4PWYA

Crystal structure of a calmodulin-lysine n-methyltransferase fragment
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
250
Chain Sequence
GSVRRFESFNLFSVTEGAWVQYTSIFCPEYSISLRHSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCFLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLILTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Calmodulin-lysine N-methyltransferase
publication title Crystal structure of a Calmodulin-lysine N-methyltransferase fragment
rcsb
source organism Homo sapiens
total genus 91
structure length 250
sequence length 263
ec nomenclature ec 2.1.1.60: Calmodulin-lysine N-methyltransferase.
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pwyA00
3C6KA 1EJ0A 3BWYA 4UOEA 3HCBA 5HOQA 3MQ2A 4X60A 5CVUA 5FA8A 3ELYA 5HFJA 3UJAA 2B2CA 3HVKA 4BLWA 3DXYA 4RTKA 2ESRA 1XVAA 4M36A 2FYTA 7MHTA 2ZVJA 5DX8A 5HIJA 3HVHA 4DCGA 5EGSA 3KQMA 3P97A 4RVGA 5CVDA 4DZRA 5EPEA 3EPPA 2IP2A 5K0FA 1VLMA 4U7TB 3MERA 4R6XA 3NDIA 1QANA 2HMYB 4YV0A 4P7JA 1KHHA 1V39A 3GIWA 3NWEA 4DQ0A 2AN5A 2OPBA 3A26A 3EVAA 5EKUA 4C4AA 9MHTA 3BKWA 3PTAA 3NJRA 1TPYA 3BWBA 2ZZNA 1VE3A 2AR0A 1EQAA 3ME5A 1R18A 4HGYA 4M7RA 2AOXA 4XCXA 4IWNA 3BKXA 3C6MA 5GOZA 3PT9A 1L9KA 1KPHA 1B42A 2FPOA 3KQTA 4A6EA 1Q0TA 2H00A 4QQNA 2P1DA 2PKWA 3CCFA 4RTJA 4M38A 3WSTA 4P7FA 5BP7A 1Z3CA 3SSNA 2PSSA 5EIFA 1RI3A 1ZGAA 2P3QA 3MCTA 5P8WA 2PX5A 2OB1A 3H2BA 3KQWA 2ADMA 3LBYA 1XTPA 2XYRA 3PB3A 4FT4A 2ZWAA 3GRYA 4P7GA 3KU1A 1IM8A 4X63A 1XJ5A 2XVMA 2PY6A 2YXDA 3I9FA 1JG3A 3AXSA 3LSTA 4RTRA 4AZVA 1R8XA 2FK8A 2PX2A 4KRGA 2PJDA 2ZW9A 5DM2A 3VSEA 2IH4A 2ZBQA 4LG1A 5FQOA 3BZBA 3CGGA 3UJ8A 3EVDA 3HVIA 2I7CA 5K0LA 2IDKA 4QVGA 3PS9A 2FRXA 4PYMA 1ZG3A 5DTQA 4BLUA 4YUXA 2O57A 3A25A 5LQNA 2AOWA 1INLA 1JQ3A 3EVGA 4OBXA 1XCJA 3PFHA 1ZGJA 4Y30A 3TQSA 4RVFA 5HZMA 2P7HA 3U81A 1P39A 3SGLA 5GINE 5HIIA 2ZCJA 3SX0A 4X61A 4FS8A 3SMQA 3GRUA 2CKDA 5EKXA 3GWZA 2AZTA 2HV9A 3UJDA 4ER6A 3VC1A 5EC8A 4EQZA 5LQKA 2BH2A 2AS0A 2KW5A 3DMFA 4EKGA 4ER5A 5ICGA 1JG4A 3G88A 4MTLA 1FP1D 3DLIA 3G5TA 5KVAA 1RI4A 4X41A 2ZULA 2OXTA 4MQ4A 1VQ1A 5DTMA 1AQIA 3G8BA 1L3IA 3PVCA 5CVJA 1VIDA 1P1CA 4HTFA 2IBSA 3O31A 2WA1A 5KYGA 1SG9A 2P8JA 3OCJA 3M4XA 1D2GA 3AY0A 3KR1A 4V0QA 3EEOA 4OQDA 3FUWA 4HTFB 5G02A 1PRYA 1F38A 2BR4A 3KPVA 5BW4A 3KR0A 2I9KA 1EJ6A 4YV2A 4YV1A 2NXEA 3GO4A 2B9EA 1NKVA 1D2CA 4HGZA 4RTPA 2NP6A 1L3CA 3UA3A 4P58A 3ELDA 3FRHA 3HNRA 3TR6A 5B1SA 2R3SA 5K0BA 4GBED 4QVKA 3KQSA 2Y1WA 3P9IA 4DCMA 2PBFA 3FPGA 2EG5A 5DWQA 3RODA 4CKEA 1FP2A 5K0NA 3CJTA 1WXXA 2JHAA 4AZTA 1EAMA 5K0JA 1O9HA 2P7IA 3LDFA 1XXLA 2GB4A 1UIRA 2P40A 4AX8A 1JQEA 1G8AA 3K0BA 4KVZA 4A6DA 3OZSA 5CD1A 3HCAA 2UYHA 2IDJA 1RJDA 4P7KA 5E9JA 3UBTA 3PX2A 3LL7A 2G70A 1HMYA 1EIZA 3M33A 4CXMA 1MHTA 4GUAA 4R6WA 1PJZA 3BXOA 4PIMA 3C0KA 5KS2A 2O06A 1NW5A 2O05A 3FUTA 4IKPA 5FWDA 3UJ7A 1NT2A 3I53A 5CCBA 1NV8A 3DP7A 1QAQA 5BW5A 1OR8A 3JWHA 5JR3A 1JSZA 2B25A 4HH4A 4DKJA 3UJ6A 2ZIFA 3NVKI 3JWGA 3G2MA 5GWXA 4GF5A 4GOOD 2PV0A 3O4FA 2PXCA 4KIFA 3HCDA 5LSAA 2XBMA 3A7DA 3MTEA 4MIKA 4CTJA 2ERCA 3E8SA 4B17A 1BOOA 2PWPA 3B3GA 5EZSA 2FHPA 2AVDA 1KPIA 2IIPA 2YTZA 1R00A 2VP3A 5FWAA 3EMDA 5EG5A 2HR1A 1L3BA 3FRIA 4EMSA 5U4XA 4PYKA 2G71A 2HNKA 1IXKA 3KQPA 1TW3A 1FBNA 3GU3A 4MWZA 2YUIA 3CC8A 2HWKA 3D2LA 5ICFA 1DCTA 3R9XB 4RTNA 1G6Q1 1KPGA 2ZBRA 2ZZKA 3KR2A 4GQBA 3O7WA 4LECA 2Y1XA 5D1NA 4HRAA 4E70A 1JG1A 3ID6C 4RWZA 1RI2A 2GLUA 2IH5A 3LKDA 3M70A 3ANXA 1M6YA 1G8SA 4OA5A 5JUWA 2NP7A 1VBFA 3E23A 2IBTA 3AWIA 3HA5A 2BZGA 4F85A 2YXLA 4FP9A 1G60A 1RI5A 2AOVA 5E9WA 2PT9A 4PCAA 2FK7A 1BC5A 4ISCA 4ZTBA 4F86A 1N7IA 2BM9A 1NW8A 3MB5A 3GNLA 4YUYA 5EIWA 2Q41A 3P2IA 3IYLW 2O07A 3I64A 5M5BA 1X1BA 2C7OA 4BY9E 3EVEA 3IV6A 4GC5A 2NYUA 4KIGA 2CL5A 2G1PA 4E32A 5ICCA 3TFWA 4YUVA 5FA5A 2R6ZA 5E8RA 2GH1A 3KR9A 2OO3A 3TLJA 1KP9A 3UJ9A 5EMMA 1QAOA 3HA7A 5GM2A 3KPJA 3EVBA 3G2PA 3QV2A 4CTKA 4QPNA 4XUDA 2IFTA 2Z6QA 4BP1A 4RVHA 3EVZA 4PWYA 3SM3A 3BUSA 2V74B 4RVDA 3NW9A 2PT6A 5EHGA 2C7RA 5E1DA 4RX1A 2YVLA 1ORHA 3G7UA 4RTQA 1FPQA 2P35A 2Z6UA 1R74A 3DH0A 3BT7A 2H1RA 2UYOA 3VC2A 2P3OA 1JR4A 3P9NA 5DXJA 3KQOA 3CBGA 1O54A 4OA8A 4C05A 1M0EA 2YXEA 2F8LA 3JWJA 2GA9A 1YB2A 1L1EA 1YZ3A 2AN4A 3GGDA 3PX3A 3G5LA 1UWVA 4ATNA 3NDJA 3R0QA 1JTFA 3REOA 4PCLA 4RSRA 1I9GA 4PGHA 4CKBA 4E2YA 3M6XA 4RTSA 3OU7A 3KQQA 3T7SA 3VYWA 3KPUA 4FSDA 3TRKA 2XYVA 5CCXA 3P2EA 3LKZA 5DPMA 3P2KA 3EGVA 3P71T 5E1OA 2VZ9A 1SUIA 5GIPE 2AOUA 5HEKA 3FPJA 4DF3A 5K05A 3ELWA 4R8RA 3OE4A 5K0EA 1JTEA 2OBFA 1I4WA 2JH8A 2ZTHA 3CKKA 5K0CA 2QRVA 3DUWA 5EZQA 5H02A 2VDWA 2AOUB 2AN3A 4L7VA 3FZGA 3EGEA 4U7PB 1YFJA 4CWAA 2IH2A 4DA4A 1MJFA 5F2OA 4LWOA 5LQRA 3GJYA 2PXAA 3NVMB 5LQJA 2CMHA 2I6GA 2NXJA 3A4TA 5FHQA 2QRVB 4YMHA 2QE6A 3MGGA 5ICEA 5CIYA 1NE2A 3NMUF 2XVAA 2N47A 3DLCA 3UZUA 5EMLA 5C9ZA 4OX9Y 1AF7A 3F4KA 2PWYA 5T6BA 5FCDA 1VPTA 4E33A 2I62A 2PXXA 2QY6A 5KQSA 3DMHA 1ZQ9A 2BR5A 3QOXA 4PNEA 3FPHA 3GXOA 3V97A 3BWCA 1N7JA 4IV8A 1WG8A 3E7PA 5E1MA 2AVNA 5BXYA 3FYCA 3BWMA 3KHKA 3ERCA 2UZ4A 2OYRA 4H0NA 3EEYA 1RJFA 3FUUA 3LECA 4FZVA 2EFJA 3A27A 3LCUA 5DSTA 3NWBA 1YZHA 4PYOA 2DULA 3TMAA 