4PXHB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P450 monooxygenase
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
total genus 22
structure length 75
sequence length 75
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pxhB00
2JGPA 2FVFA 2KOPA 4HKGA 3EJEA 4BPGA 4PXHB 2LL8A 3LMOA 2FADA 2LPKA 2FHSC 2LIWA 4PWVB 3GZLA 1HY8A 2N6ZA 1NQ4A 2KGDA 4MRTC 5HV8A 4H2WC 2KG8A 4H2YC 4R0MA 1X3OA 2QNWA 5EJDA 2N98A 2FQ1A 2K0YA 2K94A 2K93A 2MR7A 4CA3A 2KG9A 2XZ1C 5CZDB 2DNWA 2FVAA 2VSQA 2XZ0D 4BPHA 2K92A 1OR5A 2KOOA 2KG6A 2CNRA 5KP6B 2AFDA 2FQ0A 2L22A 2KOSA 2N5HA 1T8KA 2LOLA 1L0IA 1ACPA 2L9FA 1AF8A 2CG5B 2N5IA 2FAEA 2LTEA 2L0QA 2PNGA 5KP8B 2LKIA 4NEOA 2KWLA 2MY5A 2N6YA 2KORA 1DV5A 2MR8A 1VKUA 2GDYA 2GDXA 2AF8A 2EHTA 2MVVA 3EJDA 2GDWA 3RG2A 4H2XC 2K0XA 2JQ4A 2K2QA 3NY7B 2KR5A 2MVUA 2EHSA 1F80D 2AFEA 1DNYA 2FQ2A 3EJBA 2X2BA 1KLPA 4IZ6A 2JU1A 2L4BA 4BPFA 2KGEA 5KP7B 2ROQA 2KGCA 2LIUA 5HVCA 2MF4A 3GZMA 2M5RA 2KGAA 4DG9A 2CQ8A 1L0HA 1HQBA 2MD9A 2LMLA 2FACA 2JU2A 2KW2A 3CE7A 2KOQA 2FVEA 2CGQA 2N50A 2AVAA
chains in the Genus database with same CATH superfamily
3DS3A 3G6EP 4QNBA 2KOPA 4HKGA 1BAJA 1VQ5P 1K8AQ 2BUOA 4PH0A 3G26A 3CCQP 2GZGA 2OTJP 3H47A 1YJ9P 2LIWA 1VQ6P 1HY8A 2GZEA 1NQ4A 1QVGO 4R0MA 1X3OA 1W2BO 3VRLC 1VQ9P 2KG9A 2Z45A 3E2DA 3G4SP 5KP6B 2N5HA 3CC7P 3H4EA 1AF8A 4U0FA 2N5IA 2FAEA 1IMQA 2LTEA 3G71P 1Q81Q 3CCRP 2XXMA 1KD1Q 4IPYA 2N6YA 4F37A 1VKUA 3GKLC 4XFZA 2GDXA 2MVVA 1BXIA 2PEQA 3EJDA 4H2XC 1IMPA 2JQ4A 2M8LA 4U0CA 3U43A 2EHSA 3DS0A 2FQ2A 2X2BA 1MZ8A 4M0IA 1JJ2O 2KGEA 3G1IA 2E1MA 1M90Q 1S72P 2MF4A 3DS4A 3GZMA 1VQMP 4DG9A 2NO8A 1N8RQ 1RNIA 2MD9A 3DS2A 3CE7A 2CGQA 3CC4P 2JGPA 3P05A 3EJEA 4BPGA 1D1DA 1KC8Q 1VHNA 3LMOA 2FADA 2L6EA 2K0DX 2GZFA 3CCUP 4GR6A 1Z6MA 5HV8A 4H2WC 2VLPA 3CCJP 2N98A 4COCA 4COPA 2PEMA 1K30A 2Z44A 2DNWA 1AYIA 2FVAA 4WYMA 4BPHA 2K92A 4U0EA 3DS5A 1OR5A 2OARA 2FQ0A 2L22A 1VQLP 2JO0A 1T8KA 2LF4A 3DTJA 1UNKA 2L9FA 5HGOA 2PEOA 2L0QA 5KP8B 3CMAP 3HYBA 4U0BA 2KWLA 4XFXA 2KORA 1DV5A 2JAZA 5BS2A 