4PWYA

Crystal structure of a calmodulin-lysine n-methyltransferase fragment
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
250
Chain Sequence
GSVRRFESFNLFSVTEGAWVQYTSIFCPEYSISLRHSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCFLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLILTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-lysine N-methyltransferase
publication title Crystal structure of a Calmodulin-lysine N-methyltransferase fragment
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 250
sequence length 263
ec nomenclature ec 2.1.1.60: Calmodulin-lysine N-methyltransferase.
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pwyA00
4FS8A 2OKCA 4RVGA 4YUYA 4E2ZA 3OCJA 5E8JA 3BT7A 4KW7A 4OA5A 5ICEA 2GA9A 2AN4A 4F84A 4YMGA 3GWZA 4HGYA 2V74B 3FPFA 4YUZA 5GIOE 3HEMA 1XDZA 2ZLBA 1X1CA 4NECA 4AZWA 2ZBRA 5MHTA 1D2GA 3KQVA 1YB2A 4M38A 2YXLA 2G8NA 1L1EA 1QAMA 5DTRA 4DF3A 2IFTA 4ZTBA 5GWXA 1EAMA 1F3LA 2ZSUA 4CKBA 2PGXA 1P1CA 2WA2A 3EGEA 3OU2A 5EGSA 2ZWVA 3EVDA 3KR9A 5BXYA 5CCBA 1KPHA 3C3PA 5HIKA 1M0EA 1KHHA 1UFKA 1FP2A 3QOWA 4PYJA 3KKZA 3FUUA 4XCXA 1WY7A 1WXWA 4U7PB 5ERGB 5F2OA 3B7PA 4MHTA 2P8JA 1R8XA 3M6UA 4OQEA 2AOXA 3KQMA 3QOXA 5DT2A 3UJCA 2I9KA 4HSGA 1DUSA 5E1MA 3M6VA 3G2MA 3MQ2A 3A25A 3VC2A 3DXZA 3DULA 4QVKA 1NT2A 1SUSA 1FP1D 2AN5A 1EG2A 2QRVB 1SKMA 4E2YA 5E2AA 5K01A 2IP2A 1B42A 4P58A 2OBFA 1G8AA 1R8YA 5EIFA 2Q41A 4YUXA 1YFLA 4E32A 3BKXA 4FZVA 5DWQA 1MJFA 5CVDA 1WZNA 3G8AA 2O06A 4PGHA 4RTPA 1VL5A 4ISCA 3LBYA 5EMLA 4PYNA 4PNEA 3DMFA 2PT9A 5LQNA 2C7PA 5BP7A 3HA7A 4C06A 2IH2A 4HTFB 3KU1A 4P7JA 4QPNA 2OPBA 1IM8A 4B17A 1JTEA 2IBSA 2N47A 1RI5A 2JHCA 1VP3A 2H00A 3OU7A 5LQRA 3NW9A 2B2CA 3HCEA 3LDGA 2HV9A 3TLJA 4WXHA 3KR0A 1ZGJA 1N2XA 2PX5A 3HCCA 5FHQA 4KDCA 1SQFA 4LWOA 1NV9A 2NNWB 3OE5A 3T7TA 3PVCA 1D2HA 2PLWA 1FBNA 3CC8A 2QY6A 4RSRA 4CKCA 3B3GA 3HTXA 4FSDA 4RTKA 2FK8A 5JR3A 2ZIEA 1WS6A 3ER8A 5K0BA 1X1AA 2HMYB 3B5IA 3KR2A 3OPNA 2XYVA 3R9XB 1PRYA 2GS9A 3CJRA 3IHTA 1JSXA 3ID6C 3OE4A 4IKPA 4YMHA 1AV6A 2NP7A 1BKYA 5JUWA 3FYCA 4CXMA 5CCXA 1R00A 5FCDA 5GM2A 3I58A 5K0GA 2GPYA 3H2BA 2VDWA 4R6WA 5LQCA 3M6XA 2H11A 3C6MA 3G5TA 1XCLA 2DULA 3AXSA 2P41A 3R3HA 1KYZA 1XCJA 2K4MA 2HNKA 4QVGA 1NE2A 2BR4A 3PT9A 4CWAA 5HIMA 5T6BA 4C03A 3UBTA 4QDKA 3P9NA 2CWWA 5GIPE 1JR4A 1WG8A 3CJTA 3MTEA 5E9JA 3AJDA 4IV8A 5C1IA 4PYLA 4XUEA 3TOSA 2KW5A 3GRRA 3T0IA 3VSEA 2G72A 3LCUA 3M33A 2I62A 4FR0A 3FRIA 3IYLW 3KPJA 5GP1A 3HCAA 3BXOA 3UJBA 3NWEA 2ZULA 4LWPA 2NXJA 5EHIA 3TMAA 3PFGA 2PWPA 3CVOA 5EMKA 2PXXA 1NW6A 3DXXA 1L3IA 3HVJA 1JG3A 2C7OA 3PX2A 1YF3A 5ICFA 1SVUA 3TPZA 4F85A 3P9KA 2GLUA 3I64A 1RI3A 3P9CA 1HNNA 1NKVA 2AVDA 1P39A 3EVEA 5FQNA 5BW5A 3CJQA 4GC5A 1JG1A 4U7TB 5HIJA 4C08A 1RJEA 4E2WA 1MHTA 2OZVA 4X41A 5B1SA 3JWHA 3LKZA 1R6AA 3NTVA 5EG5A 5K0JA 3O4FA 1Q0TA 3K6RA 2IDJA 5EPEA 1KPGA 1VP9A 4R05A 3TFWA 4DM3A 4HG2A 2Z6QA 1YZ3A 3UJ7A 3PS9A 4DKJA 1KR5A 3HCDA 2YQZA 2PBFA 3TKAA 2ZZKA 3REOA 4ER7A 1UIRA 3SSOA 4PWYA 5DX8A 3R6TA 5G02A 2PX2A 1NBIA 3PTAA 3L8DA 2OXTA 1D2CA 2YUIA 4V0QA 3I5UA 3JWGA 5F2NA 3E7PA 3NVKI 1IY9A 3LKDA 2AN3A 2ZTHA 4PYIA 3SXJA 1N7JA 3LGAA 3BWYA 5ICGA 2FYTA 3HVKA 2PWYA 3A26A 3DTNA 1YFJA 3G8BA 1I4WA 1O9HA 2B25A 5DPMA 1QYRA 3BGVA 2BM8A 5E1OA 2AOUA 3PX3A 2VDUE 2FRXA 4BP1A 1P1BA 4E70A 2Z6AA 5E9QA 1OR8A 2O05A 4KIFA 3A27A 3MTIA 5E1BA 3GRYA 4HH4A 2ZBPA 1ZG3A 2BR3A 1UWVA 4HRAA 3DP7A 3MHTA 3DH0A 4E31A 5K05A 5KQSA 3EEYA 5M5BA 3EVGA 3KQYA 1XXLA 4M7RA 1JG4A 3FTDA 3E05A 4PYQA 3GNLA 3EGIA 4YUVA 5CVUA 5HFJA 3SM3A 3JWIA 2AZTA 4R6XA 3LDUA 4RTSA 1RJDA 4P7FA 4GOMD 1XDSA 3BWCA 2IGTA 4PINA 3BUSA 2PXAA 3SGLA 5DM2A 2VZ9A 1ZHFA 3HM2A 3X0DA 5HILA 4HGZA 5CVEA 4Y2HA 3OZRA 2CKDA 3BKWA 1JTFA 2P7IA 3O7WA 3WSTA 3SR4A 3HP7A 1KYWA 4FP9A 5LR6A 2VDVE 3NVMB 5T67A 3LX6A 4DZRA 1DCTA 2CL5A 3EGVA 5CIYA 1KP9A 3ELWA 3FUTA 2IH4A 2VP3A 3M70A 2QE6A 3UZUA 3V97A 4EKIA 5ICCA 2OYRA 3FPGA 4EKGA 2AS0A 3TRKA 4ER0A 1L9KA 1Q0SA 1EJ6A 3G2QA 3OU6A 4OQDA 2ZBQA 2UZ4A 1NBHA 3IV6A 2NXNA 2YXEA 3OZSA 4H0NA 1XDUA 3T7SA 4AZSA 1JSZA 2WK1A 1VBFA 1FPQA 3FTCA 3B3JA 5EMJA 2LD4A 3GRZA 4C07A 4RTLA 2PX8A 4GQBA 1WXXA 1N7IA 1VE3A 5LQKA 3E8SA 5EZSA 1P91A 3B89A 2FHPA 3HCBA 3KPYA 3BWMA 3O31A 4FT2A 3TKYA 5CUQA 4EMSA 4RTMA 7MHTA 4YV0A 1HMYA 5KS2A 3PLAE 1XJ5A 5GM1A 3KR1A 5EKXA 5DXJA 3GU3A 4EQZA 1SQGA 4QDJA 1SG9A 2YXDA 1I1NA 2HTEA 3CBGA 3F4KA 2YVLA 5EIWA 1X1BA 3KQTA 2G1PA 5CVJA 3THRA 2ERCA 3HA3A 2BM9A 2ZIFA 1U2ZA 3MCZA 4MWZA 2EJTA 4XUDA 5FUBA 3FPHA 3SX0A 2B78A 5C0OE 2AOUB 3P97A 2C7QA 4PIPA 3RW9A 4DA4A 1FJXA 3DMHA 3UJ6A 4YV2A 1QAQA 5IH3A 9MHTA 5DLYA 3GO4A 3LCVB 4WVLA 3DOUA 3LSTA 2FK7A 4X60A 4V0RA 4ER6A 5EKUA 4P7KA 2ZCJA 2OO3A 5FA8A 2PV0A 4PIMA 4RVHA 3BWBA 3NDJA 3EVFA 5LQUA 4OBXA 4RTJA 3KHKA 5BW4A 4CTJA 1G6Q1 1NW7A 3IEIA 3S68A 1VPTA 4KRGA 3EVBA 3LHDA 3U81A 3M4XA 2BR5A 3G2OA 1KXZA 2PSSA 2FCAA 4RVFA 5DTMA 1NW3A 3P2KA 1AQJA 3PFHA 2YX1A 5HZMA 1V39A 2OB1A 4BLVA 4DQ0A 3FRHA 3OZTA 5EVJA 4GF5A 5GINE 3NWBA 4DMGA 2IBTA 1EQAA 3UA3A 2ZVJA 3G89A 4R8SA 3BZBA 4PCLA 5FQOA 2AR0A 3SSNA 1VLMA 1XTPA 4C4AA 3KQWA 4EK9A 1Y8CA 3GIWA 1G38A 1Z3CA 3FTFA 2P3OA 