4PY8I

Crystal structure of fab 3.1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGGGVVQPGRSLRLSCAASEFTFRMYATHWVRQAPGKGLEWVALISYDGSNKYYADSVKGRFTISRDNSMNTVYLQMNTLRPEDTAVYYCARDLGGYFIRGIMDVWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Alternative Recognition of the Conserved Stem Epitope in Influenza A Virus Hemagglutinin by a VH3-30-Encoded Heterosubtypic Antibody.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4py8I02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4py8I01
4OZHF 2Q8BL 5C0RL 1KJ3L 1X7QA 4LSPL 4GG6E 3JWOC 5FA4B 5D4QA 2APTA 1F4XL 4JRXE 3BAEL 2I5YH 4WTXA 4YE4L 1XGQA 3FOMA 1MEXH 5ISZA 4ISVB 1QYGH 2F8VA 4XCEB 5CFHA 1T6WA 2RQ8A 4O02L 2XI9A 2DTSA 2F54D 1M7DB 1T21B 3IDXL 5EA0L 4M7LH 2DQDL 1ED3B 3X3GH 4U1JA 5IVOA 1J87A 1YJDC 3MLPA 4TNVK 3MRMA 3QNYB 4Q74A 5DYOB 4F8QA 2AJZB 3L3IA 3WHE1 1VKXB 1QSEA 1XFPA 3RDTA 4U1GC 5D7SH 4BFIB 2GEEA 3VRJB 4DKDC 5CINL 4JANA 3QYCA 1N0LA 3OG4B 4U1HB 4JHWL 1BQHB 2JJSA 5FIEA 5J4MA 4JG1L 2V2TB 4LIQE 4ELMB 4G8EA 5J1TC 1QLRA 4PGEB 1OT2A 1UC6A 1MJJB 2YEZB 4M4PA 3QXDB 4X6CF 1FSKB 3UTZA 1KNOB 4PGBA 2X1WL 4F9LA 4RISH 4PJ7A 4P57A 5SWQB 3TBSA 1AQDA 2MFNA 4O4YL 5ALBH 5IIEA 2GT9A 5K9OB 2EIDA 4S10A 2BC4A 1U6AL 5IJKA 3RIFF 1AHWA 3MXWL 5I1IH 4UT7H 4FQHB 1WFUA 3RQ3A 2EC9U 1PG7L 4HCRH 3VXSB 2G75A 1CBVL 4X4YA 2CGRL 3HC4H 1BF8A 4FXGA 1JTOA 1KIQB 4HPOH 3IJSB 2E6JA 1UWEH 2VLMD 2IMNA 1ETZA 3FRPA 3QO1A 4XXCC 1I1YB 3D48R 1S78D 3QXWA 4M5YH 1CDIA 3GSXA 2GAZA 1T22A 3OKDB 5T1LA 3JZ7A 3TN0A 1VGEL 3QUXC 3CSYB 2ZCHH 4RGMB 4Z7VB 5B21A 3SBWC 1IGIL 2NY6B 3L1OL 4FQQA 1XIWB 4ZUSB 4Z6AT 3ESUF 1ZA3B 4MB4A 3ZKQD 4TNWK 3GJEB 2OCFD 3NIDF 4PR5B 5INDB 3KPTA 2I24N 1IM9D 4OBSA 5EU6D 5IVXF 3RVXC 5F88A 1EPFA 1I9JH 4KJPD 5ESQB 3HI1B 5FYLE 4P2QA 2XXMB 5FF6B 4LCIH 1JPST 1CFVL 1F6AB 4M93C 4WO4A 3WO4B 1HINL 3PNWA 4GS7C 4ZFZA 4MB5A 3KJ6L 4A2LA 4OSUL 2CJUL 3NCEB 1CFSA 3NGBB 3WN5A 1HDMA 5HYJB 2O26U 5IFAH 4AM0B 4JRXA 3LH2H 3T3ME 3REWA 5DD5H 5I1CH 4UT6H 4G8GD 4FG6D 3BP5A 2F19L 4P3WA 5FKAB 4AIZA 4AZ8A 3WIHL 4BZ1H 2BNRD 4XHJC 5I17A 2A0LC 3MYZA 3O45B 5FB8A 3NA9H 5EPMB 3L3DB 2VQ1B 4RAHA 4XB7A 4M6OH 3S35L 3MJ9H 3VE0A 4LCWD 5TJWK 3KVQA 5I8KL 4DTGL 3TPUA 3SGEH 2H1PL 4HPYH 3P73A 4PRIE 4YHOL 4X5WA 1X6NA 3ZTNL 1NJ9B 4JKPL 4L8BB 1K5NB 4NWUL 5JR1L 4UTBH 3S37H 2X9YA 2E9WA 3DURA 1EIBA 4HJGA 3C6LA 4W68A 5DHYB 3WNMA 3WNOA 1JZ4A 5C0JB 4XGZB 1N5YH 4PJCE 5IROA 4XP9L 3MLUL 5E94A 4X80L 4G9FD 3DV6A 3TBWB 1CLOL 4ZYKA 1VHPA 1INEL 1QBLL 5IF0A 1IZJA 4KC3B 3VGAB 1NFDE 3VXTA 3DGGA 2PYEB 2ICWB 3CDYA 3GMRB 2M8XA 3ZO0A 2F53E 5CUSH 1MIMH 3BVNA 1UT9A 1WVZA 4PJIE 3BE1H 1FZOA 1CFTB 1MFNA 4KY1L 5EDXA 3DI2B 1A7BA 4LSDA 1WTLA 4RMTA 1ACYL 4XPBL 1MAMH 4Y4KD 1MLCB 5IVNA 4OZIB 3ARYA 1HIML 2A77L 2AK4B 1AKJD 4P9HL 1GGIL 1I7TB 3NA4A 3KLSA 3INUL 4K3EL 3P4LA 4LPUA 5GS0D 2HJFB 2BDNH 5IB5A 3DLQR 3G04B 4WFGD 3F65A 2VXQL 5T1KA 2W9LA 1BX2A 3O8XC 4EDXB 3U7YL 3VGEA 1KEGH 1MRFH 1AH1A 1A21A 4FP8H 4L8SA 1FYHB 3O4LD 3KNBA 5I0DA 1CR9H 3TV3L 4JO2H 4YH6A 1DQDL 1CG9A 2IFGA 3NCJL 4LEOA 5AZ2L 2C4FU 1FNGA 3MJ8A 5L88H 2NMSA 1B2WH 3MNWA 3Q6GL 1A47A 4FTVE 1B0RA 3N85H 3CFEA 5EUOE 1QTYT 3QFJD 4ZUTB 5AZEH 1RU9L 2DQTH 4P4RA 1NLBH 3GIVB 5J7CC 1QR1B 3M45A 2OXHA 4EN3B 4M1GL 5DFTA 1A6UH 2HT4D 4L3AA 4QXUL 3ZYJA 2Z31B 3WS6A 4HMCA 4XPHL 1MI5A 1DBKH 1ZTXH 3IJHB 3OGCB 3OB0H 4LLYB 4WTWA 2R2CA 2WW8A 4J12A 2HFGL 3ARPA 5J6HB 4R96A 4F7PB 3O9WC 1PLGL 3HRPA 4YDIL 5GGTA 1KLUB 5JIHA 1MFCL 4RZCA 2IAND 1YECL 1XF4A 1OGTA 2IH3B 2DQGL 2M2DA 2ILLA 3WD5H 1G9NH 3CXHJ 5L6YH 1KLGB 3H6JA 4OZFA 1U2CA 5HDQH 4NHUB 4Z7VF 5AG8A 4XP1H 1KGCE 4ZAKA 3D25A 2BY2A 2RGSA 5HVHB 3CK0H 4HK0B 1RFDL 3AU1A 2QQNL 3FN0L 2NTSP 3X14A 3JTTB 1NH6A 2OTUB 2IH1B 2C5DC 5IJVA 3EGSA 3ES6B 2ZNXA 4L8DB 4OQTH 4ZXBC 1AO7B 1FO0B 2HT2D 3CFIC 3WEXB 4HXAH 1A3LL 2F58L 4LVEA 2HLAA 3QQ4A 4JQIL 5E2WH 4PV9A 3VXPB 1FH5L 2BNQD 2YC1B 5DRXB 4JZNB 3LPWA 2DDQH 5KVGH 4LL9A 1KTRL 4TQEH 4PJCA 5ID0B 5F9WC 3BYTA 3K2UH 2VDKL 4OJFH 2L7UA 1IC4H 