4PXHB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
molecule keywords P450 monooxygenase
total genus 22
structure length 75
sequence length 75
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pxhB00
1X3OA 2MR8A 2LIUA 2KG9A 5KP6B 4PXHB 4HKGA 2N5HA 2FAEA 2KOSA 2N6ZA 3NY7B 3EJBA 3RG2A 2KGCA 2LKIA 1HY8A 2LMLA 4IZ6A 4DG9A 2K93A 1DV5A 5CZDB 2MVUA 4NEOA 2FADA 2K0YA 3EJDA 1DNYA 2EHSA 1AF8A 2CGQA 2K2QA 2L0QA 2KG8A 1NQ4A 2KOPA 3GZLA 3GZMA 2GDWA 2FVFA 2KG6A 1L0HA 2K92A 2L22A 4CA3A 2AF8A 1OR5A 2GDXA 2ROQA 2AVAA 2MVVA 4MRTC 2KR5A 4H2XC 2N6YA 2CQ8A 1L0IA 2EHTA 1KLPA 5EJDA 2KW2A 2FQ2A 2KGAA 2L9FA 2K94A 5KP7B 4PWVB 2XZ1C 2CG5B 4BPHA 2FVEA 2JGPA 2KWLA 4R0MA 2VSQA 2MD9A 2FVAA 2FQ1A 2X2BA 2KOOA 2FACA 2CNRA 2N98A 2LL8A 2MR7A 2LOLA 2N50A 4BPGA 4H2YC 2KOQA 2KGDA 3EJEA 2FQ0A 2LTEA 2AFEA 2QNWA 2JU2A 2GDYA 2LIWA 1VKUA 5HV8A 1ACPA 2PNGA 2JQ4A 3CE7A 3LMOA 4BPFA 2M5RA 2KORA 5HVCA 1T8KA 5KP8B 2N5IA 2L4BA 2LPKA 2FHSC 2JU1A 2MF4A 2KGEA 2XZ0D 2DNWA 2MY5A 2K0XA 2AFDA 1HQBA 1F80D 4H2WC
chains in the Genus database with same CATH superfamily
5EW5E 4U0CA 5BS2A 5F2OA 1EIAA 1Z6MA 3DS1A 1CEIA 3CCLP 2PENA 1M74A 2KODA 5I4TG 3DS2A 2LMLA 3WBHA 2GZEA 4NEOA 2QEXP 5F2KA 2CGQA 3LRYA 1NQ4A 1L0HA 2Z44A 4XFXA 1Q82Q 1K30A 1OR5A 2AVAA 2KR5A 2N6YA 1L0IA 2EHTA 2NO8A 2FQ2A 1VQ4P 2ONTA 3G28A 2K94A 2CG5B 2DGYA 2BUOA 3CPWO 1E0HA 1YIJP 1KQSO 2BHVA 2CNRA 5JPAA 2N98A 2LL8A 2LOLA 5BS1A 2N50A 3HYBA 2KGDA 3DTJA 2JB0A 5F2NA 2LTEA 1UNKA 2LIWA 1RNIA 3H0DA 1VQLP 1GPJA 3CE7A 4BPFA 2M5RA 1M90Q 3DPHA 1VQ8P 3CC4P 2K0DX 2KGEA 2XZ0D 5HGLA 2Z45A 1BAJA 4U0DA 1K9MQ 1VQKP 2EG5A 4GR2A 2KG9A 5KP6B 4PXHB 2GZIA 4HKGA 2KOSA 1S72P 3NY7B 3EJBA 1VQ9P 1ZNVA 3I56P 2KGCA 2LKIA 3CCMP 2VLPA 4DG9A 1M1KQ 1DV5A 5CZDB 1GXHA 2VLOA 2K0YA 1VQNP 1RO0A 2PEIA 3M1MA 2K2QA 5DCKA 2OTLP 5HGMA 1JJ2O 2CWOA 2VLNA 2L22A 4QNBA 4CA3A 3CC2P 2JAZA 1E6JP 1KD1Q 4U0EA 4MRTC 3I55P 2JYGA 3CD6P 7CEIA 4U0BA 3CCRP 2L9FA 4PH0A 2M8LA 2XZ1C 4BPHA 1VQOP 2JGPA 3CCUP 2QA4P 2ERHA 3G71P 2VSQA 3H4EA 3G29A 2MD9A 2PY8A 