3GDHA 1O9GA 1IY9A 3C3YA 3MTIA 8MHTA 4XUCA 4HC4A 3B3FA 4IV0A 4KDCA 4GOLD 4Y2HA 1KYWA 1R6AA 4BLVA 1KYZA 1JQDA 4FT2A 3ER9A 3DXZA 2ZBPA 1QYRA 2WK1A 3B5IA 3GRZA 1WZNA 3EVFA 4HSGA 4PGGA 3SVZA 3TM4A 3QOWA 1H1DA 3FUXA 2ZZMA 3HTXA 5EEGA 2JG3A 3DMGA 3Q87B 4PYJA 3UJBA 4C03A 1SVUA 3M6WA 2NXNA 5GM1A 5E2BA 1BHJA 2P3LA 3BGVA 5T64A 5HIKA 4KW7A 4KDRA 5K09A 2PGXA 3DULA 5E8JA 5IKMA 1Q0SA 1RJGA 2ZSUA 3I58A 1ZHFA 2CMGA 3LDUA 4E2XA 5K0GA 1AQJA 3OZRA 3S68A 1EG2A 2ORED 5KQRA 1JSXA 1N2XA 3SR4A 1AV6A 2XYQA 3V8VA 1R8YA 1VP3A 1WXWA 4AZSA 1FJXA 3P9CA 3G89A 1QZZA 2EJUA 2EX4A 3FPEA 4R8SA 5EMJA 4C08A 3OE5A 3R3HA 2LD4A 4QDJA 4R05A 5HIMA 3TOSA 3PLAE 2JH9A 4QQKA 2K4MA 3SSMA 4C07A 5FTWA 2JHPA 4YUZA 1QAMA 5IH3A 5C0OE 2OY0A 3RW9A 1XDUA 3GCZA 1WY7A 3IEIA 3AJDA 4PYIA 4MHTA 3THSA 5GIOE 3R6TA 2PX8A 2C7QA 4X1OA 3ELUA 2IGTA 4C04A 3P8ZA 4KWCA 1M6EX 4WXHA 4DM3A 3I5UA 3X0DA 2JJQA 1Y8CA 2QM3A 2QYOA 2ZWVA 1U2ZA 4OQEA 4PYQA 5EOVA 5T67A 5LR6A 3HCCA 5EVJA 3T7TA 4RTLA 5CVVA 1ZKDA 4PYLA 2PVCA 1G55A 4DMGA 1I1NA 1X1DA 5K03A 3KPYA 3OZTA 4GC9A 5DM0A 3RIEA 2P41A 4WVLA 3KKZA 4NECA 3HVJA 3AXTA 3LDGA 2DPMA 4Z2YA 1ORIA 4QTUB 5LQUA 3LCCA 4LWPA 4CKCA 1DL5A 1KR5A 2GAFA 2GS9A 3HCEA 3TKYA 4AUKA 4E30A 3LGAA 2Z6AA 2CWWA 2VDVE 5DXAA 3OU6A 2BR3A 5FULA 3HCFA 1DUSA 3UWPA 5MHTA 2OKCA 3GRVA 1VL5A 3FUVA 3OFKA 3HA3A 3SSOA 3THRA 4PINA 3PFGA 3G2OA 3G2QA 4GOMD 1UFKA 1XDSA 3EGIA 3K6RA 2ONYA 1SKMA 4PIPA 1NW3A 2VDUE 4RTMA 2VS1A 1NW6A 3DOUA 2OZVA 3UA4A 1D2HA 5LQCA 1HNNA 3MAGA 2O0LA 1NBIA 3L8DA 3M6UA 4AZWA 4YMGA 5DLYA 1X1AA 5LQAA 3ER8A 3FTFA 1RI1A 4RYLA 4EK9A 1YFLA 5GP1A 4POOA 2JHCA 2ZIEA 4JXJA 2ONZA 5FQNA 2HTEA 3EMBA 3DTNA 3CJRA 1KXZA 3Q7EA 4GEKA 3A7EA 3EVCA 3R24A 2E5WA 3UJCA 4ER7A 5DM4A 4G56A 3HEMA 3KQVA 3LHDA 5DT2A 5EMKA 5FHRA 1NV9A 2G8NA 1SQFA 3JWIA 4ER0A 3LX6A 4C06A 1SUSA 1G38A 2AOTA 4RTOA 3KQYA 2ZLBA 1SQGA 5FUBA 4XUEA 2B3TA 4F84A 5E1BA 3B3JA 2H11A 3B7PA 3FTDA 2BM8A 3HP7A 1YF3A 4V0RA 3C3PA 2AOTB 4FR0A 4GOND 3OPNA 4EVIA 3BGDA 3CVOA 4BP3A 3MHTA 4PONA 5DRTA 2EJTA 3BGIA 2ZFUA 1TW2A 5DSXA 3OU2A 4FSXA 2YX1A 3MCZA 4QDKA 5CM2Z 5DRYA 5E2AA 2UYCA 3OFJA 4OBWA 3TPZA 5K8VA 3G8AA 5ERGB 4E2ZA 3LPMA 1X1CA 1BKYA 3LBFA 1T43A 3E05A 2YQZA 5CVEA 5DM1A 2UYQA 2PX4A 5EQJB 5C1IA 4E2WA 10MHA 3GRRA 5D1HA 4M37A 4QPPA 3T0IA 3HM2A 4EKIA 1XDZA 1F3LA 1WS6A 2YR0A 5F2NA 1KIAA 1RJEA 3T7RA 2GPYA 2C7PA 2OB2A 4HG2A 1P91A 3TM5A 3KPWA 5DTRA 4PYNA 5F2KA 2PLWA 3SXJA 2NNWB 1X19A 4O29A 1JG2A 1XCLA 2G72A 1VP9A 2V7EA 3LCVB 3FYDA 4K6MA 5EHIA 5EEHA 5DX1A 2WA2A 5E9QA 3B89A 3M6VA 1NW7A 3DR5A 4RV9A 4E31A 1NBHA 2A14A 3FTEA 2ZIGA 3UFBA 3CJQA 5HILA 2FCAA 2IPXA 3TKAA 2B78A 5K01A 1YUBA 5CUQA 4QTTB 2NXCA 3NTVA 3IHTA 4YUWA 5DX0A 3P9KA 1P1BA 3DXXA 4FGZA 3ORHA 3FPFA 4ER3A 5FADA 3FTCA
chains in the Genus database with same CATH superfamily
1J20A 3H9JA 3M1YA 1OVGA 4B6SA 2JJ2D 5TMPA 1FYXA 3MQ2A 3CMCO 3FVQA 2O8CB 3QWBA 4BLSA 6NULA 5KKCA 3FKJA 1VA5A 4E5YA 5D87A 2HK9A 4C3UA 5AI9A 5G2OA 4QECA 4RA9B 5DK4A 2ZVJA 3TTUA 2OBBA 3DWFA 3K05A 3KZMA 4DCGA 3FF1A 4FYXA 1RLTA 4G4SP 1ZRHA 1ZVJA 1KEUA 2X41A 3D1VA 1JEEA 1H0SA 5C8YB 5AW8A 4IDAA 4ZDWA 2L2QA 2YDYA 3NDIA 2QTRA 4O0LA 3ZV6A 4P7JA 3HE3A 4QFDA 2Q7DA 4DREA 1THGA 1HL3A 3EVAA 1XI2A 5DXFA 1C7ZA 2B1GA 2GQ0A 2VATA 1ZI6A 1YI1A 3O8OB 1OFUA 3EA0A 3B2EA 5FWYB 2DFNA 4IXNA 4B8YA 1RQPA 5ES3A 5JALA 3LPLA 4KQKA 2Q4EA 4U8HA 3C6BA 5AI5A 3L8GA 4TLDA 4W9NC 5B1HA 3T7IA 2OZLB 2J3IA 4EM6A 2DT5A 3MMZA 1XLWA 1QFMA 1UPTA 1RCFA 1XWFA 4B71A 2I2AA 4DSTA 2YS7A 3R3VA 1GR1A 2NZWA 2VOEA 3LV8A 3PR2B 5AM0A 2YIVX 2OV3A 4G0QA 3WWPA 3LOQA 3UMFA 1P2GA 4DUGD 3HBNA 4B44A 1ZRSA 4RK7A 3Q98A 2HK6A 1K63A 1SOUA 4MVJH 1K3UB 4ND4A 1EU1A 2IITA 3BD8A 1KC1A 3JQQA 3MLAA 3CEPB 1DIBA 3P32A 4MP6A 1Y63A 3IT1A 2FPGB 1TYDE 5THXA 1ENZA 2EWMA 5F3DA 5T41A 3DDNA 2FP4A 3HVIA 5K0LA 2A6PA 1Q2XA 1CY7A 1Q3KA 4IH4A 4J9VA 4DGSA 6REQB 1DIOB 4G23A 3ZCUA 2JAUA 3H2SA 4M76B 5LQNA 4JEMA 1D9XA 3LL4A 1UAAA 3SJ7A 2J3QA 3DE1X 2J0UA 4PGFA 4PZCA 4RVFA 4Y7CA 1P3JA 2Z08A 2Z2XA 3OEEA 1GADO 4S2EA 1QFYA 4PSDA 4X1KB 1U3FA 1DT5A 1VRVA 4P98A 2Q4TA 3UMSA 2QSJA 4XTCS 5FLXA 2AZTA 3D8BA 3DR3A 2YCBA 2EWVA 1GZ3A 3PC2A 3B6JA 2OOSA 4DQLA 2VKTA 2KW5A 4ER5A 5ICGA 4M8SA 3IBTA 3KKQA 5COAA 2A9QA 4M1SA 1VSVA 1G4HA 3WMWA 1ULUA 1XEFA 2LIVA 4EA8A 4OI1A 2GM4A 2X8AA 4G01B 2I34A 4HUTA 2XPCA 4LTNA 3RRBA 5IXYA 4K7JA 4XWKA 2OL4A 5IYZA 2Q50A 2I87A 2RH5A 4JUAA 4I50A 4U9IS 3W2GA 1A8IA 5F9FA 2JFQA 2ANBA 3OLVA 4M7OA 2C54A 3RSFA 4NHEA 4Z1MD 1S0UA 1Y33E 1Z12A 1RM3A 1X80A 3PGA1 4XD2A 4RGBA 3RNOA 4WW0A 4YV2A 3ZPXA 4FW9A 3BXFA 4PC6A 2C42A 3DBHA 3Q85A 2JFXA 3AR8A 3N2YA 4FOLA 4P58A 1V5EA 5AOBA 1I13A 4NTZA 1CUZA 2WD8A 3STTA 3I6MA 4HSEA 5I9IA 4UBOA 5H5JA 5ADWA 4DCMA 4LHVA 1JPNA 2O1SA 1N2CA 1Q3HA 3BMXA 3HY6A 3ORYA 4QPDA 5DWQA 4E12A 1M5RA 3KOOA 4MV0A 1FP2A 4LDNA 3KSZO 2ETXA 3NEJA 1JT9A 4IIJA 5DYTA 4KGDA 1EXVA 4Z7NB 3TD6A 2Z5GA 3QF4A 1Q44A 2DX7A 5FO1A 2OTCA 2HSJA 5T4HA 2KE5A 4D5EA 1XXLA 3FR8A 2R751 3CU5A 4JT8A 4MB2A 5P21A 4PCUA 4OATA 1CZNA 1FEZA 4RGQA 2W2NA 1PDVA 3U7RA 4BBAA 3HCAA 4Y6QA 5JE8A 3LL7A 2I6UA 5G1PA 4CL8A 4HYEA 2C98A 4KWEA 2WWVD 5LQDA 2WIAA 2R1TB 3MUNA 3RK4A 2FNAA 2AR9A 