4PX9A

Dead-box rna helicase ddx3x domain 1 with n-terminal atp-binding loop
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
262
Chain Sequence
DWSKPLPPSERLEQELFYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cancer-Associated Mutants of RNA Helicase DDX3X Are Defective in RNA-Stimulated ATP Hydrolysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation, rna binding protein
molecule keywords ATP-dependent RNA helicase DDX3X
total genus 87
structure length 262
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4px9A00
2BMDA 3A6PC 3EASA 3B85A 4HLCA 1R0XA 2Q3FA 4NCJA 2X19A 4IEEA 1D2EA 2IBMA 2OO7A 3F3YA 1VG0B 4JLVA 2QG6A 1CJKC 2MMCA 1AJEA 1COWA 4LOAA 4YDHB 5JBQA 2ERYA 4JT2A 2PT5A 5FTMA 3KDSE 4B3GA 2WWGA 3GD7A 5JI2E 2VL7A 1DE0A 4V03A 3NBZC 3DM9B 3GEHA 3KKPA 3NG1A 3QEOA 2DFNA 3GQBA 4PSKA 1E2NA 4TT3D 5FBRB 1M7HA 1R8QA 4TQAA 1P61B 1QHYA 2IWRA 4OQFA 3WYFA 5FPKA 2IYSA 1X8KA 3QXCA 3PEUA 2GXUA 3S1AB 4D4LA 5JFGA 2JIZD 4IDNA 5K8TA 3ZIAD 1AK2A 2MSDB 4W5JA 2CLDX 2F55A 3MRSA 3CPHA 2ZRPA 4MRVA 4DLWA 1ZM3A 3FMIA 2R6FA 1W0JA 3VNVA 2ZVPX 1TF7A 2B7CA 1DO2A 2ZRBA 4QBHA 4QBFA 5DE3A 3T5DA 1MABA 1KNXA 2BEKA 4OI2A 1P2UA 3U61B 4HAVA 4C0HA 2H1LA 1BKDR 1KDPA 3QY0A 4C4PA 721PA 4WAUA 4DSNA 5IDVA 1TPZA 2GTPA 4ZIRA 4G5OA 2HXSA 1JPNA 2NO9A 3KB1A 4BZQA 2G0TA 2OLJA 5CB8A 2GZAA 4JS0A 2FG5A 3KZ1E 4IW3B 3RHFA 2HF9A 2GK6A 3TUZC 3THWA 4M1TA 2J7KA 3CRW1 5FOXA 5LB4A 1GIAA 5HPYB 1JBKA 3LAWA 4HAWA 4KXFB 2ZREA 3VHLB 5J5CA 2Q3MA 5BW8A 2P2LA 1XTKA 4DUGA 1GDDA 2NO7A 5CM8B 1QDEA 3VU9A 2QQEA 4DLYA 2PJZA 2VPPA 4M8NE 1W2HA 3BGWA 4Z8XA 4KITB 1T5LA 2QSYA 4MH0R 4RD2A 1H8EA 1ZD9A 1EESA 2YWHA 4EQ6A 1KI7A 1N5KA 2WJHA 1GZSA 1N6NA 4XVQA 1CRQA 2ZS8A 2ANBA 1GL7A 3ZS8A 2XNDD 4ERNA 1M2OB 1MH1A 5H1YA 4CF7A 1E2HA 1J90A 2EU8A 2CVHA 4URWR 1Z08A 1S9HA 2QAGA 4JLKA 4PPQA 3SFVA 3VR5A 5KOYA 3CUEF 4DCNA 3HP1A 4MRPA 2G1KA 1F5NA 2PT7A 1OXTA 1US8A 2FZLA 2A78A 3ZZTA 4DSTA 1Y3AA 1E1QA 1UBEA 4MRNA 1OH6A 2WSSA 3ONWA 1A82A 3FMOB 1E2FA 5FR1A 1XTRA 2WICA 2XEXA 4RSGA 3C14C 1SKYB 1ZC3A 2VP5A 3GJ5A 4GFDA 2JCSA 1CBUA 3RWMB 2IS6A 4M9XA 4PQRA 1EWRA 4FMDF 5KDDA 4LHYA 1P6XA 5J4KA 4C2UA 4OK5A 1M6NA 1WA5A 1E4VA 2Y8EA 2ZPTX 5FI0B 4HLUA 1RPZA 4AG5A 1Z63A 4L8GA 3HR7A 3ZVRA 1GKYA 1XBTA 221PA 3E1SA 1E2QA 2X2FA 1E2LA 3PUYA 2GKSA 2GJKA 5JWHA 4F93B 5F9HA 1G8FA 2OCPA 4TMXA 4OQXA 4DRZA 1R5OA 1RRFA 3SQWA 4P31A 3KQKA 4TYNA 1ESMA 2IYXA 3BC1A 5GJCA 4FN5A 1EFUA 1NN5A 2O5VA 3CX8A 1OXSC 4L15A 1SHKA 3CW2A 1WRBA 3UANA 3QE0A 1OH7A 2ODWA 4LGMA 1IJFA 4PPNA 3TK1A 1DS6A 2OCAA 1CR2A 2XTMA 3DMNA 4NYJR 3AVOA 3SYKA 2GXAA 3DDCA 4JL6A 2ZRNA 4QXAA 4QBGB 2MMGA 4L9SA 3I5XA 3NDBB 2ZSBA 1QG2A 1NIPA 3U6KA 1W44A 2G88A 2IYLD 5E3HA 4M9ZA 3WY9A 4LJYA 4M2LA 4BLPA 4TSFA 2C5LA 4Z8YA 2WKQA 3QF4B 4OK6A 1G7RA 2JJ1A 2GCOB 2QT0A 3EG5A 2LKDA 2CL0X 5FFMA 5G41A 2OXRA 1JR6A 3KKQA 4DT1B 5HZKA 2ZI9A 2P67A 4WW0A 1RJ9B 4TT3A 3QNUA 1T6NA 2ODEA 1QHGA 4ARZA 4MGIR 4GDFA 2J7PA 4BLQA 1KDRA 2GXQA 3KKMA 1AS0A 1J7KA 4FXPA 4HYYA 3PCRB 1FPMA 3AH8A 2Q9BA 2FN4A 2WSSD 4LDJA 4BRUA 4C3ZA 4NYMQ 2OILA 1EK0A 3ASZA 2PZEA 4LWZA 1M1YE 3FMFA 5TXGA 1GP2A 3WMEA 4US1R 4A8JB 1BO6A 4ZKEA 1KJZA 2FZ4A 3PXGA 4ZCLA 3W3ZB 4C0KA 4EJSC 2IC5A 4QBIA 3KUDA 2NPFA 1E98A 2NZJA 1VG1A 2GXSA 3A4MA 3G5UA 4H1UA 3C7KA 3GLHE 4AURA 1DAGA 4KO8A 1TUIA 4A36A 1G7SA 1G64A 1D5CA 1GRRA 1KTVA 3B6EA 8OHMA 1MABB 3Q72A 2VQSA 1E2EA 3NEJA 5EZ6B 4KLZA 4JBYA 1BYIA 1CU1A 1LB1B 2XX3A 2EW1A 1EFRD 4BFXA 5IF9A 1FTSA 2FA9A 1YZGA 3EWAA 2JLYA 2ECKA 3IO5A 2WKPA 4WBSA 2R6DA 3WHLA 2X77A 3NVAA 2ZE6A 3DOFA 3PFIA 421PA 4Q7JB 3K9GA 1JALA 4BFZA 3U7GA 2YKGA 4O0MA 2F9MA 5DYGA 1SXJB 4A1FA 1S9DA 3GJXC 1SXJA 3AKYA 4X8HA 3TRFA 2GETA 2X2EA 5FUWA 2LCFA 1E2JA 3KFXA 1IM2A 2C9CA 2OAQ1 2R62A 4OL0A 1LTQA 2VYFA 4QC2A 3U60B 3EXAA 2IS1A 4A15A 4TSFD 1Z6XA 3GJ3A 1X1SA 2F43A 2QN6A 1T9HA 4ZO4A 5DHFA 4I1VA 2XNSA 2WPDD 2ZRIA 1G41A 4B47A 4BZXA 4BUJA 2F3RA 4HUTA 3AF0A 3LX8A 3T61A 1FOEB 2REBA 2FWRA 1ZM4A 3QF7A 3FHTA 3AP3A 3P4YA 1WBDA 1IN5A 1YZUA 4US2R 3CZQA 4EUNA 4JLDA 5JSZA 1T91A 2E1RA 4B43A 2HLDD 2QEQA 3SJBA 1GRNA 3RSOA 4NCNA 1DPFA 2ZANA 1RYHA 1XFAA 1YR9A 3ZVMA 1JQJC 3AP1A 2QNRA 1R0YA 4JIMA 3CX6A 2G0NA 3CB4A 4IXMA 1TX4B 1XJQA 2JDID 3U7EB 4WZBE 3OAAD 2J5XA 4A2PA 3ICQB 2CDNA 4O2LA 2WAXA 4LYFA 3NWJA 1LS6A 5AJYA 2IL1A 3DOEA 3IIJA 1PLJA 2AK3A 2ZJ8A 3VAAA 5C1BA 1TTTA 5LPNA 4ZDWA 3X1WA 4CZ2A 4L16A 4A82A 2PCJA 4YONB 2C98A 2XGJA 2FX3A 4QOSA 1NF3A 1QG4A 1N0WA 1KK2A 1P9NA 1U8ZA 1XJCA 1OFHA 2GWHA 3EPJA 1OE0A 4MUBA 5FTJA 2PH1A 4WOPA 4ZCIA 2IEZA 3CPJB 2ONKA 4OHYA 4JLOA 1TMKA 1CP2A 2F1HA 2NPIA 1S3GA 1NI3A 2QM7A 4LHZA 1P4SA 2H17A 3QIAA 2O8BA 1UF9A 4UNRA 2I4IA 2DB3A 4B44A 4A0GA 1QHHA 2Q9CA 4OQMA 4HDOB 5FH9A 4UNNA 2CJWA 3FE2A 3IQXA 3RWOA 1QHHB 1XD9A 5E7MA 2R6AA 2CVFA 4DEYA 3W90A 2CJWB 4NCKA 4CEJB 3QKRA 4GP6A 4IDOA 2F6RA 4TL6A 2DFKB 5JJIA 1MO5A 5EXSA 3U5ZB 3QVUA 1LY1A 4M1KA 2BMFA 4ZIRB 1XTQA 3KJGA 3A4NA 1G4UR 4NTZA 3ZYCA 4URZR 2QUZA 3RAPR 5DI9A 1PVOA 3KX2A 5FUXA 3FHCB 3HJNA 1GITA 2J45A 2ZRLA 4RZ2A 3AVTA 5BYKA 2D62A 4ZDKA 4KODA 2ZAMA 3T34A 4TQUS 5BN4A 3CNOA 5JMTA 1I4TD 1QBKC 