3MRBB 3L5HA 4XVUD 4E42B 1UFUA 3ULUE 4P2YA 1YY9C 5EZIH 5JPMA 1TTGA 3WLBA 3DSNA 1KTLA 1DUYB 2BNQB 4CMMB 5HGBA 3P9LB 2WUBH 2X4NB 2F53A 3U0TA 4PJIA 4RFEB 1N4XL 2KKQA 5ICZA 3E8UH 3TJEL 3MX0A 3FB7B 4JFEB 3UBXB 1U8KA 5IV2B 3B9AA 4M1DH 1FFNA 2ZWLT 3VDCA 4J6RH 4Y19A 3JVGC 3WFHA 5EBLB 2HKHH 3BZ4A 5JXED 3H3PL 5JMRA 4OB5H 1MELA 4KJWD 1GGBL 1P53A 2F5AH 1ORQB 5KANG 5C0BD 4NHCH 4LGPB 2Z8WC 4U0QB 5IP4A 2R29L 3PJSA 3I6LE 1QFOA 5IM7B 1RZGA 3VJ6A 5JORB 3QJFA 4FQ1L 4X7TA 3T1FA 4NKMA 1YEHL 3CH1A 5C0EB 2DL9A 2X40A 2APBA 5D7LD 3ZDYE 5FUZH 3W9DA 1BBJB 3H7BA 4FTVA 3DSFL 1IGCH 2ZCLL 4NQDB 3BMVA 5EUOA 1JHKL 4D0DB 4HUUB 3WHXB 5IR1B 5E0QA 4QOKB 2XTJC 1U91B 1V5JA 4JJ5A 1KIRA 3QEUB 3D2UA 2J5LB 1UH3A 3BP4A 3QDGD 1EZVY 4I0PB 4OZIF 2VJXA 1G6RB 2GW5A 1MUJA 1IQWH 3KG5A 1OPGH 1WZKA 2APWA 3EOAB 3SO5A 2EDKA 5JW4M 4XPGH 2UWEE 3VXME 5EZJB 1AIFA 2NW2A 4NJAH 4XH2A 2Y6SC 2A83A 3PUCA 5FDWA 3L9RB 2WBJD 4CKVX 5I1LA 3H7LA 4XBPB 1JZ5A 4M61B 4N5ED 4XVJL 3T04D 4R97B 5DMKA 3KPRB 2EDHA 3VMNA 1XGTB 5E8EB 2AKRB 5D2NE 4JFOA 2C1PB 4P5KA 1JGLH 5D1QC 2B4CL 3RX5A 2COQA 5ETUB 2OBGA 1W0WA 1HCVA 1A5FH 1CFBA 4MA1B 3TGXA 4I3SH 1ITCA 3DX7A 3TFKD 4PB9L 3LEXB 1K4CA 1UB5A 4ONOA 1OAUL 1QQDB 2WWKT 2DM3A 1PY4A 2KDGA 2PKDA 1DVFA 1YC7A 1S5IH 3LIZH 4UIKH 1GXEA 4F7TA 3ULVE 3S4SA 1Y18A 2YK1L 2HMIC 4X6EB 1BD2D 5LJYH 3GSNL 1YNKH 3ZKSD 4X8JB 4EVNA 3ZT5A 4R0LC 4QXTA 5DZLA 4B41A 5FOJA 4HIEB 2ZKHH 5MI0C 3HC3L 1YUHB 3AB0B 4K55A 4F2MA 1EX0A 2YD3A 1GJIA 1FIGL 4DZ8A 1A6AB 2P8LA 1IEHA 2GSIB 5C08D 3SGEI 1QA9B 3UYRL 5DVOA 5DSCB 4EZMA 5BV7H 3MRGA 1MAJA 2GFBA 5E2UH 1LO3L 3OKKB 1OSPL 3V0AC 3O3UN 4JVWA 3KPOB 15C8L 5DTFB 4HIHB 1ZVSB 1YMHA 4RIRA 3U4EB 3M1BA 1Q9KB 1UM5L 1UACH 1GC1H 5J11B 1UGNA 3AXLA 1CFNA 1AGFB 4NQCD 2AJ3B 2QV2A 1JFQL 4UQ3B 5F70A 2EDWA 2X4UB 1J05A 3W2DH 4HJ0C 3OAUL 3NCYS 2VO5A 4PJHB 1NDGA 4YPJA 4CN1A 3FZUD 1XF1A 4XNZB 4OGZA 3QUKA 5ICYB 4M7LL 4YDLB 1UZ8B 3GZKA 5GGVL 2GJ6E 2JKXA 2CRIA 3VI4F 3QCVH 4RGOL 5HHOD 3L7EA 3VFMB 5FHAH 4QHMA 5F1NA 5HD8D 1DUZA 3AAZA 5JLZB 2NY7H 3SKMB 1QNZH 5AAWA 1EEQA 3EJZC 3WSQH 3QQ9D 2AJSH 4X99A 2VDQL 2VTFA 2ZUXA 3KPSE 3JUZA 5DK0A 3RFZC 5CEZL 1P7QD 4KV5F 1VB9A 2AEQL 3QUMH 3V8OA 2DLIA 4S2SA 5KJRH 3HZYA 1QO3B 1U8HB 4FFWC 3EFDH 2NY5C 4MA3B 1KTKE 5FYJH 3LOWA 2X4SA 5B3NA 1P7HL 5D7IB 4MD5A 5E95B 2BSTB 3GRWL 2EDFA 4AQOA 2BSRB 4QWWC 1CE1L 4HUNB 4BM7A 2AQ3A 1I8KB 4U33A 5HGHB 1CK0H 1BVKB 3GSQA 1Z9MA 3ARXA 2GY5A 4G80B 1OLZA 4F7CB 2DN7A 5I75B 3RWDA 2UWEA 3VXMA 4NUJB 5CCKL 3BN9C 4HBQA 2XY2A 5F8QC 4JDTL 1V7NH 5K93A 4YZFE 4UT7L 2P24B 4XVSH 4HCRL 2J4WL 5DRZB 1MHEB 1MWAL 2OR7A 4D94A 3LN9A 5EOTA 4HPOL 4N1HB 5D2NA 1UM6L 1SY6H 3TH4T 2D7OA 4KKLD 1NBYB 1GOHA 2LE9A 1N6QL 4LAQL 4M5YL 5DK2A 3PWPB 3QDJB 5F6HI 1JPTL 1GGUA 2I9LA 2D31A 5JOFB 1NDMA 3MYJB 4QHLB 4PGZA 1DBML 4LVOB 1BBDL 1JN6A 2XZQL 2ZCHL 4KFZC 1EFXA 5ERWA 3GMNA 1XGYH 4K7FA 4NNXA 4X5LA 5C6TH 4BZ2H 1ZSDA 5J1AB 3FFDB 3RY6A 4MVBD 2NLJA 4I1NB 1N2RA 3L7FA 1P4IL 5I73B 2BVOB 3W39B 3F12B 3QJHB 1XCTB 4LHUB 4ODUB 4P46B 2VDLL 3HG1D 2R39A 5DJYA 1CD1B 4TNVF 2C3VA 4QHKJ 3E0GA 1QEWA 2NR6D 1TMCB 4LCIL 3J7HA 2QJDA 1P5VA 4XPTH 4HKXB 4G42B 3QWQB 4WHYG 1JPSH 4U1MA 4DGYH 4IRJB 4JREB 1A6ZB 2CDFB 2PF6A 2Y5TA 3DROA 1Z6JT 3V6ZB 4MCYB 4I5BB 2VLJB 3LH2L 1Z3GL 3WE6A 2IALA 1PQZA 4ZS7L 5E2VH 5HDBF 2R0WH 4Y5YA 5E8OB 3VA2C 2WQRA 3GJFA 4OKVB 3K1KC 2CKBA 4QRUA 3WNLA 1Z5LB 5GRJH 3MRDA 1A4KB 1FSKC 4M1CC 3SO3B 5BRZE 1J0KA 3NA9L 3MGOB 1VFUA 3H3KA 5T1MB 4M6OL 3OBAA 2V7HB 3TZVB 4XBGA 5GZND 3FRUA 3ARTA 3WKMH 1MHHB 2GJ6A 2P48B 1NBZA 4H8WL 5DD1H 5DVKA 5LQBL 3TLRA 2X4OA 2EEDA 3WMSA 1E4XH 2YD9A 4Q6IB 1U42A 5ITFB 3HZMA 1JTPA 3C60D 3JWDL 4IHOB 4NKOA 4UB0H 1FNLA 1OB1B 2WP3O 3C5JB 3S37L 4CNIA 5IESL 3HPJB 5HDOA 3KPSA 2JB6B 3PHOB 3MQIA 1MRDH 5EUKB 3GB7A 4W4OC 4TUOA 4NZDA 3MRIB 4PTUB 2WWMC 3VG0H 1FZKA 2VOTA 5F7NC 4KQ3H 3DX9A 4WI2A 3OJMB 1ONQB 4RGMC 2XICA 1T1WA 3PWNB 5C9JA 3BP6B 4KI5F 3D85B 1M71A 3E3QC 3B9EA 4E41E 3S97C 1XIWC 4R26H 2FX8H 4G6JH 3D87B 4GKOA 4YLQT 