3NTEA 2FACA 4WYMA 1A43A 2MR7A 1W2BO 4H2YC 3EJEA 2PEQA 3DS3A 2FQ0A 2AFEA 4XROA 3HZQA 1IMQA 5HV8A 1ACPA 1EMVA 2OTJP 2KORA 1T8KA 2L4BA 1M6NA 3CMEP 2XT1A 1K8AQ 2M8PA 1ZMBA 1A8OA 3CC7P 2WPTA 1YJNP 1MZ8A 1HQBA 1F80D 3G6EP 3RG6C 1X3OA 2OARA 2LIUA 3DS5A 3E2DA 2N5HA 2GZGA 2GZFA 3OW2O 2GYKA 2E1MA 1HY8A 4IZ6A 1IMPA 2L6EA 2K93A 4U0AA 1Q81Q 1Q7YQ 3G21A 3U43A 1DNYA 2EHSA 1AF8A 4M0IA 1IUQA 2L0QA 4U0FA 2GDWA 2KG6A 2EIAA 1YJWP 2ROQA 5HGNA 1VHNA 4H2XC 2CQ8A 1VQPP 1QRJA 5EJDA 1YITP 3P05A 2KGAA 3Q20A 2PEKA 5KP7B 4PWVB 3CCSP 2Z46A 2EFJA 1YI2P 2FVAA 3CCQP 2FQ1A 2X2BA 2PEMA 3CCVP 4IPYA 1AYIA 3DS4A 3B4QA 4BPGA 1Q86Q 3GKLC 2KOQA 4XRQA 2GDYA 4COPA 1FR2A 1KC8Q 2PNGA 2JQ4A 3G1IA 3H47A 2N5IA 2MF4A 5HGOA 2K5XA 1QVGO 1BXIA 4F37A 2GZJA 2P9XA 2MR8A 2FAEA 2JO0A 2N6ZA 1NJIQ 1D1DA 1M6EX 3RG2A 4GR6A 3G26A 2MVUA 2FADA 3GJNA 3EJDA 1K73Q 4H2WC 3VRLC 2PEJA 2KG8A 1EOQA 2KOPA 3GZLA 3GZMA 2FVFA 2K92A 2XV6A 2JYLA 2AF8A 2GDXA 2MVVA 3B5IA 1N8RQ 3G0VA 1KLPA 2KW2A 3G4SP 1UJZA 1QVFO 3CMAP 2FVEA 2KWLA 3CCEP 2VLQA 2M8NA 4UHPB 4R0MA 1VQ5P 2KOOA 3DS0A 1VQ7P 2PEOA 1RO2A 1VQ6P 3G1GA 4COCA 4QKOA 1VQMP 2QNWA 2JU2A 1AUMA 4PH1A 1VKUA 1YHQP 3LMOA 2XXMA 5HVCA 5KP8B 3CXCO 2LPKA 2FHSC 2JU1A 1GXGA 2DNWA 2JBGA 3MGEA 4XFZA 2MY5A 1YJ9P 4XFYA 2K0XA 2AFDA 2LF4A 3CCJP
chains in the Genus database with same CATH topology
1X3OA 2MR8A 2LIUA 2KG9A 5KP6B 4PXHB 4HKGA 2N5HA 2FAEA 2KOSA 2N6ZA 3NY7B 3EJBA 3RG2A 2KGCA 2LKIA 1HY8A 2LMLA 4IZ6A 4DG9A 2K93A 1DV5A 5CZDB 2MVUA 4NEOA 2FADA 2K0YA 3EJDA 1DNYA 2EHSA 1AF8A 2CGQA 2K2QA 2L0QA 2KG8A 1NQ4A 2KOPA 3GZLA 3GZMA 2GDWA 2FVFA 2KG6A 1L0HA 2K92A 2L22A 4CA3A 2AF8A 1OR5A 2GDXA 2ROQA 2AVAA 2MVVA 4MRTC 2KR5A 4H2XC 2N6YA 2CQ8A 1L0IA 2EHTA 1KLPA 5EJDA 2KW2A 2FQ2A 2KGAA 2L9FA 2K94A 5KP7B 4PWVB 2XZ1C 2CG5B 4BPHA 2FVEA 2JGPA 2KWLA 4R0MA 2VSQA 2MD9A 2FVAA 2FQ1A 2X2BA 2KOOA 2FACA 2CNRA 2N98A 2LL8A 2MR7A 2LOLA 2N50A 4BPGA 4H2YC 2KOQA 2KGDA 3EJEA 2FQ0A 2LTEA 2AFEA 2QNWA 2JU2A 2GDYA 2LIWA 1VKUA 5HV8A 1ACPA 2PNGA 2JQ4A 3CE7A 3LMOA 4BPFA 2M5RA 2KORA 