2E1RA 2HFKA 4DDKA 1KQOA 1M2OB 3JYQA 3RYTC 2C4VA 4ERXA 5EYPA 4CHGA 4RIEA 2WEKA 1B3BA 3V33A 5A5DA 4JVNA 2HHAA 2VTBA 4B45A 3PGLA 2FPIB 3REQB 4GOJA 3S7ZA 4B7UA 5HKOA 1GXSA 1HF3A 2ZAIA 1KO1A 2ERCA 3CV3A 4G41A 3DEKA 4CUJA 5TGDA 1U2GA 3SBOA 2QTVB 4LJ6A 1KJNA 1ZUNA 1GFSA 5TJHA 1RJ9A 4PLFA 4XIJA 1OBVA 4IHQA 1W6UA 5SYMA 4HZIA 1QO7A 1MNQA 4NV0A 1OKKD 4EMSA 2G71A 4DMLA 4E88A 1HSZA 4H7PA 2JFZA 5KNCD 2VUTA 5KJFA 1L4FA 2I4MA 4RTNA 4BO5A 3RAJA 1PZFA 3L2OB 2VPXA 3GZNA 4UCQA 3GG9A 1JIIA 3C3EA 1Z2DA 3FHOA 4UKDA 1A1SA 1CDDA 2QVYX 3DV0B 1SJ9A 2X1MA 2JVJA 4Z0NA 4Q21A 1Z82A 3NTRA 2XB8A 5DMHA 1ML3A 4OA5A 2F17A 2YV1A 3LT1A 1L5NA 1VBFA 1ZMOA 1U0OC 2WVAA 3GXBA 3HA5A 1S3GA 2FRVA 4P82A 3M34A 1G60A 1RI5A 2H8KA 4E7OA 5AVWA 2FK7A 1L5WA 1XMSA 2PVSA 3RARA 3ZDQA 1G7TA 5EIWA 3LVFO 4I3GA 4B74A 2VBGA 3MWDA 1NC3A 3FH0A 4CV1A 5HYVA 3R5KA 4GC5A 1JJ7A 4F3CA 4N7BA 4Q6WA 1DFGA 3UJ3X 4J3JA 3F6SA 3I12A 1WX1A 4IOMA 3LPDA 2TECE 3IOYA 4WXPA 1ETUA 1KFCB 1GEEA 4PTZA 3R41A 5EZ6B 6ABPA 3RHTA 4A8TA 5CHEA 1W4LA 4B3MB 3SK0A 2WHYA 5H1YA 4MR9B 3PC6A 3CZMA 1HRDA 1PIWA 2QP4A 1WD5A 1UKAA 3LDAA 2HQOA 3N8KA 4H08A 3OFSA 4H59A 4PWYA 4X0EA 4RVDA 5F51A 2OD2A 1HE1C 2ZDHA 4YPVA 1SRRA 3O3MB 3VR2D 1P0MA 1PLLA 2WSLA 2XA2A 4DT1A 1DWOA 4WHMA 4TT3A 4YDRA 1CIJA 3ER6A 3PWSA 5ELMA 3B8HA 2ZUTA 3SYKA 5K0TA 1WU7A 3P9NA 3WADA 2NU8B 5BR4A 2Y68A 3V00A 2DE0X 2WD7A 2CC2A 1FSGA 1SVNA 3ZHSA 3AOEA 1UWVA 1Z6XA 3JD4A 3E6AA 1WDLA 1R3DA 1RKUA 4O5AA 4Q15A 3ZXYA 4ARCA 1JTFA 4DLAA 1LX7A 4W9NA 3M5PA 4BEWA 2AEMA 3RF6A 2JJMA 1Z07A 3NM6B 3OF5A 5BYBA 2XECA 4QULA 5B37A 1JEYB 1Q95A 1LS6A 1OLUA 2V6FA 4FOPA 1C50A 2I1WA 4YY3B 4RL4A 3MBIA 4Q4AA 4NJOA 4P92A 4ZFNA 4H0CA 1XPOA 5HEKA 4A6PA 3IELA 1KY4A 1M0TA 1XHLA 2FQWA 4I08A 3P0HA 2RARA 2OBFA 4C4PA 1GAXA 4MARA 2JH8A 3GJSA 1C9JA 1F8XA 2NO1A 4LOLA 4U2BA 4TQAA 3ZV4A 4A10A 5MDHA 1JR6A 1HQDA 4G5SA 3EN0A 4WOCA 1RWXA 2AV6A 3MBKA 2J48A 1EB9A 5FX2A 1HE2A 3HWRA 3NVMB 1CXZA 1RZVA 1M0WA 1ZBQA 3DBIA 3EISA 3IC5A 3K5IA 3V4VB 5AW6A 4OX9Y 2DKOA 3DM9B 1A5TA 1PP4A 5A3QA 4JA2A 2XQJA 4LJ8A 4LVNA 9LDBA 1N7GA 1XZJA 2J6BA 3RUDA 5KYTA 1DEXA 4LOIA 2ZETA 7ADHA 4IQFA 4UMVA 1K7FB 4AYTA 4IBOA 3MWEB 5L51A 1JILA 4GMGA 4BAZA 1YAJA 2V96A 1Z0IA 2GD0A 2WNHA 1R6UA 3CLSD 3G6KA 1U5BA 2OZKA 4KE9A 3BWCA 1GCAA 1BQEA 1DIRA 4EB0A 4OKIA 1WG8A 3F0TA 2W22A 2QJOA 1ID1A 4QUIA 4KPUB 2V7QA 2XGGA 4H0NA 1B6GA 1RJFA 2OGUA 1AKUA 4D9HA 5AYVA 3ZE1B 1JHVA 2JA1A 1JHZA 3G9TA 4QJBA 3C3YA 4E2FA 4IICA 4QWWA 3CUYA 3M3HA 1ZCAA 1B8PA 2GPSA 3AKZA 1OFHA 4CNBA 3SC6A 3RS8A 1TQDA 2Q5FA 3O8QA 5IKEA 4PZDA 1P5ZB 4IOLA 4PLPA 3K70B 3EF3A 3ZQ6A 3EVFA 3ZHUA 4HLUA 5JBIA 3D0RA 1DOZA 3H16A 1Z4LA 1O96A 1CUUA 2Q8QA 3K0KA 4Q39A 1AHIA 4XB1A 2GRAA 4DC1A 2QTGA 3LY9A 4PYJA 4ENUA 4A2CA 3H5VA 4ZPJA 3ZY5A 1XZFA 4XYGA 4KDRA 1Y1SA 4P31A 5TGZA 5BW8A 2D2EA 1BXGA 4I14A 3U4MA 3WDMA 2QX9A 5EUCA 3HP1A 2AKAB 2DWCA 3MINA 3IUQA 4TYNA 1SCUA 3ZK8A 1QKIA 5ALQA 3AM3A 4E21A 3LK6A 3C8MA 1JDZA 2Q6VA 4B3FX 1I1HA 3TBKA 4MULA 3SDZA 3BQMB 1WM1A 3R3ZA 4TTIA 5D84A 3WXMA 1E0SA 5IH7A 3E9NA 3GAAA 5J4HA 3LUBA 2EKLA 3LQ2A 4OP2A 4JJFA 4GPIB 4MUHA 1YS9A 3AEKA 1QZ3A 1UJ6A 1XGKA 4KCGA 3IEIA 2PMEA 3AJDA 1NLZA 4W5WA 1RVV1 4YAEA 1LDYA 3WRXA 4OSPA 1PEKE 4Q1EA 4J75A 3HGTA 2HJHA 2GERA 1WXDA 2QG6A 2BJVA 4P54A 4WXHA 4DQKA 1NXPA 1QJ4A 1U2ZA 3QIVA 3O1JC 3W4JA 1VDMA 3L43A 3DMRA 2PUAA 1MA0A 2O8FA 3ZTTA 1E79A 2WWWA 3VR6H 2VF8A 1YZLA 2NUTA 5CDUA 1Q57A 3HCRA 1VHWA 2AA3A 4EBFA 1T0HB 2A5GA 1A69A 3VZDA 1JEDA 3RIEA 2BM0A 4S1WA 3S8MA 3QPAA 1V95A 1FYWA 2WQZA 1NJ5A 1WPRA 2FDXA 2YMLA 4F9GA 5ITVA 4DCTA 2DPMA 2EDAA 2AJCA 4UDYX 3G9XA 1O6CA 1QFSA 3H75A 3R44A 2XODA 1EFDN 3F67A 4CDMA 4ERNA 1ISHA 1G2PA 3HCEA 1P4RA 4JJ4A 3DLHA 1I6KA 5KYVA 5IBQA 3LGAA 4RDHA 2VDVE 5AO9A 4UNIA 4A7PA 1DELA 1TJYA 4B34A 4QU8A 3QYJA 4U7WA 1W44A 5JJLA 1RXVA 2H1FA 4EF5A 5CLQA 3HA3A 3THRA 2J7PD 2FPRA 2H9IA 4KXVA 3FTNA 5FEMA 4CM7A 5K6TA 4PW0A 3GVXA 2A9RA 3K6RA 4QAJA 4DW8A 2VJQA 1ZIYA 3DDZX 3VVBA 3KALA 3EXHA 2VK4A 5LWQA 1LY1A 4IHJB 1NJ8A 4C0XA 3A2NA 2NO6A 4I5EA 4U8GA 3JPYA 1CETA 3S70A 3AF2A 4NMHA 5EJFA 3EZ2A 4JXJA 2ONZA 2X0KA 5FUYA 4LIPD 1J8QA 4ZT6A 1F9AA 4FKBA 4QFCA 3OE7A 3PWKA 1ECFA 1XK6A 1XZLA 4HN9A 3EPRA 3MLBA 4JJZA 1M1YB 2JJ2A 3HS3A 2GBPA 1GG8A 4TTPA 4WGGA 3TLZA 4C06A 1OX5A 1Y3AA 4QUBA 4HRVA 2WY2D 3U09A 1YHNA 1C1XB 3LTNC 2DETA 2CE7A 2I78A 1Z8FA 1C7JA 4GZMA 3BOSA 4QBGB 1GDDA 3WYFA 5HCNA 4TXJA 1ZCFA 4KGZA 2VG8A 4R0VA 3WQQA 4P4NA 1J0AA 1YCGA 4FJ0A 1Z3IX 1X7WA 2A30A 3WDLA 2JLQA 3U5ZB 4D97A 1J7KA 1GRCA 4FGWA 3JAKB 2PGAA 3BRCA 4D4HA 2ZXFA 3C1OA 1Y3HA 2VBCA 1QS0A 3GT4A 4M54A 2P9EA 4WN9B 3LUAA 4UU7A 4EW2A 3VKFA 1U94A 1Z38A 2NX2A 1ZONA 3HNOA 3JSXA 4N0EA 4C3VA 2QHXA 5KNDD 1EP2B 2PSHA 1EUCA 3U40A 4CQMB 3VU8A 3ENVA 3PXBA 1HOXA 1FNNA 4HG2A 2I03A 3DLPX 3KPWA 4NQZA 5A7HA 3O82A 2ZQYA 5HRAA 5FAXA 1CUXA 4W5RA 2X8JB 1JJAA 3E15A 3M6FA 4L8GA 1E62A 3KJEA 4RV4A 4QODA 2Z95A 5EWJA 5IT9A 5DX1A 1B26A 4ZVQA 1OPRA 2UUBB 3OWHA 1ESNA 3E03A 1X7XA 5BSGA 1Q7BA 1A71A 1LBSA 2WKSA 3RFUA 3WSVA 1H1LB 3CZ4A 3E9CA 3G9UA 3Q7IA 3CZ9A 3T9BA 3TL6A 3RTCA 1WCV1 5TLSA 1QH9A 5I6DA 4TMTA 2NXCA 2XXAA 3DKRA 4YJ2B 4DBVO 4EVQA 3DQPA 