2DS4A 4TNWF 4P9ML 4PJHF 1ZWIB 4UQ2A 4HGWA 4HH9A 3V4PH 4OCRL 2CLVA 3VWJB 4B5EA 1CF8L 5JW5A 2CK2A 2IG2H 3LV3A 3OAZK 1OWWA 3EYSH 1KFAH 4YHKH 3MCLL 1YY8B 1LHZA 3QEQE 4YQXL 4DFIA 3S34H 4HMDA 2BDNL 4NWTH 5I66A 3DRQA 2GTWA 1NCAL 3WUZA 1QFHA 5JO5B 1M4KA 4M6MH 3WO4C 5LGKA 2LVCA 1KEGL 5TDNA 3NFNB 3MV9E 4LCUA 2EZ0D 4HC1H 3VGFA 1AD9B 5ELIA 2E6QA 5EO1B 5FO9A 4D0BB 4F9PC 2R56H 3MPCA 4HSQA 2WMPA 1KPVA 4Y2DA 4OF3A 5I1HL 4PJGB 4L29B 2DTML 4ZPTA 5DUBB 3LPFA 1S9YA 2WAHA 4NYLB 3N0PB 5C0CE 1NLBL 1T80A 2FO4B 4Q9QH 3GK8H 3HE6D 3EJYD 4B0MM 2FJGB 4ETQA 4JFZH 4EJ1C 1V8HA 3U9UB 1ZV5A 1CLYL 1FZMB 1LEGB 1YMMD 2V5YA 1MCLA 1U8JA 2A6JA 5EU4A 1K8IA 2EIZB 2X70A 4WJ5A 5DS8B 4ZD3H 4GQPH 5SWZB 3OHXA 3FO0L 5EIIB 4JN2A 4FQJL 4LMQI 2G2RA 1RZKH 1R3JA 4P4KB 4QXWA 3ARFD 3H9ZA 1N3NA 5T3ZD 2EECA 3IS1X 1JF1B 3WD5L 1G9NL 1Y6KR 2D0FA 1F4HA 5BW7C 5L6YL 3VGAC 1LO4H 4XXCA 4U6HA 3QWRD 2G9HB 4TRPH 4XP1L 5CWSA 4NZUL 4S1SH 4TSBL 4AMKL 5KOVC 2CRZA 5BRZA 1JYVA 1A7NL 3QUXA 4HX1A 4YFLF 4R7DA 4K9EL 3SBWA 1VFOA 2B1HH 2N7BA 3NN8B 1IT9H 2W0FA 1UXSB 1VCAA 3N1MC 4JPWH 4PJEB 5D8JH 2VE6A 2GITB 1IQDA 4KTYA 1BLNA 3D0VA 2VXVH 2VR4A 1YYML 1O7SA 2IC2A 4JZOB 1H8NA 3WJLC 1YEDA 5FA3B 5IFJB 2CLRB 5ACMA 2IBGA 1M7XA 5DGRA 3SDXB 1ZVHA 1XF2A 3LSOB 3THMH 2W9DH 4JFDB 5JXAH 3HZVA 2UY6A 3CZFA 4OJFL 4MWFB 1R3KB 3B9DA 4H0GA 4CW1A 2UVFA 2VLLB 1MFAL 4UU9A 1RUMH 3UTSD 1IC5L 1Q0YL 1NAMA 4MX7A 1RULH 3VFUA 4PP1D 1ZT7B 4OZFH 4XWOD 3E8UL 5CSBA 1D3CA 5F72S 2YS4A 5L8LB 5CGMA 2EC9T 3MA7B 3UTTB 4D9RD 1FP5A 4HF5L 4AEEA 4F3FA 5MHSD 2PUQT 5KS9E 3C09B 4X4XA 1FLTX 4AT6A 3QXAB 3SCMD 4J6RL 4F58H 4EN3C 3NFSH 1DLHA 3GM8A 3KYKH 4G6KL 2CK0L 3QEQA 2Z31C 4Y5VA 2Q20A 2VH5H 4JPVL 3BPCA 3MBXL 5F6IB 5DJXB 3K8LA 4NHCL 4HUVA 1TJHH 2X4TA 4O2CA 2EIBA 2XWJA 3IDMA 5GRUH 4R7NA 3VGHA 5FKPA 4KAQH 3HS0B 2XN9E 2EH7H 2C3HA 3BKMH 1HKFA 3BDYH 3MV9A 5CIPA 1GGYA 4PRPB 3UTOA 4NSKB 3OKEA 4KDVA 4HWZA 2NZIA 2Z92B 3BIKB 1I7UA 1TVHA 4RMQA 3D5OF 3LRHA 5C0AB 3DX8A 1IJ9A 1U95B 3R0NA 1IL1B 3EAKA 3P9MB 2OR9L 4OIAA 3HUJB 4ODTH 3VXUE 1EAJA 3HI5L 1FYTD 2AAVA 3NPSB 1KCSL 2ZJSH 5C3LD 3QG6B 2HRPH 4ZS6C 2E6PA 4XMLH 3O11A 5C0CA 4KHTH 5C71A 4JGJA 4G8FB 3MV7E 3I6KB 2ZSVB 3CSPA 3I75A 1WCBB 3FQWA 2K1MA 4EKXA 3JXAA 3K8MA 3LEVH 4LCYA 1K2DA 3P9WB 5DC9B 2HN7B 4PP2B 5F71A 3BUYB 1T0MA 3ARUA 2YD5A 2Y72A 2P5ED 4NJAL 1QRNB 2LFGA 1MJUL 4K7PH 1JK8B 4GRLB 3MXVH 4XMPH 3T77A 2VYRE 4GBXB 1JZ8A 5TDPB 2J8OA 4Q0XH 5TE6H 5GGSA 3VXRB 2ARWA 2A6KB 4WUUB 2H6PA 4P23D 4PJGF 1BJ1H 3WIIH 3ZYIA 1YQVH 3LAFA 5ITBH 1S9KC 4OCLC 3EYVB 2R23B 4D8PA 1OP3H 4GXVH 5DMIL 4KK6D 2VLRE 3BPNB 2Y06H 3KYOB 2V2XA 2D9QB 4DVRL 4XVUC 1FVCA 1KEMH 1D5ZB 1RJYB 4OZHE 4TSCL 4QLRA 2G5BB 5FM5M 5TDOA 1ZHLB 3LIZL 2XTJE 1KENL 2VC2L 3VG9B 2YWYA 4W6WB 2AGJH 3GIZL 3SDYL 1ZE3C 5DD3H 3NCFB 4G6FB 3NAAH 3BD3A 3MRPA 4UV7H 4OUUA 5T33H 1KC5H 3O9WA 4WWKB 5TPWH 3MBED 1NC2B 3K80A 1LO5A 5C1MB 5MEPB 5C2BH 2VUOA 4KJWC 4CGTA 3QRFM 4Y89A 4M6NH 4YDVA 4WV1B 5E6ID 5ILTL 3SY0B 1P4BH 2NY1B 1TITA 4Y5XB 3JV6A 4U1KB 1I3RB 3LKPB 3FT2A 2VDMH 3VFTA 2XG5A 5I16A 5KS9A 2VZOA 4J1UA 5GSVB 3AMLA 4PRHE 4X9FA 1N0XH 1OM3H 5LWYH 5F7DA 3LKRB 1FGVH 2J5LC 3AM8C 2IQAA 4PJEF 5DFWH 3RZWA 4OZ4B 1DQQB 1MFEH 3DUSA 3EYOA 3MNVB 1WF5A 2XA8L 2C4FT 5HSFA 1CN4A 1RV6X 4ZXBA 2XN9A 3N1QC 3Q5OA 3OJVC 1C7SA 2IQ9H 1AXSA 2HG5B 4X6CE 3GSOA 3F58H 5AD0A 5J8OA 2J88H 3B5GA 1S7WA 3SDXF 4PJ5D 1G9ML 4MJIB 1BECA 4TULH 5IWLC 3QXTA 3GI9H 4RQQB 1H3VA 1H3PL 4I18B 4FHBD 1NMBL 4R97C 1HNFA 3JV5A 5EBWB 4M4RA 4YHIB 3VXUA 3FFCE 4TVPL 1I1FA 3CFBA 4HBCH 4HZLB 2Z8SA 1HHJA 4YNYA 5GGUA 4IIQA 1ZLSH 4TYUA 3QUML 1IC7H 2NY4D 5CBAB 4IRZH 2WBJC 4BZYA 5FECA 1SBSL 3MV7A 2AV1A 5ALCL 1G0YR 4MJ5B 3UC0H 4N5EC 3EO0B 1TJIH 1TNMA 3O3AB 4M48H 4LASH 1LE5A 5CILL 1KB9K 3RA7H 1RHFA 4RGND 3SDAD 1RIUL 3JVGA 3GNMH 2FL5B 4XC3L 3G5XB 1ZHNA 5DRNA 3RL2A 1OT1A 4JKKA 3VFVA 1FFRA 3IDIA 3PABA 4P2OB 2FYYA 3MV11 2R2HB 3AB0C 1EK3A 3NIDE 2CDEA 3VFPB 5JDJA 1WJ3A 5ESAA 5IVXE 4ODSH 1IAKA 2VLKD 3CMOL 1G7JB 2IGFH 