2GDYA 1A43A 2EHTA 3I55P 3B5IA 1FR2A 3I56P 3G1GA 2KR5A 1EMVA 2MVUA 1VQ7P 2PEKA 4XFYA 2JB0A 2PENA 3CCLP 1DNYA 1AUMA 3EJBA 3LRYA 3M1MA 5KP7B 2KGCA 2LIUA 2M5RA 2WPTA 1L0HA 1HQBA 2LMLA 2JU2A 3MGEA 2JYLA 1GPJA 2CNRA 5F2NA 3WBHA 2LL8A 1GXHA 1E0HA 2OTLP 1E6JP 1RO0A 4PWVB 2PY8A 2M8NA 2N6ZA 5EW5E 3HZQA 2KG8A 4H2YC 1QVFO 5EJDA 2Z46A 5HGNA 2FQ1A 2K94A 4GR2A 3DPHA 1YITP 1VQNP 3G21A 5CZDB 2XZ0D 1YHQP 2XT1A 2KOOA 1M74A 3CXCO 1IUQA 2KOSA 2LOLA 1KQSO 1ACPA 2QEXP 5F2OA 2CG5B 4UHPB 1A8OA 3DS1A 2PNGA 2KODA 2PEJA 1ZMBA 4NEOA 5JPAA 2MR8A 2GDWA 3RG2A 2K0XA 3RG6C 5HGLA 1GXGA 2K2QA 1UJZA 3NY7B 5I4TG 1ZNVA 4IZ6A 4QKOA 1RO2A 4BPFA 2EFJA 1K9MQ 1Q82Q 5HVCA 2PEIA 1K73Q 3GJNA 2KGAA 1M6NA 2KW2A 3CPWO 2EIAA 1YIJP 1QRJA 3G0VA 1NJIQ 2JBGA 3OW2O 2EG5A 5F2KA 2FVFA 1VQOP 4PXHB 4XROA 2LPKA 2FHSC 4U0AA 3GZLA 5HGMA 5BS1A 2KGDA 4MRTC 7CEIA 2QNWA 2JYGA 2K0YA 2VLOA 2K93A 2MR7A 2ONTA 4CA3A 2XZ1C 2VSQA 3CCSP 2KG6A 3NTEA 1M1KQ 2AFDA 3CMEP 5DCKA 1L0IA 3G29A 2CWOA 3H0DA 1VQ4P 3G28A 1Q86Q 3CCMP 2LKIA 2MY5A 2VLNA 1EOQA 1VQPP 2QA4P 3CD6P 2VLQA 2AF8A 1VQKP 3CCEP 4U0DA 2ERHA 3Q20A 1VQ8P 2GYKA 2GZJA 1F80D 2AFEA 1EIAA 3B4QA 2DGYA 2M8PA 1KLPA 2JU1A 2L4BA 2P9XA 4PH1A 3CC2P 2GZIA 1Q7YQ 2ROQA 1YJNP 3CCVP 4XRQA 1M6EX 2K5XA 1YI2P 2CQ8A 2FACA 1CEIA 2KOQA 2BHVA 2XV6A 1YJWP 2FVEA 2N50A 2AVAA
chains in the Genus database with same CATH topology
2JGPA 2FVFA 2KOPA 4HKGA 3EJEA 4BPGA 4PXHB 2LL8A 3LMOA 2FADA 2LPKA 2FHSC 2LIWA 4PWVB 3GZLA 1HY8A 2N6ZA 1NQ4A 2KGDA 4MRTC 5HV8A 4H2WC 2KG8A 4H2YC 4R0MA 1X3OA 2QNWA 5EJDA 2N98A 2FQ1A 2K0YA 2K94A 2K93A 2MR7A 4CA3A 2KG9A 2XZ1C 5CZDB 2DNWA 2FVAA 2VSQA 2XZ0D 4BPHA 2K92A 1OR5A 2KOOA 2KG6A 2CNRA 5KP6B 2AFDA 2FQ0A 2L22A 2KOSA 2N5HA 1T8KA 2LOLA 1L0IA 1ACPA 2L9FA 1AF8A 2CG5B 2N5IA 2FAEA 2LTEA 2L0QA 2PNGA 5KP8B 2LKIA 4NEOA 2KWLA 2MY5A 2N6YA 2KORA 1DV5A 2MR8A 1VKUA 2GDYA 2GDXA 2AF8A 2EHTA 2MVVA 3EJDA 2GDWA 3RG2A 4H2XC 2K0XA 2JQ4A 2K2QA 3NY7B 2KR5A 2MVUA 2EHSA 1F80D 2AFEA 1DNYA 2FQ2A 3EJBA 2X2BA 1KLPA 4IZ6A 2JU1A 2L4BA 4BPFA 2KGEA 5KP7B 2ROQA 