4DG9A 2ZB4A 4QU5A 3AI2A 2CXOA 1RQGA 3OCXA 4YEDA 5LJIA 4BNDA 4YJDA 5KSWB 3GLUA 1I4TD 3ITDA 2IXAA 3BWYA 3UQYS 3WQBA 3VU9B 2FR8C 3ELYA 3ROKA 4IR7A 2Z4TA 1AX9A 4FGKA 3R8CA 1YB6A 3D8SA 3C48A 2VQDA 4GMFA 3NUQA 5DYIA 1WD7A 4F5WA 4YUXA 2ZI6A 1H66A 2A7QA 2GZ2A 1KR2A 1XG5A 3WP0A 4JLWA 3MT0A 1T5DX 2Y0PA 4FI3C 3BL8A 1L7PA 4R84A 4Z9FA 4HYYA 4MLCA 4CF6A 4CCYB 2E55A 2XB6A 3SS8A 3U39A 4DLLA 1BFDA 2G5CA 4QAQA 4NZMA 2CBGA 3UK7A 4UDNA 1A1VA 1Z22A 1OXVA 3EYAA 4CEIB 3MJDA 1NUTA 1OB5A 4YO7A 2JAOA 4HRYA 2OCGA 5BOSA 2JFHA 4AG3A 2Y3IA 3BKXA 3IMCA 1RM0A 4D0LB 1G59A 1KZYC 3NCHA 3V32A 2CNOA 4ZEXA 3KXIA 2JCVA 2DB3A 1U2DC 1BVYF 4BVAA 1QJCA 1ZCJA 4JP2A 1ICIA 1KIFA 3LVBA 4JFRA 2ALJA 3TLXA 4A6XA 5EZYA 4WLEA 4YJ3A 4B6RA 1PV1A 2Q4OA 4ZO4A 1R3UA 4P7GA 3PHCA 4B3XA 5E38A 3VKWA 4X63A 1EUQA 4OUDB 1N9KA 4O33A 3RRMA 3VGPA 2JVKA 4AZVA 2PX2A 3MRTA 4OG2A 3MUOA 2PFSA 1Q2UA 4NBNA 4XOIA 4XQ9A 4BNIA 2IH4A 3T7CA 1KE1A 3CGGA 1C30A 2I6QA 2I7CA 4JU9A 3L1JA 1JAXA 3H97A 4QVGA 2O4CA 1FUYB 3T0FA 4P35A 4ETNA 3HSYA 3V1NA 3AP2A 3GCWA 3ECSA 4H7EA 2WYOA 3WLJA 5BWLA 1DBVO 1INLA 2OYCA 1NVFA 2W2KA 4PLZA 3TQSA 4HT3B 2BGWA 4YLYA 2PA3A 1MRNA 1WY5A 1EFCA 1ZJ5A 3BTVA 2GPWA 1C80A 2CLMB 4HDOB 4JKOA 4BMDA 3WAGA 2ZCJA 1IDOA 2PAAA 4PTLA 3E5MA 1FU4A 4ER6A 3VC1A 3GLIA 5B1DA 1M8FA 3OZUA 3LO8A 2UYGA 1G21E 5JLAA 1A96A 1C1HA 3WL7A 5JCJD 1LS1A 2CN1A 4FMDB 2CMFA 3HQ4O 2P6RA 1O89A 2HJ9A 1XZHA 1GUBA 4JLUA 1Y37A 2LBPA 1ZGZA 1NU8A 3IKLA 1T1EA 2I0FA 3N0RA 3EY9A 4IQ0A 5L3SB 3RGWS 2DH6A 1TU4A 3GCXA 2BD0A 3C6XA 2MSDB 3D3JA 4REQB 5ALZA 2ZJYA 4IXMA 1NVWQ 2P2SA 1N9GB 1U6KA 3OQJA 4V0QA 1N33B 2HRQA 4URVR 1TYAE 1E1CA 2GCPA 2OHXA 4Z2AA 3VDXA 3EZNA 4NZOA 1EHYA 3A0UA 4M55A 1NA5A 3GQBA 2XUZA 1XQXA 2IIQA 3VMMA 3N8IA 1GNVA 1UBHS 1WL8A 2O23A 2QUBA 1BOFA 4M9ZA 4ZVOA 1XAGA 2C9OA 3EEBA 3UXYA 1WHSA 2C2WA 2JZCA 2WSSA 2ZOSA 2I99A 2XUFA 3B3AA 3CW9A 3GVIA 1B76A 5ESDA 3UOGA 1N9ZA 4BC0A 4JV5B 1WKCA 1W4ZA 5JQGB 4UHDA 3GUVA 1VJ1A 1QHFA 3K1AB 4MR8B 3IILA 3ZCVA 4HV4A 1QGED 3ZWWA 4AD8A 1M66A 5TY0A 1NW4A 1NBWB 1FFWA 2C59A 3CMMA 4HGQA 2EG5A 3QWFA 2O3RA 4B0OA 3MIZA 4NAVA 3RYCA 4U2DA 3CNLA 4MQUA 2D7JA 4DBLE 2IEBA 4IEFB 4QQ8A 5FPYA 4V0KA 2VHWA 4E03A 3TW8B 4YGYA 2ZJFA 4LJ9A 1UIRA 4PC7A 3W90A 5AW2A 3D1JA 3FDZB 1JSLA 5D3QA 2QPAA 4EJ0A 2WF5A 3SD7A 4DJAA 5FORA 3ECAA 2OGSA 3QTBA 4X24A 4O02B 4DSNA 2RI0A 2ZTLA 5BNZA 4EY6A 2H3EA 2PGJA 4WVFA 3RIYA 1JDTA 2XNJA 5TT1A 4C6RA 2H92A 2PGDA 1OU4A 2ZSEA 4QUAA 4YJGB 2RGWA 4MO2A 3HLKA 4CIVA 2O2YA 1U3VA 1MGOA 4J0CA 1V7CA 3LMKA 4Z9AA 4R1UA 3UO8B 4JOQA 3PFBA 2E89A 4C5CA 4RK1A 2Y0EA 4MIKA 4ZHSA 1OZAA 4I2NA 4UUQA 4BCBA 1NIPA 4HNVA 5GJWC 3ZD9A 1E0JA 2I4TA 5BQOA 4UD2A 3IMKA 2IC5A 2GEVA 1VE6A 2E82A 2XVYA 3FJOA 3W6OA 2JAPA 3F46A 5BWBA 3AUJB 1GRVA 2ZUVA 2RDMA 1T5IA 2RHWA 3DKKA 4IHJF 1F2TB 1TCBA 4CV2A 4TSFA 5LBUA 1Z7GA 1AURA 4ND8A 1K4KA 2UZ3A 1GFZA 2CUZA 3V4OA 4LYDA 5JJBA 4M0KA 1USIA 1JG1A 2BP7A 5L3RA 5HCUA 2GLUA 4MW5A 3M70A 1KEEB 4A1FA 1VSBA 4ETIA 3D8RA 4Y2TA 4E6PA 1BGWA 4BV2A 1W1IA 1NFFA 3C8UA 3QBEA 4LBVA 5BVHB 2GXSA 2WT8A 2CXPA 4TTJA 2JKYA 5AI0A 1KL7A 3COZA 3L84A 1IB0A 4EUEA 3WAJA 1JPUA 1RAGA 5C5CA 1JLRA 1YBVA 1DX6A 1KKUA 3EFBA 3FI0A 1ZBDA 4HEHA 3Q3EA 2Q21A 1ABEA 1JHUA 2XNCA 4K87A 2Q8PA 3ROPA 4XWOA 2C7OA 3AETA 3JATA 3KWFA 1YMUA 5BW6B 2DF8A 4DQDA 3ETNA 1J0CA 1K66A 1V25A 5K9ZA 1I3NA 1XLTC 1FB5A 5FXMA 3TSWA 3ETHA 3W9BA 1H8ED 1IBMB 3U0VA 2ZBUA 1AV7A 2BGNA 2QI9F 1T3GA 4LGYA 3BIFA 2A7XA 1A8PA 3FBTA 1RHUA 3G2PA 4S3MA 2OHOA 1G20E 2GNPA 4BNWA 5F12A 1V7QA 2GJSA 3CW2A 2QD3A 3OCVA 3OURA 4K9MA 4HEA6 3HK2A 3RIMA 4ZALA 1DRWA 4FNOA 4EMUA 4KDFA 2X15A 4PC2A 2A9FA 5J5AA 4GVPA 4MGYR 3IO3A 3EG9A 3OQPA 1XMXA 2AD1A 5LDDC 5LQCA 4Q4HB 3NDPA 3BH7A 3Q15C 5AJYA 5EFZA 4M9CA 3V1TC 1TUBB 2C3YA 3IPLA 4NU6A 4C2AA 4Z9XA 3NGMA 1KDRA 5JYDA 3ZDAA 1YB7A 2VDQB 3REOA 1OC2A 3FWNA 3U2QA 3KVRA 4MK4A 4HX5A 1U2DA 4MRMA 3CF6R 1M8JA 3QEMA 4CIYA 1JIXA 2H16A 3IBGA 1GZUA 2XYVA 3TRKA 4IV5A 3TSAA 2XUQA 4ENPA 3FMOB 3GVCA 2DG2A 2ACEA 3HB4X 4YJ2F 4XPZA 4CL3A 5LXTA 5DNYB 1FX0B 4ZT5A 3TVTA 4ZA2A 3I9KA 3VUEA 1N2CE 1T6XA 2YS6A 3F6RA 3I39X 4MWEA 1T5TA 5BNWA 1UMKA 3DOHA 5CGQB 2QVGA 1OBHA 1CEYA 3ESDA 3SIWA 1XDBA 3T1VA 3HGMA 5CA0A 3G13A 3O84A 4N18A 2PXAA 4JBGA 2QE6A 1H42A 3EVNA 3IA2A 2IYTA 1GN8A 3R6WA 4O1IA 3BZWA 3EUEA 5ICMA 3OM9A 2XB9A 4R1LA 1HT0A 1YMQA 2ZI3A 2V4UA 4GYYA 4MUEA 1JLMA 4TGLA 3DZDA 3NM5A 1U9CA 1ZOIA 1ZW1A 3EZLA 1ACJA 3BXGA 1DV2A 4MW1A 3TAUA 4EG0A 2Y2VA 3GAMA 1NN0A 2HJVA 3AK4A 2VH2A 4BQOA 1BGVA 4R4JA 1A95A 2IUSA 3C3DA 5AKLA 3RNLA 4G09A 1YQXA 1XMVA 2QTMA 2HIAA 1AQLA 4LSWA 4TTAA 3O4IA 4GZLA 2QM7A 4JBXA 4PEVA 4DY4A 4UC0A 1FZTA 2Y9PB 1FMCA 1IY9A 3MTIA 2RHCA 2LUOA 3GA7A 4C9BA 3ZDYB 3OFND 1Y4SA 3KUDA 4RD4A 1KYWA 4KIUA 4R31A 2AR7A 3OJLA 3A4VA 3M1LA 4IH9A 3CFYA 3MOSA 5F64A 4D4IA 5KQLA 3ER9A 3CUKA 3NT5A 2XD4A 3UMBA 3WYGA 4EAQA 4ZV4A 5EE9A 3QFTA 2R6JA 3GRZA 5AVVA 4H15A 2V7PA 3R75A 4MAFA 3HJRA 1E32A 1J9ZA 3QVVA 5EEGA 1HXHA 2OBNA 2NUPB 2NAPA 4LF9B 4NZZA 2NXNA 3SIXA 4BGIA 2C9CA 4B3RB 1L8QA 2XCTB 2ZSUA 1J23A 4UNQA 3AP1A 5MFZA 2CD7A 3QUTA 3WJ7A 2M9MA 1OVMA 4B3CA 1HM5A 4MWDA 4EA6A 4V0LA 5KYKA 1OUMA 1NI4A 2FE4A 2NYRA 