4LLVB 3RVVD 1T04A 2H8PA 1ORSB 3HUJF 2QR0A 4MLIA 4OZGE 1A8JH 4XNQA 1QUNA 1ADQA 4G9DA 1NCUA 2VLRA 1NUDA 4V1DB 4CU6A 4JM2D 5DJ6A 5J11C 1T5XB 3O6FD 4QHNB 1JGDB 4OZHA 4C56D 5HVWA 1AGEB 5C6TL 1MLBA 5IBTL 1B90A 1D9KD 1ZKAA 4BQ9A 3D39D 1KB5H 1E4KC 3CUPB 1NANH 3UPCA 1I3UA 2PO6B 4NO3A 2Y9RT 2Q1EA 3Q6FA 4XNZC 5AUMA 3UZQA 5HPMA 1EJ6A 5JNYB 4Q9RL 1LO2L 1RHHB 2DI9A 5EWIL 5A2FA 5BV7B 4YHMH 5C7XL 4CN4A 2DQHH 5IK3A 4Y4HB 3EFFA 5JHDE 3QDAA 3FZUC 4WEBH 1XR9B 4AEHH 4JG0H 1NGWA 1CGSH 3RWCA 2R1XA 3NVQA 4QRQB 4YDKH 4HIXL 4PRHA 1SYVA 5I8EA 3IAPA 4GH7B 5I1EL 1BZ9A 5E2VL 3M8OH 3FHQA 3RBSA 5SX5H 1IRAY 1VFAA 4K3GA 4UNVA 5BVJA 5D1QA 1HYSD 4NQED 3BKYL 1JZ3A 2MHAA 2HJLA 2ITCA 2KH2B 2K7QA 4QRRD 2H2PD 3O6LL 3QQ9C 2YD2A 5EC2A 4OM1H 4L4VD 1FORH 2Q6WB 4X6CA 1ROWA 3BHBA 5SWSD 4Z77A 5F89B 5GRVL 1A6TA 1UENA 2ADFL 1KCVH 2IADA 3PGCB 5E1HB 3VMPA 1TCRA 4FZ8H 4XC1L 1VACA 1MCOH 5KZCD 1I7RA 4UB0L 1KELL 4NKDA 3FT3B 4QRRB 4R0LA 3QUMB 4UV4H 4XVTH 3TH2T 5ID1A 3FFCA 3ALWA 2EEAA 5KTEH 4LKCA 1JYXA 1DLFH 2WQ8A 2RFXA 1OP3K 5FYKH 3VD9A 2EYRA 1I9RL 5E5MA 3PP4L 5I0ZA 4BUHA 4MHHG 4CU8A 5F9JA 3DUUA 5CJXC 1DSFL 1FRGL 4L4JA 5AWNH 1AJ7L 3WFEH 4LVOC 2EDEA 1MAKA 3I3EA 2WIMA 1T4KB 3MO1B 4R26L 2Y36L 3GJFH 2CKBH 3UROR 4KKLC 4P59H 4OGXH 5I73C 5IW6A 4JO3H 1A3QA 1EEYA 4YXHH 4ACPA 4P46C 5M94B 1CDCA 2EKJA 2ED8A 4U6YA 1AY1H 4ZDHB 1YPZB 1QSEB 3B3IB 3RDTB 5I1KH 2ZG1A 4XAKE 3KR3H 5DJCA 4ODXA 5IVXA 5ENWA 4ENED 1A1MA 4FQLH 5GRWA 4JANB 3W81A 1S7UB 4M7JH 12E8L 4WHTB 1YEKH 4OZGA 4IRJC 2XKSA 5GGQL 2FX9H 4BSVB 2WBKA 3CGTA 3VXSE 4GQ9H 4YGAB 1H3XA 3K3QA 1Y6MR 2ADJB 2R4SL 1NEUA 4WY7H 1QLRB 2DWEA 2EE6A 5D96B 3I6GB 2NR6C 1DN0B 5TF1L 1KV3A 1D7FA 1PJ9A 5DVMA 4GO6B 4LIQL 1ZLUH 4CADA 4PJ7B 3FKUS 4LVNB 3TBSB 1AQDB 3SO3C 4EXKA 4X6BA 5IIEB 2GT9B 3DIFB 4OLZH 3VFSB 2GJZA 4K2UL 4Q9QL 4Z7VE 1S5HA 2V9TA 3TZVC 3E3QE 3BD5A 2AXFA 1JPFA 3EZJB 3BJLA 3IB4A 3WXVL 4Q6IC 2G75B 5CBEA 4X4YB 5EORL 4JDZB 2OSLA 4FXGB 5TE7H 2JELL 4X9HA 2DQUH 1SJHA 5JHDA 3M17B 3RWHA 1ETZB 1HI6A 2B0SL 3QO1B 5MEND 3GSXB 2GI7A 1YJDH 3V4VL 4GSDL 3LZFH 3TN0B 2ED7A 3DVGA 4YXKH 2EXYD 4OCMC 4IMLA 1CXKA 1UXWA 2R2EA 3EDJA 5EO9B 1A2YA 4FQQB 3C60C 3AGVA 1L0XA 1ZT4B 1PAMA 5F6HJ 4TVSa 4X4ZA 4TUKH 5HYJE 1G7HB 2AXHA 2YPLD 4MXWH 5CS7A 2JB5H 2B1HL 1KCUH 5INCB 3TIEA 4GMTL 3MREB 3TP4A 5HI5C 4ISVA 3VWJC 4YHPA 4WU5A 4P2QB 4XCEA 2A2QT 3V5KA 2IMMA 4G7VL 3KLDA 3EBAA 1M7DA 4WO4B 4M8QB 2BFVL 5FYLL 4I48B 4IOFC 4ZFZB 2DICA 2MMXA 2M1KA 1CFSB 4A6YH 3QNYA 1DN2A 4F57H 1MCPH 4RMSA 5DYOA 4JHAL 4I3RH 4QRPB 2VR5A 5CEYA 2AJZA 4JRXB 3REWB 4DKFL 4M5ZL 5GGTL 5LGHL 4KHXH 4OIIL 4U3HA 3BP5B 4PLKD 4BFIA 3CMGA 3VRJA 1HEZA 1U8MA 1I8LC 4AIZB 4ZQKA 3N1FC 4ZOCA 3VCLB 1QLEH 3BKJH 2EDQA 4WI6A 1CGWA 4EBQL 1BQHA 2D4DA 2A9NL 1KPUA 5FUOH 2LU7A 1ODAA 2V2TA 3NIFE 5EOCH 1NCWH 4XZUA 3TPUB 3QIUB 4X6FB 43CAA 4PGEA 2PYEE 4RCAA 1MJJA 3QXDA 3KYAA 1KNOA 3HRZA 4HJJL 3GM0A 4LQFH 3KYKL 1X4ZA 4PBWD 4KTDL 5FGBA 2X05A 5SWQA 1QSZA 2ZUSA 3DURB 4WCYL 1TJHL 4HKJB 3SOBL 4OFKA 4OZIE 3BT2L 1IAOB 2V17H 2AK4E 3CJJA 2VXUH 3V6FA 3DV6B 2SEBB 5HGGS 4K3DL 1QFPA 3VXSA 1M1SA 1KXVC 4P4KC 3V7MA 1Q1JH 3V5DB 2VDOH 5FM5O 5SX5K 3STZA 2YKLL 2YN3A 5E8DL 1KIQA 3FAXA 2FX7H 3IJSA 4KUCF 4WHCA 3F6LA 1XGUA 4W4OA 1B4JH 1MFBH 1I1YA 3QULB 1MCHA 4ODTL 1I3GL 3LRGA 2FZ3B 3TBVB 3OKDA 1INDH 2P45B 2WUCL 1EFQA 5T5FH 4I0KA 1OTUC 2NY2D 2RJMA 4Z7VA 3EJJX 4HFUH 3ZHLA 1RURH 3O4OB 3L5XH 5C8JA 4XNYH 5D1ZD 4M3KB 2MPAL 3NTCL 1XIWA 3HR5A 4JFQA 1OCWH 4LFHG 1PY9A 1ZA3A 4RFOH 1FGNL 4O9HH 1YPZF 5FGSA 3L6FA 4WGVB 5IB5B 4D3CL 3WXWH 1E27A 4NQXB 1DQLL 3MACL 4PR5A 2E7BA 3O6KL 5INDA 3T0ED 2W38A 3ZE2F 4L8SB 4KKCC 5CD3A 4QRTB 3KNBB 2LQRA 4NO0D 5ESQA 3KGRA 3HI1A 1NANI 4KVNH 3FQUA 5D71H 2X1OA 4LEOB 5JDSB 3GBLA 4GAGL 3MJ8B 1FNGB 3IFOB 3FRPG 3MA9H 4XMPL 1MF2L 2W0PA 3MNWB 2IF7A 3SDCD 1I8MA 3GHBH 1B0RB 1QKZH 4ODHH 4FA8A 1YEEL 2CUHA 1TENA 3GO1H 1IM9A 3H9SD 5HYJA 2E7LC 2MCPL 4JEGB 4Q2ZB 4P4RB 4DOHB 4F9PA 2VXSH 1YQVL 2ORBH 5JTWA 5GS3A 4X7SH 3ILQD 4PJ7F 1I1AD 