B 3DWIA 1QVWA 4FLFA 2RHCA 2BSQA 4GKJB 1ECFA 1IFXA 4NE9A 4NCBA 4FFOA 3RNLA 4JV5B 2JPDA 3N28A 2NPFA 4JGBA 5FOVA 3ZK7A 3GFBA 1LVGA 1N7GA 3HPQA 3R0JA 5ALJA 4DNQA 4E0BA 2JAQA 4NBVA 2JH3A 3FBGA 2QLTA 4P80A 4RK4A 4F2HA 3RYCA 5A0VA 3DZJA 3UXYA 5K3DA 3EIQA 2LTAA 3PJRA 1Y8AA 4FW8A 4AZSA 1IHPA 5ALFA 4BLUA 4B71A 3ESZA 1CF9A 4IO1A 4FCVA 1DV2A 4PFQA 4FGUA 2JD0A 3P9XA 1E2FA 1F1JA 2P9FA 3AESB 4Y8VA 2OQVA 4XARA 3RHSA 1H2BA 1H23A 4R31A 4CF3A 3AU8A 3GCWA 3A9RA 4L27A 5JNRA 5KJCA 4G56A 1DRWA 3V80A 1W9MA 4TVKA 1WP9A 3RS0A 1F12A 2BM8A 3C14C 2IYZA 4QNMA 4GAEA 4PZDA 4A4DA 2ALJA 1A7JA 1JJBA 1V3TA 3UNXA 4MAFA 3ZCUA 3G5MA 3K1AB 5JQWA 1WKBA 4R83A 2IEIA 1TCBA 3HBMA 1MABA 3HA7A 2MR5A 2R6AA 4PGAA 4Q4AB 4MUGA 1E2LA 5IDVA 4JLDA 1K8RA 1WDMA 1TZMA 1KMCA 1WMSA 1PTKA 1UH5A 1ZNQO 5LMCA 3H4TA 1SKUA 3T15A 1BH6A 2J5KA 2BGNA 1IQPA 2MINB 1FPQA 3PGLA 3O9ZA 5AJVB 2H5JA 4BKPA 4DLLA 4CM8A 3H86A 1R6XA 4YUVA 2X5XA 4WI1A 4B4WA 1FYWA 3QENA 2PUWA 3CR8A 3K6KA 3U60B 1ZUWA 1I6LA 2OO7A 1OA0A 4KQJA 1GT91 2R96A 2VC2B 3KU4A 1YQEA 5EUCA 3T4XA 3VNBA 2W43A 3V8MA 3Q2KA 4A16A 1HLDA 6PFKA 2A7QA 2XMCA 1A71A 1YZUA 4YJDA 3TGLA 1GRCA 3IBTA 2HC9A 1R5NA 4B75A 1QP7A 4QGFA 2JDID 2HEIA 2ZTUA 4ZWNA 3UHOA 4S12A 5HZHA 5HPYB 4MJ3A 1QQTA 3SZMA 4D9FA 3VZDA 2GF0A 5C8DA 1WD7A 3ZKWB 1QH1A 1XTIA 4IOMA 1XE3A 4AB1A 1Z6PA 3FF1A 3GL9A 3N07A 4TQGA 4XWYA 5DVZA 4D3FA 3QX8A 1FS6A 3ZTWA 5JRJA 3NDBB 3TJRA 3OUTA 3OHSX 5K8LA 2E18A 3HJRA 2ST1A 2F4NA 1MD9A 4RENA 2FAXA 1QFSA 2O7NA 3H1BA 1GPKA 3LPMA 4MHTA 3X43A 4INPA 2PSEA 2VPIA 1Z0FA 3YASA 4AS2A 4AUNA 5JJCA 4Z4FA 5CDGA 5ESRA 4YJHA 4C4YA 3OOJA 3HI6A 3LUAA 4R9NA 4TUYF 1E6KA 5G4KA 