5HVCA 1T8KA 5KP8B 2N5IA 2L4BA 2LPKA 2FHSC 2JU1A 2MF4A 2KGEA 2XZ0D 2DNWA 2MY5A 2K0XA 2AFDA 1HQBA 1F80D 4H2WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3O A;  2MR8 A;  2LIU A;  2KG9 A;  5KP6 B;  4PXH B;  4HKG A;  2N5H A;  2FAE A;  2KOS A;  2N6Z A;  3NY7 B;  3EJB A;  3RG2 A;  2KGC A;  2LKI A;  1HY8 A;  2LML A;  4IZ6 A;  4DG9 A;  2K93 A;  1DV5 A;  5CZD B;  2MVU A;  4NEO A;  2FAD A;  2K0Y A;  3EJD A;  1DNY A;  2EHS A;  1AF8 A;  2CGQ A;  2K2Q A;  2L0Q A;  2KG8 A;  1NQ4 A;  2KOP A;  3GZL A;  3GZM A;  2GDW A;  2FVF A;  2KG6 A;  1L0H A;  2K92 A;  2L22 A;  4CA3 A;  2AF8 A;  1OR5 A;  2GDX A;  2ROQ A;  2AVA A;  2MVV A;  4MRT C;  2KR5 A;  4H2X C;  2N6Y A;  2CQ8 A;  1L0I A;  2EHT A;  1KLP A;  5EJD A;  2KW2 A;  2FQ2 A;  2KGA A;  2L9F A;  2K94 A;  5KP7 B;  4PWV B;  2XZ1 C;  2CG5 B;  4BPH A;  2FVE A;  2JGP A;  2KWL A;  4R0M A;  2VSQ A;  2MD9 A;  2FVA A;  2FQ1 A;  2X2B A;  2KOO A;  2FAC A;  2CNR A;  2N98 A;  2LL8 A;  2MR7 A;  2LOL A;  2N50 A;  4BPG A;  4H2Y C;  2KOQ A;  2KGD A;  3EJE A;  2FQ0 A;  2LTE A;  2AFE A;  2QNW A;  2JU2 A;  2GDY A;  2LIW A;  1VKU A;  5HV8 A;  1ACP A;  2PNG A;  2JQ4 A;  3CE7 A;  3LMO A;  4BPF A;  2M5R A;  2KOR A;  5HVC A;  1T8K A;  5KP8 B;  2N5I A;  2L4B A;  2LPK A;  2FHS C;  2JU1 A;  2MF4 A;  2KGE A;  2XZ0 D;  2DNW A;  2MY5 A;  2K0X A;  2AFD A;  1HQB A;  1F80 D;  4H2W C; 
#chains in the Genus database with same CATH topology
 5EW5 E;  4U0C A;  5BS2 A;  5F2O A;  1EIA A;  1Z6M A;  3DS1 A;  1CEI A;  3CCL P;  2PEN A;  1M74 A;  2KOD A;  5I4T G;  3DS2 A;  2LML A;  3WBH A;  2GZE A;  4NEO A;  2QEX P;  5F2K A;  2CGQ A;  3LRY A;  1NQ4 A;  1L0H A;  2Z44 A;  4XFX A;  1Q82 Q;  1K30 A;  1OR5 A;  2AVA A;  2KR5 A;  2N6Y A;  1L0I A;  2EHT A;  2NO8 A;  2FQ2 A;  1VQ4 P;  2ONT A;  3G28 A;  2K94 A;  2CG5 B;  2DGY A;  2BUO A;  3CPW O;  1E0H A;  1YIJ P;  1KQS O;  2BHV A;  2CNR A;  5JPA A;  2N98 A;  2LL8 A;  2LOL A;  5BS1 A;  2N50 A;  3HYB A;  2KGD A;  3DTJ A;  2JB0 A;  5F2N A;  2LTE A;  1UNK A;  2LIW A;  