3IGFA 2ZYVX 1DAEA 1KI1A 1SVWA 2D2FA 4RZXA 4TMTA 2O8FA 1GKIA 4PHFA 2CK3D 3QXXA 4KV9A 4GZMA 3EW9A 1IHUA 1ZNYA 4A0RA 4II7A 1TU3A 1CLUA 1RZ3A 1NJFA 3TW8B 5TMPA 4D4JA 4Q66C 2AR7A 5L8VA 5FL7A 5KSYA 1KGDA 2CCJA 3QEJA 2ZS9A 1CR1A 4OYHA 1U8AA 2WOJA 1FNNA 4POAA 2VP0A 5FL3A 4DDVA 3I5YA 4HAUA 2YV5A 1AGRA 2HT6A 5FOWA 4BFVA 1BH2A 1KI8A 1RIFA 5HR5A 1KI3A 3FWYA 1XB2A 2WMOB 4G5RA 2ATVA 2OESA 5EXXA 2R8RA 3OE7D 4Q47A 3ZZ0A 4U00A 2ZR9A 4PC3A 1N3BA 3DKPA 2IYYA 1DAMA 2AHOA 4KHZA 3DZDA 3H84A 5DLQC 2J3EA 2NZ8A 4M1MA 5FTKA 3SR0A 1W7AA 2UZIR 5KDLA 4E07A 3LD9A 3MWJA 1YKSA 4CEIA 3QF4A 1GVNB 1NSFA 5AUQA 1YE8A 2XITA 3CR7A 3W8RA 3SZRA 2OXCA 2WOOA 4HSEA 2V1UA 3OEHA 4AIIA 5JS8A 4PHHA 4RD3A 3THWB 1WE2A 2BHRA 2OE2A 4S2EA 5EZ5A 1HH4A 3SJZA 1DAHA 5H70A 1G6OA 4AYWA 5JI3E 1NMXA 4V0ME 4M4SA 1D9XA 1A4RA 1IXSB 1ZC4A 4AYTA 2WJGA 4A6XA 2XZOA 1P9RA 5HKKA 4FCWA 5FTLA 1LNZA 3EPHA 4HLDA 2HDNB 1EGAA 1HQCA 4QJ4A 5JRZA 3KUCA 2FF7A 1RRPA 2H7VA 1OF1A 4DDUA 3SBEA 2J87A 3NHBA 2XJ4A 4KYIB 1UDWA 2C78A 2ZJ2A 3CZPA 1E9SA 1KZ7B 1R8SA 2D2EA 3BK7A 3OAAA 1CS4C 1QHIA 1SZPA 1X3SA 3QKUA 4HAXA 4MYTA 3GFPA 1U0HC 2B8TA 1OHHD 3AM1A 5GJWC 5AJXA 2FFBA 3SFZA 5A4JA 3G82C 1JQLB 2GCOA 2EFCB 3W34A 3X1YA 4IDHA 4EPXA 4YQFA 5GVRA 3CH4B 3RS0A 1BMFA 1SVLA 1VECA 4CT4B 2BCGY 3OIUA 4GOJA 2WHXA 2RGGA 1NVUQ 3V00A 4G0NA 3TSOA 3X2SA 5K8UA 2IT1A 1XX6A 3T1TA 4AKGA 2NG1A 2FEMA 4V0NA 1T8UA 2ZQ5A 3K0EA 1PJRA 2BBOA 2AKAB 2CEAA 4QHTA 4G5SA 3K70C 4L4UA 1KMHB 3CH5A 3MLEA 4A9AA 1HT1E 3VR6A 3GLFA 2ZI7A 2JJ2A 4Q9IA 4MRRA 1TL7C 4V0LA 2R2AA 5G53C 3IBYA 4OI4A 5LD2C 1HT2E 3B1XA 5KNBA 3SBDA 2RGBA 4PAMA 3W8NA 4FCTA 1Z0FA 2QM8A 4Q21A 4AY2A 1ELOA 2C77A 2OT3B 3T35A 1OXUA 1IN7A 2WWWA 4TLAA 1AZTA 3SC3A 3WRXC 1DG3A 1XPRA 1CJVC 3U3RA 2AXNA 4AKIA 3UG7A 3EA5A 4KFSA 5KUTA 5H68A 5F3WB 4KSBA 2A7QA 3HYTA 4KVAA 3H2YA 4BFYA 1UDXA 2AD5A 2IUSA 3P27A 3U44B 5BN3A 1E3MA 2Q3HA 1XD2B 1LF5A 1NP6A 1FP6A 4M1WA 4Q19A 4UXIA 2R6GA 5SZIA 3GLHB 3W6NA 2BKEA 4G1UC 2PCLA 1Z29A 3FMPB 3B7GA 1ZD1A 1BYUA 1IY0A 3EIHA 1CF4A 3QKSA 4F4CA 2WJJA 3V4FA 1RVDA 2IWHA 4KFTA 4NYIQ 4C0QC 1Z2AA 3B82A 2CK3A 4U5XA 3VX4A 3HWSA 3BRWD 1EFTA 4YC7A 1D2NA 1DAFA 3LY5A 4PZLA 1VKJA 3I62A 4GMXA 3LV8A 3GLGE 3PV0A 2GEDA 1KO7A 2RKOA 2ZAOA 3KFVA 3VU9B 4AK9A 3QVVA 1Q57A 1N5JA 3K70B 1RYFA 3EZ2A 3ZH9B 2BWJA 4NYJQ 2ZYUX 4Q4HA 4JKIA 1JECA 2JJ2D 2BOVA 2KJQA 2EFDB 2DFLA 2NO1A 3LRPA 4NCHA 4CIDA 3IKJA 4QKQA 1G18A 4WIAA 2HT1A 1HUQA 5L3SA 1M7GA 4IOLA 4B33A 1E79A 1II0A 3LW8A 5JLJA 3NH9A 3R8CA 3B5JA 4YXWA 4D0GA 1YR6A 1XD2A 3LDAA 3K09A 1ZM7A 3HU1A 3DL0A 4PC6A 4BEBA 2YINC 4XD7A 1Z2CA 1CIPA 3OIVA 4H1VA 1II8A 4Q4JB 1DELA 1P2SA 2DYKA 1W5TA 1E2GA 1N6RA 3KKNA 1ODFA 4DCSA 1T0HB 4AKEA 1E94E 1P62B 4XOIA 3LBHA 1W4RA 4P4TA 2O8BB 5K8IA 3W5JA 1M7BA 3K9NA 4C0JA 4R7ZA 1Z6GA 2ZJOA 1K6MA 3JVVA 4JLJA 4D81A 5AUPB 3M4YA 2XAUA 3Q3JB 2IYZA 3K8YA 4LUCA 2P5SA 2ZJAA 3TKLA 5HCNA 2RHDA 3EPKA 4JJZA 3B60A 1U98A 2V54A 2FGKA 5KHOC 1A2KC 2P5TB 2VHUA 1RRCA 1VMAA 4RZUA 4KFUA 4JLBA 3R9IA 3E2IA 1Z6YA 3MJHA 4DLUA 1PLKA 4G5QA 2C9OA 2DBYA 3LQQA 3THOA 2A2ZA 1OIVA 1AM4D 2D06A 1SXJC 4CDGA 1XD8A 3QBTA 4CT5A 4C7OB 1RJ9A 1NVVQ 4PTLA 3VQTA 1FL9A 4DCUA 3CKLA 4BQSA 3KQNA 5IT5A 4DDWA 4NZYA 5C4GB 1R5BA 5EE3A 2D74A 4DLVA 4G5GA 4ZI2A 1ZU4A 4AD8A 5G3YA 1NN1A 3OE7A 4OQNA 3VKWA 1XZPA 5DHAA 5DH9A 2F43B 4LBYA 1VTKA 1F2TB 5D3MB 2JLQA 4BRWA 5CJ2A 4X8LA 3D3QA 1PV4A 3OIWA 5CB6A 2ZS7A 2P0EA 2Z4SA 1FNMA 3CR8A 3C4JA 1N6OA 2IW3A 3N70A 2WAYA 4HZUB 5HE8A 2FSIA 3QKTA 3IQWA 1YZLA 2ZUCA 2ZUBA 3LNCA 2J9RA 4FWTA 4KU4A 4I1UA 4RVCA 3PEWA 2ZJBA 3S1AA 4QRHA 2BV3A 3WNBA 621PA 5JHHB 4IOMA 4V02A 3IPXA 3TNFA 1KKMA 3O8RA 1IJEA 4JYBA 1U0LA 4JBXA 4WXPA 2D4HA 3CWZA 4JJKA 1BIFA 5HKKD 4EKDA 3LVRE 1JB1A 1VCNA 1XTJA 4XVUA 3BB3A 2WJVA 3EPLA 1NN0A 4AG6A 1G7TA 1A1VA 4QM6A 2DWQA 2RGEA 1NG1A 3PIRA 3QENA 5ANRB 1GNPA 4ACAA 1GAJA 5DISB 2XZLA 3MUFA 1UBCA 2JDIA 5A0FA 1NMZA 2RGDA 4HATA 4QGFA 4OJQA 1N6IA 1YR7A 2WMNB 2BEJA 3SYLA 4RCYA 5JECA 4XSHA 1KDOA 5JWOA 1MRSA 1IN8A 1F60A 1E1RA 1G4AE 5EP4A 4N1AA 5TARA 1M34E 4I99A 4QHSA 3L82B 4Q7MB 5M04A 2J46A 2PLFA 1N6HA 3LLMA 5CK5A 2J0QA 2BDTA 1ZINA 2GRJA 3SDZA 2W0SA 1YQTA 3FTQA 1KY3A 3DO6A 3T5GA 2QGNA 2REXB 2ZJYA 3ADKA 1HE8B 3LLUA 4DLZA 2ATXA 5FTNA 5FR2A 4DWJA 4DIDA 1NKTA 2VSOA 1ESNA 1G19A 3OFNA 4B3FX 3D31A 2XOKA 3TIFA 2XXAA 1WCV1 4GOKA 3A36A 1WP9A 5KU1A 2CL7X 1XCPA 2REOA 1HY3A 4ZKDA 1KIMA 1HV8A 1Z0AA 4FCVA 2CNWA 1E32A 1F6BA 1FTNA 3RYTC 3FB4A 4BFSA 2ONJA 1OKKD 1OIXA 2C99A 2ZEJA 4FMDB 2EFHB 3DKVA 1US8B 2GESA 1NVVR 4C30A 1O87A 2ANCA 1UKZA 4DT1A 4R2HA 1SGWA 4GP7A 4M0LA 4S35A 3LBNA 2RGCA 5BWMA 2FU5C 1Q1BA 1XXHB 4DB2A 1FQKA 4I81A 3BIFA 3PVSA 5D3QA 1ZUNB 1XXHA 1FUUA 4OQLA 5AJWA 2GVDC 3U3JA 1NG9A 2ORWA 3L0OA 1W1WA 3F0TA 2C9YA 1Z3IX 4MUAA 4N0EA 1KSHA 2WSMA 2E87A 3RNLA 3MD0A 5CIQA 2W0MA 4TZ0A 5EUMA 1GL9B 2RHMA 3H4MA 4ZCMA 2FE4A 5JEEA 2GHIA 2ODBA 3R8FA 3CNLA 4O2RA 5L3QA 4HDCA 1UKYA 4QJ5A 2V3CC 1MO4A 3DVLA 4Q1EA 4RCZA 1WXQA 2AKYA 4EPVA 5E7JA 2PJRA 2ZI5A 1W48A 1V5WA 1KNQA 4ITRC 3VX3A 2GILA 3TMKA 3T1OA 4XWOA 4C0SA 2I3BA 4FI3C 4Z51A 4ZI3A 2V55B 2IS4A 2AWOA 5LB2A 5DNYB 3RS2A 2WKRA 3THXB 