2ZZMA 1EIZA 3UWPA 3HCFA 4PYMA 2HWKA 2DPMA 3LPMA 5DRYA 3FTEA 3R24A 4AUKA 4OA8A 2YR0A 3THSA 4AZVA 3DMGA 3LDFA 2ZFUA 1T43A 1VIDA 5FHRA 1L3CA 2ZZNA 3SMQA 2NXEA 5DSXA 1ZKDA 5E2BA 5K8VA 2YTZA 4OBWA 3VYWA 2UYHA 2NP6A 2ZWAA 1ZGAA 4GOLD 3MCTA 5DSTA 5HIIA 3BGIA 3GJYA 4Y30A 3G2PA 1YUBA 1F38A 3NMUF 4HC4A 2P7HA 2PY6A 2ZW9A 1KPIA 2NXCA 3A7DA 3EVAA 3G5LA 3LECA 1BC5A 1O54A 1QANA 1TPYA 4O29A 4YV1A 1JQDA 4X63A 5EMMA 4CKEA 4QQNA 5EOVA 3ANXA 5EEHA 2JH8A 2UYCA 3UJ9A 2ZIGA 4MTLA 3EMBA 3A7EA 4PYOA 3I53A 3NJRA 3P8ZA 3C3YA 4RTQA 3CGGA 1JQEA 3OFJA 4KVZA 3GDHA 5EC8A 3T7RA 2JG3A 5LSAA 2JHPA 2XYRA 2EJUA 4M37A 5D1HA 4MQ4A 1O9GA 2G70A 5FADA 5FULA 3RODA 5K09A 1NV8A 3Q7EA 2FPOA 2PX4A 3FUVA 4LECA 3FUXA 5FTWA 4A6EA 2IPXA 2P3LA 3GXOA 5D1NA 2JHAA 3Q87B 10MHA 2I6GA 1TW3A 5FA5A 3UJAA 3SSMA 4RTOA 5K03A 2A14A 5HOQA 3DR5A 4Z2YA 4PCAA 2AVNA 3UJ8A 2OB2A 3KQSA 4PONA 2AOTA 2OY0A 4RTNA 1NW8A 4X1OA 3TR6A 2JH9A 3HVHA 3P71T 3ME5A 3KPUA 2F8LA 1BHJA 4BY9E 1BOOA 2P3QA 3ELUA 3QV2A 4M36A 5DXAA 4POOA 3GGDA 2O57A 3BGDA 3HNRA 1KIAA 3R0QA 4G56A 1JQ3A 2IH5A 4GEKA 4UOEA 3NDIA 8MHTA 1JG2A 2P40A 5FWAA 2WA1A 2PJDA 3GRUA 3VC1A 3V8VA 4R8RA 3DLCA 3DLIA 5CVVA 2EG5A 3MGGA 4QPPA 2QM3A 2BH2A 2AOWA 1IXKA 4GC9A 4DCGA 4FT4A 5K0CA 3EVZA 2Z6UA 2O07A 1H1DA 3MAGA 2ONZA 4GOOD 5K0NA 4QQKA 4BLWA 1XVAA 5DM4A 2ORED 3LL7A 3P2IA 4KIGA 5E1DA 5IKMA 2XVAA 3EMDA 4E30A 3P9IA 2GH1A 5EZQA 3MB5A 4P7GA 5U4XA 1EJ0A 4GOND 4RYLA 4CTKA 4PYKA 4ER5A 4E33A 2UYOA 5CD1A 2ESRA 1NW5A 2EX4A 1R74A 2XVMA 2Y1WA 3D2LA 3KPWA 1QAOA 2P35A 2B9EA 2GB4A 2PKWA 2PT6A 5HEKA 3TM4A 4RTRA 3B3FA 3PB3A 1X19A 2EFJA 3FPEA 2VS1A 1ORIA 1TW2A 2R6ZA 3FYDA 5DRTA 5P8WA 2UYQA 3AY0A 5DM0A 5K0FA 1I9GA 4IWNA 4K6MA 3I9FA 4LG1A 4QTTB 4F86A 2GAFA 1R18A 5DX1A 4FGZA 3ORHA 4PGGA 1X1DA 4YUWA 3DXYA 2C7RA 2PXCA 5F2KA 4DCMA 2H1RA 2JJQA 3KQPA 4FSXA 4C04A 5C9ZA 5K0LA 5H02A 1RJGA 4AX8A 3G7UA 4OX9Y 3KQOA 3CCFA 5GOZA 4A6DA 5DX0A 5CM2Z 3UFBA 3AWIA 1AQIA 1L3BA 2G71A 2QRVA 2Y1XA 3LCCA 3ER9A 4RWZA 3FPJA 3AXTA 1INLA 2E5WA 2R3SA 5LQAA 3C6KA 1DL5A 5LQJA 2XBMA 4KDRA 4KWCA 2CMHA 3GCZA 3GRVA 4IV0A 5FWDA 5DTQA 2AOTB 5DM1A 5KVAA 3OFKA 2O0LA 3G88A 5EHGA 2P1DA 4RX1A 2ONYA 4X61A 2HR1A 3ELDA 5E9WA 3ERCA 3UA4A 3FZGA 3EVCA 1QZZA 3LBFA 2NYUA 1RJFA 3P2EA 4HTFA 3RIEA 4C05A 1M6EX 4E2XA 4GUAA 1RI2A 1ORHA 1G55A 3FUWA 4JXJA 2PVCA 1SUIA 3DUWA 5E8RA 3M6WA 2AOVA 4RV9A 3JWJA 3C0KA 5K0EA 2B3TA 1ZQ9A 3HA5A 1RI4A 3UJDA 2QYOA 2XYQA 4EVIA 4XUCA 5KYGA 1M6YA 3EPPA 1RI1A 3TQSA 3KQQA 4QTUB 3SVZA 4L7VA 1AF7A 1G8SA 3MERA 4MIKA 4RVDA 5T64A 3TM5A 4ATNA 4ER3A 2BZGA 1YZHA 3EEOA 2IDKA 2CMGA 1G60A 3KPVA 3A4TA 2I7CA 4BP3A 1VQ1A 2ADMA 4BLUA 3CKKA 3ELYA 3HVIA 5EEGA 4AZTA 1PJZA 5KQRA 3E23A 3K0BA 2IIPA 5EQJB 4GBED 2V7EA
chains in the Genus database with same CATH superfamily
4GI5A 2VDRB 3PXGA 2OZLA 2RBGA 2X7XA 1IH8A 1L4UA 1XDBA 2QW0X 3A1TA 3PQ3A 4FZRA 3S7ZA 3TD9A 5BW6B 3I8SA 5FF9A 4Y8VA 3L92A 2QL7A 1CU1A 1NXWA 2X77A 1KZGB 1O0CA 3M1YA 1BCSB 1RFGE 3H7IA 3KQVA 4PZAA 2W6JD 5CFQA 5F5NA 1QPZA 1OJ7A 1V8DA 2O2JA 3KJZA 1N33B 5HF9A 1H0RA 1GNQA 3LPDA 3C8DA 2ONKA 2L0XA 3AJRA 5EGSA 4KRYA 2QX7A 3E7XA 3I4CA 4HWSA 1KPHA 4MLDA 4XM2A 3QOWA 3JQ7B 4OHBA 3TB4A 5DYWA 3G79A 4G5QA 1QO9A 4A8JC 4YACA 5CITA 3QBVA 1POWA 4NDNE 3MWLA 2YJZA 2VFAA 3NRJA 4N76A 3AM3A 4X54A 1XD2B 1DV2A 4ZOLF 1NF9A 1QF7A 4AUEA 3U4IA 1V4VA 2FP3A 4I5IA 4KO3S 3ZQ6A 5JS8A 3C3WA 5K45A 5IT9A 3KZNA 4FGJA 8ADHA 2WYUA 2ZT8A 4DPKA 1NVDA 3AV0B 3NHJA 5TMBA 3UC9A 2PPLA 1VA4A 1BXRA 4HN4B 4OSOA 5EIFA 3RT7A 4B4UA 3QUSA 5T8KA 4C4RA 4IIUA 2F1RA 4OVKA 1MJFA 3DTTA 4TPKA 4D4HA 2WHXA 3EFOA 4FYPA 1HNXB 3LC7O 2GGSA 5LQNA 3HCWA 3P32A 3PYLA 3FN4A 3HA7A 1KI4A 1QR2A 1SG6A 4HMOA 4KO2S 4Q93A 3KU1A 4WNCA 3AUFA 4LFBB 3BEOA 1IE3A 2Y68A 3BF8A 3CUTA 4ZOLB 5AVJA 2BM1A 3WOVA 2D5AA 1Y89A 5I3ZA 4C7OA 3QI2A 3M2PA 2PKYX 4JOSA 3I23A 3TLJA 5A0TA 2I3GA 1N2XA 4HGOA 2O8DA 5KREA 4N5NA 2IYNA 1NZJA 3H04A 3GRAA 4QECA 4DUPA 5D5QA 5AIBA 1GJRA 1M0SA 3QKUA 4J16A 5BYJA 3R7BA 1AUOA 4X1IA 4CKCA 3K70C 1TLLA 1XEWY 4B83A 1CF2O 2H4XA 2JIPA 1EX6A 1FXUA 3CE9A 3ZXIA 1ISMA 4B6RA 4EW2A 2R4QA 3P9RA 3NT5A 4R9SA 5CCDA 2H8KA 1WZUA 3DE6X 4QNNA 5AW0A 4EY3A 5L51A 2P9CA 3B20A 4DN6A 4L3VA 1JHXA 2CFOA 1M2VA 3FYCA 1M7GA 3OFND 4G25A 3WMFA 4Q18A 5FBQB 4DWWA 3G49A 4BLPA 3A4IA 2WINI 1XMIA 3M6XA 3UJHA 5DP1A 2RH8A 1QF6A 1DP4A 1TLFA 1R5NA 4G9BA 5A4AA 1X14A 4UE3S 3VH3A 5T6BA 2GK7A 3ZK8A 2NACA 4J4HA 2CWWA 1KZ6A 1U2EA 1XA3A 2JFBA 4LXQA 5E9JA 1YS1X 1VSQA 1DQYA 2PBLA 5DSZA 5ENZA 4P2BA 5AUOB 4KFSA 1LPPA 3LYAA 2XVYA 4ZVPA 4XUEA 1OILA 1JIVA 2GFQA 4WL0A 4Q4HA 4MRSA 3WISA 5BN3B 3AGQA 2HZBA 2DCMA 3PR3A 1BVRA 2HUNA 2YOFA 1TQDA 2OHIA 4OFBA 3RGWS 2JFUA 1E3IA 1T2VA 5DHAA 1U0SY 1IN6A 1GYQA 2NXJA 2W11A 4B7UA 4EEZA 4ZZ0A 3N7TA 1W44A 4MZXA 3RSGA 4O2BA 1BJRE 3WC4A 2H9YA 1PK7A 2DFKB 2VLBA 5GZ6A 4YRPA 3S55A 2DGDA 3RYHA 1H5UA 1QUFA 1U0FA 1U98A 2GOYA 3A06A 3DLPX 3DNFA 2A9KA 4I5EA 3TPZA 3TZHA 2VDNB 1RI3A 4MQFA 1KMMA 2PGLA 3PEWA 3OIYA 1Z12A 3S99A 3PC8A 4J49A 5JNLA 1M10A 4FYIA 1RQNA 1G5PA 1SU8A 1Z4KA 5F7JA 2GEJA 1DTEA 3KEQA 1FTQA 3B1ZA 3ZZTA 1QIDA 3L4JA 1K92A 1C3LA 5KMGA 1TX4B 3NM6B 3V1TC 3PP8A 4Z4GA 