2KGCA 2LIUA 5HVCA 2MF4A 3GZMA 2M5RA 2KGAA 4DG9A 2CQ8A 1L0HA 1HQBA 2MD9A 2LMLA 2FACA 2JU2A 2KW2A 3CE7A 2KOQA 2FVEA 2CGQA 2N50A 2AVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGP A;  2FVF A;  2KOP A;  4HKG A;  3EJE A;  4BPG A;  4PXH B;  2LL8 A;  3LMO A;  2FAD A;  2LPK A;  2FHS C;  2LIW A;  4PWV B;  3GZL A;  1HY8 A;  2N6Z A;  1NQ4 A;  2KGD A;  4MRT C;  5HV8 A;  4H2W C;  2KG8 A;  4H2Y C;  4R0M A;  1X3O A;  2QNW A;  5EJD A;  2N98 A;  2FQ1 A;  2K0Y A;  2K94 A;  2K93 A;  2MR7 A;  4CA3 A;  2KG9 A;  2XZ1 C;  5CZD B;  2DNW A;  2FVA A;  2VSQ A;  2XZ0 D;  4BPH A;  2K92 A;  1OR5 A;  2KOO A;  2KG6 A;  2CNR A;  5KP6 B;  2AFD A;  2FQ0 A;  2L22 A;  2KOS A;  2N5H A;  1T8K A;  2LOL A;  1L0I A;  1ACP A;  2L9F A;  1AF8 A;  2CG5 B;  2N5I A;  2FAE A;  2LTE A;  2L0Q A;  2PNG A;  5KP8 B;  2LKI A;  4NEO A;  2KWL A;  2MY5 A;  2N6Y A;  2KOR A;  1DV5 A;  2MR8 A;  1VKU A;  2GDY A;  2GDX A;  2AF8 A;  2EHT A;  2MVV A;  3EJD A;  2GDW A;  3RG2 A;  4H2X C;  2K0X A;  2JQ4 A;  2K2Q A;  3NY7 B;  2KR5 A;  2MVU A;  2EHS A;  1F80 D;  2AFE A;  1DNY A;  2FQ2 A;  3EJB A;  2X2B A;  1KLP A;  4IZ6 A;  2JU1 A;  2L4B A;  4BPF A;  2KGE A;  5KP7 B;  2ROQ A;  2KGC A;  2LIU A;  5HVC A;  2MF4 A;  3GZM A;  2M5R A;  2KGA A;  4DG9 A;  2CQ8 A;  1L0H A;  1HQB A;  2MD9 A;  2LML A;  2FAC A;  2JU2 A;  2KW2 A;  3CE7 A;  2KOQ A;  2FVE A;  2CGQ A;  2N50 A;  2AVA A; 
#chains in the Genus database with same CATH topology
 3DS3 A;  3G6E P;  4QNB A;  2KOP A;  4HKG A;  1BAJ A;  1VQ5 P;  1K8A Q;  2BUO A;  4PH0 A;  3G26 A;  3CCQ P;  2GZG A;  2OTJ P;  3H47 A;  1YJ9 P;  2LIW A;  1VQ6 P;  1HY8 A;  2GZE A;  1NQ4 A;  1QVG O;  4R0M A;  1X3O A;  1W2B O;  3VRL C;  1VQ9 P;  2KG9 A;  2Z45 A;  3E2D A;  3G4S P;  5KP6 B;  2N5H A;  3CC7 P;  3H4E A;  1AF8 A;  4U0F A;  2N5I A;  2FAE A;  1IMQ A;  2LTE A;  3G71 P;  1Q81 Q;  3CCR P;  2XXM A;  1KD1 Q;  4IPY A;  2N6Y A;  4F37 A;  1VKU A;  3GKL C;  4XFZ A;  2GDX A;  2MVV A;  1BXI A;  2PEQ A;  3EJD A;  4H2X C;  1IMP A;  2JQ4 A;  2M8L A;  4U0C