3BH8A 5JMOC 1PSKH 2JCCB 4R4FH 5GS1C 1U36A 5DJDB 3C09C 1WISA 1X5YA 5FKAA 2V5SA 1MI5B 5HHVL 3AVEA 2HP4A 1KEML 3O45A 4TOYL 4R96B 3OV6A 4JQXC 2VQ1A 3MRHB 2QBWA 4KJQD 2LAGB 5DR5H 3S88L 5F6IC 3ZKXB 1WZMA 1CQKA 2ARJA 4G8GA 5ABDE 5BS0B 1XF4B 2KQNA 5I2IA 4NKIH 3IJYB 1NJ9A 3DPBA 4L8BA 2BNRA 5T33L 3SCMC 1BIIB 3W0WD 1W72H 3CLFH 4H88H 4OZFB 5DJ0B 1SJEB 4YEFA 3VI4E 1P84J 5C0JA 1OW0A 3AU1B 3CDGA 4BK4A 3ARED 1OGAB 5LBSL 1NUGA 3X14B 3NPSC 2X42A 2LVEA 5BW7A 2VDML 1L9NA 2A73B 3HNTH 4KH2A 1D6VH 1NKRA 5IJVB 1IAIH 5FHBH 4UT9H 2W9EH 2BXZA 2ICWA 5DQDH 3GMRA 5A1AA 2BNQE 1AE6H 5LWYL 4KV5E 2E9JA 3AREB 3U36A 3B5TA 3K8KA 3U0PB 4FFYL 4OZIA 5T1DH 2AK4A 5T3XH 4NM4L 3JV0A 3F58L 3ILPA 1J0HA 2J88L 2VWEC 3PGFH 1IGYA 2HJFA 5F7LB 5HYQB 4PYHA 3WJLA 1AC0A 4M43H 1MCIA 5JPMB 3G04A 4GRLC 3SE8L 1KTLB 2IAMB 1A7PL 1C1EH 4EDXA 4GBXC 3NCMA 4ONHA 2PYFB 3L5WB 3ULUL 4L9DA 3CC5A 4URTB 4XCCH 2AW2A 5F9AC 4JRYD 1AKJA 4CJ0A 1RUQL 1TZHA 1U8KB 1MQKL 3OKOA 3E2HB 1R3IH 1A7QL 1HXMA 2VXTL 4Y19B 5DD0H 3LY6A 3IGAB 1UJ3B 2WBWB 1W0YT 3BZ4B 3P0YH 5F7MC 5SV3A 5CJOH 2X5PA 3D18A 4NQDE 4DN4H 4OFPA 4LASL 4ZUTA 4YFDB 3LKNB 3GIVA 4NP4H 1QR1A 5I8CA 5TFSL 4P23C 1VPOH 4QOKE 4EN3A 2J6EH 3EYFA 3VG9C 2GUOB 5D7LE 3QJFB 6FABH 3HN3A 2Z31A 4MJ6A 3IU3A 3T1FB 4NKMB 3LQAH 2ID5A 1I7ZB 2VKWA 4KK6C 3OGCA 3IJHA 1U3HD 4DZBB 4LLYA 4P5TD 3U6RB 3FB8B 4HXBL 1CU4H 2BCKA 3QFJA 1OLLA 3W9DB 2ARJQ 3I3DA 3H7BB 4WWKC 4S1QH 5JPNA 1KLUA 4LSUL 4ODSL 4NJ9H 2FIKB 5EUOB 5D7KD 3CPLA 4XTRC 4LSTL 2IGFL 3QPQD 1L9MA 3O2WH 4WV1C 1ULVA 2NY1C 4Y5XC 1EO7A 5DJZA 4FQXB 1JGUH 1KLGA 3BP4B 1NFKA 4LPTA 4NHUA 4YHYB 3MBEC 4ONFH 1CDUA 3I50L 4LF3B 2Y25A 2PNDA 5D1XB 5IEHA 5BZWB 2HTKD 5GPRA 5JZ7D 3QHFH 4DWHA 1U9KA 1JNJA 1AIFB 4XH2B 2OM5A 4L8DA 2A83B 1FO0A 5FDWB 1UG9A 5I1LB 1FAIH 1OARL 3RAJH 2GKIA 3O2DH 4H20L 1GGTA 5DMKB 4JZNA 4RBPH 5DO2D 1QBML 4I18C 2HTLC 3DBXB 1TLKA 5EH1A 3D9AH 4UOW0 1T66D 4L4TD 4P5KB 3UDWA 4FFVD 5F7UA 1J11A 2ADGB 4OZFG 5CEZD 2HAZA 4HKBB 2OL3A 5FO7A 4AEHL 2GK2A 1W0WB 4JG0L 4E42A 3BESR 3T2OA 3MRKB 4LBEA 1JYWA 3DX7B 2CLZB 2BNQA 4CMMA 4J4PD 2X4NA 1Q9WB 1UB5B 4HG4J 2JCCF 1BD2E 1DVFB 5KSAB 3ZDXF 4GKZB 4F7TB 1Y18B 3FB7A 3UBXA 4MXQD 5B8CC 5IV2A 2QTEA 2D7PA 1NSNH 4IEFB 1IKFL 4QXTB 4V2BA 3ULVL 1NFIB 1JE6A 5C08E 3B9KD 3TT1L 2H41A 3PWLB 3W5NA 4F2MB 3T3MF 3GMQB 2DYPD 4PJHE 4FZ8L 3UO1L 3OWEA 3LRSA 4P2OC 5FAAA 1EXUA 3QIWD 2ZNWA 2CH8A 3MRGB 2GFBB 4UV4L 4XVTL 3SDAC 5IM7A 5KTEL 2NNAB 4NQCE 1DLFL 3M1BB 5JXEA 4WI3A 4XCFH 3AXLB 1CFNB 1AR2A 2OQJB 1BZQK 1F4YL 5JQHC 4AEIL 2MOVA 3D3VB 3K46A 2Y23A 4TTGA 4NQDA 3NIGF 4F15C 1UKSA 4D0DA 4HUUA 3WHXA 4MHHI 1T1ZB 1NDGB 2HWZL 5DUMH 5DURD 3B8YA 4QOKA 1U91A 2CKBL 5HHOE 4ZFFA 4KUZH 5D7LA 3B8SA 3QI9B 3L3JB 4OGXL 4DAGL 2PO6C 3AM8A 2PTTA 4PV8A 1E4WL 1U93B 3SGJC 2VABA 4QHMB 5F1NB 3ARVA 4W4NA 1ACZA 1DUZB 5BV7C 3DMMD 3C5ZD 1DBAL 9CGTA 4U6XB 1KIPA 5CP3A 5EZJA 1VGKB 4DW2L 5F1SA 3WJJC 1WSST 2X4QB 1GC1C 5IWLA 4RDQG 3QDGA 1YEKL 3HZYB 3Q1SL 4M61A 2C9AA 1S9VA 3MLVL 5K33A 3QR2A 2Z0BA 2Q8AH 1LK3L 2FCBA 4MD5B 4M62H 1H15B 1XGTA 2H32H 3A6CH 5E8EA 2D7NA 1KB5B 4FABH 4GXUN 5GHWH 5L0QC 3QG7L 4Y16D 3KWWB 4R8WH 2WINA 2C1PA 4APQD 4GXUM 2FECI 4P3DB 4MXVF 4YO0B 4DUVA 2IPKB 2WBJA 4HQQH 5ETUA 3PWPE 3QDJE 3VXMB 1F90H 1N26A 1UA6H 3BI9X 1MCRA 2JTDA 2YBRA 1FL3B 3JWOL 5IB1B 35C8L 4XP4H 1QQDA 5E08H 2HFEB 1WCQA 4KROD 1NGYA 3B2UD 4XB8A 2XT1B 3LS4H 4R4BB 4LU5H 4X8JA 5HI3D 2H2PC 4X7FC 4KK9D 3NZHH 4HIEA 5EUOF 1YUHA 5DK2B 1YJDL 5K59F 3MLSL 2XKNA 2D31B 2FATH 3X13B 1NDMB 1A6AA 3QIBD 2GSIA 1QR4A 1QA9A 1EFXB 4KROB 5DSCA 3GMNB 1N59B 4NNXB 5IHBA 4ZSOE 1ZSDB 1BD2A 3OKKA 2VZTA 5DTFA 4NN5B 4OQ1A 1E6OH 4HIHA 5LVEA 3HG1E 3U4EA 5C07D 3L7FB 5KN5A 3T08A 4P0DA 4NRXB 3I9GH 1TJGH 2NXZB 2VLJE 5DJYB 5C09B 4UQ3A 5IT2H 2AJYH 5DHXB 5C08A 4MAUL 3S4SG 5TQ0L 3SE4C 1N6VA 2BX5A 1R5VB 4MSWA 4QYOA 1E4KA 3U0WL 3T09A 3MOAH 4JAMA 2UUDK 4JKMA 3ZMRA 5ICYA 1JBJA 3VWKD 2Y5TB 5IQ7H 4NQCA 3SPVB 4F57L 3MUGB 3PV6A 4I3RL 3VFMA 2Z91A 2WLYA 5DT1H 2FEDD 1FLRH 1B6UA 