4NBSA 2ODNA 1GL6A 4B48A 1E2KA 3TAUA 2N46A 3H1TA 3TUIC 4CEIB 1ZJ6A 2P6UA 3DEFA 4DCTA 3Q9LA 1VCIA 3FHOA 1W0KD 4ILEA 4TMZA 5EUQB 3CF2A 3E5HA 4E03A 5CIWA 5GADl 4PAQA 4NL4H 4KBGA 1XMJA 4DLRA 1G8HA 2BMJA 4IVQA 2GK7A 2Z6VA 4HI0E 4P4SB 3TQCA 1ZCBA 2GA8A 1TQ4A 2O8DA 1IY1A 4C9BA 2OFOA 2PX0A 4WVFA 1S4QA 1WQ1R 1E0SA 3OHMA 1G5PA 1W47A 2Z0MA 5CITA 4L5BA 2ZETA 3M6AA 4J0QA 3NEYA 1FUKA 2WPDA 1Z22A 3GJ7A 4LJ7A 1R10A 5HTKA 4BLRA 4DBLC 3U7FB 2KBFA 2PL3A 4JSYA 3RS4A 1QHSA 4QGGA 5DN6A 2QAGB 5C2JB 4D26A 1MO3A 5TB5A 3TGPA 4H9GA 2XB2A 2BJVA 5JJKA 2YWFA 3R9XA 1E96A 4LJAA 2G3YA 3ZIAA 2VF8A 2WWYA 1ZYUA 4A0FA 3EZ7A 3QG1A 4UNQA 2GBLC 4F4JA 3O47A 3D6TB 4B2LA 4JVSB 5L3QB 2RGNC 1S96A 2Q6TA 2PX3A 3RRNA 4HB3A 1OIWA 1IBRA 2QE7A 4PO8A 4Q7LA 2NGRA 2VA8A 4NCIA 4UJ5A 5FBLB 4LZZA 2V7QA 1W4BA 2JJ8A 1H8ED 2YZ2A 3A58B 1DVRA 1IY2A 3GFTA 1EX6A 2JA1A 2C04A 3TR0A 4ESVA 1JR3E 2IF2A 2HJVA 3LXXA 2W58A 2QROA 3HYRA 4BECA 1Q21A 1JR3D 3GJ4A 1OYWA 3JZAA 3PUZA 4JLAA 3HU3A 2H8KA 1EFHA 1H65A 1KJWA 2J0UB 3B1ZA 2QGZA 4TLEA 3REGA 4Q4LA 3GMTA 3BJIC 2QMOA 4C2TA 1GNRA 4HZIA 1Q12A 4D4KA 2JAQA 4OHVA 3ZJYA 2GVZC 1KDTA 3GEEA 5DN6D 3T12A 2P6RA 3IDQA 3LW7A 4MKHA 1UBGA 2PLRA 5KSZA 4NE2A 4DHEA 2PEZA 2JLSA 1MR3F 2WM9B 2VTKA 1N5LA 1KK3A 5LDDC 2WWXA 1CKEA 1OV4A 1OYYA 1ZP6A 4IOJA 1XU4A 4PC7A 2I1VB 2N42A 4V0KA 5CLLA 4LJ9A 4G3XA 1W49A 3IHWA 4JLMA 4F38A 3TBKA 3A1WA 1AZSC 5FBWB 2FFAA 2OBMA 3ND9A 4Z1MD 4MKGA 4DLSA 1GILA 4F92B 1HYQA 1E9CA 1Q3TA 1AKYA 4IVRA 4B3BA 4YMWA 1U90A 3VR1A 5TY0A 1Z28A 2VF7A 3EC2A 4QL3A 1XNJA 1DEKA 2IA5A 2ZU6A 3O8CA 4CRWB 1IXRC 3K09C 1G5RA 1SKQA 3WBKA 2ZJZA 4JVMA 2QZ4A 1GKUB 2ZE5A 1AS3A 2NO0A 3F5FA 1TQ2A 3QPWA 1ZBDA 1W4CA 1PUIA 3NXSA 1G8YA 3CRQA 2WIBA 1E9FA 3H0KA 3B2EA 4TYPA 5DSZA 3EC1A 1L4YA 3CPEA 3QBVA 4FMBB 5J40A 2QTFA 3WXMA 4XH9B 2ZIAA 4R71A 2PEYA 3BD9A 1Z5ZA 2D3WA 3IIMA 1T4GA 1AS2A 4PPGA 3EA0A 5C18A 1ZNWA 1X86B 2WWFA 4PPFA 5DIFA 3WNDA 3NHAA 4LHVA 4B3CA 3P20A 4ZV4A 3GLFE 2J7PD 3KXIA 1NVXQ 4ZDJA 2FPLA 1MT0A 1XEFA 1JXMA 2IXGA 4ASUD 3VFDA 3QG5A 2IHBA 4FINA 3PEYA 3SU8A 1W36C 3BFXA 3AV0B 1COWD 3NBFA 3QKSB 1R7RA 2RB4A 1IN6A 2B6HA 2KSQA 2MSEB 3B78A 4W9MC 3ICEA 4QM7A 2J59A 3OESA 2QMEA 1ZD8A 4LJ5A 1I2MA 4E5UA 4A4DA 3AVYA 1JPJA 1J8YF 4P33A 5AJZA 1Z47A 1WB9A 1DARA 2P3SA 1KKLA 4ABYA 3IBGA 4YDSA 4RFSA 1E9EA 2ZR7A 2C03A 2WJIA 1L7VC 1ZUHA 4OBEA 2DR3A 4Q1FA 1J8MF 2XTNA 1W5SA 2IEYA 1JEDA 5JCZA 1VIYA 3AQ4A 3ZVLA 5G3ZA 4EQ6B 3WNCA 1XEXB 3C8UA 3ZQJA 2ZU0C 1NJGA 3DM5A 4URVR 1NLZA 1E0AA 4Q4JA 2VO1A 2QP9X 3WMFA 3RC8A 1JAIA 4JLPA 1T3SA 4MKFA 1UPTA 1JI0A 1G1MA 1P5ZB 1R4AA 3K9HA 1EFCA 3W5IA 1S2MA 1SXJD 3NKVA 4KJZA 1CULC 5JS7A 1VHLA 2ZRFA 2BMEA 2CHVA 3K9LA 5EP1A 1GM5A 2GEVA 2WTUA 5BN5A 1KAOA 1I4LD 1KO5A 1KI4A 1DTSA 1UEJA 1ZNXA 2C8VA 1KO1A 2VSFA 3B9PA 2B8WA 2DWOA 3ECCA 3I32A 4GZLA 2V4ZA 3L0IB 2X8AA 2FDCA 4QGHA 5FBVB 2G77B 5DI3B 4JLNA 3W9YA 5JCPA 2O8EB 2ZE7A 3LO5A 2ZSEA 4I4LA 1TAGA 2HEIA 1QVAA 2CLSA 2R44A 3DHWC 3T15A 1TADA 3QOFA 1A7JA 1RRGA 2Q21A 1G8GA 3SNHA 1S1MA 4LC0A 5FOTA 3OF5A 4LYHA 4P0TA 5AR1A 3A1VA 2A30A 2QTHA 1G8PA 1XMIA 3ZVNA 1RC8A 1DBSA 3AKCA 3C41J 4JT4A 4MDFA 3A8TA 5CYPA 1JJ7A 4GBMA 3ZD6A 2YOGA 2IX3A 2OCYC 4Q1AA 4BFWA 4K81B 3X1ZA 2AK2A 3GJ8A 4OK3A 3CRVA 2TMKA 2VH5R 4TWZA 2G9NA 1NKSA 4Y0VA 2CBZA 2V7QD 4OI1A 4EIWA 4EFNA 4V0MA 4MDEA 2A3RA 2IYVA 4LC1A 1HURA 3PQCA 4RZ3A 3CNNA 1TEXA 3AP2A 4PR0A 1DAKA 1N0VC 4JZKA 4NPHA 1ZRHA 1E0JA 3TUJC 2Q9AA 3I3SR 4TN1A 2WJYA 4C0BA 1Z0JA 4EPYA 2QBYB 3C15C 2KB0A 1P2VA 2VBCA 3K0CA 4LSGA 3C5CA 3RS3A 3B9QA 3NDPA 6Q21A 4TZ6A 3QXSA 3A1SA 4Q5IA 4HB0A 2QAJA 3SQXA 5J47A 1AA9A 1AQYA 1N5IA 5CK4A 4IHQA 1TNDA 3BE4A 3U3MA 2O0KA 3AVUA 1XPUA 1GWNA 1G291 1HEIA 2FEOA 1FP7A 4LV6A 4V0OA 1ZMXA 1MO6A 4P32A 4B76A 1XZQA 5AUNB 3B13B 4DKXA 3AVVA 1B23P 1PLLA 2CHQA 2SHKA 2Z43A 4KSCA 2BIFA 3RABA 3THYA 2CXXA 3SYNA 1W4AA 2B21A 2E9SA 3I92A 5JWRA 4R2IA 1XPOA 3MG9A 1G6HA 3NC1C 1U9IC 3FDIA 4F4IA 2KWIA 4DCVA 1KI6A 3OEHD 4KAXA 4LV8B 1T5IA 2EWWA 5IK2D 2BBWA 3DZ8A 2X1VA 2VLIA 2XSZD 3QUSA 5TVKA 3GFOA 1UBFA 2VHTA 3GLIB 3P32A 1DG1G 3I4LA 3EX7C 1VPLA 2HF8A 4NDZA 3ZGXA 4HAZA 3CRRA 3FKSD 4LJ8A 3KQHA 4QG7A 1G5TA 3FPAA 3Q5DA 3QQ5A 3WHKA 4PQFA 3G0HA 2OLKA 5CYOA 4E22A 3ADDA 2N1BA 3PITA 1SVIA 3WRYC 2QENA 2IS2A 3GLHA 1KO8A 2NMVA 2RMKA 1KI9A 2D7CA 5GVSA 4CEHB 2JLVA 2J0VA 5G40A 4TL9A 2FSFA 4XTRA 4DDTA 3HDTA 3GLIE 1Z6AA 1XXHE 3LBIA 5J4VA 1TUEA 3VR4A 4MKIA 2F7SA 5CDFA 3TJZA 2ZXUA 1NIJA 1P72A 1YRAA 4KLNA 2ZRDA 4NH0A 3KQLA 2EWVA 4Q4HB 4F91B 3FOZA 3BB4A 2YOHA 2C96A 3OZXA 1IN4A 4Y0AA 3BH6A 3BAFA 2BBTA 1X8JA 4WZAE 4LCBA 3K1JA 1GG2A 4ZDIA 5F9FA 1G9XA 3BFKA 1OFUX 1P7CA 4IKEA 1FFHA 3AVPA 4LYAA 5B58C 2BM0A 4GL2A 3R7WA 2FH5B 2OEPA 2C2HA 2WZQA 2DY1A 2GBLA 4RY2A 4TYWA 4TMKA 3MFYA 4MYUA 3UXMA 5JHGB 1ZM2A 4MITA 3CLVA 4EDHA 5GJBA 1Q20A 1OXXK 2J41A 4QNRA 2JATA 4DSOA 5IRCD 2WIAA 3VMFA 1OB2A 1Z07A 3KQUA 1K5DA 2MSCB 3A4LA 1FMJA 1SVSA 2F1JA 3UKDA 1NL3A 3KJHA 2H57A 1Q1ZA 4XD7D 2ZI4A 1UJ2A 2QU8A 4LK2A 1NY5A 4Q01A 1A2BA 1E79D 4FD2A 3GLIA 2O8EA 1VIAA 2O8CB 4B3DA 3BXZA 3KB2A 4PQYA 5DYIA 4A92A 1VG8A 4QHYA 2VEDA 2HCJB 2ZUDA 4X8OA 2GJAA 2P6NA 4E09A 3K70D 