A;  3U43 A;  2EHS A;  3DS0 A;  2FQ2 A;  2X2B A;  1MZ8 A;  4M0I A;  1JJ2 O;  2KGE A;  3G1I A;  2E1M A;  1M90 Q;  1S72 P;  2MF4 A;  3DS4 A;  3GZM A;  1VQM P;  4DG9 A;  2NO8 A;  1N8R Q;  1RNI A;  2MD9 A;  3DS2 A;  3CE7 A;  2CGQ A;  3CC4 P;  2JGP A;  3P05 A;  3EJE A;  4BPG A;  1D1D A;  1KC8 Q;  1VHN A;  3LMO A;  2FAD A;  2L6E A;  2K0D X;  2GZF A;  3CCU P;  4GR6 A;  1Z6M A;  5HV8 A;  4H2W C;  2VLP A;  3CCJ P;  2N98 A;  4COC A;  4COP A;  2PEM A;  1K30 A;  2Z44 A;  2DNW A;  1AYI A;  2FVA A;  4WYM A;  4BPH A;  2K92 A;  4U0E A;  3DS5 A;  1OR5 A;  2OAR A;  2FQ0 A;  2L22 A;  1VQL P;  2JO0 A;  1T8K A;  2LF4 A;  3DTJ A;  1UNK A;  2L9F A;  5HGO A;  2PEO A;  2L0Q A;  5KP8 B;  3CMA P;  3HYB A;  4U0B A;  2KWL A;  4XFX A;  2KOR A;  1DV5 A;  2JAZ A;  5BS2 A;  2GDY A;  1A43 A;  2EHT A;  3I55 P;  3B5I A;  1FR2 A;  3I56 P;  3G1G A;  2KR5 A;  1EMV A;  2MVU A;  1VQ7 P;  2PEK A;  4XFY A;  2JB0 A;  2PEN A;  3CCL P;  1DNY A;  1AUM A;  3EJB A;  3LRY A;  3M1M A;  5KP7 B;  2KGC A;  2LIU A;  2M5R A;  2WPT A;  1L0H A;  1HQB A;  2LML A;  2JU2 A;  3MGE A;  2JYL A;  1GPJ A;  2CNR A;  5F2N A;  3WBH A;  2LL8 A;  1GXH A;  1E0H A;  2OTL P;  1E6J P;  1RO0 A;  4PWV B;  2PY8 A;  2M8N A;  2N6Z A;  5EW5 E;  3HZQ A;  2KG8 A;  4H2Y C;  1QVF O;  5EJD A;  2Z46 A;  5HGN A;  2FQ1 A;  2K94 A;  4GR2 A;  3DPH A;  1YIT P;  1VQN P;  3G21 A;  5CZD B;  2XZ0 D;  1YHQ P;  2XT1 A;  2KOO A;  1M74 A;  3CXC O;  1IUQ A;  2KOS A;  2LOL A;  1KQS O;  1ACP A;  2QEX P;  5F2O A;  2CG5 B;  4UHP B;  1A8O A;  3DS1 A;  2PNG A;  2KOD A;  2PEJ A;  1ZMB A;  4NEO A;  5JPA A;  2MR8 A;  2GDW A;  3RG2 A;  2K0X A;  3RG6 C;  5HGL A;  1GXG A;  2K2Q A;  1UJZ A;  3NY7 B;  5I4T G;  1ZNV A;  4IZ6 A;  4QKO A;  1RO2 A;  4BPF A;  2EFJ A;  1K9M Q;  1Q82 Q;  5HVC A;  2PEI A;  1K73 Q;  3GJN A;  2KGA A;  1M6N A;  2KW2 A;  3CPW O;  2EIA A;  1YIJ P;  1QRJ A;  3G0V A;  1NJI Q;  2JBG A;  3OW2 O;  2EG5 A;  5F2K A;  2FVF A;  1VQO P;  4PXH B;  4XRO A;  2LPK A;  2FHS C;  4U0A A;  3GZL A;  5HGM A;  5BS1 A;  