1RNI A;  3H0D A;  1VQL P;  1GPJ A;  3CE7 A;  4BPF A;  2M5R A;  1M90 Q;  3DPH A;  1VQ8 P;  3CC4 P;  2K0D X;  2KGE A;  2XZ0 D;  5HGL A;  2Z45 A;  1BAJ A;  4U0D A;  1K9M Q;  1VQK P;  2EG5 A;  4GR2 A;  2KG9 A;  5KP6 B;  4PXH B;  2GZI A;  4HKG A;  2KOS A;  1S72 P;  3NY7 B;  3EJB A;  1VQ9 P;  1ZNV A;  3I56 P;  2KGC A;  2LKI A;  3CCM P;  2VLP A;  4DG9 A;  1M1K Q;  1DV5 A;  5CZD B;  1GXH A;  2VLO A;  2K0Y A;  1VQN P;  1RO0 A;  2PEI A;  3M1M A;  2K2Q A;  5DCK A;  2OTL P;  5HGM A;  1JJ2 O;  2CWO A;  2VLN A;  2L22 A;  4QNB A;  4CA3 A;  3CC2 P;  2JAZ A;  1E6J P;  1KD1 Q;  4U0E A;  4MRT C;  3I55 P;  2JYG A;  3CD6 P;  7CEI A;  4U0B A;  3CCR P;  2L9F A;  4PH0 A;  2M8L A;  2XZ1 C;  4BPH A;  1VQO P;  2JGP A;  3CCU P;  2QA4 P;  2ERH A;  3G71 P;  2VSQ A;  3H4E A;  3G29 A;  2MD9 A;  2PY8 A;  3NTE A;  2FAC A;  4WYM A;  1A43 A;  2MR7 A;  1W2B O;  4H2Y C;  3EJE A;  2PEQ A;  3DS3 A;  2FQ0 A;  2AFE A;  4XRO A;  3HZQ A;  1IMQ A;  5HV8 A;  1ACP A;  1EMV A;  2OTJ P;  2KOR A;  1T8K A;  2L4B A;  1M6N A;  3CME P;  2XT1 A;  1K8A Q;  2M8P A;  1ZMB A;  1A8O A;  3CC7 P;  2WPT A;  1YJN P;  1MZ8 A;  1HQB A;  1F80 D;  3G6E P;  3RG6 C;  1X3O A;  2OAR A;  2LIU A;  3DS5 A;  3E2D A;  2N5H A;  2GZG A;  2GZF A;  3OW2 O;  2GYK A;  2E1M A;  1HY8 A;  4IZ6 A;  1IMP A;  2L6E A;  2K93 A;  4U0A A;  1Q81 Q;  1Q7Y Q;  3G21 A;  3U43 A;  1DNY A;  2EHS A;  1AF8 A;  4M0I A;  1IUQ A;  2L0Q A;  4U0F A;  2GDW A;  2KG6 A;  2EIA A;  1YJW P;  2ROQ A;  5HGN A;  1VHN A;  4H2X C;  2CQ8 A;  1VQP P;  1QRJ A;  5EJD A;  1YIT P;  3P05 A;  2KGA A;  3Q20 A;  2PEK A;  5KP7 B;  4PWV B;  3CCS P;  2Z46 A;  2EFJ A;  1YI2 P;  2FVA A;  3CCQ P;  2FQ1 A;  2X2B A;  2PEM A;  3CCV P;  4IPY A;  1AYI A;  3DS4 A;  3B4Q A;  4BPG A;  1Q86 Q;  3GKL C;  2KOQ A;  4XRQ A;  2GDY A;  4COP A;  1FR2 A;  1KC8 Q;  2PNG A;  2JQ4 A;  3G1I A;  3H47 A;  2N5I A;  2MF4 A;  5HGO A;  2K5X A;  1QVG O;  1BXI A;  4F37 A;  2GZJ A;  2P9X A;  2MR8 A;  2FAE A;  2JO0 A;  2N6Z A;  1NJI Q;  1D1D A;  1M6E X;  3RG2 A;  