2GEUA 1R0WA 2CMKA 3A1UA 4QGAA 3T06B 1E1RD 1CXZA 2Q0HA 4IFEA 1E0KA 2EYQA 1E1QD 3RDPA 4EJSA 3FFAA 4JVLA 2GF0A 4YLGA 5KNCA 1NSTA 1G7CA 2YVUA 4ZPXA 4BLOA 2VP4A 2QTVB 1ZU5A 1B0UA 2F1IA 4GPTA 4URYR 1O3YA 1S8FA 2PMDA 3SS8A 2CCKA 1ZM9A 4QNMA 4JYCA 4GMDA 5FOVA 3AF2A 2DCUA 3L43A 1OXVA 3PJRA 1SVMA 1Q22A 3B1YA 5F2EA 1BOFA 1EXMA 2IHYA 4M21A 1SVOA 2ZVQX 4RD6A 3TVTA 1YZKA 1OW3B 3KTAA 3KXKA 3QXHA 2ZSDA 4G01B 5B2ZA 3K0AA 3TSWA 3QKRB 2W6ID 3IEUA 4F7WA 2W2XA 3O8BA 1SVKA 4BEJA 2BVNA 1YZTA 1E2IA 3OIYA 4A2QA 3RS5A 4CVNA 3ND8A 3I8SA 3VNUA 3H86A 4LV5B 4UXHA 4LJ6A 1P3JA 4B75A 1KSJA 2QI9C 4M1SA 4P4SA 5EXTA 3TR5A 4TL7A 2BC9A 2EYUA 3JZMA 2FV8A 4CYMA 3P1JA 5L3SB 2B7BA 1ZVQA 5TV2A 1R5NA 2OV2A 2GZHA 3L0PA 3MAAC 2IYTA 4LX0A 5JRJA 5KO2A 5J4HA 5TDHA 1KMHA 1XMSA 4TLBA 3VKHA 1N6KA 1KSFX 2HYIC 2Z5FA 5A5GA 5K8LA 2CHGA 4BLSA 3GCGA 2PZFA 3AF3A 1KO4A 3BFVA 2R9VA 3SOPA 3MSXA 5CLQA 4DLTA 1F2UB 3C5HA 1KI6B 1W46A 3TAHA 2QPTA 4PZYA 4Q00A 4R9UC 5IHPA 4HAYA 2NTYC 2W00A 1YHNA 1ZAKA 2ERXA 3LVQE 3PUWA 4AYXA 1G3QA 1JXOA 3UWKA 2H5EA 4EAQA 1OSNA 3K0FB 1VYVA 1OH8A 1P9WA 4WXRA 2JEOA 1Q44A 3D8BA 1OFIA 5FL7D 3L8ZA 1OFTA 2ORIA 3ADBA 2VSXA 1F48A 1C4OA 4D0LB 1OJLA 4I1OA 1DAIA 4FMCF 1QVRA 5EQTA 1WMSA 1IOZA 4YMVA 3D7MA 4DJTA 5FOSA 4CEHA 2QL6A 3CWQA 1M8PA 4LY6A 5JZVA 1N25A 2CCGA 2QSZA 4XJXA 3TVDA 3MGCA 4Q1BA 2FPKA 3GEIA 1G16A 3CF6R 3O8DA 4HLQB 4LPSA 4TMWA 4TQ9A 4WZ6A 5KPJA 2XOKD 2VP9A 2GAAA 2VP6A 2EQBA 1NBMA 3CBQA 4TTQA 5SZKB 1XWIA 5KSPA 4JMPA 4PAOA 4AC9A 1AIPA 3MWYW 4LJ4A 2FFHA 1GTVA 2QP4A 2GAOA 4GT1A 3EIQA 2OFXA 2QPAA 1G21E 2XJ9A 2DWPA 3LXRA 1BS1A 1E6CA 1P73A 3A1TA 3SHWA 3FKSA 2AD1A 3VKGA 1Y63A 4D80A 2YOFA 2FGJA 4IDPA 2OCBA 1UM8A 4D25A 1TQ6A 1TF5A 1KAGA 3EARA 4FWIB 1D6JA 1SKYE 2ZYWX 5CJPA 1OPXA 2UZ3A 1RW4A 2Z83A 1I4DD 2A5YB 3K0SA 3NBXX 5FI1B 1TQDA 1CJMA 1K8RA 1T0JB 2F3TA 2ZJ5A 1XTSA 2QQ0A 4M22A 5HE9A 4EFMA 3ZS9A 2A5GA 3FGNA 3J81k 2HXYA 3KKOA 2AFIE 3HU2A 1TEVA 1IQPA 2NOAA 5E95A 2KI5A 3K0FA 3AGPA 2IYRA 4LHWA 1WF3A 1UKVY 1E9BA 2A9KA 4JVNA 1CEEA 2ZSFA 2ZE8A 3HPRA 1ZIOA 4QJ3A 3Q85A 1N0UA 1G3RA 2IYWA 3AEZA 1BMFD 2HYDA 3MMPA 4BLTA 1CRPA 3RS7A 3BB1A 4DZZA 1FZQA 1X1RA 2K5UA 5E4FA 4TTRA 3U6BA 1II8B 3U4QA 5LBIA 4TLDA 4LHXA 1YZQA 4B6FA 3TLXA 2W2VA 2V6JA 1MOZA 4B3XA 2QT1A 2ORVA 4A8JC 4GOXA 2VHCA 2HCBA 2YYZA 2FSHA 1UAAA 3GJ6A 3LA6A 3IILA 1T8TA 4W7SA 3BOSA 3U3OA 4Q1CA 1NN3A 1D8TA 2F9LA 3ASYA 2V1XA 3Q7PA 3EZFA 5EP3A 2JLXA 3K0AB 1XEXA 5AWFC 2AWNA 3VR3A 3U44A 1RFLA 4ESHA 3Q8XB 3R9WA 4HZUA 2QP3A 4QFMA 5BXQC 3KJIA 4P3YA 4MGKR 1W0JD 3Q5EA 3UIEA 4R98A 1E9RA 1JAHA 3OEED 5EE0A 2ZI6A 2VHQA 4EPWA 1L2TA 2GZDA 1I2DA 1FMLA 1NLFA 2G1JA 4MYHA 4RFSB 4TTPA 4ACBA 4RD1A 4D82A 4DLXA 1Z8FA 2GJ8A 3PEVA 4Q02A 1W2GA 2O52A 3P4XA 1ANKA 1MRNA 4OHXA 5KDOA 1MKYA 4LBVA 4I1SA 2W6JA 4XIGS 4X8MA 3IEVA 1VDZA 5KYKA 4PSAA 4NHOA 3N2IA 5EXPA 4EPRA 1KJYA 2OBLA 3AKEA 1EFRA 4HB4A 4O25A 1P2TA 2EFEB 1N6PA 4M53A 3X1DA 4A2WA 3U3KA 1XP8A 1KZGB 1F2UA 1KI2A 2QE7D 2V6IA 3L0SA 5J4YA 3IO3A 4B2PA 3W6PA 1Q0UA 2OSBA 3IIKA 4IVPA 4Z54A 3CM0A 1OKKA 5BQ5A 1MV5A 1KOFA 1L8QA 2AXPA 5JEDA 4DC9A 4RKFA 2QORA 4IEIA 2JLUA 1NVWQ 1W36B 1DO0A 1G3MA 2G83A 3TE6A 4BWYA 2J1LA 4U02A 1GFIA 4KVGA 1PUJA 4JKYA 1J70A 1IAQA 3E70C 2JLWA 1S0UA 4PO9A 2WVJA 5EJEA 4ON9A 2O8CA 4M9SA 4JL8A 3UWOA 2Z4RA 4CEJA 1NNEA 1HTWA 4MA4A 2XSZA 4FIDA 2ZRHA 1ZNZA 2AN9A 821PA 1XRJA 2F1RA 3BERA 5C4MA 1XDBA 3IPYA 4A6PA 1LW7A 2HLDA 3IUYA 4NP6A 2C95A 2FNAA 2ASEA 2B92A 2HV8A 3TH5A 2QAGC 1EX7A 2WWHA 1U2RA 3V4RA 3W6OA 1XJ0A 1XTIA 1LVGA 5H8WA 1E69A 1OLOA 2ZTSA 2YWGA 1SULA 1KSGA 3N2EA 2CE7A 2GF9A 4WA7A 3P26A 5FOUA 3WMGA 1JNYA 1N6LA 3SE0A 5DI3A 5FPYA 3UG6A 4GNKA 4CGZA 1UKEA 4PO1A 1GRQA 2OZEA 3LH5A 2FMXA 4B74A 4KI0A 4A8JA 2XXAB 2VP2A 2YHSA 1E99A 4HB2A 2AL7A 1EWQA 2ZRCA 4RFVA 2VIIA 2JLZA 4MGYR 1D9ZA 1LF0A 3VR2A 3B1VA 2I1QA 2L0XA 4PC1A 1K5GA 3TSZA 1C9KA 3WYGA 1FX0B 1R2QA 1WDTA 4IJMA 5P21A 3LFUA 4XTCS 1CR4A 3UK6A 3WYAA 5FPSA 5EE1A 1S3SA 3UPUA 2ZRKA 3U2QA 4Q4AA 1SQ5A 2IXEA 3PENA 4W5HA 5B30A 3LX5A 4OI0A 1TF2A 4DVGA 1ZCAA 5EE9A 3A37A 4K8OA 4KBFA 2KE5A 4TL8A 1AN0A 4HLUC 4UNPA 1M74A 521PA 1E4YA 5SZJA 4O3MA 3QXJA 1GUAA 2W2TA 4XWKA 1U94A 1T3LA 4DB4A 1Z0DA 2QRZA 2ZM5A 1NRJB 3SI7A 4MRSA 1LS1A 1IXZA 1VG9B 2GNOA 2ZROA 3GLFB 3I61A 2IUTA 3U7HB 1U0JA 3C16C 4TMVA 4MYCA 5UKDA 2ZR0A 4HUQB 1YR8A 4C7OA 4M1OA 1QF9A 1YVDA 2IF0A 3AB3A 3SJCA 4URXR 1W0KA 2ZRGA 4HUQA 2PBRA 2OBNA 1N2CE 2RCNA 2V9PA 4LPKA 2BBSA 4US0R 3NH6A 1GSIA 1E2MA 3DMDA 4NONA 3W3AA 3NC0C 3AKDA 3ZQ6A 2AFHE 3PG5A 4GSYA 4AWXA 3ZDQA 2VRWA 3NBYC 4B35A 1HE1C 2PZGA 2QMHA 4RKEA 2RAPA 2IK8A 3DPUA 4XVRA 1P60A 3QJYA 4Q9LA 5JSZB 1G17A 2DFTA 1A5TA 2JASA 3FYHA 3CONA 1AGPA 3QPUA 3SN6A 4B32A 2XB4A 4Q03A 2QBYA 1YU9A 3AUYA 1OB5A 3TW4A 1J2JA 1QZXA 4B73A 2QY9A 3OFND 4D2IA 2ZITA 1UEIA 4YMSA 5KPDA 3I8XA 4OHZA 1HA3A 1ZIPA 2WWIA 4AI6A 1G3IA 4PANA 1KK0A 3GLGA 1HQYE 5EP2A 5HZHA 1J99A 4BASA 2J0SA 1XEWY 1CTQA 1U8YA 4JSTA 1VCMA 2GJSA 3PR1A 4UXJA 3GJ0A 4XSGA 2KBEA 1Z83A 2RGNA 4L9WA 3EAQA 5GJVC 4DSUA 1X8LA 2VHJA 3HR8A 1LV7A 2V8OA 5SZHB 3PUVA 1NBME 5FUVA 3OEEA 1E2DA 4Q7KA 3I72A 1VYTA 1Z06A 2A5FA 2RGAA 