2IS1A 2JJMA 2HU5A 2IDJA 4EIWA 1RQRA 3RVMA 4N4AA 5JATA 2GF9A 2Z83A 4IIFA 1VP9A 1YRHA 5AI4A 3LWBA 5ELMA 4D4IA 4DM3A 5FWYB 2IS4A 2ZBFA 3PS9A 1UDRA 3HWX1 3H9EO 4U0KA 1HX7A 5EPOA 2I91A 2M6RA 2X1LA 1QZTA 2JJ2A 1CKEA 1EJ2A 4IZOA 4DG9A 5G02A 5KNLA 3PTAA 2YUIA 4C89A 1EB8A 1YI0A 1GRNA 2A86A 3QPAA 5CRIA 3MWDA 3DFIA 3JRNA 2C04A 2EWWA 1W93A 4P32A 3DBOB 1PYGA 2Q62A 3MT8A 3OQIA 4RE5A 4D3XA 5HX7A 4EHJA 1HGXA 4L9RA 1NVGA 1SQSA 3PJRA 2BLLA 4KLRA 1NG1A 1QRTA 1N8KA 3INNA 4HEHA 1XAGA 1T34A 4LV8B 4EHLA 1UKZA 2D1QA 2PQ0A 3OVMA 4KACA 4KPUA 2OHGA 2ZRPA 4MI1A 4BP1A 4EPXA 2GPAA 3MUFA 3JQCA 2MSWA 4ARBA 1AZLA 2D6FA 4KR6A 4DHEA 1Q0UA 1Z73A 3QEMA 1IOLA 2A5JA 2PBZA 3RSZA 4GSYA 2D0OB 4HRAA 1KYVA 2C59A 2QK4A 2EBFX 2ZG6A 3MHTA 4C14A 4KXUA 2ZROA 3NBFA 1Y3BE 2ZUSA 1U0JA 1DG1G 4AJHA 4CI9A 3I0NA 4OAPA 2A57A 4ZQIA 2D2XA 1YBVA 2WYHA 3KL2A 4Q9DA 3TG8A 5HFJA 4CCYB 1XTIA 3HV0A 1QKJA 4R6XA 4OI0A 3SIRA 1LTHR 5BQ3A 2VIIA 3FF1A 4PNHA 4YCSA 3WK7A 2I80A 2E2WA 1I01A 3R7NA 3F73A 3PGLA 1W59A 4X3CA 5IXSA 1J09A 2Z9DA 4HGZA 4KXMA 3RFXA 1G2IA 4X0EA 4C0AC 3A9UA 3HGTA 1H3FA 2BL4A 2R6AA 3NTXA 1JTFA 4BQNA 3WQSB 4ZGGA 2Y8EA 1PTJA 4DL9A 3MS7A 2QUHA 1FFWA 5IX8A 3TD2A 1RS0A 3C43A 3QPWA 1YS9A 3TNLA 1M9NA 1H9CA 3O8QA 1RJWA 2I99A 5CDTA 2QE6A 4MR8A 1ENPA 1H6BA 1HE8B 5DHUA 3WGOA 4ER0A 3GFOA 4IQ4A 5REQA 1ZW6A 2R6HA 3W05A 3BFVA 2V4MA 4Q15A 5EJ8A 2WF6A 4DDHA 4LJYA 2FWBA 3A2KA 3TGLA 1GCIA 3S2FA 3T5DA 1TAHA 1FPQA 3PXBA 3D5TA 1QQAA 4RTLA 1M6VB 1C7JA 1YL6A 3I6IA 4HDAA 2C7OA 2R85A 4QD3A 2QG6A 1G42A 2X58A 2V3VA 5BRAA 1EFRA 1P91A 3K15A 4RQBA 3BWMA 2XWQA 4TX1A 3CWQA 5FPPA 4B0OA 4AY5A 4C3VA 2P6RA 5DVZA 2D4HA 3E18A 4WZZA 2YWXA 2C2XA 2ZXFA 3NJ4A 5DEOA 3HDVA 1E5TA 1H2HA 2EATA 1K0UA 2HTEA 2HWWA 3CBGA 1CJCA 5JASA 3V00A 2HPAA 2D0IA 3WAKA 1QHEA 4QGHA 3R23A 1GRRA 1CUZA 2OHFA 2KM1A 3B1XA 3H0KA 4XUDA 4AMVA 1O6FA 1YV9A 3C4QA 4KSBA 4A8JA 4ZTUB 2AOUB 2C7QA 1XLTC 5CXUA 1EFPB 2YRWA 3NEAA 4IR7A 2PCLA 2UUCB 1BVYF 2G1AA 2ZAOA 5JSKA 3NHMA 1XZCA 2W2NA 2ZCJA 4K0RA 2OGWA 5FA8A 4C6TB 4F3RA 2QQFA 4OREX 3QLEA 1T5OA 2HA6A 4QXOA 2JVIA 4XGNA 1HLPA 2YNMD 3FNQA 4HS4A 1G20B 2VHVA 3GK3A 1PSDA 3KD3A 1IEWA 1ECGA 1GLGA 1K9VF 1TUBB 3VNRA 5GZ3A 3I5YA 2CYBA 4TYMA 3L7DA 2GA8A 4K1XA 4Y18A 4BMYA 2V7VA 1GGEA 3TPFA 4GIBA 4QFBA 1Q3TA 4B71A 3M4XA 1BTOA 4RCYA 2BR5A 3NQ41 2H1OA 1P2FA 4BJ3A 2DECA 1U2DC 3D6NB 1YE3A 2QVXX 4KN9S 4RSHA 3ZR4B 1V39A 2OB1A 4KE8A 4BLVA 4ZCRA 2ODPA 1USUA 2C1ZA 4BO0A 2HK8A 1VIYA 3GOHA 1P2GA 1QFMA 2ZUWA 4HD8A 2DUNA 5KPJA 2ZIZA 1X39A 2RKBA 4W9MC 3SC4A 4KJXA 2NOAA 3ZWNA 4ILKA 2ZYUX 1BS9A 3U44B 1XJCA 2PTHA 4IP0A 4O4JF 2HF7A 4BFXA 4HAWA 1NVAA 3OLWA 2PM8A 4W1PA 5DO9A 1GLNA 3TW6A 5HQTA 5I5EA 3GX1A 4WXMA 4X84A 1ZDMA 5DRYA 3NJ8A 3BMNA 2HF2A 1IIRA 2CN1A 3GPIA 3L6BA 4OA8A 4BKQA 3W5AA 4JT9A 2GBIA 4ASUD 2ZZNA 1O7JA 1CUCA 1W85A 2QRHA 3GH3A 1P80A 3VGJA 3GLIA 1UK9A 1ZGAA 1XKTA 5CURA 3EPRA 3FVRA 1F38A 1QHNA 2H51A 1NLZA 3KS9A 5SZJA 4C21A 4ILEA 2PMEA 1PV1A 4HLDA 4ZEOA 5K8UA 1JEQB 3EUWA 3QP9A 4YV1A 2ZRIA 3EE6A 1U1FA 4Z4FA 1Y5RA 3MRVA 1F51E 3QYFA 1WW8A 4AY2A 1K89A 1K27A 3B5JA 3EN0A 2Y99A 2N1MA 1CUFA 1G5TA 3BQMB 4GU5A 1XTBA 3ZI0A 4L5IA 3KAPA 3GLGB 1EYZA 1AGNA 2YWEA 3VVLA 4HVLA 5TGDA 1U6KA 1FZTA 3K6KA 4FKBA 2AA3A 2HBRA 4FJ2A 2AC4A 3T7RA 2DUUA 2EBWA 1Z47A 2VYVA 4B6OA 2EJVA 3HPQA 1Y6ZA 4GWGA 2EJUA 4II7A 2O50A 4M55A 4N3GA 4GSLA 5BP7A 2G70A 1QGYA 4MWTA 3F49S 4QUDA 4RHTA 4C76A 2WZBA 4GE0A 4CDMA 1ORDA 3TLGB 3AIKA 3JZMA 3OMWA 5LXTF 2NAFA 3E53A 1ISRA 2IU3A 1VYVA 1T91A 3DBLB 5CLJA 2EQBA 4RW0A 4R2JA 5K03A 5AKHA 5LKAA 2VHWA 3CRNA 3AUJB 5TGTA 1DG9A 2J4CA 1XA4A 5FWNA 1SUBA 2VG8A 2YMLA 2IOHA 4LOHA 2VSOA 3E0XA 1NW8A 1FDRA 4RHFA 3KPUA 3RVJA 1JMKC 3SHVA 3TZCA 2P3QA 2E5FA 4NHOA 5FT9A 3ZW7A 1BA3A 3P4XA 2OLEA 3B7GA 1K7EB 5GONF 3O92A 1QRRA 2FPXA 3NU1A 3JD3A 3R6DA 3CNNA 1WZEA 1Q6YA 4EBBA 2IH5A 3T7KA 1A04A 1XNJA 2PLNA 2XCQA 2Y1EA 1G4AE 5A3QA 4ZN6A 3S27A 2OAEA 5G3ZA 3L8YA 4MQEA 3SFZA 4DJTA 4GDFA 4QPPA 3UK6A 1WW3A 1VKZA 4R1LA 2R66A 4KE7A 3FHTA 3ISVA 1AQ6A 5JT1A 3FYHA 1OROA 2ZYTX 2O5VA 2PLAA 1CCWA 2FR8A 3LL7A 1WETA 2AFHA 4ZRDA 5IKMA 1X3SA 3X44A 2WSMA 3EQ8A 2XEDA 2PFGA 4HUTA 1P2BA 3WGGA 1GKIA 4HAUA 5GONB 4C87A 1NY6A 1A82A 1YB7A 2UYOA 2VZLA 2ZDGA 2WV9A 2PZLA 1WAMA 3AUUA 3F9CA 2ILTA 3NTOA 2M98A 1NW5A 2ZETA 2BP7A 4PAWA 3U6KA 5HTOA 1G59A 4RTRA 3C6ZA 1RXWA 4K6HA 1TF7A 2HDOA 3AV3A 2WPDD 1JHAA 3FYDA 4D4KA 4DDWA 1P9OA 2V98A 1TVMA 2ZUCA 3BN3A 3UYKA 4O0LA 2JD2A 2R48A 3DYIA 1N5RA 4CKEB 2PWBA 5HS4A 3FWNA 4KV7A 3NPAA 1W30A 5A7FA 2Q4EA 4IF4A 4OUDB 2BZSA 4Q03A 4RZSA 5ALTA 1NJ1A 1HYHA 1GPNA 1SB9A 2F3QA 2I6QA 3P1JA 3JZIA 4JA2A 3QX9A 4BQIA 3VDRA 2WVGA 4DNXA 3IO3A 4UFPA 4OHKA 1SVWA 1K4KA 2O8FB 2C4TA 1U0HC 1NDUA 2VHUA 3ES9A 3IMGA 5EUMA 1ORWA 2VP5A 3HR7A 4IM7A 3QA9A 3H5LA 4D3DA 4CIAA 1A27A 4QTYA 4RWZA 2ZQZA 3AXTA 4K6OA 1F2TA 3JTEA 2FW6A 2GHQA 1D5CA 2CFTA 2MU1A 4PPGA 3AI7A 4PZZA 5IDQA 4W5TA 4D3YA 2WKSA 2JAPA 5LPNA 1O94C 1WX1A 2ZCVA 2LKDA 2QN3A 2J31A 1TO1E 2F1KA 2PGNA 2W22A 3A36A 3HZHA 1K63A 4RX1A 4X61A 1P2TA 2HDWA 4U8GA 3DC2A 1PW7A 1Q7BA 2NYUA 3L84A 6GPBA 5H81A 4XQ9A 3WMWA 3OEYA 1RI2A 3FUWA 2P9HA 4KR2A 1QCZA 5DF1A 1JBEA 