4GR6 A;  3G26 A;  2MVU A;  2FAD A;  3GJN A;  3EJD A;  1K73 Q;  4H2W C;  3VRL C;  2PEJ A;  2KG8 A;  1EOQ A;  2KOP A;  3GZL A;  3GZM A;  2FVF A;  2K92 A;  2XV6 A;  2JYL A;  2AF8 A;  2GDX A;  2MVV A;  3B5I A;  1N8R Q;  3G0V A;  1KLP A;  2KW2 A;  3G4S P;  1UJZ A;  1QVF O;  3CMA P;  2FVE A;  2KWL A;  3CCE P;  2VLQ A;  2M8N A;  4UHP B;  4R0M A;  1VQ5 P;  2KOO A;  3DS0 A;  1VQ7 P;  2PEO A;  1RO2 A;  1VQ6 P;  3G1G A;  4COC A;  4QKO A;  1VQM P;  2QNW A;  2JU2 A;  1AUM A;  4PH1 A;  1VKU A;  1YHQ P;  3LMO A;  2XXM A;  5HVC A;  5KP8 B;  3CXC O;  2LPK A;  2FHS C;  2JU1 A;  1GXG A;  2DNW A;  2JBG A;  3MGE A;  4XFZ A;  2MY5 A;  1YJ9 P;  4XFY A;  2K0X A;  2AFD A;  2LF4 A;  3CCJ P; 
#chains in the Genus database with same CATH homology
 1X3O A;  2MR8 A;  2LIU A;  2KG9 A;  5KP6 B;  4PXH B;  4HKG A;  2N5H A;  2FAE A;  2KOS A;  2N6Z A;  3NY7 B;  3EJB A;  3RG2 A;  2KGC A;  2LKI A;  1HY8 A;  2LML A;  4IZ6 A;  4DG9 A;  2K93 A;  1DV5 A;  5CZD B;  2MVU A;  4NEO A;  2FAD A;  2K0Y A;  3EJD A;  1DNY A;  2EHS A;  1AF8 A;  2CGQ A;  2K2Q A;  2L0Q A;  2KG8 A;  1NQ4 A;  2KOP A;  3GZL A;  3GZM A;  2GDW A;  2FVF A;  2KG6 A;  1L0H A;  2K92 A;  2L22 A;  4CA3 A;  2AF8 A;  1OR5 A;  2GDX A;  2ROQ A;  2AVA A;  2MVV A;  4MRT C;  2KR5 A;  4H2X C;  2N6Y A;  2CQ8 A;  1L0I A;  2EHT A;  1KLP A;  5EJD A;  2KW2 A;  2FQ2 A;  2KGA A;  2L9F A;  2K94 A;  5KP7 B;  4PWV B;  2XZ1 C;  2CG5 B;  4BPH A;  2FVE A;  2JGP A;  2KWL A;  4R0M A;  2VSQ A;  2MD9 A;  2FVA A;  2FQ1 A;  2X2B A;  2KOO A;  2FAC A;  2CNR A;  2N98 A;  2LL8 A;  2MR7 A;  2LOL A;  2N50 A;  4BPG A;  4H2Y C;  2KOQ A;  2KGD A;  3EJE A;  2FQ0 A;  2LTE A;  2AFE A;  2QNW A;  2JU2 A;  2GDY A;  2LIW A;  1VKU A;  5HV8 A;  1ACP A;  2PNG A;  2JQ4 A;  3CE7 A;  3LMO A;  4BPF A;  2M5R A;  2KOR A;  5HVC A;  1T8K A;  5KP8 B;  2N5I A;  2L4B A;  2LPK A;  2FHS C;  2JU1 A;  2MF4 A;  2KGE A;  2XZ0 D;  2DNW A;  2MY5 A;  2K0X A;  2AFD A;  1HQB A;  1F80 D;  4H2W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...