2KGD A;  4MRT C;  7CEI A;  2QNW A;  2JYG A;  2K0Y A;  2VLO A;  2K93 A;  2MR7 A;  2ONT A;  4CA3 A;  2XZ1 C;  2VSQ A;  3CCS P;  2KG6 A;  3NTE A;  1M1K Q;  2AFD A;  3CME P;  5DCK A;  1L0I A;  3G29 A;  2CWO A;  3H0D A;  1VQ4 P;  3G28 A;  1Q86 Q;  3CCM P;  2LKI A;  2MY5 A;  2VLN A;  1EOQ A;  1VQP P;  2QA4 P;  3CD6 P;  2VLQ A;  2AF8 A;  1VQK P;  3CCE P;  4U0D A;  2ERH A;  3Q20 A;  1VQ8 P;  2GYK A;  2GZJ A;  1F80 D;  2AFE A;  1EIA A;  3B4Q A;  2DGY A;  2M8P A;  1KLP A;  2JU1 A;  2L4B A;  2P9X A;  4PH1 A;  3CC2 P;  2GZI A;  1Q7Y Q;  2ROQ A;  1YJN P;  3CCV P;  4XRQ A;  1M6E X;  2K5X A;  1YI2 P;  2CQ8 A;  2FAC A;  1CEI A;  2KOQ A;  2BHV A;  2XV6 A;  1YJW P;  2FVE A;  2N50 A;  2AVA A; 
#chains in the Genus database with same CATH homology
 2JGP A;  2FVF A;  2KOP A;  4HKG A;  3EJE A;  4BPG A;  4PXH B;  2LL8 A;  3LMO A;  2FAD A;  2LPK A;  2FHS C;  2LIW A;  4PWV B;  3GZL A;  1HY8 A;  2N6Z A;  1NQ4 A;  2KGD A;  4MRT C;  5HV8 A;  4H2W C;  2KG8 A;  4H2Y C;  4R0M A;  1X3O A;  2QNW A;  5EJD A;  2N98 A;  2FQ1 A;  2K0Y A;  2K94 A;  2K93 A;  2MR7 A;  4CA3 A;  2KG9 A;  2XZ1 C;  5CZD B;  2DNW A;  2FVA A;  2VSQ A;  2XZ0 D;  4BPH A;  2K92 A;  1OR5 A;  2KOO A;  2KG6 A;  2CNR A;  5KP6 B;  2AFD A;  2FQ0 A;  2L22 A;  2KOS A;  2N5H A;  1T8K A;  2LOL A;  1L0I A;  1ACP A;  2L9F A;  1AF8 A;  2CG5 B;  2N5I A;  2FAE A;  2LTE A;  2L0Q A;  2PNG A;  5KP8 B;  2LKI A;  4NEO A;  2KWL A;  2MY5 A;  2N6Y A;  2KOR A;  1DV5 A;  2MR8 A;  1VKU A;  2GDY A;  2GDX A;  2AF8 A;  2EHT A;  2MVV A;  3EJD A;  2GDW A;  3RG2 A;  4H2X C;  2K0X A;  2JQ4 A;  2K2Q A;  3NY7 B;  2KR5 A;  2MVU A;  2EHS A;  1F80 D;  2AFE A;  1DNY A;  2FQ2 A;  3EJB A;  2X2B A;  1KLP A;  4IZ6 A;  2JU1 A;  2L4B A;  4BPF A;  2KGE A;  5KP7 B;  2ROQ A;  2KGC A;  2LIU A;  5HVC A;  2MF4 A;  3GZM A;  2M5R A;  2KGA A;  4DG9 A;  2CQ8 A;  1L0H A;  1HQB A;  2MD9 A;  2LML A;  2FAC A;  2JU2 A;  2KW2 A;  3CE7 A;  2KOQ A;  2FVE A;  2CGQ A;  2N50 A;  2AVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...