2RI0A 4JBWA 3EISA 3LUKA 4QOIA 4Y2JA 3IBCA 3M6IA 2JD0A 1TM4E 3LC1O 3NC4A 4LZWA 3E9DA 2NM0A 3S81A 2Q1XA 2ZB3A 4NXMB 3DD5A 1WTAA 3VI4B 3TQSA 1ZUNB 5D3KA 4RVDA 3MERA 1SNYA 3TRFA 4FEYA 1S1MA 4QDXA 1LDYA 3QG1A 4UUNA 1BWPA 1ZD9A 4GVXA 4K9QA 4RHUA 3KPVA 2V65A 4BP3A 4C5AA 2WD7A 3HO8A 3IQXA 4I1SA 4ZU1X 3V6LA 1GR0A 1BFKA 5TF0A 1ADFA 2HBQA 2P8SA 4W9RA 3M4JA 2NIPA 3OCVA 2OGSA 3GQBB 4C7VA 1NJGA 4X7BA 3AMVA 3LPCA 4PLHA 1FJGB 1FVXA 3B1VA 4OA5A 4YRLA 1SFRA 2VCYA 3KKLA 2GK4A 1P5JA 4QX6A 4XQGA 4IL5A 1VGVA 2CVQA 4HN2A 4UZSA 3RE1A 4MVJG 1E2NA 1LWOA 1U5AA 2B36A 1LX6A 3ZJVA 4PLWA 3DVSX 3VU3A 2RHLA 1NI4A 1NJ2A 1UDAA 1STOA 3I2YX 4D81A 1EAMA 5AVVA 4I4TF 5BN5B 4M9RA 1P1CA 3BREA 5E38A 3BRWD 4GYWA 5I4KA 4U9HS 2C9OA 1FYXA 1ZU5A 2DPGA 2B30A 3C3PA 1G4HA 2H59A 3C45A 3IXMA 3EF0A 5H3HA 3UAZA 2AF3C 4D3ZA 1U2DA 3VKVA 1NRIA 3TBHA 3TZLA 4DIEA 1R9JA 1X6VA 4KSCA 5E9AA 1MJ5A 5JMTA 2H16A 1DVRA 2AEJA 3QOXA 4L5JA 5MN6A 3SVTA 5HRUA 4JR1A 1RBYA 2CXXA 2WWIA 3K94A 4JUAA 2ORIA 5DMXA 4RK5A 1ZXLA 1CUWA 1EGQA 2BI7A 3OURA 4Z7JA 2RHJA 3O8NA 4URYR 3E3NA 4MVJI 6REQB 1RRCA 2AN5A 4YRNA 4G2NA 2CFSA 5KCMA 2PRKA 3SXPA 1E9BA 1Y9DA 1HTBA 4BMPB 1ZRSA 4BVBA 3DE3X 1IRIA 1MABB 3FR7A 1TA0A 5BVGA 2WJZB 1EXMA 4I4TB 2QRUA 2XRFA 5AOVA 5JISA 2JIZD 2W4MA 4IEEA 4RTPA 4I0WB 3DC7A 4L1KA 3AM4A 3BDVA 1YS7A 1OZGA 2C5SA 3AEKA 2D2VA 1MR3F 4WPGA 3T8YA 5EFZA 3TZKA 2FY8A 4IXTA 1RI5A 4WK4B 4A92A 5JCJA 1M67A 2IVZA 2XKBA 3AHFA 1KO5A 1SIUA 3WFIA 3QBJA 3ZDDA 2COKA 1B14A 1ULZA 5FPYA 4A15A 2VPZA 3WSWA 3FW1A 3JASB 1ZIPA 1OI7A 4NCJA 4RH3A 2DFPA 2C94A 5HCUA 3GFSA 1VJTA 4DJEC 2FN9A 3AI2A 5A5FA 3B3GA 4MAMA 3WFZA 5LLDA 1QKIA 4TT3A 3HTXA 3CZ5A 3WB0A 1FC0A 2ORWA 5K3SA 3N75A 3V1KA 3RLIA 3FHCB 1AY0A 2J67A 2AQIA 4NJEA 2HMYB 4QYTA 1JU9A 3LUGA 5G4KB 5CDUA 4ARCA 1O6ZA 4L8LA 2QR2A 4BJ6A 1PRYA 2X2PA 5KAMA 2EEPA 4NV0A 5JMOA 2O8CA 5HUJA 2Q45A 1GZUA 1F4LA 2PYDA 2IZ5A 5HKKD 3PQCA 1NIPA 2FPPA 1U1CA 2P5YA 4KO8A 2OFXA 3NNSA 3UG6A 3GLFE 3M82A 5IPFA 1CUEA 3BHNA 1XTVA 3NOVA 1XWFA 4J94A 2GPWA 4HNUA 3F1LA 3SYLA 4QOFA 2I1WA 1K3TA 2GAJA 3ZIAD 1JVBA 1MNAA 3K1YA 4FINA 1V8OA 4ZWNA 5EMNA 3DV2A 1XPUA 1JG6A 3L7OA 4CUZA 3V8PA 2X8AA 5F5LA 1O97D 4RMIA 4OQ4A 3D4NA 3ZCXA 5AVTA 4JI5B 4Q3DA 4YXWA 2PD4A 1A9QA 2GPSA 3NWEA 4GT1A 4OQPA 2LIVA 3SYMA 2PT7A 1YACA 3GP3A 5DNAA 1Z4IA 1O95D 1KEEB 3FUCA 2AZXA 2FMIA 4L16A 1JHRA 1W87A 1GEEA 1QNLA 4DLKA 3AI3A 2IE0A 1TO6A 2GLUA 4OXIA 4ZCSA 5IDVA 4BS9A 3CNHA 5HDQA 4ETWA 3C14C 2KI5A 4F0JA 4NYMR 1RHUA 3AJ9A 3EIOA 4KXVA 4PC2A 2GJAA 4QO7A 1TE2A 3ZZUA 2G5CA 3EC7A 4YCMA 4LPSA 2I4NA 1L8QA 1EX7A 3CR8A 3LL4A 2ZWOA 4Q4DA 4UULA 4WUVA 2NZ2A 4S0ZA 2XMGA 4GL4A 1K8QA 1L2TA 3RYFB 4LF5B 2CVZA 5DGDA 1VLVA 4MVJF 1Q0RA 3ED5A 3HBJA 2QRMA 4PHHA 1Z62A 3TKAA 4WH0A 2P90A 1PLJA 5JAMA 5JOQA 5KSWB 2GBLA 3RB8A 4EJ2A 5ITZA 2HB6A 4TTJA 1OHHD 2VLIA 2CBGA 3R5XA 1GGNA 4BZXA 2QTTA 3Q5DA 4ZGWA 4Z53A 4DMCA 3O8BA 4XGKA 1U8UA 1IY9A 4WLUA 3WYEA 1JHDA 2V6FA 3LFUA 1GNSA 4PYIA 3KZMA 3H4TA 4B3XA 4YB8A 1E2DA 4KQ1A 3ICWA 4BIIA 3RRZA 3HVKA 3SZOA 3NDBB 1KP2A 1ADBA 4H1HA 4DLZA 2PUGA 2FX5A 4MPDA 2QVBA 5JARA 3B1WA 3JSXA 4NZMA 3WGLA 5KX5A 5T4EA 3BGVA 1J1IA 1FDOA 3PRKE 2JI6A 1E7RA 2VDUE 2Y4NA 4RXUA 4HLUC 3F74A 4PXYA 4V03A 4YJHA 2O05A 2XZPA 1EP1B 3I4LA 4JT8A 4H1TA 1YS2X 3OO0A 4LHSA 2GPTA 5ICMA 1EFCA 2QRKA 5GVSA 2BR3A 4WESB 3HRKA 4Y2GA 3WGQA 4AP9A 4P0TA 1H2BA 4LMAA 3OOWA 4HN9A 3ZHSA 1H0HA 1TYZA 3KQYA 5EP4A 4XCQA 1J23A 4HI0E 2B8TA 4GVLA 4LJKA 4JLVA 3UMMA 4PO3X 1KMIY 3CRMA 1PWYE 4WV3A 2XUAA 4KITB 1HTTA 1KK2A 2QQGA 3G02A 1TF2A 2FPSA 3Q7QA 4BNXA 4F11A 4RJ2A 1P9LA 4G89A 4PLGA 2B2NA 5HILA 8GPBA 3L0OA 1XPJA 1YZLA 3W4KA 1H6CA 2CKDA 4NBUA 4YMUA 2L42A 2PZFA 3WSTA 3T9AA 4JXKA 3EVNA 1KYWA 2Q5FA 3F3YA 5ECYA 2MYPA 3ZCQA 2F8MA 3UJ8A 1C3OB 1FQJA 2CL5A 2V4ZA 1R0ZA 3PQ6A 4WLNA 3AYZB 1SOVA 4I6EA 3RUAA 4F9EA 2QGFA 1I1QB 3DNPA 4GL2A 3DL4A 3FOZA 3OHMA 3U62A 2JI7A 2X3YA 1ZSNA 3MGBA 1M8GA 1E3EA 1S0UA 1G5QA 5EPUA 1FS5A 4AYTA 1V1RA 4C2UA 5IC4A 3GYBA 1MCZA 1YXMA 4L5AA 1FUEA 4PU0A 1PO7A 4K6KA 1I0LA 1FW8A 1XDUA 4M1YA 1BA2A 4JB0A 1VBFA 4YT5A 3GFTA 5EMJA 3MWYW 3QJ5A 2B83A 1S2MA 5FOUA 1DAGA 5FBVB 1WCYA 3MF4A 1HLFA 3QWIA 4RIFA 1TA9A 4UAJA 3IBTA 4YJGB 5B1EA 3ZWBA 3NYIA 3C4VA 2JBHA 1MFPA 2D8AA 3EB9A 4XJVA 4ZU6X 5FKJA 3KFLA 4FGSA 1XI2A 5ALMA 2HMSA 5DXJA 2WU3A 4EQZA 3J80A 1SQGA 2J3IA 3MCAA 2CD7A 5J5CA 3VJMA 1A72A 2Q5IA 3F4KA 3IKJA 1X42A 2CNNA 5FR1A 3C3EA 4B6EA 4BNMA 3EUFA 4RJTA 3THRA 4CMKA 4DABA 1EP2B 3GLTA 1QBKC 3KEGA 3NONA 4HQFA 5C0OE 3LBHA 3VSBA 4HEQA 5F7XA 2YVKA 4PIPA 4YJKA 2YW2A 1SIWA 4CKBB 1AUQA 3UJ6A 2WPNA 5IH3A 4AQ7A 5DDIP 1EINA 1T9GR 2IA5A 5LA6B 4C4SA 1W0CA 3VU1A 2OG1A 5L3SA 4ND4A 3VU0A 2EFEB 2UXDB 1M1NA 2ISCA 2HIHA 3OPXA 4AS1A 2GVZC 2P2LA 5IC5A 3NHKA 4IVNA 5C4IA 3GXBA 4RTJA 4YPOA 4LY0A 3L18A 4OAOA 4JI4B 1PFWA 1YDHA 2SHKA 3OEEA 4CLHA 2H2IA 1OSNA 4Y6SA 2XXBA 4HOYA 2EU8A 2JGDA 3BPSA 3U81A 1JPNA 4TLBA 3G2OA 4ZO9A 4JGGA 2FCAA 4PM4A 5FWXB 1LB1B 2G6TA 3P2KA 3LYUA 2OO7A 4MULA 1BWSA 4W7IA 1SA0B 2FPUA 2IEIA 3JQBA 4KEAA 3TLEA 1N5LA 1N5JA 2AUNA 3GG9A 5EVJA 3NWBA 1Z6TA 4NCAA 1G3MA 1XR3A 2C8VA 2E48A 2HYDA 2YMPA 1GG5A 2X76A 2D1YA 5DM70 3TECE 