4LDPA 5FF9A 1T2UA 1HT3A 1VP3A 1WXWA 4CDNA 1WB9A 5C4GB 3F7MA 1W8IA 2EJUA 3AF0A 3RD5A 1CJCA 3U80A 4ZU1X 5EHZA 1T4MA 3W5JA 3R3HA 4XM0A 2X1VA 3ASZA 2BBOA 3ESAA 3Q2KA 2DHCA 1Z63A 4JSTA 3BQNB 4MKFA 5CH3A 4TPKA 3OICA 4GP6A 5AHXA 3CB4A 3T15A 4HVCA 5DWDA 4DLNA 2FEOA 1AKEA 4NJMA 5FOTA 6GPBA 1SOVA 1XRNA 5AK5A 3ICEA 4CIDA 4ZT4A 3TFQA 3KZNA 2F8MA 3FG9A 3OETA 5CM9C 2QGFA 1UBOS 4H60A 4OHOA 1JHDA 3PXCX 5EE5B 5DNUA 1UM9B 3QLJA 1BN6A 3T3PB 5CXUA 4UUOA 3NXKA 2VNAA 3PR3A 3CUWA 1ZU5A 3KPYA 5KCMA 5HTOA 1MX5A 4YI5A 4J0QA 3CY6A 4D6XA 3HNPA 1IH8A 1JKFA 4BFCA 1CUHA 5C2JB 1I94B 4QDUA 5M2QA 2Z9CA 3UOWA 1XJ0A 1CYDA 4F46A 5KNDA 3CX3A 4UHKA 1Z47A 2P4UA 4LWPA 2EC5A 5CX4A 3U7QA 4RDXA 4LYYA 5SZHB 4KE6A 3CX8A 4L6AA 1CF4A 4JL8A 3L02A 3RVJA 2Z6AA 3FZQA 2DKFA 3CPJB 3ONEA 2I2FA 1F3OA 4Y1FA 3ESZA 4BP8A 1UBCA 4DIMA 3DDHA 5MHTA 3G3EA 2CV0A 3H9QA 4X8HA 4GFDA 4NK4A 5EERA 1DJLA 2IV7A 1UINA 3GUUA 1GSIA 3QE9Y 2V7WA 3A1EA 1PJCA 2ZJBA 3PUKA 3ZBUA 2OG2A 1CJVC 1DKUA 4RF4A 2ONYA 3C3JA 2C2KA 1RMYA 2A0YA 1N2IA 1JFRA 4Q18A 3DZCA 5AJZA 2GEKA 1NW6A 2NZYA 3BH6A 3KV3O 3HYRA 3W79A 5LN1A 1RHKA 1Y1KE 3IL2A 1QX3A 2FZVA 3CF2A 4LV8B 3SP1A 1J25A 4IDBA 1RI1A 1BDJA 4Q00A 3WGIA 1GRRA 3L05A 4MZDA 4BKQA 1FW8A 3AUSA 4IQGA 2CVFA 2H1CA 5HSGA 4CKBB 4YAFA 3HRIA 2HRDA 2PKYX 3DT8A 2PWBA 4FXOA 3PEWA 2CXNA 3FMPB 3Q7TA 3ORFA 2RBGA 3K30A 2ORWA 4JYPA 4DCSA 4KAFA 1L4MA 1E2IA 2W4MA 3JQ7B 3E3LA 3QE4A 2GNOA 2BFDA 3WOHA 3PHBE 1SQGA 2O1EA 2ZB8A 1H2YA 2XI4A 3D8UA 2HIMA 5FUBA 3LE8A 3SXUB 3RKUA 4Z4EA 3P5SA 1HEUA 5K20A 4P1ZA 1IOLA 2O54A 2F55A 3A1NA 1F1BA 5C7YA 3WO0A 1Y4ZA 4PZAA 1JB9A 2BKUA 1J0BA 1SC9A 1MPXA 2ZFUA 3LA8A 2OCXA 3O38A 4J2HA 3JZDA 2YX1A 3KAKA 3MCZA 4CT5A 2UYCA 4DV6B 3ZE6A 1KF0A 4FGUA 4HNUA 4I1PA 4DNXA 1ZJ4A 2NADA 2X0IA 4YDHB 2AW5A 3STHA 4KREA 4IXWA 4XWGA 4HFRA 3EXG1 4DUPA 3KKEA 3OM0A 4U3JA 3C6QA 5PNTA 2QSUA 3R7LA 4BQPA 1XDZA 1N1GA 2HEGA 2XIJA 4N7MA 2WINI 2XTMA 3A9VA 3W3AA 3T3GA 3VNAA 5C7LO 1GSHA 3V55A 3T5GA 1IM5A 2ISCA 1E60A 2OORC 4LJ4A 1QC5B 2AF3C 4TTVA 1OILA 4PYNA 3BULA 2N1MA 2DWOA 4ZD6A 5IC5A 5EJEA 1E2QA 1FK8A 3L49A 2YWDA 2WKRA 4DDMA 4EJSB 2FPKA 2FX3A 4EY8A 3EGXB 3GUCA 3LCVB 4RFSA 5L6LB 4QHSA 2WA2A 1L5HB 3PGJA 4NU5A 4DIEA 2P1ZA 4LRXA 1CUEA 3TR5A 3NQ41 4E31A 4C14A 1NBHA 3TTTA 4WESB 4AO8A 3FTEA 1J90A 3I73A 2FQYA 3UMYA 2HNAA 5IX8A 3IDZA 1WZEA 2VRBA 3JTMA 5BR1A 3VPAA 1K4MA 3VYRB 1EXDA 2IRWA 1Y3DE 5D3MB 3IP9A 3CWQA 1N5RA 1ETHA 3HKBB 1UBRS 2IEZA 5JSUA 2II6A 4C7VA 2HRCA 1ZD1A 3LPCA 5HOQA 1XKLA 1SN7A 4M6WB 3Q8MA 3QX3A 1EWQA 2BFFB 1N6NA 1RXIA 3DOIA 5LB4A 2J0VA 2A9PA 1XVAA 4HNSA 3IR5A 5LYJB 7MHTA 2A5YB 2E18A 2VYND 3RIHA 2HBRA 3O8NA 1MB3A 4IZ6A 3TH5A 4B75A 4F6LA 2R2AA 1AKRA 3CURA 3TLAA 3FOZA 5TQ2A 1UXIA 5HK9A 2QTFA 3FRJA 1B0PA 4Q4LA 4BRUA 2O0JA 3U4HA 4CBVA 2JIZD 4JGIA 3CGWA 1T0JB 3WK4A 3PI6A 2NTVA 3BERA 3L82B 3U9TA 4DTCA 5JJIA 4UHFA 2ASVA 2HL6A 4N01A 1V39A 1VHQA 2XMZA 3GIWA 2IXGA 5AW4A 3EIOA 3R6GA 1TM2A 3A2MA 2GM9A 2W4QA 2YVKA 3T9EA 4D2IA 1DXQA 2JLAA 3V4LA 1VE3A 2P5UA 1MRZA 2CXHA 4MI6A 4BATA 5IRCD 1CS4C 1O3YA 4DDHA 3WLPA 1KGSA 1ODJA 1YWGO 1KOJA 1RXSA 2A9OA 3BIJA 2IYUA 4U00A 4WK6A 3ZY3A 1JALA 3PT9A 4KXYA 4A6EA 1SVSA 4ARSA 4F8EA 1A5BB 1ZNYA 3UJHA 2HRBA 1Q0TA 3BFKA 2PZFA 1U04A 2AFRA 1D0IA 4RTJA 3NALA 4F97A 2AC7A 2LPMA 3H17A 2ECPA 4BOYA 3MJFA 3QYPA 2ZM6B 3FIUA 3VVLA 3LIIA 3WK8A 4C5BA 1LKZA 2OB1A 4DSZA 5ICEA 5C52B 1XDDA 1ZITA 1DQYA 2IXEA 4OYHA 4P53A 4MDYA 1PWEA 3OX4A 1WXQA 3PUVA 2YXDA 1FFEA 5TX7A 2QX8A 5LQMA 3CH6A 3I2YX 2VNKA 4PX2A 1T4GA 2OPHA 1J42A 3MGAA 1WBBA 1OZHA 1Z6ZA 5TQ0A 2HFJA 3IDOA 1KKLA 1KO8A 1I10A 1K7XB 1OT3A 1XA4A 1ZG3A 3NTOA 3W7VA 5FBWB 4V0OA 1KRWA 3QEKA 1WSDA 5KI6A 2BFEB 2PHZA 3V1MA 3SVLA 2R7MA 1SQSA 2PCJA 4HXGA 1B14A 3HA2A 4IXTA 4DXDA 5IF3A 1IUKA 4MI9A 1H2FA 1E1RA 4Q37A 5LB2A 5K6AC 3D4LA 4HH3C 1JDJA 1JHPA 3CH7A 3H04A 4URUR 4C1NA 3LCRA 2ZYSA 3GRPA 2J0UB 3UMCA 2C07A 3R9KA 2O19A 3KCNA 4MTLA 3ZWKA 1MA3A 3NC0C 4GR9A 1P0QA 5IAKA 1VMIA 5FUMA 2VZ8A 3L41A 1L3IA 4WNAB 4YONB 2MJLA 3B1WA 4EFDA 3RDPA 4IS2A 3E22A 4EG8A 4MVJF 3BMCA 5BYKA 3TLGA 5IASA 2OLKA 3RT7A 5HQJA 4PQFA 3RSOA 3DS8A 4GX5A 4PSAA 5BPFA 2JANA 3TZQA 3VNBA 3FTQA 2ZRKA 1H6DA 1NXTA 4BNUA 1H8HD 4V1CI 3ADDA 3FSRA 3O4JA 2G6BA 2ZP1A 3CPSA 3PR1A 4I50B 4I9UA 1Q1GA 4X44A 3U4QA 1HEIA 1YRLA 1X9HA 1OFUX 1X80B 2H4HA 3WA7A 4H1WA 4ZIRA 1AS2A 4DRXA 4ZHQA 2I3GA 4JODA 3QUAA 2IXDA 4NEQA 3DBHB 2XDWA 4R68A 4D43A 1AHPA 2XR1A 2QL5A 1D07A 3DCIA 3RSSA 1DJMA 1X15A 5AP9A 3RODA 4KFUA 2P4SA 3W5IA 1CRZA 4B47A 1XPJA 4JSYA 4D3ZA 2PRKA 4LFBB 4RGVA 4JXZA 5IVHA 3VAAA 4QKQA 4LF8B 4NOKA 5G41A 1OD6A 1TT7A 2C8LA 2GB4A 3KVYA 3OEHA 1VXRA 1ZJZA 4FQ7A 5F3RA 3M3DA 3ZHTA 3NHUA 5JFOA 5B58T 1ULSA 4UBLA 4Q1AA 3F2VA 1CVIA 3QF4B 3M33A 4HMPA 2CNDA 4IW3B 3U0BA 1L7BA 1PJZA 2Q27A 5SZJA 4OKSA 1E3WA 5CURA 1U7UA 8ADHA 5K8LA 3L8MA 2VP4A 3IULA 5J4LA 3I53A 3B3QA 5DCYA 1QAQA 2Y0CA 2PKCA 1OR8A 1NW9B 2P9CA 4HH4A 5FTNA 1MJGA 3RAPR 1J56A 3G2MA 5BV2P 2BTEA 4L5IA 5FJJA 4CLXA 2XTJA 1JDNA 2XBMA 1FDWA 2C9MA 1BH2A 1YDHA 2WVJA 4E94A 4IUBS 5H4HA 1X0XA 3CNHA 1I5EA 1KPIA 3OKAA 2VTBB 1TB4A 3R9XA 2DUNA 3WDKA 3H11A 1GV1A 1GXSB 3ILVA 3TVYA 4QJ5A 1SWVA 