1PQZB 1Q9LA 1L7IL 3UMTA 5HYEA 1NLDH 3SKMA 4Y5YB 3GJFB 3NOIA 1Z0NA 2CKBB 1MFDH 4QRUB 1GAFH 5C0FB 3MRDB 2QADD 1KB9J 3IKKA 4XP6L 4ENEC 2A6IB 1U8HA 1HHGB 5HHOA 1G0XA 4LVNC 4XBGB 3FRUB 1WWBX 5GGVY 1NBZB 1ZGLP 5KVFL 2BSRA 1P5UA 2X4OB 4DQOH 2FB4H 3IF1A 3LEYL 3NCBB 4XPAL 5HGHA 2B20A 1BVKA 4LQFL 2ZG3A 4S11A 4RBPK 4DKEL 3ZT7A 3RPIB 3T4AB 4F7CA 3PP3H 4G80A 1CL7H 1P7QA 1NGZA 1FL6B 3DXAD 1MJ8L 2MJWA 1WEJH 2ZOKB 4TUOB 5KW9H 4C57C 1BIHA 1URLA 4HMEA 1T03L 1MOEA 1FNSL 4OGAC 2H9GB 3DX9B 5DRZA 3IDNB 4NQUA 1MHEA 2ZUQB 2VDOL 2PR4H 2DLGA 3R1GL 1NUNB 1LO0L 1RZFH 1FJ1A 4NFCA 3PWPA 3QDJA 4ZTOH 5CD5C 1NAML 1KT2A 4UQ2B 5CJXA 5JOFA 4BSJA 3MYJA 4QHLA 4HGWB 4HH9B 5D72H 2CLVB 1TZIB 2VDPL 3ROOB 2DMKA 3LV3B 3QDHA 4OLUH 3TWCL 5J1AA 1QFWH 4HAGA 3REVA 3MZTA 3ARDD 3FFDA 1FNHA 2QSCH 3G6AB 3DVIA 2RCSH 3TA3D 3HLAA 2BVOA 4XI5D 4O9HL 2VB5A 4KRPB 3BEVA 3F12A 2GTWB 3H3BC 4LHUA 4ODUA 2E9BA 1CD1A 1AD0B 3RKDC 4UZGA 3HFML 1NGQL 2UZYB 2Y7QB 2CPCA 3E6HA 5EU5A 4JFYB 1JUFA 4DGIL 2QHRH 1IGFL 3C5SB 2DQIH 3MUY1 3SJVD 2EYTB 1P6AB 4HKXA 4ZSOA 4Y2DB 3UTPE 4HIIB 3N9GL 2GQHA 2YR3A 4JFFD 3H0TB 4JLRB 5SWZE 1WAAF 1A6ZA 3HG1A 2CDFA 1UKTA 3GO1L 5E99H 3IXAA 2P49B 4PJ8D 3QUZD 3V6ZA 4MCYA 1H0DB 3TBTA 1NCNA 3DOSA 2VLJA 4I5BA 1GHFH 2VXSL 1G7PA 4O58H 1A9BB 3CZJA 4PRBB 4ETQB 5I1GL 1IBGL 3CCHB 3BYYA 5JW4Q 3S9DB 5E8OA 4LSRL 1LQSR 3QIUC 1EMTH 2B39A 5CMAB 1Z5LA 2A6JB 1EERB 1K8IB 4N8VA 4N9OB 1A4KA 3HE7D 4PLKC 3KAAA 4A6YB 2Y07H 3MGOA 4PJ8B 2VZ1A 5T1MA 1MCJA 1H8OA 1RUKL 4NPYB 2X70B 3TZVA 2V7HA 2QEJA 3OHXB 1MHHA 4JN2B 4J2XA 5GXBB 4PJEE 4HWEH 3LKSB 3WUWA 4Q6IA 5ITFA 5DZNA 4I77H 4X5XB 1ND0B 4N1CA 5DLML 1N3NB 2YPKB 4IHOA 5JUEH 1OB1A 2I60L 2NY0B 5LKNA 3C5JA 4I4WA 4KTEH 4U6HB 5F9OH 4M7ZB 3HPJA 1C5BL 5CWSB 3RNKB 5HHXH 4R90H 1HWHB 2JB6A 3H9HA 3PHOA 4FZEL 3SDXE 5BRZB 5EUKA 3QUXB 2FSEA 3QUYD 4HX1B 1YA5A 4OCYH 4JFDE 5JOPD 3V8CA 1DFBH 1LWRA 5I6XB 1EGJL 2GJJA 3C60A 5HHPA 1U8LA 1CGVA 1NC4D 1ONQA 1QVOA 1CICD 2VE6B 3F7VA 3RWGA 1L0YA 4BK5A 1ZS8A 1HZHH 4YXLL 3UTTE 3EO9L 1ZWIA 2ZCKH 4NNYA 1DL7L 3CNKA 1RZKC 3VWJA 3QCUL 1C5CL 3WFCL 1WZ1H 1WTGT 3UTSE 4F33B 4MYWB 1JNNL 4HFWB 1GZQA 3F7QA 4MA7H 5D1ZC 3NACL 4UU9B 3RWIA 5IMOB 1NAMB 5IFHH 3VFUB 2AJVL 4OGYH 3BISA 3T0EC 3NFNA 4BUGA 3U4BH 4TUJB 4F3FB 5I8OL 3BP7A 3PWVA 3IFNH 4X4XB 5C0AE 2HFTA 4AT6B 1I8LA 1DQMH 4U2ZA 5HBBA 1BEYL 1DLHB 5IB4B 1J5OL 5L8JB 3HUJE 4Y5VB 5CJOL 5IQ9A 4Z78B 2YUXA 5DUBA 1ZMYA 2FBJL 3BPCB 4DN4L 1OWRM 5A40E 4HUVB 4L3EB 4KKNA 1YZZA 1J86A 2XWJB 4JY5L 2ZSWB 4J23A 3ZL4H 4R7NB 2P8PB 1NUFA 3PE9A 1VPOL 1I8IB 3DTXA 3EOBB 5B4MD 2FJGA 3MV9B 5IB3B 1X4YA 3U9UA 3MV8D 5B3JE 6FABL 4QXGH 4ZFGH 4HWZB 1FZMA 2ZZUT 3MCKA 2HH0L 1TVHB 5GJTL 3G6JE 1IGJA 3LHPH 2XIDA 4MNQB 5I15H 1FYTE 1JGVL 2EIZA 2P1YA 2XRAH 5DS8A 2AJUL 3HMXH 5SWZA 1PG7X 4ODWA 3V4UH 5I18H 1E0OB 2P5WD 1DJSA 3DETD 2VWEE 4P4KA 4GW5B 1D5IL 2MCG1 1RZIB 1TDQA 1HN1A 1LGVA 1YMMA 1JF1A 3UX9B 3NH7H 5F3BB 3RGVD 3EO1B 1T2QH 2M26A 4PYGA 4LNRB 4FQCL 1NBVL 1F3RB 4G6AC 2G9HA 3FQWB 4TPRL 3MJ9A 4ONGH 5GS0H 4GAFB 2FLBT 3PP3K 3WDIA 5BVPH 4E5XB 1CDJA 2P5WB 3OF6A 3RUGB 1JRHH 4LK4A 3VXOA 3JUYA 3QCTL 4J3XA 1OQXA 3AREC 3CLEL 3ARFA 1MRCH 4Y8AA 4PJEA 1EO8L 1T20B 1W72B 5BMFH 3WFBH 1Z9OA 2NXYB 4PRNA 2GITA 4PREB 3GSVB 3RWFB 1S9WA 4JZOA 3MRNB 2XG4A 3B43A 4JPKL 4EUPH 1F42A 5FA3A 3MFGB 5IFJA 1TTFA 2IAMC 2H6PB 2CLRA 3SDXA 1EHLH 3CVIH 5T3XD 1BQUA 4JFDA 2NX5B 1H8SA 25C8H 3V52H 4D8PB 5D6CB 1FVEB 1FL5A 1KUMA 1R3KA 1RZJH 1NBQA 2V2XB 3E2HC 3GHEL 3O2VL 4P2RB 3IDJB 1P6FA 1I85C 3TBYB 1HH9A 3U1SH 3N1PC 2FGWL 1UJ3C 1ADQL 1ZT7A 4CDHA 1J1XH 1EH9A 3UTTA 3C08H 5ISZD 4RNRB 5GS1A 2I25N 4JRWA 4AYFA 1EBPA 1XZ0B 3AS1A 3RKPA 2AS5M 3QXAA 2I26N 2DD8H 5F44A 3UTSA 1T0PB 2B1AH 4JQXA 5ACZB 2BVEA 5DJXA 3PDDA 4POZD 2FJFB 3MRFB 1NCCL 4U1NA 1VFMA 4JCLA 3DWTA 2FIRT 3JV6B 1OSZA 3SCMA 3BIKA 5IMMB 4J1UB 4NFDA 2YD8A 5C0AA 1U95A 3P30L 4FQXC 2D0HA 2OL3H 1JGEB 4P5TC 3X3FL 2DIJA 4QF1A 1MNUL 3HUJA 5ADOH 3Q3GA 4DGVH 3DUSB 3QG6A 3EYOB 1UWGH 5E7FA 3ZYOA 5D1XC 