1XTPA 3VJKA 3S1LA 4N0MA 1AN0A 3HKCA 3HWWA 5DHQA 3ZQKA 4DA6A 4PY2A 4IXWA 2JCGA 4ZXFA 3EBOA 3AUAA 4DVJA 2J0EA 1DBSA 2W9XA 2IYXA 4RZHA 1UXIA 1N2HA 3AHDA 4R2MA 1L5MA 2BFFA 1EFUA 2BFMA 2G8LA 1UBLS 2XB2A 1QOQB 2WHPB 2ANBA 3SXUA 4R9UC 5FHRA 4H3KB 3K09C 5IZ4A 3K4PA 1D4ZA 4EUKA 5IU6A 2YTZA 3VYWA 1RWWA 1SRQA 4ND8B 4C0SA 4D92A 1U8EA 5H1YA 3MCTA 4XYLA 2XWSA 1AK9A 3IHLA 1YWGO 4Y30A 1ZD3A 4COKA 3UAXA 5I48A 5BMVB 4N3CA 2CSUA 1MO6A 1QANA 2DRIA 3MJRA 4AI6A 3WGYA 3JD1A 1X70A 4RIHA 1J7JA 6CHYA 4YROA 2QSUA 1YONA 2EAUA 2WE7A 4Y9RA 3A7EA 3MWKA 3NO4A 4YRIA 4LC0A 4E5MA 4O1MA 3FAKA 2I8LA 4G8BA 1A9TA 3SCZA 4XRGA 2HFKA 5DFAA 1UXGA 1TCAA 1LDNA 2NW6A 4IGFA 4PNZA 3QEAZ 2PX4A 3FUVA 5IVIA 3FUXA 5ABPA 1C7EA 3CGWA 3QLJA 2XHZA 1W2WB 3KB2A 2DT8A 3NM4A 4UJ5A 4YV7A 2BSAA 3SSMA 3F5MA 5IZCA 3BD8A 4YECA 2V58A 4B8YA 4C20A 1GSIA 5F9HA 3QELB 2I2WA 2IV7A 5C35A 2QM8A 2OY0A 4RTNA 2HA0A 3DMTC 3S2YA 1KAGA 5IFLA 3T7IA 3EA5A 3QG5A 1YB5A 3V4RA 5ICSA 3IMEA 1O3YA 1Z6PA 3KLPX 2QJOA 3EFBA 1SBIA 1P44A 1Z56C 4HRVA 1SOUA 4L9AA 2MYUA 1WVMA 4V2IA 4EF4A 3WRXA 1J0AA 4QJ4A 4YP9A 2RHHA 1ODIA 4TUYF 5KJ1A 2GZ3A 3HN6A 3L41A 1F8YA 5U4QA 3WAGA 5H80A 4J9VA 1RDFA 2VRBA 5E6SB 5DOVA 1R4NA 4BFYA 4W63A 1ZBDA 2WTEA 1F2UA 4GBMA 2JFZA 1KFKB 2Q5QA 1M3SA 1JXQA 2MSDB 3DEFA 2XH8A 4X45A 4LRSB 1LX7A 1JLKA 1NULA 1F12A 1YD7A 4JLMA 4TRNA 1TADA 4UNNA 5DN6A 3S2ZA 3EZ7A 4KIGA 3KU4A 1TVKB 2V6JA 4KQIA 2AFVA 4DWVA 4II3A 5AHRA 1AO3A 2V7WA 4P7GA 4ZPXA 1MRNA 1QC5B 1FNCA 1OI4A 1CQJA 4WINA 2Y1WA 5CA0A 1EDDA 1AGRA 1QAOA 1OFIA 1PJAA 3TM4A 2OMKA 4JP1A 1AO0A 4QLBA 1DO2A 5B4UA 3ORYA 1WCV1 2R2AA 3C3DA 4OHFA 3SC3A 5CBPB 3U16A 1DBWA 1YRYE 2JBWA 3NWPA 3ONDA 4IMJB 4IIGA 4JJAA 1OJLA 5DU2A 5I7FA 1TCBA 3UH0A 1TD1A 2FJPA 3K0AA 3K6JA 2FPIB 1LLCA 2B5WA 2GWRA 1M2NA 3DONA 3GWGA 3I9FA 3AT1A 2FGKA 3GJ8A 3L6CA 3HZRA 3MJDA 2J9RA 4G9EA 4OXXA 1KE1A 4B80A 1C5KA 5GPBA 1E2JA 3DXYA 4LDZA 3CSSA 4DCMA 3BFJA 2VWHA 3U1TA 4N3AA 3KQUA 2O2SA 5CTJA 3SAJA 1NVXQ 3PENA 4ETMA 2XGMA 4CLDA 2WJVA 5CM8B 2YWBA 1SZJG 5HW0A 2W58A 3IV7A 2DHCA 2G6BA 4AKEA 3QE0A 3THYA 2A94A 2X41A 2FG7C 2GNAA 3WAJA 2W2VA 1I3LA 3A04A 3QU2A 3NALA 3RTEA 3PG5A 4UD2A 2JCBA 3QEKA 1L3BA 2QRVA 4FB5A 1XTUA 2NTYC 2HC9A 4AO6A 4B82A 3IP3A 8OHMA 2NT4A 1S7CA 2GCIA 4DIUA 1O0SA 3D4IA 1H0SA 3EGWA 1Z7GA 2CMHA 5LZ5A 2B1GA 1F7VA 2FMUA 4LXUA 2CXTA 2WLSA 3OPYA 3WYBA 1LFDB 4KI7A 5KVAA 1ZW1A 1GTZA 3IAFA 2QTVA 4LV6A 2C3YA 3U4GA 1PLKA 3UIEA 4A3SA 4YQFA 1K3FA 1U6JA 3W04A 3OA2A 4V1CA 1QDEA 4GKAA 3ET4A 1E3JA 1JFFB 1XTQA 3A4NA 4BQQA 4CR6A 3I61A 4A8PA 4MS1A 2FFHA 4PX9A 1F8XA 1JJFA 1GQOA 1HORA 2BM0A 5I5GA 1X7WA 2XMQA 3RHTA 2XYQA 1AGPA 1CE8A 1N2GA 1GGFA 3EPPA 5DZSA 3Q3GE 3THOA 2PD6A 5JO0A 4QDZA 3SFVA 4J1TC 1JQKA 3PITA 4Y9SA 5AUNB 3EEOA 2J1LA 4MR9A 1WULS 1V4NA 3GPDG 3INRA 4E88A 4R7GA 2GEKA 2R1VA 4N9QA 4NZYA 1C0LA 2AD5A 1DAFA 4BAUA 3KHTA 4WJLA 3A1VA 5ILGA 3A31A 4QU8A 4YUYA 4IUDS 3PA8A 4JP8A 2PGIA 4FYJA 5E8JA 4CN9A 2VJNA 2D7CA 5CGQB 3Q6IA 2IEBA 2WSLA 4JBLA 3UT5A 3VR2A 1SKQA 2HRQA 1FW6A 2QVLA 1SHUX 3HEMA 4PSVA 1TT5A 2BHSA 4AZWA 1IPFA 1O58A 1X1TA 1S8NA 3W1EA 4Y3UA 4CM8B 4G8CA 4GX2A 2OE2A 2RK4A 1G18A 4OQNA 2QPLA 1I33A 5EWMA 3CX4A 3JQGB 1HPLA 1ZCJA 3ZWVA 3HY3A 3HN2A 1I7SB 3R9WA 4YH1A 3FJOA 3C48A 1C4XA 1II8B 3DDUA 4KV9A 1YDGA 4CV1A 3AU8A 1HL3A 4J90A 4WKBA 3WDLA 3VKUA 3Q1KA 3ITEA 2O2IA 1VJGA 1DBRA 2OQRA 3A25A 3PXEA 4KYIB 5E4JA 2PJRA 1D5WA 1JI0A 3M3DA 2BGTA 5JLJA 1EFVB 2HO5A 1A5TA 1JH9A 1V26A 2ZAYA 3UYLA 4BBAA 4TXJA 1T5DX 3KEMA 4XTRA 4F7DA 2WZDA 2R47A 2F7SA 1GZHB 1N6NA 2DFVA 3GLSA 4GM1A 4RFLA 4IOMA 4BAZA 5JY1A 1DFGA 4K9LA 3RI3A 4PGHA 1FP4A 2ID9A 4BATA 5KVQA 3V5NA 4PZEA 1Z2AA 5EIBC 4F8JA 4R01A 1XROA 3W5DA 1SU7A 2HJHA 2YMMA 4HTFB 2B6HA 4K2HA 5ES3A 1XZDA 3G9QA 5JNTA 1FU7A 1IJKA 2O7QA 2EV9A 2PGAA 2F1HA 2NTNA 3L8ZA 5CB6A 4URXR 4KK4A 5C1BA 1RM3A 3DEHA 4RZUA 4OGGA 2UUAB 1NLMA 2HRCA 3GA5A 3WHIA 1LQ2A 1PS0A 4R7TA 1VTKA 2ZRHA 1PGQA 2YZ2A 4G4JA 4FFLA 4MDHA 3HU1A 1TAGA 2ZITA 2Q46A 1FBNA 3UMVA 1IN1A 3T99A 3L9XA 2Q1UA 4CM4B 4L0CA 4EGFA 1VE1A 3CUKA 2KLBA 2K6GA 1G5RA 2WOOA 1REQA 4TKUA 3ER8A 1LPNA 2ZIAA 2XTJA 4FLEA 1JA1A 2QU8A 2XYVA 5EYPB 4FFVA 3TLCA 4B47A 4P8RA 5K0ZA 3PPYA 2A9PA 4DRYA 3D5EA 1B6TA 1ZVKA 4IH9A 5H70A 3N0TA 4M8SA 4M76B 2Y27A 4AWAA 5A02A 3UPUA 1CZHA 2OENG 5LQCA 1E6UA 2H11A 3ZDEA 5KIAA 1XCLA 2R79A 2J6IA 2WAMA 5KOJB 1XCJA 4CWAA 4HAIA 1TIBA 3L04A 3LQQA 1Z5WA 1FJHA 4D1YA 3P9NA 4J9UE 5KSZA 3TJMA 1U0LA 2WP0A 4CCSA 1DB3A 1JDBC 2FRDC 2ZRKA 3KT0A 4R1PA 4UU8A 1MAVA 4BWGA 1KFCB 4CL0A 4YJ3F 4DV1B 3RUCA 3RJTA 1JV2B 2H06A 4MWBA 2CUZA 5JD4A 3LIIA 1XN4A 5DNVA 1DEHA 4BDTA 1I51A 4IUBS 1D1TA 1Z7BA 2NYVA 3CMCO 4YRFA 5JDCC 2PA3A 3LC2O 3W2IA 7ADHA 5IHXA 1W5EA 4P4TA 5JC8A 3HVJA 4ZQBA 3OKPA 2R1TA 3STVA 1DKMA 1B26A 2DLNA 2RHBA 2W43A 5ALWA 1CJVC 4P4NA 5ILQA 2D5LA 3HYSA 4L9WA 4OSPA 4C1BA 1Y8QA 3IVGA 3DW1X 4Q3OA 3UJ3X 1RYHA 2HSZA 5FQNA 3JQAD 3D4LA 3VC7A 2F43A 2Y66A 4DQLA 1BH2A 2VYND 4YP5A 3MTGA 3PR1A 4DXHA 2EZUA 5C52B 3FB1A 5TQJA 3LUHA 3GDFA 4WA7A 3BBPA 1XG5A 3OZVA 1EWTA 3QBDA 4W4TA 1QG2A 2XZTA 2G4CA 2GYUA 2HIMA 4R05A 2O2EA 3UF0A 4DKJA 3HCDA 3TXYA 2YQZA 3NBUA 4F4IA 5AR1A 4C6RA 2FTKE 3HA2A 