1WIWA 5LBIA 2WG0A 5EJAA 1R9JA 3FE2A 1FDIA 4LJ7A 3INYA 3RADC 2X9NA 1BX1A 1ZUNB 4RU1A 1RJ9B 4ZI2A 3JVUA 4GQBA 4QJIA 4UEOA 3EWAA 4RNCA 1L7OA 1ADJA 3MJRA 1LJLA 4TXNA 1ZVMA 3WHKA 3HDVA 1T8PA 4TV9B 1U0NA 1W5AA 1KORA 2CLOB 3ZGVA 1SQ6A 2CHUA 2OK7A 4Q1FA 3GZNB 4C0LA 4PU0A 3ZBQA 1YBAA 3AH8A 1E7RA 1L8AA 4RPHA 4QJ4A 5KQSA 3AIOA 1ISRA 2JFOA 2W71A 5A5GA 3PA8A 1N7IA 1MG5A 3VQTA 4CMGA 2BSQA 2ZYWX 3ASUA 1FY2A 1HK7A 1Q3TA 1NZFA 2QRKA 3G0IA 3LKVA 1YL7A 5E7MA 4BV8A 3ZWQA 4J7XA 2ZR9A 2Q1TA 1HNWB 4DYVA 1BQ3A 1NQOA 4DA6A 4RD6A 3AR4A 3KR9A 5DBEX 3MWDB 4KYIB 1Y5MA 2O7QA 2R65A 1EBBA 2BFCA 3NFYA 4LRSB 3GLIE 1YQDA 5A9SA 1E2HA 1RS0A 3GNSA 3PE4A 4QHYA 4ALKA 1TQ2A 1C7EA 4EQ6B 4EGQA 4HH0A 3SM3A 2W00A 3FDFA 4BGUA 2HLNA 1JRLA 4RF3A 4G0ZA 5EJ7A 4QOIA 2HRRA 5HDBB 1DCFA 4QXPA 1P1HA 4S2UA 4JI1B 4ZT3A 4AJ9A 4IIYA 3ABSB 1PFQA 3H5WA 1G3RA 1O54A 4JZKA 4DT1B 1S2IA 1YZ3A 3CTPA 3ZS8A 1Y4DE 1DUVG 2ZTMA 4KAJA 2RHJA 4W4TA 1P8JA 3JD2A 3T9FA 3LCMA 3WBKA 3NDJA 1BAPA 3R0QA 5A03A 3UXMA 2IHNA 3QXCA 4PQRA 1U1CA 3TL3A 1OX4A 5IAAA 4MW7A 3LY8A 3GGOA 3ZWVA 5JC1A 3AGPA 1AMNA 4K6GA 1QYDA 4PM4A 5T6MA 1E4EA 4MVJD 4GE0A 4QEDA 5HZGA 1NP6A 3UGQA 4H3KB 3IDSA 4EHAA 2WM8A 3LBAA 3PXXA 4Q5IA 3AVWA 1KZ6A 1GPKA 2I7XA 4L9AA 4RSMA 1KEVA 2HSGA 4IJVA 4TM7A 2QN7A 5J4VA 3WQSB 1TCCA 1SK9A 4ZV9A 2HMWA 1W0JD 2HBYA 3N2KA 5ALXA 1A82A 1OLUB 3MQ4A 4HDRA 4EG5A 3I4FA 2I66A 2YV5A 4Q4AB 4ZYYA 4FDMA 4M1MA 2PS1A 2D8MA 2JI7A 4QUDA 1FYEA 4XDHA 3EGEA 3QEBZ 1AKMA 2ZRFA 2IH2A 5SYAA 5IM4F 3IEMA 1JMKC 1MO2A 5IWAB 4PLWA 4JKIA 3GX1A 2NXJA 5HM8A 3QLVA 4BFZA 4KUEA 3UUEA 1Z88A 3ZUGA 4WOBA 1VHTA 3RKSA 2XWJI 1GZ7A 2QR5A 4U5QA 4B85A 2Q4DA 2P65A 3RBXA 3GXOA 3KSMA 5AQEA 2P62A 2I1LA 1XN4A 1LI7A 2IY9A 4AWXA 5K6RA 1AGRA 4NFYA 3L8YA 1H2XA 2W83A 4JD5A 4PQGA 5J2TA 1ECJA 1U80A 4R2KA 5ALFA 2D2XA 3F5DA 1EE1A 3NRBA 1DQNA 3O95A 2EV9A 1U5BB 4XYBA 2XXBA 5AW7A 4Z4QA 3NWBA 2AG0A 3D4IA 4K46A 2DT8A 4H0FA 3KO8A 3OWXA 4KACA 4U6NA 4AICA 3WLAA 3B3FA 3EZFA 4LXQA 2NUBA 4G25A 1J99A 4TMZA 2BY4A 3A0RB 1VCHA 4FX5A 2YZNA 1YOBA 1N5MA 3ZC3A 1R37A 1WWKA 4ND1A 1XTSA 1NATA 4PGMA 5LNK6 2AK3A 3L7LA 3PGVA 5AKYA 1RCTE 1VFPA 1IM2A 4BQEA 4Q9LA 3ON5A 1Z5UA 4DCUA 4FK8A 2FW0A 1E1DA 3PIIA 4K6HA 1BDBA 3U3XA 3ZNOA 4GLFA 5K2OA 1UWKA 1JFLA 1BXRA 4QSHA 1G66A 1FFXB 5FUWA 3CINA 4Y1EA 2O5VA 3QU2A 1O96B 1ZWLA 1EGAA 2OXCA 3ESCA 3Q9NA 2WQ7A 4TRNA 4XGKA 4AP6A 2WKWA 1NMYA 2SNIE 1K5PA 2WJWA 2ZRHA 5FBVB 3I2GA 4EBBA 1NXSA 5TEWA 4RDIA 4YRQA 5A4KA 1TO1E 4LY0A 1QZZA 1SOMA 4NAHA 4RD3A 2QQFA 4NHOA 2CXUA 4NH0A 4XRRA 1BXGB 1IJFA 4HQOA 4RZ2A 2PV7A 3VZQA 4CUKA 1XNQB 2PCLA 4KE8A 3MINB 4YRCA 1CZUA 1DBRA 2IOFK 3GY0A 4IVRA 2EBUA 4QDJA 1SCUB 1KY3A 4R05A 4RJKA 4UUMA 1IEVA 3DL7A 3EIUA 3OOJA 4I46A 1H2RS 2VQ6A 4RMGA 4RH3A 3Q3VA 3OM1A 3AIMA 3CRW1 1ADCA 1KOFA 4QPJC 5JWRA 1XDUA 2YWCA 3FWPA 4YMVA 3DGEC 1IN7A 2C92A 1OIWA 1F8UA 4Q3KA 4DADA 5JI2E 1LQTA 3SZOA 1KVSA 2IGTA 1T8YA 2GYWA 4EFLA 1ZH2A 5LMCA 3O47A 1NOJA 5HBRA 3AEKB 4NOMA 4OMFG 4RQTA 5EOVA 5J58A 4LISA 5EVJA 4I9GA 4UNPA 4BUCA 3GEDA 3HU1A 3OAAD 3EYWA 2R0QC 3HZHA 3D31A 1TM1E 3DKIA 5CAEA 1V8ZA 4FWTA 2C0PA 2VC2B 3L0SA 3K71B 3TRIA 4OHCA 4JX8A 3BH0A 2O8FB 2BEKA 1NR7A 4N82A 4PS1A 4LX8A 2JKZA 4G9BA 3PF8A 1RAIA 1ZIDA 2IYEA 2XQFA 3A37A 4Q9AA 1R6DA 4OXNA 3RC7A 3WQRA 4TQ9A 3STXA 2WUVA 3H1TA 5CT8A 4LRUA 3NZEA 3O1LA 2O2DA 4WNYA 4E30A 3EUFA 3NP7A 1UKVY 3LC7O 3WIBA 2Z2IA 3O74A 4RE5A 5D7NA 3NWOA 3D7NA 4PWZA 2OKCA 1VL5A 2C4WA 1M10A 3D6TB 1UPBA 4HNHA 1EGMB 2AG6A 3EOAI 4AY5A 1XEWX 3JX9A 4GOMD 4FYJA 2ZSDA 2ZT6A 3Q11A 3K0FA 2CLHB 2GCOA 3ND9A 2PUTA 4ROSA 4D80A 4YT2A 3H6HA 4TXMA 3F73A 2XNHA 2G67A 3SZMA 3UA4A 5AESA 3K9NA 3M6AA 1WDMA 1IG3A 1X1AA 4O3MA 3AEXA 3DOFA 3GZJA 4RLFA 1KQ3A 4UBKA 3EXHB 5FBLB 2ZAMA 3E5HA 4GPEA 1E6MA 4MI3A 5G4KB 4F5DA 2QRMA 1KQGA 5FKJA 1ORDA 4NOJA 2PNJA 2OBXA 1ML4A 7GPBA 2B6NA 3KQVA 3ML1A 4O59O 2WJ3A 1EVQA 2WD9A 3C2QA 4QYSA 1OH7A 4KN5A 5CFMA 1N1MA 4JI8B 4LMAA 1FFYA 4QTZA 2QTNA 2A67A 1M1XB 1V7PC 5ENDA 1D4OA 1FBTA 1ABFA 5I4KA 1C1DB 2XOEA 3HABA 4JP5A 4P3PA 1F8FA 3JD0A 3B7PA 2D6FA 1MJGM 2VYNA 3V9AA 1MP0A 2EW8A 3DEJA 3BCHA 2H2HA 4H7KA 1HKHA 1OXBB 3D6MA 2V55B 3PRYA 3F3MA 4A0HA 2UXCB 4PG7A 4YAOA 3BMQB 3OHPA 1VHJA 1X7DA 3SLKA 2JIZA 13PKA 3E9DA 4YUAA 5JOQA 4J8PA 1U9JA 3Q3CA 1UEJA 3LPMA 2IPOA 4UM8B 4NICA 1QZUA 3KJFA 4CG1A 3J7AC 1X7WB 3RH0A 1P7WA 10MHA 4OPMA 3F9RA 4O6VA 1TKCA 3EIXA 4TV9F 2QZ4A 1VBNA 2FUG1 2VJPA 3VTAA 5AUNB 2X7XA 1QS0B 1XP8A 3RSHA 2ZJ8A 4BJ3A 2OQIA 621PA 4WUTA 3MT9A 1E3IA 3GD5A 3E9EA 3ZZMA 2WUDA 1AOXA 1P77A 1E2FA 1TKBA 1EUCB 1KK0A 1JV2B 1Z37A 1C8LA 3QE0A 3NAGA 2Q3JA 2G72A 1MCZA 3PQ3A 4HDNA 1OU0A 1GTL1 3SZ3A 3ENZA 1NNLA 1RWWA 3WB9A 1YS7A 9LDTA 3GMDA 4FCTA 2AXQA 3IT2A 4B7ZA 1TEHA 3O8CA 3WWCA 2JZNA 2G9QA 3RV3A 5EWJB 2J4FA 3GH3A 1GU1A 2GD1O 2J85A 2FTKE 4PY2A 2O2IA 1HZJA 1NYQA 4MB0A 2K7ZA 2E6UX 4YCBA 1CY6A 1YS1X 3DD1A 5HF5A 3SQNA 5JMTA 2DTXA 1FXSA 1KVQA 4BMNA 4XLLA 3FHCB 1U0EA 2XXAB 1JZSA 3T8YA 4ALNA 3IOEA 4W5NA 3L4BA 4FZ3A 2WP8J 4AZ3B 3MMNA 4H6WA 4BNDB 3HVHA 4DR6B 2YJ5A 1LZLA 1HT2E 5EXXA 3S2GA 1ES9A 1KYQA 1ESDA 5EGSA 3P5BA 1GOTA 2BCEA 2A59A 1QIEA 3Q9SA 4PS0A 1N4AA 4G5FA 1EYZA 1H3EA 5K0FA 