1ZUIA 3MJRA 3NIBA 2NIPA 4EJSB 4Z1MA 4AKHA 3RANA 3CRMA 2FOLA 3N5CA 4GRAA 2QA5A 2ZI3A 4GI7A 3EZ9A 4NYMR 2JGNA 2W6IA 3EWSA 4D0NA 5IK2A 3AGQA 2ZRAA 3M1IA 4IFBA 3AVWA 4MGZR 2CNWD 3X1XA 2IUUA 4LBZA 2YWEA 3GPLA 4YMTA 3JVUA 3IHLA 4UQOA 4UNSA 4PXAA 1TU4A 1WBBA 2AX4A 1OH5A 4Q18A 1OT3A 4FW9A 4PZZA 3CX7A 4DIEA 2GCNA 1Q3HA 4KFRA 2EVWX 1QRAA 5CDFE 4LYJA 4W5WA 3L8YA 2HUPA 4BZPA 1IONA 1VCOA 2BKUA 2YJTD 1AKEA 5FPTA 4NKRA 1R6BX 4TLCA 3MWLA 4RD0A 5C46F 1G3UA 4M9QA 4OKSA 1W36D 1VYUA 2UKDA 1OHHA 4PC2A 5L3VA 2HJGA 3RRMA 2J0UA 1XCMA 1CJTC 4IDQA 1U9IA 4ARZB 1II9A 4TYQA 121PA 2ZSAA 3B8HA 3I1FA 4HEJA 3SJAA 5LD2B 4Q48A 4URUR 1AQUA 4XWAA 2OM2A 4Q9JA 5FPHA 3WP1B 1GNQA 1GOTA 2H92A 1EG7A 1RE0A 1CR0A 5KSOA 1U81A 3VTKA 4OHWA 3PUXA 4N0DA 4IOKA 4YMUA 3QPVA 1KY2A 3GLGB 1G20E 2OAP1 2DPXA 2YC2C 1ETUA 3FVQA 4BE7B 1PZNA 1JJVA 3HPQA 2QPOA 1D2MA 4BGDA 3THYB 1Q1QA 3LQRA 3RC3A 3UMRA 1E2PA 3QI2A 1E9DA 5BYJA 5J4LA 2H16A 3R7WB 3UMFA 4M1YA 3FFBA 4B71A 1DADA 1FX0A 3UATA 4U7DA 2P65A 1S1CA 5EE5B 2GJ9A 4NU0A 2UVQA 1H8HD 1Q1EA 2WBLC 1C1YA 4A0HA 4B2IA 5DGXA 2ZYTX 4EPTA 1Z0KA 4Q9KA 2BCJQ 2IXFA 5FBQB 3KL4A 1KHTA 5KNDA 2RH5A 4ASUA 1LFDB 4PHTA 4NMMA 3KTAB 3RVBA 3VHXA 3KXLA 2EFGA 1Z6TA 3REFA 5B57C 2XNDA 1NBMD 4BPBA 1U99A 2IYQA 3AVQA 2XTZA 4B6EA 3ADCA 3MCAA 3EZ6A 1ONBA 3AF4A 3TQFA 2WV9A 4LBWA 2W83A 3ETLA 2OUKA 1XMVA 3EIEA 4N3NA 2LWIA 4P4UA 2NO6A 1E9AA 4D4MA 2A5JA 3SEAA 3U4QB 3L2OB 2XZPA 4D6PA 1Z0IA 4PSVA 3I73A 2G6BA 4B34A 2GCPA 5FUYA 1JR3A 1KMQA 2FFQA 2YC4C 4LRWA 2CLCX 5AK0A 1YZNA 3T1VA 2R65A 1P75A 1RKBA 1XF9A 2FJUA 2O8FB 1FQJA 1NLYA 4TYYA 5B64A 4DUGD 4YXWD 2FSGA 2FPMA 1F2TA 5D3MA 1V43A 4PFSA 1H8HA 4KCGA 3F8TA 3AUXA 3WP0A 4RD4A 2H18A 2O0HA 3BS4A 1DOAA 3QSYA 3CO5A 5E7IA 5AUOB 1JEEA 1ZW6A 1SHZA 3WBJA 4BFTA 3UMSA 3BH0A 3K0CC 3Q7QA 3R20A 4Q9HA 4CW7A 1UADA 4BFUA 4PHGA 2PMKA 3RLFA 3RSLA 2BJWA 1T3HA 2O0JA 5KTYA 2BM1A 3BH7A 4OJKA 5CM9C 1L4UA 2A5DA 4PX9A 4DXAA 2R6CA 1SXJE 3NTUA 2ZRMA 4IXNA 2CE2X 4MQBA 4NYIR 1QHXA 3AF1A 4RJLA 3ZZUA 4EFLA 3AVXA 5ELXA 3ZD7A 2JLRA 5HCIA 3SHFA 3ZLJA 3RRZA 1QHNA 5AJVB 4C0AC 3LWNA 2JJ1D 3RRYA 2D7DA 1F3OA 1XCGB 2QRNA 2JIZA 2OFWA 3BBPA 2YNMA 4KYUA 2DHRA 4Q1DA 1CJUC 2NQ2C 4K46A 2O8DB 3M0EA 1KK1A 4UKDA 2CL6X 1X6VA 2LKCA 4UJ3A 1YJ5A 5DO9A 3V9PA 2OHFA 4FMCB 4DEXA 3CIOA 4Q4AB 3BWDD 5F98A 2OG2A 5L3RA 4C0LA 1NMYA 3MWKA 1XEWX 1YRBA 1UFQA 4IRUB 3CF0A 1R0ZA 2RGXA 4JBWA 3KJEA 1FW6A 5JJLA 2IYUA 3BORA 3T1QA 3GP8A 3B1WA 4HDQB 2W6JD 4JL5A 3K53A 4LI0A 3THXA 1NY6A 1KYIA 2QMUA 2GDJA 3FKQA 2ZRJA 1VHTA
chains in the Genus database with same CATH superfamily
2GHQA 1FMCA 4GVPA 4FEYA 4AP5A 3A6PC 3KS9A 3ZV6A 2QV0A 4HLCA 4L3VA 4IJ6A 4MKRA 3GB9A 4IEEA 4X60A 1X7ZA 3PHLA 2VPYA 1I7PA 3KSDO 2VNHA 1CX9B 1YB5A 4EMUA 2MMCA 1MNAA 2HLPA 3EXG2 3JZIA 3PC8A 5THKA 4BKPA 5DNCA 1RQRA 2HQ1A 1COWA 4PW0A 3C4QA 2X0FA 4YRNA 4Y98A 3FGPA 4E1VA 2PT5A 2ZTUA 2I1LA 4OGFA 5CDSA 1QIKA 1OGJA 3DTNA 2L19A 3ISVA 1IATA 2WWGA 3K6JA 3KDSE 4OIFA 4PZ0A 3AJRA 4QPPA 1J24A 4V03A 1DKNA 2WF5A 2X0IA 2P2ZA 3GEHA 3NBZC 5COQA 4J1TC 2Z04A 1IG3A 3KKPA 3NG1A 4OBBA 3UV7A 7ABPA 2P9GA 1E2NA 2RHHA 4TT3D 2PJUA 1R8QA 5CM2Z 3OUTA 3OIDA 2AJLI 4XWYA 3F97A 3KEMA 2IWRA 3FNHA 2ZQZA 5FPKA 4OOEA 2JVIA 3DBIA 3QXCA 3RC1A 3RU9A 5JNVA 1NXOA 1E6MA 3R3VA 3RFUA 1JFSA 1SC1A 2JIZD 4IDNA 4ZHQA 5K8TA 4DUYB 3JQ8B 3C8HA 3W5UA 5JDCA 2MSDB 3AMVA 3IDFA 3MS2A 2RGYA 3MILA 4PRKA 3H0EA 4W5JA 3VMMA 1C0IA 3GNTA 4I0WB 4Q9DA 1AUPA 1ZM3A 4I50B 3FMIA 4RF5A 3PEFA 2R6FA 6ABPA 1NI4A 1YRYE 4RAOA 1UK6A 1T6XA 1HT3A 3OZFA 4QBFA 3UHAA 4XQ0A 3A32A 4HDAA 4LMBA 4YGYA 4KQMA 1AX9A 4ENWA 4ZZIA 3AF6A 3ESAA 1C1XB 5AVWA 4JJEA 4G5XA 1QFJA 3K1TA 5KVQA 1JWLA 3VJKA 1GGHA 1KDPA 1LQUA 1PWEA 3I9OA 721PA 2HHJA 4WAUA 3M3PA 3O03A 4DSNA 3K32A 3QUTA 4N4AA 5A5FA 2XNJA 4DF3A 7AT1A 5CB8A 1JPNA 3ENWA 3KB1A 4BZQA 5HM6A 1BU5A 1NATA 2WYHA 4JS0A 2FG5A 1UPUA 3KZ1E 2O1SA 4H7EA 1H1LA 5HXAA 3TUZC 1DT3A 1UJ4A 3CRW1 5LLTA 1CUFA 2ZTLA 1EH5A 1A7KA 3CO0S 1B00A 3IMCA 5EMLA 5IG2A 4HAWA 2PLWA 4YK7A 5J5CA 2O2SA 1W1UA 4PGAA 2FYTA 1OVGA 3LY8A 3VU9A 1Q14A 3HKCA 1QE3A 4YJDA 2FZEA 2PJZA 5GIOE 1MFZA 1YU6A 4RGBA 2QSYA 1JEJA 3P2IA 4RHFA 5JY6A 4GKVA 3H18A 1RPJA 4U6SA 3R7BA 2CYAA 2XDQB 4FDUA 4FYVA 2GTIA 1LDEA 4Z86A 5TPZD 1EK6A 2EQ5A 5A9TA 4YWHA 2ZS8A 3B6ZA 4K9DA 3Q7IA 5AK4A 1O0BA 2XNDD 4FIZA 4I19A 1M2OB 1MH1A 1L1FA 2Z57A 5H1YA 4O4LB 5CFMA 4D4IA 4C05A 3VR5A 3A6DA 4ZU3A 4OLBA 3AEQA 1URPA 3IJPA 1GHTA 2ZVJA 3NWPA 4DCNA 4RL6A 3HP1A 4OHCA 2IDZA 1X1DA 3IELA 3H3XA 3KR1A 4CMIB 2GVNA 3MHPA 1Y3AA 2BZ0A 2W6OA 4MRNA 4Y6PA 1XNHA 3ONWA 1A82A 4MV0A 1OH6A 3F8WA 3Q11A 5G0SA 1B8UA 2WICA 3T4UA 3L7NA 3C14C 4LZWA 4DIMA 1ZC3A 2VP5A 5JJCA 3U37A 2VOJA 3CVXA 2FX5A 2B37A 2A9OA 2LRHA 3K1YA 4ZRNA 4FMDF 5B58T 4KTTE 3URKA 1P6XA 1Z12A 4Q3OA 1YHZA 4C2UA 2AH5A 3FCEA 5AVKA 4OK5A 3VO8A 1M6NA 1QTRA 2Y8EA 5FI0B 3H83A 3S7ZA 1YCFA 4HLUA 5KU7A 1RPZA 5GZ3A 3B38A 3HADA 1Z63A 3ZVRA 1XBTA 2QTBA 3QELB 4OBWA 2NTVA 4CMAA 5CTAA 2IZOA 5KYXA 4BLWA 5F3DA 4F93B 2WUWE 3ED5A 1PWXA 1EINA 2BR3A 2CLHB 1VFPA 4LJSA 2H00A 2IV3A 4KQJA 5F21A 1TYEB 1PK9A 1R5OA 1EP9A 3KQKA 2IXDA 1T8YA 1U4OA 4I5IA 3KPYA 3IP6A 