1MVFA 1J1PL 3QPQC 2J12B 1TNNA 3KPMA 1CWVA 4LARH 3BFOA 1ZEAL 4PJ5E 5I1AB 4G8FA 1FBIL 4ZG1A 3I6KA 2ZSVA 1GH7A 2XPGA 2VQUA 1U3ZA 4OM0L 5E6YA 2P7TB 4ZODA 1HWGB 3G6JA 2F5BH 5CJ8A 4OI7A 2BVYA 1HKLH 1IAMA 1FYTA 2WNGA 3IDYC 2HN7A 3BUYA 4OLYH 1QFWI 1C12A 1N5AA 4GMSH 3CFBB 2FNBA 3ZE0F 5JZ7C 4OD1H 3B9VA 5GGUB 4IIQB 4KK5D 1Q72L 1OAZL 3BQUD 1QLFA 3ECBB 2AV1B 4GBXA 4K3JH 4XNXL 5DQ9A 1AR1D 3VA6A 1DBBH 1AXTL 3QPXH 43C9B 3ARBB 5DO2C 3S5LB 3WS3A 4OQTA 4I2XB 2P5EA 3TVMB 5KSAC 3BPLB 3DI3B 2R23A 4FFVC 4V1DE 2CUMA 2XZAH 1GGCH 4GOSA 4PB0H 3VFVB 3TM6A 1KJVB 1RJYA 1D5ZA 3IDIB 4PTTA 1S7TA 2VLKE 2LV4A 4HS3B 2G5BA 3F7YB 1ZHLA 1A4JB 4P23A 4AL8L 4JFHD 5IBLD 2R8SL 1RMFL 3ZKMC 3LPGA 1Q0XH 1KLFA 2VL5A 1PEZA 2WIIA 4WNQB 3I85A 1CGYA 3HI6L 2MQCA 4HK3J 4XNQB 1J8HB 2IBZY 1OAXH 4HDIA 2VLRB 3D0LB 1GPOL 4WWKA 5TE4H 4P3CH 3S96A 4DEPB 3B9KC 4MDJA 2XWBB 2BOBB 5MEPA 1AFVL 4WV1A 4S1DD 1MLBB 1NGPH 4Y5XA 3WFZA 4U1KA 1G1CA 1J8KA 3LKPA 3SDDD 4D0CB 1T6VN 4FNLH 2E27L 4NO3B 3CXDL 3Q6FB 5HPMB 1TJGL 3RUGF 2VZUA 4ZNCD 3MBEA 3LDBB 3LKRA 2NY5L 3QI9C 5CZXD 4XCNB 4HIJA 3PXHA 2N1KA 2OP4H 1UWXH 4PLOB 5IK3B 4IDJL 3MNVA 3EFFB 3O0RL 5C0ND 1T7WA 4N90E 2DI8A 2HG5A 4GKNB 1NGWB 2F8OA 4MA8H 3RWCB 2F8XC 2JJWA 4JGMA 2FDBP 4HS8L 3C6LD 2VDRL 4PS4L 2X44D 4I18A 2XQYG 4Y4FD 1CD8A 3OR7B 2QQLL 4QRRE 5EBWA 4YHIA 3RP1A 3BSZH 3HCVB 5FYJE 1GAFL 1YEJL 2MHAB 4NIKB 1KF9B 2HJLB 4HZLA 4G3YH 3IYLW 1OD9A 1AC6A 5CBAA 4R3SA 4PJ5A 2WK2A 1BGXH 3BHBB 3EO0A 4Y4FB 1D5BA 2FD6L 1SEBB 1TCRB 3NABH 2UZIL 3LKQB 5B8CA 4OLWL 5F9DC 5ESVB 4ODVL 3V79C 1I7RB 5GZOC 1X5LA 3BDBA 1IFHL 3OZ9L 4R0LB 4YHLH 4YX2H 1R24B 1CL7L 5EBMA 3V0WL 3G5XA 5MI0B 3GI8H 5ICXB 2DRUA 2DQJH 3E6FA 3HMWL 4HWBH 1G7LA 1BMGA 1PD6A 3IU4L 5T1KD 1WEJL 2H32B 1YPZE 4KZEH 2O5ZL 4P2OA 2R2HA 5E5MB 5F9JB 3ZE2E 4OT1L 2ICES 3ARQA 4LRNL 3SDAA 3PDGA 3H9YA 1G7JA 3GSUB 1D5MA 4KROC 2PR4L 3B2UC 2IPUK 1ORSA 4PRAB 1RZFL 1BQLH 3G5VA 1WBXA 4NN5C 1BWMA 5EOQH 4F7EB 1LDSA 1SJXA 4RMRA 1N7MH 4ALAL 2JIXD 4KK9C 4G6MH 2ZUTA 4V1DA 2E7HA 2NXZC 1T5XA 3EZ8A 4QHNA 3S8WA 4Z7WA 1JGDA 1CGTA 3MLRH 2VLKA 3QIBC 5J9PA 5EZOL 5J3HD 1AGEA 5K9QG 1CYGA 1EHNA 2QSCL 1CZ8H 4PJ7E 4ODXB 4PLJC 5ENWB 3CUPA 4R4NC 1A1MB 2RCSL 4NCDA 2PO6A 5FYLD 4U0RB 3VRIB 1YNTB 4YHZL 1RZ8A 2AQ1A 2Y1VA 1QFWM 3MODL 1ZLVH 4OZGB 3SGJA 4F80A 2DM4A 1RZ7H 3HC0A 3V5HA 2VDNH 5JQ6L 3D39A 1KBGL 3U7WH 3WJJA 7FABH 2XWTA 3T0BA 4Y5YC 3U46B 5E99L 3VWKC 4HV8B 4NQVA 1YNLH 3FT4B 4QRQA 4ZAKD 3DYPA 2GJZB 3S98A 1F02I 1S5HB 3O41B 4Z8FL 3T2NL 1QPXA 3CAFA 4UINH 3EIFA 2AXFB 1JPFB 3KXFD 4XP5L 1MVUB 4BQ6A 3GBML 3MLXH 4IM8A 2OSLB 5MENE 3C2SA 4PRID 1U92B 1SJHB 1TVBA 5I30L 3H8NA 3T3PE 1HILA 1NMAH 4HKZB 4OCSL 5F89A 1EUTA 3P11H 2ICCA 3PGCA 4P2QE 2DBLH 1EEUA 4ERSL 1S7SB 4IMLB 3CVHH 1XF5B 1U8OB 1GOGA 3FT3A 4QRRA 2VQTA 2XV6B 4PUBH 4RFNB 5HHXL 1FIEA 1V3KA 2EC8A 4JN1H 5L2KB 4QRPE 4UTAH 1MQ8A 2F53D 5CJQH 1JF6A 5KVEL 3OTTA 3TIEB 1A6VH 3ZYZA 2RIKA 4YHPB 3C6SB 5DK3A 4WU5B 3X12A 1MCFA 2YZ8A 3V5KB 1T4KA 2C3WA 3MO1A 1P7KB 4JHBA 3TT3H 5HVFB 2ESVD 1NCDL 4KRPC 3P4MA 3SE4A 1B3JA 4QTHB 1IEBA 4OLVH 2DM7A 2AI0H 5JOEA 5I1JL 5CEYB 3T4YB 4ZDHA 1YPZA 2VN7A 3B3IA 2YD7A 2W07A 3MOBL 1SY6A 2V5RA 2BSSB 4UNUA 4Z5RA 4MA7L 2F54B 3OXRA 1HEZB 1MCNA 1U8MB 1PKOA 4ZQKB 3AROA 3A6BL 1S7UA 4WGWB 3T65A 3RVWC 3L95A 4Y2DC 2XA3A 4WHTA 3K2MC 4D9LL 1Y0LB 3RZCD 4BSVA 3LS5L 3IFLL 1KPUB 4FTVD 1IGMH 3U4BL 2AV7B 3RU8H 4XZUB 2ADJA 1HH6B 43CAB 5LCVL 3I6GA 1DN0A 1FN4A 1RVFL 2DJ4A 1UJTA 1UWXK 3HRZB 5J6GA 4JB9H 3OAYK 4B53A 2A9ML 1HNGA 1WFNA 4WFHE 1KSRA 2EO9A 3D2UD 1HXYB 3MLWH 4A2MA 4QTIL 3C8KA 3DIFA 3VFSA 3RNQB 4PJ8C 3UPAA 1CI5A 3ZKND 1KN2L 3QUZC 5D9SA 1F4WL 3QEGL 3CDCA 2VL4A 5IMKA 3V6FB 1ZK9A 2OZ4H 1HHHA 3RI5K 5BZDB 5JIPA 4JDZA 4G8IB 3STZB 4ORGB 4WFEE 5DGQA 3M17A 2DQCH 1XGUB 3TO2B 3DECA 2NY0C 4UILH 1KN4H 4M7ZC 4UBDD 4GRMA 5MP6H 2QQKL 5DWUL 2BERA 2XKUA 1KGCD 1J18A 4X9GA 3H42H 3VMOA 5EO9A 5C8JB 5I6XC 3NH7L 2B2XH 3QH3B 3HR5B 2E3VA 1ZT4A 4JFQB 1OAQH 2Z4QA 1F58L 3L6FB 1G7HA 5MENA 1E27B 