2HSJA 2IQ5A 3AONB 3QHQA 4DIUA 5ALIA 4ED9A 1EBBA 3UJ6A 4YK7A 1N9GA 5FLYA 1ZONA 3E5HA 1NU6A 2O2GA 1K89A 2PT7A 2ATCA 1OX4B 1AHPA 3EGXA 3LWNA 4FJ1A 4C88A 2BF7A 4B9AA 4AX8A 4C7OA 4H6VA 5ALUA 1P0CA 4FS3A 2ZJ8A 2W6QA 3IUYA 4TWRA 2EHDA 4YRTA 5K8UA 3EULA 3EVTA 4YALA 2IDMA 2YY7A 3VR2D 1DG3A 1FMCA 1XJ5A 3IIEA 1Q1QA 4KJXA 4QHYA 5I7VA 5JANA 5ICFA 2WTXA 4MUNA 5M04A 3IMGA 1WZCA 2QBYB 2WTUA 3DTVD 3KKLA 2OT3B 4HAUA 4QBTA 4PAQA 5K3BA 3AP3A 2DVMA 3C6ZA 2HK9A 3DE4X 5THKA 4AJ9A 4I5EA 1QU3A 2XADA 4KKVA 1QP8A 2X2EA 2EP7A 4W1PA 2OUKA 2PBFA 3COJA 1RCUA 2NADA 4EKNB 1CQIA 2CY0A 3IL2A 2R79A 3MMXA 4CDMA 5F73A 1V37A 4AK9A 1NM5C 1OLOA 2G3YA 1IBRA 2X5JO 2X5KO 3EQZA 3ESYA 3S1AB 3ZU6A 1N6HA 3S55A 2W37A 4O2LA 3WZMA 2LIVA 3TIGA 1Z3IX 2OGZA 4M87A 5C37A 2QM8A 2XCLA 2QN9A 4AN1A 4MARA 2WJAA 4GUDA 5HIAA 4MIKA 1PJQA 4GRAA 2MMGA 3LA8A 3FYTA 2KMLA 3KTFA 3ZUPA 4C06A 4LXHA 1KZ1A 1C4WA 5JXJA 1CQJA 1XTBA 1GTVA 2HRDA 3EZLA 4G8DA 2EBUA 1UWVA 5IXSA 2AF3C 1PIWA 1ZOSA 2BD0A 1Q7CA 1UFOA 2H5LA 5T6BA 2XT9A 1ZC3A 1I4EB 3MT8A 3TW8B 4BAGA 2IIVA 3IYLW 4NBUA 2O54A 3I92A 4LY6A 5AVKA 5EINA 3TZBA 1KJZA 4AFNA 2XDWA 3W9YA 1EHYA 3QMWA 3IBSA 4AMBA 1BQEA 3HXLA 3GQBB 4EG4A 2NU9B 1Y6GA 3B3QA 1O08A 2VEOA 3LUPA 4XZ3A 5EKSA 1MVOA 2X40A 5FUBA 2DERA 1XQXA 3OOEA 3UGQA 5F5XA 4JVLA 4LQCA 1DQYA 5CB8A 4OHVA 4M2LA 4OM7A 4IM7A 1KEVA 2BFBA 3TZHA 1E6MA 3KBBA 1T2FA 2C99A 5B7PA 4JOCA 5AOBA 4ENRA 2H1FA 1RYZA 3QY9A 4HH0A 3WGYA 2ECFA 2DCMA 2SCUA 5GQSA 4FGZA 5F2OA 1WBJB 3N3AC 3PYXA 4HTFA 1B8VA 3EGEA 2GJ9A 3PFWO 3R8FA 1US8A 2P90A 1EK5A 1X1AA 2X9QA 4Q9JA 2ZK7A 5FOXA 3NYRA 2ERXA 1PFYA 3IPYA 2PTHA 2EFJA 5FRDA 5J58A 3FVTA 