4PY3A

Crystal structure of the n-terminal fic domain of bep8 protein (virb-translocated bartonella effector protein) from bartonella sp. 1-1c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
HMARNYAYPHMNTLKNKHNIMSTKKLAHVCEHYAKKAIINLNKEPLPQKFDSSYLKYIHQRLFESTFEWAGYTRDFSFTFDDGTVAEMPMMKVPNLDIFYVQGNDIQENLKKFDQLLASKNNLQGLSREEFVDEAAKLFVFLNSIAPFRAGNEPTQRVFFEKLAEAAGHQLDFSVATEKRIMRACIDGMTLKDNMAYKEMKSLFEDISDPKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal FIC domain of Bep8 protein (VirB-translocated Bartonella effector protein) from Bartonella sp. 1-1C
rcsb
source organism Bartonella sp. 1-1c
molecule tags Protein binding
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 76
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4py3A00
4XI8A 3CUCA 4U07A 2JK8A 4ITRA 4U0ZA 3SE5A 3SN9A 3ZLMA 4X2EA 3SHGA 2F6SA 4U04A 3ZCBA 3LETA 5CKLA 5CMTA 5EU0A 4X2CA 3N3UA 5JJ7A 3ZC7A 5CGLA 4WGJA 2VZAA 5JJ6A 4X2DA 2VY3A 2G03A 4U0SA 5JFFA 4N67A 5JFZA 4U0UA 4NPSA 3S6AA 4LU4A 4PY3A 4M16A
chains in the Genus database with same CATH superfamily
4XI8A 3CUCA 4U07A 2JK8A 4ITRA 4U0ZA 3SE5A 3SN9A 3ZLMA 4X2EA 3SHGA 2F6SA 4U04A 3ZCBA 3LETA 5CKLA 5CMTA 5EU0A 1NH1A 3N3UA 4X2CA 2NUNA 5JJ7A 3ZC7A 5CGLA 4WGJA 2VZAA 5JJ6A 4X2DA 2VY3A 2G03A 2NUDA 4U0SA 5JFFA 4N67A 5JFZA 4U0UA 4NPSA 3S6AA 4LU4A 4PY3A 4M16A
chains in the Genus database with same CATH topology
4XI8A 3CUCA 4U07A 2JK8A 4ITRA 4U0ZA 3SE5A 3SN9A 3ZLMA 4X2EA 3SHGA 2F6SA 4U04A 3ZCBA 3LETA 5CKLA 5CMTA 5EU0A 4X2CA 3N3UA 5JJ7A 3ZC7A 5CGLA 4WGJA 2VZAA 5JJ6A 4X2DA 2VY3A 2G03A 4U0SA 5JFFA 4N67A 5JFZA 4U0UA 4NPSA 3S6AA 4LU4A 4PY3A 4M16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI8 A;  3CUC A;  4U07 A;  2JK8 A;  4ITR A;  4U0Z A;  3SE5 A;  3SN9 A;  3ZLM A;  4X2E A;  3SHG A;  2F6S A;  4U04 A;  3ZCB A;  3LET A;  5CKL A;  5CMT A;  5EU0 A;  4X2C A;  3N3U A;  5JJ7 A;  3ZC7 A;  5CGL A;  4WGJ A;  2VZA A;  5JJ6 A;  4X2D A;  2VY3 A;  2G03 A;  4U0S A;  5JFF A;  4N67 A;  5JFZ A;  4U0U A;  4NPS A;  3S6A A;  4LU4 A;  4PY3 A;  4M16 A; 
#chains in the Genus database with same CATH topology
 4XI8 A;  3CUC A;  4U07 A;  2JK8 A;  4ITR A;  4U0Z A;  3SE5 A;  3SN9 A;  3ZLM A;  4X2E A;  3SHG A;  2F6S A;  4U04 A;  3ZCB A;  3LET A;  5CKL A;  5CMT A;  5EU0 A;  1NH1 A;  3N3U A;  4X2C A;  2NUN A;  5JJ7 A;  3ZC7 A;  5CGL A;  4WGJ A;  2VZA A;  5JJ6 A;  4X2D A;  2VY3 A;  2G03 A;  2NUD A;  4U0S A;  5JFF A;  4N67 A;  5JFZ A;  4U0U A;  4NPS A;  3S6A A;  4LU4 A;  4PY3 A;  4M16 A; 
#chains in the Genus database with same CATH homology
 4XI8 A;  3CUC A;  4U07 A;  2JK8 A;  4ITR A;  4U0Z A;  3SE5 A;  3SN9 A;  3ZLM A;  4X2E A;  3SHG A;  2F6S A;  4U04 A;  3ZCB A;  3LET A;  5CKL A;  5CMT A;  5EU0 A;  4X2C A;  3N3U A;  5JJ7 A;  3ZC7 A;  5CGL A;  4WGJ A;  2VZA A;  5JJ6 A;  4X2D A;  2VY3 A;  2G03 A;  4U0S A;  5JFF A;  4N67 A;  5JFZ A;  4U0U A;  4NPS A;  3S6A A;  4LU4 A;  4PY3 A;  4M16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...