1E9VA 3VPHA 4AI6A 4I1RA 1MEEA 3KQNA 4Q9IA 1U8TA 4QUHA 3QH4A 1NMEA 3WIEA 1QYXA 1Y7TA 5GOTA 5CVTA 1TCVA 4OVKA 3C8ZA 2DBZA 3PWZA 1OI3A 5EKUA 3I3OA 4QRIA 5L45A 3PC8C 3WFZA 1I4OA 2BMAA 3QVUA 3A8TA 3A9UA 5JNVA 3PQCA 4RHCA 4BAGA 4F5ZA 3F8TA 1L9KA 2WM2A 3RRJA 3W1EA 2P1DA 1GZHB 1E9BA 2R6DA 5BOSB 4B3HA 1EFTA 1F6BA 3HB9A 5LJLA 1OGYA 2ADMA 5L4LA 3I8OA 2CXXA 2IYRA 1KAMA 1MJNA 1QG0A 2PY6A 2HSWA 4WOJA 2C1XA 1QBKC 1ONNA 1SU6A 5EZYB 4YJ3B 1R8XA 5CNKA 1EDDA 1LNZA 3X1ZA 3LD9A 1VKRA 4US1R 1YA6A 2XB2A 3AEUA 1TVEA 1NT4A 2XQIA 4JVLA 2QW8A 2VZLA 3AJ9A 4IFEA 4IGAA 5TMEA 1I80A 3IAS6 3QJYA 5AW5A 3ADCA 5KSZA 1EJBA 2FPLA 3NVDA 1C0EA 4RC9A 2HCRA 4AJ4A 4GYWA 2WYWA 5JRDS 1XBTA 2DR3A 2WWXA 3FROA 4KKXB 4X3OA 1L4GA 3DE4X 3ZWNA 4JYZA 5LYYA 4ZMRA 1V43A 1A77A 1QG2A 3IUYA 2G9ZA 4YR7A 2W2KB 3AJAA 3B1ZA 4NNOA 4EQZA 4EKGA 2B3DA 5DISB 1ADFA 2IBMA 2AZDA 1A5SB 3G5TA 1SIOA 4G63A 2LE0A 4IIGA 5JD3A 1N75A 4CRWB 3HHEA 3EIFA 1SB8A 1SIWA 4UVGA 1BH6A 2X23A 1H1TA 3OMWA 5A6SA 4MWGA 4BKPA 4EY5A 5JXIA 3T5DA 4KI0A 2H4FA 3JQDA 3RIGA 2Q3DA 1GCGA 3FGNA 4OQDA 3L6CA 2VTKA 2QLTA 3HLYA 4WK0B 4YRBA 2IEGA 2H51A 4CR7A 5JAOA 3A06A 1LSUA 2EKQA 1EHIA 2ZVDA 3HXLA 1E5VA 4R8MA 1W48A 2GCIA 3T9DA 3AFGA 3L7MA 1WMDA 1NRWA 1E1CB 2ZSJA 4A0RA 1K2VN 1BEEA 3C98A 4RTPA 3GQBB 1G2IA 2PLNA 1GWNA 2VUSA 1WW2A 4QYMA 1V3QE 2WKQA 1A5ZA 3GA0A 3LQFA 4I7EA 4K26A 4Z8YA 1FW6A 2L18A 5KTYA 5C81A 4BC1A 1I2AA 4QPCA 1RYYA 2OEPA 3AHEA 4NBVA 3IBFA 4MDEA 3CTMA 1HORA 3AUKA 2F6RA 1XSEA 1TKAA 3THWA 4S0XA 2LXNA 4YP1A 3ZU2A 4Q93A 5DLEA 1E59A 4I4LA 2VFAA 3L0CA 4E4RA 1A76A 1FSZA 3CX4A 4AIIA 2E1PA 3RUHA 1JDUA 1LWOA 4JUFA 5JT1A 2H4ZA 3H4MA 4RADA 3RYCB 4KVZA 5K3EA 1I0LA 1AN0A 2IDJA 1S02A 4B8ZA 1V7ZA 3PX2A 3YASA 3VC3A 5ECYA 1HA3A 3QUCA 2FPPB 5A9TA 2L82A 1GAQA 2PEZA 2VPQA 2G7MC 2P5TB 5FTLA 1XAJA 3DP7A 1MMFB 3D7KA 4EATA 2X8WA 4DKJA 4L4YA 1C7IA 2OCBA 4OM8A 4Z4HA 1NPDA 2PT5A 4W1PA 4W6ZA 1HZZC 4CKXA 5IDXA 4GKVA 4Z54A 3CZCA 3ROFA 1P31A 2ZAYA 5IZ4A 1ZX1A 4CMEC 4Y1GA 1CV2A 4QBFA 1R8SA 3U19A 2NO0A 4AQ7A 2X9LA 1L3BA 3RO7A 1IWBB 3FRIA 4JI0B 3E70C 1RKQA 3MJSA 1X1EA 4MWZA 1A9SA 1K75A 3T4EA 3AC0A 2R1VB 4TKUA 4D8WA 2V8BA 1MC5A 1T35A 2XX3A 3KYIB 4FYVA 1THZA 4I4IA 1CBUA 2ZWPA 3ROXA 1L5OA 3IT0A 2G17A 3MBOA 4HQRA 1RYNA 4HDKA 2UZ1A 2ADFA 3LKDA 3OG9A 4LX0A 1TTPB 3HCNA 4LZAA 4ND8B 4E5SA 1PZHA 4ARZA 1E6KA 4LK2A 2XE4A 2G04A 3L8EA 2BP7B 2VI5A 1M34A 1W0JA 2A92A 3QLTA 3DPSA 4JL6A 3UXHA 1V8BA 4NL4H 3CVYA 3IH5A 1VYTA 1KH3A 1BC5A 3ABOB 1Y4UA 4FGSA 1Y5NA 4PCAA 5DNWA 4DAEA 2HWXA 4P9NA 4TKLA 5IHPA 4O2AA 2A8YA 5FOSA 1Z6YA 2DBQA 2PQ6A 4PPNA 1G8FA 1QGYA 4BY9E 2KLBA 2FPMA 1UFQA 2LV8A 2O7VA 3CSDA 1IK4A 2J41A 2XQGA 1U28A 4B79A 3PCTA 3VHRA 4F96A 4XVUA 1PHRA 2PQ0A 1KZ9A 1F7VA 4M1TA 2HPVA 4ZZ3A 2BFNA 5B36A 1KJ9A 3AETB 3JATB 4PZ9A 3GLFA 4YAIA 1WNTA 3TGPA 3OZ7A 4KPFC 4M87A 1RYZA 3L9XA 1FQWA 3NHYA 3NHFA 3NBUA 1BU8A 5BV1A 3DAOA 1G3UA 2QQ5A 1NJ1A 5A6VA 4OSEA 3JAWA 3WGLA 1DBWA 3DH0A 3HLTA 2CUKA 5LDHA 2D1YA 3I2JA 1KP2A 3B48A 4GI2A 3JASA 1T24A 2OR3A 3ZCXA 4DSAA 5BWCA 1T8WA 1U0FA 4AL4A 2Z2KA 4RHEA 4X5OA 4BXOA 4ZRNA 3VM6A 2XZOA 2PUVA 1GKKA 4G8CA 1DP4A 3EG9B 2AEJA 3MMXA 1XMPA 3RT1A 4BB5A 2V7UA 1SU7A 1IVYA 2Q3MA 2CF6A 2BE7A 2AGVA 3SYLA 1EUYA 3DBOB 1W0KD 4ITVA 2WWFA 1GV0A 1GA1A 2GEDA 2HZ7A 2PR2A 3K2IA 1H4TA 1RT9A 2WFAA 4KJXA 4OQPA 3ZVRA 1IBSA 4HY3A 3KLOA 5JAPA 1KXJA 3ELBA 3CHYA 1CUWA 1Y6RA 2IYPA 2ODNA 1WDTA 3B6IA 4MINA 3QEMB 4MRMB 3OIFA 3JARA 2Q7XA 2VWGA 2RGNC 1YKSA 4S35A 4FDTA 4C43A 1DEHA 4C7MA 5LXTB 2PKRA 2TSYB 3EWNA 5EZQA 5H02A 4ZANA 1C9DB 3GP5A 4DA4A 4IOKA 4O2BB 4A15A 3H0EA 1WO8A 3W9UA 4YRTA 3NIBA 3NMUF 1T8RA 4J1NA 5A71A 3W7BA 4ZI7A 5L53A 4UVEA 3ILXA 4RK5A 1EH5A 1ZIXA 2C5AA 5B12A 5CA0B 3H86A 1VPTA 2JDID 2CJWA 4WQMA 2QY6A 3PSAA 5EMNA 2BYTA 5ENVA 1W5FA 1G16A 2FHSA 3BB4A 4PICA 2REXB 1PNOA 3M9WA 5HKBA 4XGRA 3ZWDA 1EVZA 1P0PA 2J6HA 3F71A 1QO0D 2BHTA 2GAIA 3OAAA 1HLGA 2OKGA 3CPEA 3EE6A 3LO5A 4HWRA 5T3YA 2A33A 2A78A 4V02A 3A9RA 4DMUB 4EITA 1CQIB 3ED1A 3IJEB 3EEYA 1YR9A 3FUUA 3IXMA 2WMYA 3K6JA 1SVKA 1TEZA 4IRXA 1DGQA 2JIDA 1RPAA 2LNDA 4CM3A 2WTXA 4N49A 1J00A 4PRLA 3THXB 4KMRA 4Y6OA 4JXKA 3HN2A 3HUFA 2NXWA 2OV8A 4GOLD 2BISA 3IBYA 4A8HA 1ECGA 5FPSA 4EJFA 2AMYA 3O94A 4CMHA 1WV0A 2BEWA 3ZVNA 1BD4A 4EI9A 3D0OA 1T1SA 3DFKA 3VMFA 3MTBA 1GNSA 4F8JA 1H1DA 4M49A 3FUXA 1EDBA 1QIIA 1X7ZA 1ISMA 4J49A 1Q22A 3PFNA 5B1YA 1WF3A 3PPWA 4J1SA 2VDNB 4PNZA 3GG2A 4U2CA 2R6FA 3BGVA 5AJTA 1COWD 4I55A 3JQAA 5KNLA 1KI1A 2PK3A 1UQUA 3CEAA 3OHMA 3EDOA 3ZE9A 3AERA 4F1WA 3SQWA 3JD1A 4N9WA 3ZW8A 4DBLC 3KC2A 2C1ZA 1DAEA 2CSXA 5IJ0A 3DXFA 3Q6NA 1YZYA 1A2QA 1CJUC 2FWNA 1BW9A 2EX4A 3G89A 3ET4A 3MTJA 4ZTZB 4C08A 5KOJA 2V97A 2WSIA 5L3ZA 1NI4B 4QOGA 1GVHA 4AB1A 1NLYA 4F93B 2WM9B 2VYFA 1JEAA 4QOHA 3TB4A 4F0JA 1DDOA 3PLAE 2OT3B 4F06A 4QXQA 5CLIA 5EXTA 4X8LA 5C0OE 3RTAA 4G5GA 4CLOA 2PX3A 1FRZA 5CG2A 4BJ6A 2HIGA 2Q5LA 4X1OA 2P79A 4DR4B 1EFKA 1YZGA 3WLOA 4G1MB 2OQRA 3T7EA 3CKLA 1NVVQ 5FYDA 3O0DA 3VOSA 5BSVA 2JCYA 2ZVPX 3T7TA 5MGBA 1X8LA 2D59A 2Q99A 2RKBA 1MENA 3H2HA 3S44A 3WG9A 2D5CA 1Z83A 4LC9A 4HLCA 3K3PA 2X40A 4P4UA 1E9RA 5AW9A 3WLHA 4AY4A 1HZZA 1U4NA 1E1LA 