3KEQA 2VVTA 1MHPA 1ODKA 4CHGA 1C9DB 4OGKA 4WJLA 1NJ1A 2BI8A 4NXNB 2N46A 3OTWA 4JKOA 1KZ4A 1SUEA 3U39A 4WJZA 4HDRB 3SS7X 2B1QA 5LDHA 1RM5A 5E4JA 5K2MA 4HZGA 1G4HA 1SG0A 1YZGA 4RH0A 4OI4A 1NHWA 5E2IA 3WYAA 4GUAA 3AB8A 1E20A 4NARA 1YB7A 1YR3A 2YHUA 3AM3A 3ICPA 5BOVA 1X9IA 1WXHA 4G5FA 5BRNA 1UKEA 5CGZA 3PU6A 1VTKA 3JQ8B 4LDJA 1I7QB 2DR2A 1YZYA 3JQBA 5KSZA 4H15A 3B1JA 4IDEA 4KVAA 2OHJA 4ZJPA 3MTQA 3IMFA 4ZZ1A 3F74A 3QUAA 4DC9A 3JTMA 3EEOA 4D2IA 5MN4A 4TN5A 4KXLA 3DTVB 4UKDA 3I9KA 4KQHA 1EFPB 4A23A 3K71B 2ORWA 4P38A 1IUNA 4AL4A 3HI4A 4EHNA 1J8MF 2PR7A 1LJUA 3R20A 2ZM5A 4E2YA 1O97D 2R1TA 3FOCA 4F5DA 4A91A 1E32A 1T2VA 1FUYB 4TTVA 3VO1A 2VQSA 3OLYA 4GQIA 4ZCRA 5ITVA 2A2ZA 1IXRC 4WCVA 5JVDA 2YV5A 1P4SA 2IXFA 3TVDA 5CFZA 4PGFA 2P6MA 1EM6A 4ZPXA 1NVBA 3RS9A 2GHIA 3PC2A 3M5CA 3D4OA 4IUCS 4X20B 4GH5A 4CTKA 4IQGA 1QPZA 1MB0A 5H9VA 3AUXA 3OHMA 4M0PA 5HF6A 2X6TA 3N2KA 4L28A 1I7SB 2FFJA 5TEVA 1JYEA 2WYUA 1JEYB 2A92A 4X8HA 1TU0A 4DMMA 2QZ9A 3U09A 4QM6A 1C8VB 2R6ZA 1K8QA 3PTLA 2YV3A 1YASA 5CT6A 1N2BA 5T4BA 3RRMA 4KTVE 5CH3A 1TJ4A 2JLQA 1ZNXA 4GX5A 4K3UA 1NW4A 3T5DA 3WWZA 1F2TA 4HEA1 3DMTA 4CQJA 1G1AA 1KJ8A 2DQSA 1FZQA 3UCFA 4ZEWA 5IDXA 1PS8A 4X8LA 2JFXA 1OT3A 4JXJA 2B8JA 1N3YA 1IAVA 2PS9A 5JNLA 1NDHA 2FWMX 4CJXA 3U4DA 2V8BA 1Z6XA 5DBGA 2R85A 4DZZA 3I6YA 3WLPA 3OAAA 3QVWA 1Q11A 2ONKA 1O0BA 2VHWA 3BDAA 3CGGA 4X44A 5DW0A 5FFFA 5FT9A 1W85A 3G0BA 1OW3B 5IG2A 4I50A 1NOKA 3BRWD 1UC8A 4LE1A 1KMHA 1B8OA 1RDFA 1V4VA 4CMIA 5DBFA 1XQVA 2PLAA 4MP8A 5ELLA 4IUBS 3GEGA 2XUHA 4Y9TA 4B3FX 4UUOA 4H18A 3HNRA 2IF2A 1SRQA 1YU9A 1EDZA 3AK4A 3GA5A 1D4AA 3H11A 4KO2S 5EI5A