3IAS6 4G86A 5CK5A 3N87A 1BJTA 3R6TA 4B33A 1QTNA 1NBIA 3CR7A 5KNDH 1P6UA 3CLTD 5TEVA 5IUJC 1QVRA 5IEBA 3WB1A 1RM0A 3Q8WA 4XX0B 3ZN2A 1LTKA 3PSAA 1B3RA 1IU9A 1IQRA 2OWEA 3Q4GA 3S4YA 3WL4A 2CUKA 4BNDB 2OV6A 1TAUA 2BEWB 2QTLA 4GMHA 3RABA 1H1LB 3CZ4A 3D7SA 4KZPA 1V2GA 5AKLA 4EG1A 4FKZA 3UMGA 3ROXA 5DASA 2BKAA 4YI3A 4BLTA 3QM1A 4A8HA 3ZDBA 4ZO4A 4HJXA 1ECBA 3VPDA 821PA 3GZTB 2SCUA 3U9TA 4Q4CA 3KZOA 4RY8A 4D9NA 1YJQA 3W8DA 1JP7A 4E31A 1SWWA 3MTJA 2QORA 4KO1S 5AWFC 1UKCA 1CFZA 5B30A 1P4JA 5IM4A 3DZKA 5LUBA 2JFGA 2JLCA 3Q5GA 3N0XA 3PUHA 4ZOAA 4B79A 3THXA 1NE7A 3M6FA 2DM6A 2MWMA 4KX5A 3MMZA 3V46A 1DOZA 5A9SB 4GOMD 3LX8A 1C8KA 4GRDA 2IGTA 4DAOA 4Y9TA 3E1GA 5JTTA 1ZNXA 2GKOA 1Y9JA 4HUQB 2JASA 4AZ3A 3PUYA 1M5RA 1EGVB 1BQ3A 2Q99A 3A3YA 5EUCA 1BD3A 3LM8A 1FRZA 1VIAA 4MQLA 3R75A 3HV2A 2DWOA 1BXKA 1ZCFA 1N3YA 4RF5A 3UCEA 3HP7A 1BN6A 1SVIA 1P77A 3MBKA 1US8A 2NYAA 3A1CA 3ZJYA 1PUJA 2CFRA 4WKCA 1GZ7A 2VP3A 1S3SA 4I3GA 4C1NA 5BNFA 1SPXA 2Q9CA 3WL8A 3TRKA 1A4RA 1XDDA 1CR0A 4XD7A 2Q5EA 1QB8A 2DTXA 4A0RA 1RYYA 2CWDA 3OU6A 2UZ4A 1HETA 3IV6A 1I4LD 1UZUA 4KN8A 5IJAA 1DX9A 3T7SA 1WA5A 2C78A 3KXKA 5BSRA 2E0IA 1FSGA 4B3IA 1ZIDA 3NANA 3UFXB 2YASA 1RM5A 2BTQA 4D26A 2G9QA 3H84A 1KC3A 4ARZA 4EJSB 5BUZA 5DJ5A 1U81A 1XCMA 3DA8A 3D3NA 2IHBA 3AG6A 1MAUA 3C5HA 2QMUA 4FT2A 4Y2SA 3A6KA 1UM9B 5BN4A 3A3OA 3GZNA 3T3DA 4RZ3A 3WNBA 3KR1A 4I4NA 1GPH1 3SHWA 4NZPA 1J6UA 4Q66C 3PNBA 2XB4A 4JLOA 3VHLB 2D59A 5JSZA 5F52A 3GGOA 4YCAA 1QOPB 1AU9A 2AHOA 2VXBA 1FRVA 3WQRA 4LUCA 1LCIA 4LJ9A 3RIYA 3WGHA 5CBKA 1WUYA 3P97A 1JKJA 1WQ1R 4C7JA 3U4AA 4W8OA 3RW9A 4CLXA 2G77B 2QT1A 3FNEA 4MUJA 2DXIA 1XZFA 3L7NA 3ONFA 4NENA 3B51X 5ALGA 3VYTB 4DDVA 2FVXA 6AT1A 3HG7A 4NLLA 1L5WA 3ND8A 3ORSA 1I5OA 3MWEA 1J9GA 2COUA 2FKNA 1DKPA 3F8SA 1JXOA 2OCIA 2A4KA 1C9JA 2QLLA 4DEVA 3OQOA 3QNMA 3PIDA 5J59A 1OXBB 4LVCA 1TQ6A 5BW4A 1QO0D 1D6SA 1N6IA 2X0JA 4MW6A 1SGWA 1VPTA 4FUTA 1OQAA 3QKSA 2I7XA 3LIPA 2FJ0A 2NO4A 1OWPA 2OORC 3LPNA 4AKSA 4B3CA 2GXUA 2BEUA 2O59A 3EXFB 1CQZA 1UOOA 3LGXA 4XYMA 1CQIB 5DTMA 4DZTA 4CTNA 3O4JA 2CNWD 2AL7A 3EXHB 4QUHA 5KWEA 2IS2A 4TTQA 3GRPA 4UQLA 2DVMA 2XJ4A 4HYTA 3PWTA 4R1MA 4BWYA 1DAKA 3PUJA 4N7RA 4DMGA 1DIRA 1GA4A 2QDKA 2ZVJA 4LI0A 4UU0A 4WXPA 1YS4A 4FKMA 1YKFA 4BQRA 2PL1A 2XUDA 2QL6A 2AR9A 2DEUA 4I50A 1MB3A 4BNHA 1L5RA 2P3OA 4D44A 1RZUA 4TSRA 4G5HA 3RRNA 2YVAA 3CRRA 1JJVA 3QNUA 4QT0A 3JAKB 5EAIA 3WMEA 4YPVA 2BFDA 3U3DA 3IO5A 1N6LA 3OX4A 7REQB 1UK7A 1Z0ZA 2EFYA 3QIAA 4CFSA 2OCGA 1VIDA 2RH9B 4OV6B 2WUEA 3CPSA 5CLQA 3SMQA 3SYNA 1C9DB 3VO2A 4GR5A 4NG4A 5CDFE 3G2JA 1OPRA 3V8BA 1EE9A 1FUYB 4S1WA 2UVQA 1HNZB 4F2WA 3DCIA 1BXGB 5DSTA 3SEFA 5HXAA 4O5AA 1ABBA 3BGIA 3VR5A 3GJYA 4N49A 1E6LA 3RYCB 5K9ZA 2C3UA 5GMOA 1RXEA 4B3FX 4L72A 2QYHA 3COYA 1M2VB 4N7BA 4FYVA 2CEAA 5EOVA 1IUPA 3UAOA 4L8GA 2GJ8A 4GPBA 2FWJA 2NSLA 2OVBA 2UXBB 4REOA 1P4HA 1IULA 1JNXX 1VJCA 1NNEA 5C46F 3MW8A 4RHCA 4H31A 1A8PA 2WVAA 1E3WB 2XYRA 4TLAA 3L4SO 4Q4JA 2P27A 3W3AA 1BROA 2QGNA 3IAM6 5CJ2A 1G291 2VUHB 3PEEA 3ESQA 1OLXB 3PE4A 1WU8A 1R9NA 4I8XA 4W82A 2M1XA 3USES 1WOYA 1QGUA 2H1HA 1CQPA 1SC1A 3B6KA 3F4LA 3T3NA 4AECA 4Y6RA 3JZAA 3TDKA 5H59A 3TLMA 5JAOA 1Z34A 3HJRA 1E8MA 1N0IA 2NU7A 2WWTA 2PE5A 3OESA 2ZUEA 1ATIA 1L6RA 1ESNA 3TCNA 3CN9A 4ZEMA 4ZK2A 3NAMA 5AI5A 1X7XB 4M36A 3S44A 2QVCA 2HQSA 1DWPA 3COJA 1P4AA 1AZSC 3RAEC 3D2CA 1JKMA 4RKWA 2XRZA 3FWPA 2J7PD 1K7SN 4Z86A 5AUPB 1JQLB 4LF8B 4N8SA 4U6QA 3C1AA 2WA1A 3LLUA 2G1UA 5FWAA 5BO5A 3LCJA 1O96B 3GDOA 3T3OA 3PPXA 3BSYA 2HK9A 1SKAA 2RI6A 2CLCX 4GXNA 4KC0A 3BBLA 3A6FA 2XMZA 3PDCA 1JB1A 3HY6A 2ONZA 3MAGA 4G1CA 1SOMA 5D5PA 1D0IA 2X22A 3EEIA 3TIVA 4FGWA 3A1WA 3USZA 3VUEA 4GOJA 4HTAA 1U3FA 2BEJA 3WIBA 3P9IA 3VPFA 2CEKA 1KO8A 4RIEA 2C3MA 5ESWA 4C7OB 4FCWA 1J2UA 3F6PA 5H5JA 4FBMA 2DKFA 4E5NA 2JARA 3RIGA 1A1VA 3D2LA 1OBCA 3JPWA 3GYGA 4LGVA 2GB4A 1X15A 4U63A 4EVSA 3AR7A 4PVDA 2GLXA 2ERXA 5AKGA 4BDSA 2QYTA 2YIVX 2TYSB 4MS3B 3RS5A 2R6ZA 2NPOA 3MSXA 2BMJA 3E81A 1TD9A 4B3TB 5JVDA 1R12A 4L02A 1PT5A 2ALJA 3KM0A 4P3XA 4L7QA 2OFFA 5T7BA 4EI9A 2FX3A 4ITRC 4RVSA 1AH2A 4ADSG 1SCIA 5TNXA 1CQXA 2PXCA 1JALA 2BGLA 4MUBA 3I6MA 5C9ZA 5C1DA 3C8ZA 1U3WA 5K0LA 1Z07A 4MTCA 2HXGA 5MGBA 4JZYA 3W8NA 1G0OA 2I2AA 4H4EA 4ZT7A 4DCOA 3M3PA 1E89A 4M3NA 2ZDHA 2NQTA 4PBSA 1YBAA 5GOZA 2OHOA 4D0GA 1P1RA 4EGQA 1Y6GA 1I4DD 5JD6A 1AQIA 2FUCA 1EESA 1M2JA 3AESA 3D02A 5FNVA 3BA6A 3GC6A 4CLRB 4I4LA 3X1MA 4Z3OA 5COAA 5KYVA 3AP2A 2MT9A 2FUEA 2VZ0A 1T5TA 1V9LA 3DFMA 5A4JA 5I9IA 4NI5A 1IY8A 1TKRA 1OV4A 4OHOA 1VECA 4EA7A 1HDXA 2GRAA 1UBHS 3EBLA 1KQPA 1OXUA 3G6KA 5DI3A 5JFTA 3ND5A 4KQCA 5UKDA 1IZ7A 3TSCA 2ZTVA 3L0YA 3KOYA 3N2KA 3OKFA 1GAXA 1O0BA 4KE6A 1UXJA 2II6A 1P7VA 3ONWA 3IAS1 3N1UA 4MKXA 4Q3AA 3VO9A 4B73A 1J06A 2BGWA 1DQZA 1ZJ4A 3ABRB 4FMPA 2E89A 3GZ4A 4LV5B 3VH1A 3M4ZA 4C22A 5HKOA 1ZR2A 4GZMA 2LIPA 5BSVA 3HB7A 4EEXA 1EWYA 1Q83A 4XYGA 5KCZA 1RAFA 2ZSIA 3QVGB 4NQZA 1GXSA 4Z9FA 1EJBA 2IDKA 1G60A 2IYFA 3ZWKA 1HH4A 4BN4A 5C5EA 5BR4A 1QLWA 3HPRA 4KI0A 2X4GA 2Q2WA 2PSHA 4FMDF 3KQLA 1N92A 4JI3B 3WGUA 2O7NA 1NNSA 5BOVA 3R1IA 3FHJA 4GBED 3WB2A 4EYOA 4NABA 4RVGA 