3BC1A 1JDJA 3I6MA 4JHLA 5GJCA 3VC3A 3E7WA 5F2KA 4UCXA 2FWAA 4DVJA 2O5VA 3CX8A 2V0GA 3G2LA 1PGJA 1VSTA 1SHKA 3CW2A 4L15A 3K2QA 4FZ3A 1SZCA 1N2XA 4HEHA 4PPNA 4V39A 4NYJR 4TM7A 3TK1A 1CDZA 1LJ8A 4BVHA 3SYKA 3QLEA 1I0ZA 1GYQA 2CDBA 2G9UA 4M3NA 3EOBI 3HA5A 1FXWA 1HYGA 2AG8A 2H9YA 4N8DA 5BMVA 2ZSBA 4CQLB 1WUJS 2G88A 1PS9A 3OJLA 3WHPA 1SCAA 4J07A 2NPOA 3TPFA 1M2NA 2EP8A 2C5LA 3PICA 5H82A 3TCXB 3LF2A 2J33A 3QE3A 3EG5A 4R69A 2LKDA 5IYZA 4YRQA 1PHPA 2V6BA 3AG5A 3E3NA 1JR6A 1LA2A 3O2QB 2A0WA 4DT1B 4Q9NA 1CDOA 1L8OA 2C94A 2P67A 4JBHA 3OCZA 4W1RA 3KD3A 1CCWA 2I34A 1I7QB 2IU3A 1T6NA 2YZNA 2YJ4A 4R8VA 1QHGA 4B3SB 5CRIA 1C2TA 4D0SA 4R9RA 2QMQA 4R8RA 1LPPA 1FSFA 3OURA 2ZWIA 3HB0A 3OMLA 4EL5A 5HUQA 3BTVA 1XLUA 3E5RA 1P91A 3N75A 4WCFC 4V24A 2GPTA 1YA4A 4X92A 5DEOA 2C29D 2GFHA 2WSSD 4LDJA 4BRUA 4C3ZA 1EQAA 1FFGA 1KU0A 2YR0A 4BBPA 3T3IA 1Y82A 4E31A 5HKOA 1T2VA 2IHUA 2UUOA 1IQ0A 3I05A 3OZDA 4MIKA 4G84A 3FMFA 2ADFA 5C3MA 4ZKEA 2R6R1 1KJZA 1PK8A 4ZVNA 4KHPB 2FZ4A 4ZU1X 4AZ3B 4FDMA 4QBIA 4G0VA 2X41A 1E98A 2NZJA 3A4MA 2X8JA 4H1UA 3G5UA 4IILA 1PL8A 4MEJA 3UMJA 1TUIA 2WFLA 1VL0A 1G7SA 3B6EA 4F56A 1KTVA 5E6UB 1Z5VA 5DRYA 3DWIA 3O8OB 4EENA 1LFAA 1N3YA 3Q72A 1KQOA 2VQSA 5GIPE 1E2EA 3QUCA 4KLZA 4CU2A 4JBYA 1XMOB 2I6SA 3O95A 5DP1A 5CCDA 1EFRD 2XB6A 4ENUA 3E3LA 5IF9A 2FA9A 4LFBB 3C7TA 1L4MA 4HMOA 5K0JA 4QSMA 1ZG3A 4ZVVA 5JAUA 2XA9A 5ALZA 4FOPA 4BKMA 1YD7A 2ZE6A 4M0PA 5IZCC 2JH8A 4KO3S 4QFDA 1OLUA 4E5PA 1JALA 4CQMB 3U7GA 2PLAA 3GT3A 2WTNA 4AUKA 3RYFA 2VQEB 1JP7A 4H77A 2RAVA 2I80A 5DYGA 4DEVA 3F2IA 3AHJA 4Y3UA 4ZQFA 4B45A 2V6GA 3ASUA 5GONA 2QL9A 2D2XA 2BGMA 5DM70 1JA1A 3M6FA 1SC3A 2B99A 3TRFA 3SIRA 5G4KA 1LBEA 4XD7D 5G4LA 1E2BA 2OPBA 5LUAA 2KYRA 3L8EA 1GJRA 1ILWA 2R8PA 4ZRDA 2R62A 1KVTA 1EPUA 4ZJPA 1YDMA 3EXAA 3IUPA 1AF7A 2AC7A 4O02B 2CVPA 4PF1A 4AMGA 4M46A 1XHEA 4B6RA 4G0WA 3B1KA 3PX2A 3ZNNA 1IEWA 1Z0UA 2QN6A 3IVMA 4QNNA 1T9HA 5KNLA 3KTFA 1A76A 1V2GA 3REQA 2G0AA 2VHZA 5DHFA 2PRKA 4I1VA 2F3UA 1ECBA 2WPDD 3I52A 2ARKA 5I9MA 2REBA 3CZCA 1J21A 3QF7A 4P98A 1XF1A 2IDMA 2C58A 4MVWA 1IN5A 4BE9A 1YZUA 1ADJA 3CZQA 3WO1A 3N3AC 4R83A 1EVEA 4JLDA 1T91A 4B43A 4CM6A 4QELA 1JJFA 2JJMA 3HEAA 4I3FA 1GRNA 1VKZA 3I39X 2DTDA 3PKZA 1L5RA 3M49A 1MDFA 1XFAA 4JLUA 1M73E 4GZ5A 2GBPA 2QNRA 1JVBA 1R0YA 2HNAA 5FJIA 3CS3A 2G0NA 1NJSA 5FA6A 4JEMA 1BHJA 1H66A 2JDID 4QQRA 1YZHA 2PWYA 3D4OA 3OAAD 4IHJB 1C1DB 3NXKA 3OZRA 4A2PA 1SCDA 2CDNA 2WAXA 4LYFA 4C7BA 1LS6A 4CKCA 3PNPA 1I3LA 3LOQA 5BQFA 1GLVA 4PIPA 1XAHA 2FW8A 2BKLA 3QVWA 1UBUS 2ECFA 4G4JA 5K51A 3ACDA 4CZ2A 1R66A 1RYMA 1MOPA 3HMKA 4KQFA 3KQMA 5LQNA 2G06A 4QOSA 4DA0A 4L0MA 3UCEA 3QU4A 2IY9A 2Y1GA 1KK2A 2X2PA 2WFZA 1U8ZA 1G0NA 2L18A 1BXRA 4DQVA 1OFHA 4F6RA 4ZOBA 3L7BA 3IV9A 4AIRA 4MA5A 2PH1A 4WOPA 4EP1A 2ZCVA 4ZCIA 1XXLA 4QQNA 3VSEA 2R87A 1W9HA 1CP2A 2F1HA 4JLOA 1LBSA 2YN4A 2H1FA 4XCQA 4LHZA 4O29A 3H9BA 3QIAA 3ZGVA 4FQ8A 3L5OA 1UF9A 3AWIA 5EC8A 5GAJA 5AW2A 2Q62A 1F12A 1TYAE 2Q1XA 2FPIB 2E4UA 2F67A 1GU1A 2FP4A 1GCUA 3LRXA 3OTWA 4HDOB 1YS6A 4OQMA 4AB1A 1X42A 3IQXA 4BJ3A 3DGFC 4LCEA 4EL0A 4KAFA 1THMA 5E7MA 1V2HE 2C57A 2E4XA 2CJWB 3C7DB 1BJRE 2NXJA 1AUVA 1E5LA 1L7AA 4GP6A 4J0FA 3WMWA 3TKAA 1E5QA 1DQPA 2Y0EA 3ZTTA 3VVMA 2ESRA 4TSRA 3PQ2A 4BB6A 1H2BA 3U5ZB 3P45A 5JJIA 3QVUA 1G60A 4Z0TA 5JVDB 4ZIRB 1QIHA 2FZWA 2GDZA 4OYRA 2GEJA 2X9NA 3KJGA 4B46A 1G4UR 1K66A 1AK1A 4KQIA 1ZISA 2QSJA 3OKAA 1U11A 1KS9A 4XASA 5A6SB 3COZA 3CURA 3R6WA 3ID6C 3HJNA 1E4EB 4ZEVA 4F9GA 3HBFA 1IHPA 1GITA 5BNTA 3TZBA 3IXMA 2KS6A 2G1AA 2XUKA 4RXUA 5DPMA 3UJNA 2ZT6A 4GMFA 2D62A 4YJGA 4XB1A 5B3JA 1QHEA 1K86A 3JASB 5AXCA 3DNFA 4HX9A 1T24A 4YA6A 2ORED 1DAEA 3PWKA 1KI1A 1SVWA 1KKUA 2HB6A 4MVJG 4QATA 4GZMA 1ZNYA 1DU4A 2WU3A 2JC3A 1BDMA 3K4HA 2GUWA 2M32A 2WD9A 1PEKE 2XDQA 1CLUA 1RZ3A 2X40A 3UBMA 4FHCA 4D4JA 5TMPA 4JROA 2VS1A 2CNNA 2AR7A 4U6NA 4Y2TA 4IR7A 1EFPB 1KYWA 2J4DA 1KGDA 3DS8A 1C7ZA 2H29A 4G1EB 1EXWA 1I4EB 4AUMA 1U8AA 3KJFA 2JCBA 3IP9A 1NLMA 1RCTE 2IX9A 4QPJC 4XR4A 3VO2A 1GSOA 4YRAA 5C81A 4HAUA 3NKFA 3L8HA 2YV5A 3N0TA 3KYCB 1J49A 1BN6A 2XCSB 4PVDA 1GUDA 1BH2A 1NWHA 1RWNA 2PUBA 2JKVA 1G8AA 4JUAA 4YO8A 1KI8A 3MCVA 3VUFA 3BDAA 4RZQA 1V8OA 4IH9A 1KI3A 3FWYA 3M83A 1I9GA 1X39A 3WZLA 5CAEB 3OA2A 4BNMA 2R8RA 1GQOA 2OKGA 3MSCA 3OE7D 1KE1A 2RKBA 5HRAA 2EZ9A 2R6JA 1EWYA 2ZR9A 5HMMA 3DKPA 4DLAA 5JH7F 1YB2A 2IYYA 4LOHA 1FYFA 3B51X 4KHZA 2C20A 3ZJVA 2J3EA 3M82A 5I4KA 3KXDA 1Y42X 2O3JA 2QGFA 2VKTA 3QOXA 3UY4A 1W7AA 4CQNA 4QDXA 4CEIA 4JYAB 4P54A 2EERA 3D2CA 4B09A 2V7TA 1MD9A 3ABQB 3LX6A 3PF8A 3CR7A 4ND1A 1VFNA 2I4NA 4K2HA 4M87A 4AJ9A 3SZRA 4YCNA 2OXCA 4H6PA 4BB5A 3IT1A 3OEHA 4CEJA 4PHHA 4OKIA 1CY0A 1WE2A 2BHRA 4QVGA 5EZ5A 1B0ZA 5HJ5A 4NV1A 1HH4A 4FGUA 1XZHA 1S2DA 4B8WA 3QIVA 5IX8A 1VHWA 4V0ME 4M4SA 1D9XA 1A4RA 1IXSB 1TUBA 2ILVA 3NJRA 4P3NA 4X3CA 3PQ5A 3TQRA 3MXOA 2QVCA 5AW3A 4MUYA 1IBKB 3C6XA 5HKKA 1QTNA 2HREA 1FFSA 4DA8A 4BNZA 1E2UA 2HDNB 5EA2A 3EPHA 1EGAA 1TRHA 1LX7A 2DHQA 2H59A 4LDZA 4DMRA 5JRZA 3GEGA 4K40A 1UWLA 4LA4A 1OF1A 1JGTA 2Q3LA 2QRVA 2W7TA 4FYKA 3ZQKA 3E5MA 2X4DA 3OE1A 4GI5A 1PR1A 