1QDLB 4UBNA 2C78A 4MKXA 5J63A 5I7AA 3R1IA 3KKZA 4CMEA 4ZCSA 4Y6PA 3SX4A 3AVVA 2WTAA 4J2OA 1JQKA 4C22A 2N0SA 3B13B 1CE8A 1K6XA 1NVDA 3EMVA 4UTOA 5CMLA 3JY6A 4JIMA 5DOZA 3ZQ4A 5JWOA 2XLBA 2PZBA 1E2PA 1RYEA 2Y1CA 4I3FA 3TUIC 5JNSA 2JI6A 2C2ZA 1XZCA 2WSMA 2G36A 5JMWA 4JNKA 1JYFA 2C2OA 1DUSA 1U2PA 4C29A 4G07A 5YASA 4BV3A 5KMGA 1KS2A 4HD8A 1J24A 1AKVA 2OG1A 1E6EA 3U3RA 3F97A 2OHHA 1Y1QA 4ZAXA 2QG4A 4FYHA 5B2EA 2VS1A 2PRIA 1CUFA 2RJ3A 1D1TA 1K27A 4CGYA 1Z35A 1KI9A 4HAZA 3L77A 4G5QA 3D4BA 5JVDB 3VH4A 2EATA 1VG1A 3WLFA 4B2LA 3NHMA 2E5WA 3FKSA 4S0ZA 4DCNA 1DLJA 2OYSA 5DI9A 2AG8A 4BNNA 1G38A 2F8TA 1FXWF 2ANCA 3KQYA 3ITEA 4RY0A 2TRSB 4RK6A 2VT7A 1DG1G 3A6PC 4GE3A 2HPAA 2D2IA 1K92A 4JB0A 2PA0A 1PR3A 2HXGA 2G76A 4KAXA 4LQCA 4UDOA 5DHQA 4B0PA 3PRKE 4BP3A 4N54A 3D8TA 1AQ6A 2RI6A 4Z1OA 4BVGA 5JDIA 3N3BC 4P3NA 5CM2Z 5IDWA 1UBFA 3NR2A 4L0QA 1AKTA 3G8AA 3H1PA 1X1CA 1BKYA 2Q9AA 2JARA 4MUNA 4WKPA 2Z30A 3K4QA 4C4TA 3BICA 1PS0A 3IRUA 1YC5A 5DM1A 3L1UA 5TXGA 3LZ6A 1UWCA 2WWHA 4LYAA 2ZB7A 2UVPA 3COPA 2GHRA 2C88A 3OCCA 3UHAA 4NNPA 4B40A 2JL1A 5KC9A 4V0NA 1N2JA 1WS6A 2X6TA 1OQAA 2IZ0A 5C51B 4MV9A 5FDFA 2NM0A 3EAGA 5SICE 4URYR 4TLMB 2XRZA 4V1CA 1XN1A 5LMZA 4U3JB 2B5WA 5DCLA 3SXJA 1D6SA 1ESEA 2E3JA 2PLWA 5EUBA 3DMNA 1Z0SA 2D7CA 3BXXA 2VAVA 1XQYA 2I3BA 2B99A 4K6MA 1NI5A 1PJAA 3WGNA 4KQGA 1X1QA 4MV8A 3AW9A 1KSHA 3V6MA 4CHTA 4D9EA 4F4FA 2Q1YA 2Q49A 1N5LA 1SHLA 1IEXA 4YBZA 2IPXA 2C95A 3GYGA 3O5AA 5DI3B 3TKAA 4LF5B 4LJRA 1T0PA 4RFSB 2QP9X 2R5FA 3QKSA 1LSOA 4ZVMA 5D00A 1M6WA 2XVXA 1OXXK 1GNQA 1Z17A 2FXIA 1NZJA 4POAA 1GA6A 4I4TB 5GMOA 1LPMA 3DAGA 1Q0LA 4QDOA 4OM7A 5ALTA 1BJTA 1W1UA 4Z3DA 2PZEA 2GPNA 4BUZA 5WRFA 3UJAA 4U7DA 3D0QA 2BGKA 1AZWA 5HJ5A 1AA9A 2EZ8A 5AJVB 2O5RA 3BK1A 4B09A 3VUFA 3THYA 3BJIC 4GKBA 5F23A 3GDGA 4EG3A 5J40A 2ZJOA 1PQWA 4FCWA 1G98A 1TE2A 1CRQA 3OTGA 2HWYA 1L9XA 3G2KA 3QTLA 1J8MF 1QNFA 1VKJA 2W2PA 4F4DA 1JDBB 2XUIA 4J16C 2G6TA 2YUTA 3GMIA 1BEUB 3C7TA 1KHHA 3EFEA 4FUQA 3WL4A 1P0FA 2BGLA 5TQ2B 3ZN2A 3ANLA 4UFPA 5AHRA 1AGYA 3FCCA 4N7JA 2ZZNA 2MIIA 2AF4C 3KYJB 1D9ZA 5I9SA 4OGWA 4BRSA 1FIUA 2FW9A 1MLDA 4XCXA 3R7BA 2WJIA 1ECLA 4D25A 1ESZA 1KY5A 2KLHA 1OV6A 3FYUC 4NDZA 4E14A 4MDHA 3BE6A 1P7ZA 3AF1A 2QG9A 3I05A 4FQ8A 3RUFA 5HVNA 3HXTA 2JAHA 4NENA 5LXTF 1WRBA 3VKHA 3T9CA 2ZSFA 2O20A 1W19A 3HPQA 4NOLA 4XI9A 2PX5A 3LBYA 4O2BF 4RVSA 5LIPA 2XYRA 2HF9A 1L7QA 1Z2OX 4MYHA 3AHGA 3BIXA 1TMKA 5JSZA 2Z43A 4MUKA 4TWRA 4YGXB 3EJWA 3DAFA 2CMDA 4MJLA 4C0BA 4D4GA 3TEFA 3LLSA 1Q6YA 3RUIA 1TM5E 5CA0F 4LQLA 1E3QA 2E7ZA 2PYDA 3UJ8A 3UK2A 1YJAA 1UC5B 1PQUA 2LIPA 2XB4A 2GK6A 2OCYC 3MC1A 5EWMA 4TYWA 2I6FA 1GUZA 2HU8A 2UZAA 1S1MA 2ZIVB 4ZAWA 3ES9A 1NPYA 3NDRA 3ETGA 4OBXA 2BRUA 4KMMA 5TQ0B 4KOEC 4DA7A 5HZMA 1VRWA 3A9SA 3C43A 2CZCA 4BBPA 2AC4A 1W2GA 3K1ZA 3ICWA 2VTDA 3C3WA 1Q7GA 4HX9A 3RS3A 3EC1A 3UJDA 4JB2A 2JFGA 4HWGA 1J2RA 1RRKA 2VAMA 1H6CA 4K9QA 1O94D 1XOIA 2C04A 1IEQA 2R6CA 4ZEMA 2G8LA 2O2CA 2QRZA 3FZYA 2VDMB 1E5TA 2GMWA 2WWRA 4AJ2A 4MYTA 2GPAA 4A16A 2R8EA 3C3BA 4Z7QB 5KCZA 4REMA 3OJWA 5KNBD 4AQYB 4ZCLA 2I67A 3B7GA 4TS9A 2IOYA 3A3PA 3E22B 1JXAA 1IHXA 3BMCB 4X45A 3TLGB 4ALIA 3NOOA 4LZNA 4KSYA 5HUQA 5DM60 4ZVSA 4DR5B 3B1YA 4IZIA 3H1BA 1SVIA 2XNSA 1PV2A 4NYJR 2HX1A 2JAQA 5EQDA 1MX1A 2FMTA 3JYOA 1L3CA 3AVTA 3ABQB 1FMFA 1QIHA 3HYTA 4M1EA 3G17A 2G83A 4G0VA 3VR5D 3ZDXB 4WFJA 3R7DA 1KO7A 5L3VA 2W6QA 3U4QB 2CK3A 4WIAA 2CLSA 2HXYA 3LX4A 4XH9B 1BE0A 1XRQA 1RLIA 3MA0A 3ROMA 1ST3A 5JCOC 4CKEA 2IEDA 1Q0ZA 2VAXA 3UMRA 4FFPA 4BX3A 4DRXB 4E3WA 4ZIRB 5TVKA 1LGYA 5LKRA 3FY4A 2IS2A 1MAUA 2Q6IA 2FI1A 3T34A 1MV5A 5FNVF 1E61A 1TCAA 3CQ9A 4AZTA 2IZ5A 5CT6A 2SKEA 2OV4A 3HBJA 1N2GA 1Z4KA 4B8WA 2F1RA 2QTWB 1CJSA 5KYWA 3BREA 3AFIA 1U2QA 2X86A 5G0UA 5IHXA 3AGQA 1D4ZA 4BEBA 2G70A 2BBTA 4TVOA 5FBQB 4AIRA 4DGQA 1PL0A 4YLGA 2RHLA 3U3ZA 4HLNA 1GYRA 3PQFA 3A6KA 3IO5A 3KU4A 2W5UA 4INOA 1ZXXA 4RAQA 5A04A 4NE2A 3WZLA 3GJTA 1N2HA 3AHHA 4CT0A 3JWHA 4ZCIA 1XA0A 1F7UA 1JSZA 5KNCH 3X1KA 1JQAA 1YL6A 2H7CA 1NP3A 4TYPA 3ACBA 3EMKA 4Y1RA 5SY4A 1YU6A 2OFFA 4DIKA 4YCLA 4QRDA 1A50B 2YZKA 4LYFA 4RK0A 5G0VA 5JANA 1E3LA 2M6RA 1ZXLA 2HXSA 1WCIB 1CRWG 1KH1A 4TLEA 5IK2D 5D6OA 2Q8NA 1E5XA 1SKBA 3E9QA 5H59A 5A3JA 5AKJA 5B6IA 4L74A 3VV3A 2AYXA 3CUUA 4TMKA 2NPFA 3RJTA 1P61B 3GT0A 4AF6A 3CC8A 1YFZA 4PAWA 1L5KA 3R9XB 4AYWA 4TRJA 2IU0A 1G6Q1 1KPGA 1P3DA 4HXFB 5H3LA 3H11B 4DCPA 4UTNA 1W0KA 2Y1OA 1CVLA 3PQ5A 2Y1XA 3TZLA 2WDZA 2MSEB 2EFGA 3UPDA 4OU4A 3QLUA 4QXMA 4L76A 4RWZA 1BNCA 1RYMA 4EB6A 5JVDF 2YV2A 5JQGA 3ZK9A 2RKOA 1QKJA 3CZ5A 4M8LA 4EVRA 1UBLS 3JRWA 2NV2B 3PZBA 2VPWA 3AWIA 4YECA 3RV4A 2IOFA 3RVBA 2HUNA 3W4KA 3QU9A 3E8MA 3RJMA 4AUNA 4FYIA 3KWMA 4FE4A 4BRWA 5JMOA 3IIMA 4F8YA 4INZA 3WLTA 1GYQA 1MT0A 2HI0A 3O6VA 4YCSA 4IF6A 2XMGA 2ZYHA 5FNZA 3H1FA 1OWNA 3W1VA 3AIIA 2XCIA 1LUAA 5FB3A 4A8JC 3LX5A 1KP9A 4JI7B 3KJZA 4EI7A 5AJWA 1EE9A 1ABBA 5EMMA 3SAJA 2FF5A 2BGMA 1MH1A 4CTKA 3WGVA 3I62A 3S1AA 3U4DA 3L8HA 2CLEB 1IPEA 3NHWA 3EEFA 3D3WA 5K3SA 3K70D 2AC2A 1FDRA 4BNMA 1UKZA 2Q6LA 2BFCB 4JC0A 1LJ8A 2WF6A 2WR8A 4X93A 4RX1A 1FJGB 1ODSA 2BELA 3MFQA 1TYCA 4F3KA 3SYNA 4EGFA