3Q2KA 4URHA 2O1WA 4OXQA 2DZDA 5K8JB 1JDPA 1WV1A 4B76A 3OEHD 3IJ5A 5JLAA 3U0VA 1CB7A 3ZE9A 4BX2A 2CZCA 4TL7A 1PDOA 2QLJA 4FJ1A 4A8JB 3FLMA 4BN0A 2VNHA 4LXTA 1QAMA 1E7MA 3FKSA 1JW9B 1N1MA 3FOAA 3N9IA 4FDVA 4IIVA 5GWXA 2ZAIA 1AV7A 2F3SA 2A7QA 2WIJA 2ZYSA 4WGGA 1N77A 4RMGA 2WABA 4ZRNA 4X8HA 4AMYA 2IYUA 3KB1A 2BGMA 1HQCA 1UKVY 3PC2A 3ONEA 3KKZA 1M5UA 3H2ZA 4HK4A 3FH0A 4Q12A 3GLHB 4JHLA 3RUHA 3STYA 4OQEA 4CIDA 2WHQA 3AIMA 4HDSB 4HXYA 2WWXA 4MW9A 4KU4A 2HHJA 3UV6A 4BNKA 1VLZA 1U6IA 1A9ZA 1WXIA 2VJOA 4LK2A 3I5MA 1X7HA 3UWKA 4IRMA 4P0QB 5ED4A 1V0JA 2ODNA 4EHKA 1L7XA 5E2AA 4EG4A 2BELA 2IP2A 4L07A 2A7XA 3K9CA 5CFRA 3EAFA 5AW7A 5HUQA 1V25A 5DHRA 4DMUB 4NU6A 4BXOA 4NFLA 4DNPA 2PUHA 3UK0A 1HSZA 1WZNA 1TGYA 2Z3ZA 1R0SA 4G37A 2RGNA 2IXEA 2HF9A 2ZRMA 2D7DA 1NGSA 3AINA 4Q4AB 3KTDA 1T29A 4DA7A 1FMTA 2C57A 2FUKA 2XR1A 3H16A 5K0SA 1GUZA 3K70B 4FB4A 3F5DA 1Z8NA 3CURA 3SHFA 2N47A 3ZNQA 3OU7A 3I12A 5BQFA 2XVXA 1I0ZA 1SCUA 2VCHA 3LZ6A 4CEIA 3WYCA 1C9MA 1PJRA 1NXOA 1WD5A 2MR6A 4RNCA 5B4VA 2FAXA 2B5VA 3HYCA 3TL3A 4J0CA 2VTBB 2W70A 2PQMA 4UHDA 2P6NA 4FW8A 4QBTA 4EHBA 3Q8KA 4BZPA 3RKSA 1ULAA 2NWQA 3FAZA 3PR2B 3GLIB 2BCEA 5JO9A 2EARA 4J0QA 4AKHA 3GEEA 2XE6A 1XEWX 2Z4RA 4I1UA 4DUZB 1E2BA 5KNCA 1OPXA 2FK8A 3AVVA 1KFEB 1CF9A 1TJ4A 2ZJ6A 1XN1A 2JATA 1VL6A 1EI9A 2O19A 5A4DA 1W36D 2HREA 1W0KD 5GGXA 1I7LA 2HHLA 3X1ZA 1VGRA 3K2BA 1IJFA 1WHSA 1ZK0A 2A1UA 2I4TA 2SBTA 4HNHA 4KFTA 4AUMA 3TI9A 3J7TA 5T3UA 3HLKA 3GD7A 3RSSA 2H8GA 4HDRB 3RADC 3NWOA 5SZKB 4BECA 2GO7A 2NT3A 3IP6A 3PUZA 4WX2B 5U1PA 4DQXA 1IM5A 3QMVA 2RBKA 1ICIA 2DULA 4H0FA 2HHHB 4ACAA 3KLNA 1E1NA 3PJFA 1U9JA 3ADPA 1NE2A 4J6FA 4QOEA 5DM60 5LDHA 3QENA 1U0NA 1RQPA 1ZXXA 4MKRA 4WY2A 4C03A 3V4SA 1P19A 2CDNA 3SEZA 3RYTC 2A92A 4I81A 5F9FA 2VJDA 1H2XA 5KWVA 4B48A 3QUTA 1FNDA 4B4VA 2ATIA 4BU1A 1M6NA 1KJ8A 2C42A 1N9ZA 3CSDA 3PPVA 3ULKA 4BEWA 2G72A 2FSHA 1M54A 2AMJA 3D8RA 5FBKA 3ZU4A 1U8AA 3KPJA 1PJSA 5GP1A 3GPCA 3TMAA 2ZULA 2ZSHA 1HDRA 1LS6A 3JZFA 4BCCA 4X90A 3WK5A 3RVSA 1E96A 3OSUA 1A7AA 3Q10A 2ZYGA 3UXYA 1WTCA 4F85A 1OIWA 3UHFA 2JCVA 1WHTA 1ZOSA 2P4EA 1P39A 2JFNA 4XPZA 3OPVA 1EM6A 1IRXA 3FPLA 1XQ6A 3HUDA 5HIJA 4BQFA 5K8LA 5H16A 5FOSA 1YJBA 2CL0X 3JWHA 4IZ6A 4AN1A 1X1EA 2BBWA 2X9NA 2E6KA 4FONA 3ON5A 2QD2A 3OZGA 1Q0TA 4MB6A 1SCBA 3DBVO 1T3TA 5CX1B 2GD6A 4D96A 1UEIA 3W5BA 1AOXA 1TU0A 2TSYB 1MC4A 3KUUA 4LRQA 4NYMQ 4MRRA 5FI5A 2VAMA 1MZVA 1NZDA 3F97A 3KYCA 3G2NA 4ZQFA 2GKSA 4KQKA 1N2IA 2FI1A 2CJWA 2QTWB 4FNAA 1B16A 4JZKA 4XWWA 5F73A 1AXGA 3WX0A 3ZDXB 4MWEA 1BW9A 3C6XA 3ETCA 2OXTA 5DYYA 3GQVA 3QITA 3EDRA 3JWGA 1E9FA 1SZCA 2R4UA 3O8OB 4Y67A 4HFJA 2BP7B 4N03A 3RUIA 1EWQA 2EKZA 4M0DA 1LDMA 3GVHA 4E5KA 2J3JA 1KI2A 4LKOA 1YZGA 4XGQA 1YFJA 2YVQA 5JZSA 4OX9B 4URWR 3CLSD 3Q9NA 1QQ5A 3H2JA 4M22A 3M49A 4PFSA 4AG5A 4DM7A 4FFWA 4OMCA 3PX3A 3H5OA 3OH8A 4M86A 3COSA 2NV2B 1YHYA 3GDGA 3H5VA 5BV1A 2D4AA 3FDFA 4NSNA 5GQSA 3TSZA 4DLAA 5J2TA 4DSTA 3AOEC 3EEQA 2P0YA 1HFJA 1B8PA 2Z09A 2Q8PA 1ZNWA 3S8MA 3SBDA 1YFKA 5EJMA 1PR4A 1BE0A 5JPIA 5HOEA 2XITA 2EX0A 3OPMA 1NF8A 2VYVD 4MEAA 1XRRA 3ZTTA 1M6WA 1U2SA 4EFKA 2XKJE 5T3YA 1PNQA 3BB1A 3QWHA 3UTDA 3WXBA 2Y0BA 1E5XA 2PU5A 3KTOA 5AOCA 4U2CA 4MQ6A 1F6DA 3WV5A 5L3QB 2C4MA 5JCOC 2IY7A 3OI7A 4HH0A 2NZUG 5HFAA 4RFSA 3ZTYA 1J7KA 1SZPA 3UNXA 1ACLA 1W4RA 3LX6A 5HA5A 2N0SA 1DCTA 5BSMA 2XB6A 4OQLA 3NYQA 4Y6OA 2BDTA 3H9UA 1JFSA 1XVIA 4WMLA 4E12A 4YY3B 1COWA 3CPEA 3FPGA 2AQKA 2FZLA 1JVNA 3LOQA 4O1IA 5HZHA 2TMYA 5B12A 1CVRA 5IMSA 1GIAA 5J1SB 2V6MA 1BEZA 1Y7HA 4AZSA 2R8ZA 1IQPA 1QDUA 3L6DA 4ZCQA 1TK3A 3UG7A 3WIUA 4HO1X 3K9NA 1T35A 4LAFA 4IDEA 4TMKA 4HLNA 2ZRCA 3WBKA 1JILA 3D0QA 3EQ6A 1Y1QA 4QU0A 1VBKA 1YULA 2CVHA 3N0WA 3VKWA 3AUXA 1YKGA 3TUJC 2QLMA 4P33A 3HCBA 4OB7A 5FUXA 1XRMA 2AGVA 2MIIA 3IB6A 4F91B 5ECGC 5LMUB 1AX9A 3EQ2A 5JJKA 3C3CA 1AB5A 2FWMX 4DWJA 3CX3A 4UTXA 3BVPA 3I32A 5EKXA 2VSFA 3ANYB 5IARA 5LZ2A 1FYVA 1ZINA 2YXDA 2M6SA 2OBMA 2ZSFA 1EB9A 3KTAB 4Z8YA 3TZ6A 2JIQA 3PL5A 2ZI3A 1ZKMA 3ED1A 4ENUA 4CKWA 3KBOA 4TTSA 3QY0A 2BGJA 4CGYA 1KIMA 2GUWA 1J2RA 1XYVA 3IHWA 3IPCA 3PKJA 4HVTA 4EFNA 2P65A 3QKTA 3W5HA 4F2DA 4W5OA 3R7LA 1DDOA 1XAHA 1JHYA 4EB8A 1JLLB 2JB9A 5DLYA 4C7XA 1EHYA 3OCZA 2WEKA 3AKZA 1TQ8A 5AW4A 3U7FB 4ARIA 3LSTA 4TL6A 4ER6A 5KHAA 4OGKA 1A9RA 5DGHA 4GWLA 4IOJA 4MUHA 1SR8A 1XD9A 1O77A 1GFWA 1XCGB 2XB9A 4OLHA 3JQFA 4QOJA 5DYIA 3O9VA 4CM1A 4ZXPA 4JSYA 1CUHA 3ZGVA 1VA5A 1EXWA 5TDHA 4BUCA 1F14A 2AXQA 4LMBA 1NW7A 3IEIA 2X5NA 2ISSD 1LNQA 4MA0A 1P0QA 1G2QA 1VE5A 5EE3A 3GBVA 1N25A 3LHDA 4H6XA 1E9AA 2R8BA 3OZ7A 3R0IA 4TMZA 3PGVA 2YH2A 2A1TR 3LXMA 4J07A 1E99A 1A9XB 3DS8A 4KMOA 4EGCB 3LQ4A 2HRRA 5D00A 3A6LA 1QRDA 1FE8A 1ZU4A 4WBNA 1NUSA 1OE0A 3FG9A 3FMPB 3EXIA 3GELA 1DINA 3JALB 3UA3A 4HGNA 2WJWA 2YV2A 3G89A 5LQMA 5H3LA 4ZU3A 1IBCA 1T36B 3T7JA 1B23P 5D3MA 1L5NA 4EK9A 3QW2A 5BYAA 4XQEA 5B55A 3MHPA 1ZM7A 1RHKA 4NCIA 3EZXA 1X7ZA 2UYGA 2PL5A 1K86A 1JXMA 1DLJA 3M3HA 3NLLA 4U7FA 4RV4A 2A0XA 3AETA 3QVSA 2HWXA 4IJUA 4K2AA 1IZZA 3C70A 5CPBA 2JK0A 3KX2A 4JJ7A 1Y81A 3IEMA 4DMFA 3QXSA 2F4NA 4UDXX 3VR3D 3RWOA 2XRYA 4HNTA 3IT1A 2WJPA 3K2IA 2NP6A 