4INJA 2GN9A 3HY3A 2ZJ2A 4F6LA 2CL5A 1VKOA 1QIJA 4HAXA 1IQRA 3FH0A 1CS4C 1X3SA 2PZBA 3FN4A 5J1SB 5TC4A 1ISPA 3TCKA 4N7RA 2R6HA 3JV7A 1CYDA 1UAGA 4WA8A 4G0XA 3WMRA 3DOIA 5J63A 3TAXA 4B8ZA 1BWRA 1OWPA 1VMDA 2P9YA 3BZWA 4MEBA 4O4HA 4P9NA 3CH4B 3HV2A 3N6XA 4XM1A 2K2QB 3EEBA 4CT4B 3OIUA 3M1YA 3TN7A 4RABA 2QN7A 2OXIA 3KSUA 3IAUA 3JAMA 1MOSA 3H13A 1KMNA 3PGLA 3G9ZA 4KRYA 5HEKA 1E89A 4BQQA 1MZPA 3KOZA 1YRQA 2PQ0A 3CKYA 3JQPA 5F4ZA 4OUKX 3SXUB 2AI2A 1T5HX 3K0EA 1PJRA 3DG9A 4HQNA 4EB6A 4QXMA 4FHZA 4NK5A 1Q2UA 1XRNA 1YIOA 1L6RA 2A1TS 2YQ5A 3AEKB 3CF4G 5AI5A 3FCYA 2VR1A 1HT1E 3KKKA 3A9UA 4HDKB 3VR6A 3GLFA 1JEYA 2IELA 4MRRA 4S0ZA 3O83A 2BEUB 4OGLA 1YMQA 5AQEA 2X9GA 4OI4A 1N75A 4QQKA 3A1DA 3RSQA 4LF7B 4L74A 1EDOA 5MN5A 2NZYA 5FULA 1QMGA 1THTA 4F3RA 4FCTA 3HCBA 1L7QA 1QCDA 3KOXA 3SP1A 2P3QA 4XR9A 2F1OA 4JOSA 1G8SA 3Q0IA 1FNSA 1FDVA 4QJIA 1D6MA 4ZQGA 1R74A 4ME6A 3ZK9A 2OT3B 1HNXB 1OXUA 2WWWA 1QZZA 3WRXC 4PS0A 1BAPA 1DG3A 3U3RA 2GA9A 4Z7OB 2AFVA 4ZVSA 3BULA 3MRVA 3UG7A 1QRDA 2FZKA 2OCXA 1OT5A 3EA5A 3QYAA 4RDHA 3VRHA 1UMDA 4AVYA 3JCZA 5B12A 1DDIA 2PDAA 1AU9A 4H6WA 3KG2A 2XGSA 4JDUA 4X94A 4BFYA 3C5EA 3HL0A 4RIHA 4HDRB 4J0GA 4MCIA 2VH2A 1CQXA 2VFAA 3GFBA 2PUVA 1BXZA 1NI5A 1QAOA 2WFAA 3AR3A 1M5UA 4WERA 4M1WA 4OXYA 4Q19A 3G2JA 3WWZA 3GWZA 1P29A 2R6GA 1ZD2P 3ZE7A 3GLHB 3KB6A 2BKEA 2N75A 3ICVA 1GPNA 1Z29A 3FMPB 1PR0A 3G2HA 4N7BA 4B6OA 4WXHA 4DCMA 4F84A 4YT8A 3AB8A 3A1FA 4P0PB 1CF4A 1Y5MA 4K7JA 2IWHA 1HE3A 4YO7A 1CQJA 3FWZA 3OQMA 3AQIA 1GPWB 3UGQA 2WUEA 1SFRA 1EFTA 3HVRA 2AOTB 2LD4A 1X7XB 3LY5A 1NHWA 1XDUA 2YUTA 3NKLA 4GMXA 3UWPA 2PUEA 2BONA 5EIAA 2EJUA 3GLGE 3D54D 2GEDA 1KO7A 3F4LA 3F9IA 3VU9B 1SHJA 1QRUA 1CZUA 2OFFA 1N5JA 4D6YA 1RYFA 3EZ2A 2FKAA 2Q0QA 1ZUWA 2ZDQA 4H31A 1M8JA 3CZAA 1U0TA 5K4AA 1JECA 2JJ2D 2BOVA 2KJQA 3LRPA 2NO1A 4NCHA 4AUNA 1G18A 1X1AA 4WIAA 1AQNA 5L3SA 4BNJA 4S1OA 3OOEA 3IUEA 3P0JA 5REQB 1E79A 4MVXA 4G6ZA 1J07A 4TTSA 5JLJA 3SF0A 4IIEA 5KYUB 1U31A 2JEYA 2XUGA 3AR5A 1KMCA 3UH0A 3K09A 5EWJA 2ZW9A 1HT0A 1RLOA 3DL0A 3BMQA 2W6QA 4G41A 1NRIA 5K2MA 1YH3A 3NCHA 2D3TA 1Z2CA 2C82A 2CWDA 5F12A 1CY8A 1II8A 2HRDA 2WJ4A 1H2RS 2WJWA 1X1TA 4Q3NA 4Q4JB 4YAOA 4B87A 4WBNA 2VJQA 3HNPA 4YRDA 2XCTB 4XOIA 4DR1B 1EI9A 1QWOA 2ZIXA 1HEUA 2I87A 1NOIA 1M7BA 3K9NA 3PVZA 2QTGA 2NLOA 4C0JA 5FI3A 5HKBA 5CB6A 2FPIA 3JVVA 3JAKA 3L4SO 4EX6A 4D81A 4MS3B 4WADA 3ZLTA 5ITSA 3K8YA 3TM4A 2AZDA 4Y6RA 1ECCA 4IHJA 2A9QA 3TKLA 3WL6A 1V9SA 2YMPA 4JOCA 5HCNA 5H9WA 3H6KA 3V97A 3EPKA 2V4UA 3B60A 3IQIX 1RACA 2MSNA 3R8XA 2EIXA 2FPRA 1U98A 4CLHA 5IVHA 2C2GA 1SELA 5HFJA 1NXSA 1KJIA 2I3GA 3INTA 4HXFB 5KHOC 3MHTA 2R7KA 5DM4A 4EUHA 3AUAA 4KFUA 1LQ2A 1USIA 3R9IA 4PSUA 3MJHA 3SQDA 3O75A 4DLUA 1BQEA 1XRRA 2JPDA 3JXEA 3LNTA 3LQQA 1XLTA 3V2HA 2Y1WA 3T4EA 5COAA 4WDRA 3UA3A 2P9EA 2ZWOA 1FUEA 1HDGO 3SIXA 2D06A 2WA2A 1U1FA 3PXDA 4B7UA 4JBLA 3ZZ1A 4CDGA 4CT5A 2NZWA 3AVWA 3ACCA 3GAFA 4PZUA 1NW9B 4RETA 4DCUA 3GUCA 2Z95A 4IIFA 4DDWA 4I08A 5LZ2A 4NZYA 1QFSA 4AJ4A 1B6RA 1R5BA 1AT1A 1SXHA 2VCEA 4MICA 2MYNA 3OETA 1Y7HA 3OICA 4V0SA 5KVSA 1SXPA 4K0KB 1WXDA 1XNRB 4OQNA 3UJHA 2PS0A 4L50A 2BT4A 3T9BA 1BD3A 1C9YA 1NW4A 3NASA 3OCVA 5DH9A 2BPOA 1Y7TA 2LUOA 3INYA 4A5SA 3M4XA 1PV4A 1UFRA 3EFOA 1DX4A 4PNZA 5E6SA 3UAVA 3U40A 1GZDA 2SCUB 1C0PA 3C4JA 1N6OA 3AEUB 3HQ4O 3N70A 4R16A 4DR4B 3I64A 1JG1A 2FZCA 3IQWA 4D9FA 1P4GA 1EUCA 1YZLA 3NWBA 2ZUBA 4NK4A 1P31A 3V6LA 2X5OA 1VZ2A 1J1UA 1E5TA 3ABSB 3DZBA 3MK31 4KU4A 2XW6A 4L27A 3WLKX 4AT1A 4FWTA 1SNYA 4QRHA 1ULZA 1JLKA 621PA 5IHXA 1GNVA 1TLLA 3A3KA 1N36B 3HBMA 3IPXA 4MUNA 2MINB 2IOFA 3O8RA 3LVFO 3A9CA 4JYBA 3VSBA 1WOMA 2XVZA 3AO0B 3O7MA 2D4HA 2D0DA 3CWZA 4MR8A 3OJWA 4WBXC 3UJBA 1V16A 4XB2A 1JB1A 3B7WA 5AVTA 1M2HA 3LXUX 4W4TA 3P2OA 3EPLA 5ENZA 1A1VA 2Q8QA 1G7TA 4WY8A 2FJPA 2MDTA 1MQSA 1NG1A 5CT4A 4ACAA 5A4KA 5LU8A 4AZVA 2NU7A 4TKVA 5DISB 1JA9A 2WT9A 2JDIA 5KVCA 5EESA 2X14A 4MVJH 5JASA 3QLUC 4OJQA 2QV7A 2CHUA 2WMNB 1WJGA 2BEJA 3RLIA 3MBIA 4RCYA 4XSHA 1V95A 3DCIA 2XT9A 5JWOA 3I45A 2BHSA 2ACEA 3IE0A 1E1RA 1G4AE 3O90A 4E11A 4Y6SA 1HK7A 1SIOA 3DE7X 5KYNA 3TFOA 1JSZA 2EBWA 5JNLA 1XDWA 3IAFA 4M36A 4I99A 4DTIA 3L82B 5CK5A 2CDCA 3ZCVA 2J0QA 3GELA 3WSWA 1QPZA 4I4CA 1C3OB 4URFA 2W0SA 3UB2A 1LPNA 3D5QA 2EW2A 5D85A 1H6CA 2QGNA 1KOJA 2ADMA 2ZJYA 3T5GA 2G1PA 4ARVA 3R5XA 1BDIA 4TX1A 2X1HA 2ATXA 5FTNA 1ZCFA 2NZ2A 4MB2A 4DWJA 5ARCA 1ESNA 1G19A 4GM0A 3OFNA 4RQBA 3RJ5A 1HMPA 4D1YA 3CE6A 1N78A 3R7NA 2MJLA 5F9MA 2JFHA 4ZKDA 4ETIA 1VOTA 3L3BA 4YMLA 3GHHA 3RUFA 3TDNA 2PKRA 3ZOKA 1LZLA 1U9CA 4Z9FA 4LQ4A 3LUAA 3VDRA 5ERXA 2GH1A 3BHMA 3MJSA 5JD4A 5KTPA 1GN8A 1B0AA 2ZEJA 4GRIA 1NVDA 4EITA 2JJQA 4BQNA 1H2HA 1NVVR 4BC1A 2B9EA 1UKZA 4R2HA 4XOUA 1GKLA 3FTDA 3MWFA 1DCMA 3MJCA 2QIOA 5FOQA 2CSXA 1S7CA 1VE1A 5JQGA 1TUBB 4V0RA 4DXHA 1Q0ZA 1YS1X 4DB2A 2EX0A 1E6UA 2VJKA 4YJKA 5D3QA 3VPHA 4AZSA 1ZUNB 3PYLA 4BFLA 1XYVA 1FUUA 2QHXA 4IX9A 2GVDC 3U3JA 3WJAA 3N2GB 2F59A 3L0OA 3HACA 2VTBB 4IGEA 1W1WA 2I7CA 4HBGA 3LP6A 1Y8ZA 3F6CA 4MQFA 3F0TA 2XUJA 2Z5GA 2GD0A 4R2WA 4KR6A 2Q99A 2BEWB 3B52X 1UPFA 4N0EA 2QU7A 5K45A 5KINB 1KSHA 