3HSKA 1KMHA 1QHHA 3MT7A 3WBFA 3GHHA 4GPIB 5AOAA 3NHRA 4NJEB 3DLTA 1IY2A 3WA6A 1YUBA 2P9ZA 2Y67A 4IRUB 3NMUF 2XE8A 1VHTA 4PVCA 2QE7A 2J0VA 2JGJA 3B1FA 3E3LA 2IODA 3IAXA 1N2ZA 1KDRA 3PNSA 4O3FA 1FS4A 4QQNA 1HE2A 2OV3A 5BRNA 3ASYA 4WXYB 4G63A 4KNYA 3DUFB 3V1LA 1J20A 1Z0IA 3MG9A 4JK3A 5E7QA 3QE3A 3TR5A 3QU5A 2X2OA 4WCDA 3TTUA 4BMVA 2DPYA 1R6XA 1A88A 1NN0A 4OKSA 1CRWG 4FOOA 2OVFA 4QO8A 1QPBA 2C2ZA 2WU0A 5FADA 4DQUA 3SJBA 1S2DA 1SQ6A 1T9GS 3GXOA 2P3LA 4FMBB 4TKVB 5AVKA 4J03A 1KEWA 3AF0A 2BKUA 1MN6A 3A37A 4QG7A 2A14A 1ADCA 2X8WA 2DTDA 2XUJA 1WF3A 3IDOA 4KWTA 4WNYA 4D3FA 4LTMA 4DLPA 1SEVA 4EHDA 1C80A 5E0KB 2G9VA 4LDNA 3EGCA 1ULTA 3HFSA 2JH9A 3HVHA 3P71T 4LE1A 2WAOA 2CXSA 4KDFA 4QU9A 1XV5A 5L4LA 4JLNA 3I6QA 5CA1B 3CVWA 3B70A 4H6VA 4JXXA 1ZXBA 3BE4A 4MW4A 2JGRA 3LOPA 1YIDA 1LK7A 3QVLA 4UD6A 4I8DA 3Q7IA 4RJJA 4RULA 1TYDE 1EP3B 1UJNA 4JAVC 2VH1A 3J81k 1NXPA 3GP8A 4MWOA 1PNVA 1FDSA 5JWRA 5PGMA 4ZANA 3ZY5A 2WJ6A 2RGXA 3VC1A 5HSGA 5ED0A 5KX5F 1PG5A 2P9BA 3FWYA 1D3AA 1L4FA 2O0JA 2IITA 4LDJA 2DFNA 1OAOC 3G23A 2FEOA 3GI1A 2OP0A 3H8WA 4BLWA 5I7RA 4H35A 5DM4A 2H17A 1FEZA 3TZQA 1KJYA 1RCFA 4QLOA 5EZQA 1ZMRA 2ATXA 1WMEA 4GOND 4HDMA 4TLMB 4AJLA 4LF7B 4JOCA 1U3GA 2C98A 2ESRA 5BMOA 1Q50A 4IQFA 4EYEA 3IIIA 4MP6A 4D0SA 3CIOA 5F3RA 3K0FA 3RU2A 5EWLA 4B34A 1IZYA 1NUUA 2EIHA 2QLBA 1FXWA 1HMPA 3GGSA 3PB3A 1HR0B 1IMOA 1G6HA 3FPEA 1F17A 1FDIA 1G21E 2O6LA 2BE9A 3V1UA 2YIDA 3GJTA 2C2MA 3HDQA 5HKBA 4OL9A 4WASA 1OFUA 1K9SA 4KGVA 2D3WA 3NIBA 2ZK7A 5C5CA 2V54A 5F33A 4UMFA 1TYAE 1KOFA 1H8ED 5DTIA 3A8TA 4PQYA 3ICOA 2OXIA 3KK0A 5JCOA 3V7FA 3OJ0A 1Q0ZA 1L9XA 1OOEA 2MINA 1LF0A 4JJGA 1L5KA 4D56A 1U28A 4IG4A 2DG2A 3WLMA 4A6DA 3P9YA 4POAA 1NXTA 1SELA 3K4HA 4HBZA 3ROZA 5HVNA 3MYRA 2FQQA 5AI8A 1NW4A 4CTMA 1TB4A 4R2LA 3M81A 4M83A 1CK4A 3I39X 5L8VA 1AHPA 4ZRMA 1DQRA 2EZ4A 1DL5A 2QW1A 1GLVA 1C1HA 1EVKA 3QYPA 5E7MA 5EESA 4HB3A 3ZC3A 2P9QA 2NUAA 2QP4A 4GECA 2P1RA 2QR3A 3UT6A 3OQ1A 1HXHA 2H7XA 4IICA 3FKQA 4P4SB 3VR4H 2HR1A 5K6AA 2E87A 1M6EX 2BGNA 2WG1A 1PZEA 3EOZA 3M4YA 4L5YA 3G1WA 1BS1A 1S02A 1V1RB 2QOEA 3LZDA 3C0KA 2EXXA 3KUXA 2VF4X 4DYHA 3ABQB 4QELA 1KEUA 4UVHA 3DAYA 5ENVA 3E58A 4BO2A 1RI1A 1UFRA 4BMXA 5AH0A 5K3CA 2QP9X 3U19A 1PF7E 1W35A 5B3JC 2CNOA 2BZGA 2NNLD 1YQDA 2V96A 3I9MA 3IT3A 4QL3A 5KNBH 3FBTA 4YR7A 3KJIA 2RGDA 4LJ6A 1VI6A 4Q37A 1SUEA 4PG4A 3NTUA 5A3RA 3JATB 2WD9A 3WYNA 1PJZA 4E3ZA 2NU8A 3RC9A 3HCOA 4RGBA 3OIFA 4JD5A 3QX3A 3T38A 4CDGA 4PLVA 1GTSA 3FNGA 5ICEA 4KQ6A 2Q3LA 1MB4A 4YUZA 3FPFA 1Z0AA 3ISJA 2H48A 5TR9A 4MB2A 4O4LA 2E4XA 2ZRAA 2VDQB 3DTVB 4UARA 2BYTA 3H4IA 1KK3A 1YZYA 1QZUA 1GU0A 4JJZA 2FW1A 4MRMB 1PFYA 1SH7A 1JAZA 2W6JA 2XX3A 3GMDA 4EDHA 3R7WB 4N6GA 1BEUB 1UBOS 1X86B 4CEHA 5JMPA 1I32A 4IIYA 2ZWVA 3VU9A 2WYVA 2ZM6B 2WF5A 3W3ZB 2OOSA 1BRTA 4ZDKA 1RHQA 1DU4A 3OAAD 3ZU6A 3Q72A 5HM6A 3RUEA 3HJGA 1ZZGA 4H6PA 4NDAA 1E5QA 1E1KA 1SVKA 1FLAA 3DULA 2DR2A 4CQLA 1DCFA 1YA6A 2WSIA 2GXAA 3KVYA 1Y33E 2V45A 5JEDA 2H54A 1GPBA 2VP6A 2JZNA 1DUVG 1W29A 4HEJA 4ZAFA 3EGDA 2V9PA 3W06A 5BWLA 2I7TA 2WTXA 2VJYA 2QT9A 3ET5A 3HR8A 4HHEA 4HQKA 5CFMA 1UBUS 2XOEA 4F4DA 5CVDA 5JV5A 2JBAB 1NW9B 2VDOB 2O06A 2XYGA 3BCUA 5KYKA 3D6JA 3CU5A 3LBYA 3PFCA 4FFDA 4H4CA 1OZ0A 3L3BA 3AEQB 2PT9A 4I5GA 2O7SA 1ISIA 3LXUX 4PYNA 4PNEA 3L1KA 4ZYWA 1XZPA 2B34A 3DFZA 4AMUA 4XRRA 4HFMA 1GV1A 1UPBA 4LJ5A 4Y0VA 2JHCA 1TM3E 1ZUHA 3TLYA 4G6ZA 1YQGA 4GQAA 1UC4B 3E35A 4OJQA 2VPQA 2G1KA 5ALRA 3MELA 4ZC1A 2P4HX 4FSHA 2V6BA 1HC7A 1PV2A 1MMFB 1V5IA 4V39A 3M8KA 4NMLA 4MDYA 3EPLA 5KC8A 3MJSA 5DOZA 1UZMA 2AYZA 1Z0JA 2OQ2A 1BHSA 1HZZA 2YWFA 2GCNA 2L18A 3S1AB 1N2CE 3D7RA 2W2LD 3TO5A 4D8XA 4MVJD 1O5OA 1AURA 3R2JA 3N58A 2E55A 3TSAA 2FPMA 4EVQA 2PZ8A 3BH7A 4N5HX 4X71A 2W83A 3ID6C 5DIFA 4F60A 4RL6A 1OTHA 1R15A 2DYKA 2Z2YA 2XUZA 3AR9A 1UH5A 1R00A 3IH5A 3BCHA 3HO1A 2GARA 3OFNA 3GROA 3REFA 3AL0C 2HT1A 5IF3A 1UOEA 1VDMA 3KOWA 1NVKA 3D6FA 3QK7A 5JEEA 4MW5A 3VR6D 2HNKA 1Y3CE 3WP0A 4P80A 4FEAA 4WK2B 1NQXA 2J41A 1CV2A 1T3ZA 3P19A 3OF5A 4ZCTA 1BGWA 1JR4A 1R4MA 1VMDA 2CMFA 2QPTA 4PRKA 4QYIB 2QQ0A 2R25B 3UCFA 4G9GA 1Z36A 5AVSA 1YJ8A 1XLWA 3JQ9A 4MR7A 2ZI4A 4IIXA 3GT3A 3P5BA 4EHNA 2PLFA 1MAAA 1D04A 3HCAA 2GCOB 2A58A 1GAQA 1TJYA 3VDNB 5I7EA 2EGUA 2V6IA 1TJNA 3VHRA 4M4SA 5K51A 3IILA 4IIBA 2WB2A 1E4EA 1E4OA 1T8TA 2P69A 4JC5A 2AI2A 5JIBA 1MP0A 4TRJA 621PA 2OSVA 2YWJA 4CF3A 3EVEA 4UKDA 4GC5A 1JG1A 2Y1CA 3IELA 4XKJA 5HCNA 3EXEA 3RT1A 1CZKA 4BFLA 2ISQA 4OL0A 4EZBA 3KZ1E 1C30A 1G8YA 1U7ZA 5J5VA 4TMFA 5SZHB 3P52A 5I7OA 1NUHA 4YDRA 1SXJE 2QZZA 4G1EB 4IHQA 4EPTA 3O90A 2PKCA 3V55A 1X7YA 1YZ3A 2I6FA 3CLVA 3IQFA 4MW0A 2FN8A 5COBA 1VYHA 5H9WA 3U0BA 1IZ0A 1G7SA 1NFQA 4O2AA 4QULA 4ZYLA 2X9VA 2CK3D 4M98A 4EM6A 2MOKA 3OT5A 3CNBA 2GXSA 2YDYA 1H2YA 5BR7A 4L50A 3GAAA 1LS1A 2PX2A 3L8DA 1X0XA 4A5SA 3F47A 1GQYA 3I5UA 5JANA 1U9YA 3CA8A 3SXJA 2ZBVA 6Q21A 3LGAA 1X3LA 3BZWA 2JFFA 4Q5IA 2EC5A 3FETA 1UFQA 3KQKA 4IRXA 3E5NA 3NGMA 2LZ0A 1U1DA 2YXNA 4EOGA 2BM8A 2ECOA 1TCUA 2ZSBA 4HWOA 2A9FA 4EW6A 2UVPA 2Q5CA 4OIFA 3MTIA 5K7SA 5E1BA 5FLYA 2C2BA 3HL4A 3PNKA 4AKTA 5B5SA 3L8EA 1H4SA 2LUOA 2JDID 4BFVA