2WSMA 3PRHA 1KP9A 3ZOZA 2Q1SA 1GQRA 3I1JA 1GL9B 3NVDA 5C7IO 3H4MA 4ZCMA 2JL1A 1NJ6A 1CQWA 2FE4A 4O59O 2GHIA 5DN9A 3HYCA 4DLKA 1MP0A 4KAAA 3W5SA 2Y1XA 4FQ7A 4RPKA 3UUFA 1JU9A 4HV4A 5KNBH 3TD6A 5L3QA 2EC5A 1UKYA 1Z37A 3JWGA 3KP1A 4B3RB 1FF9A 2H51A 4QJ5A 3GGPA 5FQOA 2I66A 4ZXPA 4B9AA 5LQRA 1I1NA 2ATEA 4CKZA 2B4QA 3HABA 4IQ4A 1CZHA 3IKMB 2ZI5A 3USZA 4HWTA 2G7ZA 4Y9TA 1KNQA 1USKA 3DGEC 5ALYA 5K3AA 1U1DA 1UKAA 1TD9A 2HRZA 1R0RE 2PUWA 2P1DA 4IXDA 3SXUA 1PR3A 2V55B 3ONDA 3WSTA 5L4NA 2BKVA 2F8LA 3U9SA 4HSGA 2IS4A 2AWOA 3LMKA 3DP9A 1Q0PA 4TM8A 3VKVA 2FXIA 5JSYA 4CN9A 5DNYB 1ADGA 4CQLA 3E22A 1MZVA 1J8QA 1E2KA 3TAUA 1QIIA 2YQ4A 1W1IA 3H1TA 4PHCA 3TUIC 4XYEA 3HXTA 1WX1A 2JCVA 2W11A 1ZJ6A 3QMWA 3G0CA 2CLLB 4UOZA 1JF8A 2RGUA 4FFRA 4KQ1A 3GROA 1X1QA 4TMZA 4QEKA 1K8XB 1ESCA 1K9VF 1P3Y1 1RS0A 1SOVA 3HSSA 3IBTA 4LKRA 4KBGA 5LLSA 5KYWB 1IEVA 2IQIA 1ZN8A 4CMCA 4K8RB 1L4NA 3EGDA 1ZCBA 5CLGA 1V8FA 3VH4A 1SZDA 4C9BA 2OFOA 2PX0A 1TC1A 4EFKA 2DC1A 4OOFA 4TTIA 5MHTA 2PTGA 1IUOA 2PGXA 3UV3A 4QU9A 4U9IS 2O19A 5HTOA 2Z0MA 3HP4A 4F1KA 5HTKA 2HHAA 2WPDA 3I9JA 2QW8A 4LJ7A 5LP6C 4BMPB 3EMDA 3GA7A 5FWNA 5D00A 3BBLA 1DC4A 2PL3A 2QNBA 3RS4A 3M1LA 4QGGA 4WKGA 5E4YA 1G2IA 3DZJA 4OB6A 4S1TA 5IJXA 1GUBA 4WBNB 1GXSA 5JJKA 2PV7A 3EDRA 3HR4A 4CQJA 3Q9SA 3R9XA 2YDYA 4CMEC 2VF8A 2WWYA 4Z6KA 4A0FA 3IJEB 2VDPB 2Z8YA 4MLPA 4UNQA 5I7FA 2IHNA 1E5DA 1NPTO 5F64A 4ZT5A 1LSJA 2KPOA 2DKNA 4POOA 4I7EA 5M34A 4B2LA 6ADHA 1RABA 4OXQA 2PX3A 4EECA 1FFYA 4YRZA 2WKSA 1VA4A 1NF2A 1OIWA 3OPYA 5KX5A 4JC5A 3M5CA 2NGRA 2QVBA 2VA8A 4LY3A 4NCIA 4P7BA 4EK9A 4D98A 5B5SA 1W4BA 1H8ED 4R9SA 5CHYA 5IKPA 1FVOA 1XDSA 1KMIY 3A58B 1U04A 1IY2A 2OCDA 3AINA 1EX6A 1KJ9A 3E9MA 2JA1A 4I9GA 3TR0A 4ESVA 5CH5A 1HNNA 3ICWA 3DWEX 3BICA 4QDZA 4ZAZA 3PUZA 2PVSA 4JI6B 3FHJA 5CPBA 4GQIA 1Z4OA 4YBZA 3C6BA 3NV7A 3OM0A 1FNDA 3B1ZA 2CJYA 1BNCA 2XR1A 4NPCA 4DAEA 4IKPA 1A8UA 2J3MA 4RK0A 4MNTA 4TLEA 2QTVA 3BJIC 4OHOA 2Y1CA 3RCBA 1GNRA 1TMGE 4GYWA 2J9XB 1Q12A 4Q93A 4D4KA 3I28A 4UDYX 1TIKA 1UKBA 4OGGA 5JCOC 1DCKA 1COZA 3AG6A 3BGDA 1F4LA 5H4GA 4RWZA 1XWWA 2H2GA 1HFJA 1P6QA 3SDSA 5KSZA 3U26A 3GN2A 5CG1A 4FX2A 5DFAA 3FETA 1GQ2A 2VTKA 1N5LA 3IB6A 1Y0BA 5HIMA 4NZOA 2HHHB 1OV4A 1OYYA 1ZP6A 2FRDA 3DE3X 3MM4A 1A7AA 4IOJA 2GBGA 4PC7A 2H1CA 1O6BA 2N42A 4EHHA 4PLTA 2PMWB 1B2RA 2B4AA 4AO6A 3HUEA 5J5VA 5ESRA 1EUCB 5HIKA 2NXEA 2FSUA 1PTKA 4FHGA 5ALUA 3NBKA 3PVCA 2C07A 3HUTA 2FX2A 2IP4A 3MQ4A 2H7YA 2XMDA 4Z0HO 4MWCA 4DLSA 2B2CA 2EZUA 4FBLA 4MVJI 1UWCA 1ZY2A 2IYFA 1HE4A 4H1HA 2NO4A 1Q3TA 3BG5A 1KPHA 1WMEA 1YDHA 1XAJA 1RLTA 4A8TA 2H3EA 5L7TA 4W9NA 4W63A 4YMWA 3GRAA 4E3ZA 4JYZA 3RC9A 2ZULA 4MEAA 2GMWA 2B4RO 1XE3A 4GR9A 5LKAA 4UPVA 3O8CA 4KNYA 4YPOA 2RJ3A 1IXRC 1HSZA 1G5RA 3K09C 2E55A 2PPLA 4CRWB 1RRVA 5BOSB 2VVTA 4MVJM 1POXA 5AQ1A 5KX5B 2FAXA 3IXQA 2P9ZA 1FYEA 5LP6B 3ESCA 3FMGA 3KTDA 1KDZA 5JSFA 3NAMA 4E15A 1WNFA 2C0QA 3L40A 1I2CA 1W4CA 3ACBA 1G8YA 2WIBA 4ZJZA 3TW8A 1U0NA 1KGSA 1JV2B 2QG4A 2FLKA 4I14A 3EG9B 4JBGA 1AD2A 3C2QA 1GA6A 3JYNA 2QTFA 4CLDA 3WRXA 4R71A 3HU5A 1Q0HA 1VCHA 2GZSA 2XVAA 3KK0A 3PZBA 5LNK1 2PEYA 2Q8PA 2V65A 1KWGA 1KOGA 4PPGA 1AS2A 3U7JA 1FUIA 1O94C 4EYGA 4FNAA 2Q0XA 4UEWA 2XGMA 4M0UA 1GPAA 3JU3A 1X86B 4QWWA 3D6MA 5H0IA 2OHIA 5EXTA 1F6WA 3A7EA 4OLFA 4B3CA 3RTGA 1A5ZA 1VBMA 1I2AA 2GHRA 2QZJA 4ZV4A 3GLFE 3DEZA 1UXHA 2FPLA 1MT0A 1MB2A 2H2WA 2GPAA 2YMMA 3BHIA 4UHDA 5GV7A 3ROPA 3EVAA 2IPLA 3TOVA 2QTRA 3NBAA 4HS9A 3IBCA 3NHRA 3WGVA 1LDMA 4IL5A 5F33A 4EI8A 4F8EA 2G1UA 1N4DA 1PNQA 1COWD 3TQQA 4U1RA 1YNOA 1R7RA 1DRVA 2C8LA 5FBHA 4TRJA 3RVOA 3WK4A 1NUTA 1A72A 8ATCA 3B78A 3GZNA 4RLSA 4MS1A 5FNVA 5G2OA 5K0NA 1ZD8A 1U7WA 2GUGA 4LJ5A 5I8WA 4E5UA 1HLGA 3KPVA 4J2TA 4PY2A 4A4DA 3DT8A 5I8PA 2F3QA 4PYNA 4NS4A 4IUDS 1EAMA 3LCMA 4G86A 3W2FA 2P3SA 3M4JA 2FVYA 3FNRA 3EBLA 3BTOA 1YL6A 3IBGA 1TVCA 4GI3A 4FE7A 2JHFA 1CVIA 2RI1A 1ZUHA 3J7TA 1ZMOA 3OQJA 4K6OA 1BEZA 3ZGLA 4CCAA 1LD3A 1YBAA 4TUYF 4Q1FA 4DMCA 1JFRA 2UUBB 2IEYA 2RH4A 2XTAA 3AQ4A 1GR1A 3CRNA 4HNRA 1CEQA 4KIGA 3KM0A 5JCZA 5JNWA 1SCIA 2VDLB 3SBOA 5K0SA 4EQ6B 1RHRA 3HDQA 1XEXB 4G81A 1H93A 1QIDA 1T6YA 1NLZA 3DJYA 5C7YA 4Q4JA 2VO1A 3WMFA 1QP7A 3GP5A 4MI9A 5KKAA 2JAHA 2Z56A 4X7BA 4CUJA 1JI0A 3U3ZA 5FF9A 2FQ1A 3NX4A 1KQFA 1MB9A 3A1EA 2CV0A 4BO5A 3BXHA 4LGVA 1ORWA 4ND2A 1AQ6A 4RGQA 1S2MA 4KJZA 4LW8A 5DULA 5HCUA 4EA8A 5K7SA 1VHLA 2ZRFA 3FNFA 1C0LA 1BKSB 2CHVA 2CUTA 1ODKA 2GEVA 3COJA 4R01A 3Q98A 4C20A 5BN5A 5HWSA 1PVDA 2O5RA 3FPKA 4JA2A 3JVDA 1DMSA 1DTSA 1ZNXA 2OZKA 4FYWA 3RIYA 4CDMA 2C8VA 5CB4B 5CFOA 4HYTA 3H1EA 3M5WA 1ULSA 2FB9A 1UOPA 2QWXA 2A84A 2X8AA 4B8YA 1D2CA 2GN1A 4M0KA 4QGHA 2G77B 3MINB 5DWDA 3DP7A 3QX7A 4ZN6A 3CZMA 2ZSEA 5IM4F 3KZMA 2EEPA 1E8DA 1TAGA 2SNIE 3DHWC 2YASA 4W8GA 4HVTA 1A7JA 1RRGA 1Z5GA 5KOJB 1OOEA 2ZIFA 5LOVF 2MHCA 4HPXB 5ALVA 4OSOA 1K0FA 3DR3A 3L7MA 4FX5A 3HY6A 3WAJA 1N5DA 1TCBA 2A30A 1YJBA 4M0MA 4BNWA 2P11A 3GNLA 3JD4A 1DBSA 3OLZA 4OV6B 3AKCA 1IEQA 1QS0B 3GUVA 1TXGA 4MDFA 1EVZA 4RIFA 1DIOB 1WUIS 3A8TA 4PLFA 5CYPA 4B7CA 3A2LA 4GBMA 4MVJP 3PQDA 2IX3A 1QGZA 4Q1AA 4JUCA 1EM8A 4YJ3F 2OZVA