2DJUA 4DOHE 2J2ZA 1KYOK 3FQXA 4AG4H 3U4AA 4BJLA 3RVTD 6CGTA 1W8NA 5TQ2L 5INCA 5CD3B 2JCCE 3MREA 1FV1B 1K4DB 3ZDXE 1MI5E 3FQUB 4OZGF 3VGDA 2QL1A 1BFTA 4LPYA 1UVQA 4M8QA 1LDPL 1I8MB 4I48A 3PHSA 3FQNB 2ZPKH 2Q87A 4K94C 3EYQD 1IM9B 4U1SB 5EU6B 5HVGB 3P4NA 5BS0E 3I2CH 2R2BA 4QRPA 1GVIA 1JL8A 5D7JD 3BH8B 3SN6N 3UJJH 2YA0A 3P0VH 2X9XA 3OJ2C 2KPNA 4GAJH 3VCLA 4J3VA 2EKSA 5AG9A 4Y5VC 1J1XL 1OGAE 1C7TA 1D5XA 2A1WH 1ZLVK 1NAKL 4JKLA 4M9PA 2ARJB 3OJDB 3QIUA 4G8GB 4X6FA 5D7JB 2CR6A 3OX8B 4LSQH 4XMKL 3W0WE 3WHE0 3NIGE 5H2BB 5E1AB 5I2IB 5EZLB 3I6LD 3EHBC 2BNRB 4NDMA 5T3ZH 2B1AL 2R69L 4HT1L 2AEPL 2ZUWA 1SVCP 1ZANL 1FO0L 2W0KA 3K81A 4KRMB 4BQCA 4M7KH 5DMGC 1DBJH 4HC1A 4HKJA 1KOAA 3HPLB 3WFDH 4LCWB 1KG0A 2X2YA 3CDGB 4NM8L 1IAOA 3VU2A 2SEBA 4XPFL 2R4RL 1NKOA 4U6VH 3V5DA 3WYRA 4PJBB 2DBJA 2OL3L 1BQHG 4KK8D 2YPVL 3TCXA 3QULA 2MNUA 3OQ3B 2FZ3A 3NZ8B 3TBVA 1S7RA 4X8XA 3U36B 2W1NA 1IEAB 4G9FB 3QHTC 2IFFL 1U8NB 2OK0H 1GL4B 1CGXA 3DETC 3QT2A 4UNTA 4KMTH 4Y19E 2MQ0A 3ILPB 3MRLB 4L5FL 4MXVE 2NXYC 4JCMA 1IGYB 2PN5A 4Q58C 4NQXA 3VGGA 3ARGD 1EJOL 4ONHB 5BXFA 3CC5B 2EDJA 4MAYD 4Y4KB 2DI7A 4QRTA 5C6PB 1QOKA 1AKJB 1JTTA 5D1ZA 1TZHB 1A0QH 5JDSA 3OKOB 3IFOA 5I19H 3FMGL 1HXMB 1WFOA 4AIOA 1YN6A 4QO1A 4YBQC 3A67L 3KPQB 1AGCB 3BKCL 2R0ZH 3T0EA 4K23H 3D18B 1BPVA 3UJTL 3TJHD 4X98A 5GISH 5K59E 4Q2ZA 4MAYB 1X5IA 3O4LB 5JIIA 1QBAA 4NO0A 1LEIB 5I8CB 4O2FB 5E2TL 4K07A 3EYFB 4Z0BH 4PGCA 5EO0A 2JCCA 5DEZA 3SE9H 1XMWA 5DJDA 3U83A 4MJ6B 3ULVD 3IU3B 2EDXA 3T0WA 2I9TB 2DLFL 3NMEA 4KQ4L 1TETH 3ZT6A 4O5LL 4EUPB 3LD8C 4EDWH 5L8KB 1MCWM 2BCKB 3QFJB 4MCZA 3DRTA 3MRHA 5JPNB 4LDEB 1G6RL 5FM8A 5CAYB 3CPLB 3TO4D 4KVCL 5BS0A 4F7MA 5L9DL 1SYSA 3IJYA 2O5XL 3QO0A 1F00I 2YMXH 5DJZB 2X4PB 1BIIA 4GAYB 4N8CH 5LXGH 4JY6A 4P3CL 3QHZL 5DJ0A 1SJEA 1C8PA 3IS0X 3TYGH 4JVPA 4NFBA 3UAJD 4ZPVB 3TO4B 2IANB 1OGAA 5IEHB 1NGPL 5B38B 1EVUA 2EDRA 2HT3D 4S1RH 3HNSL 2A73A 4ZUVB 5ADPL 3LQAC 1KCRH 1KJMB 3W0WA 4KPHH 1BREA 3S3JA 5A2IH 1XT5A 4JJHA 5H37G 1F8TH 2GJ6D 4NZTL 4L4TE 4LGRB 4F37K 3AREA 5CSGA 3G6DH 1L6XA 4Z76A 1UCBL 1NCBH 3U0PA 5L7XL 4X0KB 2O5YH 3ME0A 4XX1E 4YWGL 2R9HD 4ZFOA 2OL3B 5FO7B 3PIQB 3GSWB 2O61B 2GCYA 4MA8L 3B5HA 1A7OL 5HYQA 4IIQC 4LBEB 1A3RH 4IS6B 3KPSD 4PJ9D 2IAMA 3CFJA 2PYFA 1V3MA 5F96L 3L5WA 3ORJA 4K8RH 5DUPH 4JO1H 2XZCL 2AXJA 2YWZA 3ARBC 4K3HA 1F3JA 1MHPH 4G3YL 4LLUB 3TVMC 1UM4L 2YZ1A 3BPLC 2IPTH 4QGYA 4I3GA 1I85A 1WUNT 8FABA 3IGAA 1ZVYA 2D7MA 2OMNA 1UJ3A 2A74A 4NZRH 4DK3A 5DMJB 1M6OB 3D3VE 1ERNA 4XNUH 1JI2A 2EH8L 3BQUC 4KKBD 4CVWA 1JNHA 32C2A 1AR1C 3LRSB 3LKNA 1EXUB 4JRYA 1A6WL 2OJEB 3DYOA 2GUOA 3RGHA 3D1MC 5HYFA 1I7ZA 3B2VH 4DZBA 3GMMA 3U6RA 4X6DE 2Z93B 3FB8A 4JM4H 4LSSH 4XWGL 5C0BB 3NIFF 4DEPC 3FONA 2FIKA 4PJBF 3ZE1E 3X11B 2PCPA 3MFFA 1X5KA 3SKJL 5JA9A 4FQXA 4ZFFB 4P5TA 5D7LB 1N7ML 1S7XA 1JNLL 2PTTB 4PV8B 2XQBL 1WAAE 4OFVA 3EYUH 5E4EC 3LDBC 4OD3H 2VABB 5JW4N 1U8PA 4LF3A 5D1XA 4S0SD 1PYWB 4OLXH 5E24E 4LLWA 4YGVA 5D93B 5BZWA 1H9VA 4S1DC 5DC0A 3PWJA 4CVUA 2G60H 1KIPB 2R0LL 3SDDC 1A64A 1V7MH 2H45A 3QDGB 3S3PA 1S9VB 4RWYH 1SJVA 1S9XA 3OPZH 4LSVL 1FE8H 3MLZH 3DBXA 4ZOAA 2WINB 2ADGA 5C0NC 4H26B 4HKBA 2WBJB 3TCLB 1OAYH 2YBRB 4FN0A 4ETYA 3MRKA 3TYFB 2CLZA 1R5IA 1Q9WA 4UINL 1FDLH 2FH6A 1A14H 1RY7B 3RIFK 5IKCA 1SM3H 2IBZX 1A7RH 4Y4FC 5KSAA 4GKZA 4DFHA 5KVDH 4EOWH 4L4TA 4PJFF 1N64H 2D7QA 1NGYB 3R0MA 5CEXB 1P2CB 1BM3L 4J3SA 3LCYA 2DQEH 3B83A 2OR8A 2JE8A 5C09E 3FO2A 2Q8BH 5C0RH 2ITDB 4LSPH 1NFIA 3OAZH 3PWLA 3GRWA 1F4XH 3QB7C 2I07B 2XKNB 3RVXD 3MRQB 4FQ2L 3BAEH 3GMQA 4DJMA 4YE4H 2DBLL 1WBYB 1JIBA 2PXYD 4NC1C 5C07E 3UP1A 1BD2B 5FYKE 4EQ2A 2NNAA 3H2WA 2WM0A 4O02H 4EIZC 5KN5B 3Q5YA 2NW3B 3IDXH 4N0CC 5EA0H 4QT5B 2DAVA 3ABZA 3B9KA 4NOFA 2DQDH 4PJDA 5IHLB 4E41D 2OQJA 4R2GD 2I5YL 3FJTA 4HW6A 5CJQL 3D3VA 5C08B 1MEXL 3N1GC 3UBXG 2PXYB 4MSWB 4QYOB 1QYGL 2EXWC 1T1ZA 1O5DT 3G5YA 1U8QA 5FOBB 4JAMB 2BMKA 4L8CB 3MMEB 4XCYB 2A0LD 5CINH 3W9EB 4KMLB 3CU1A 3QI9A 3L3JA 3X3GL 4JHWH 1IKNC 4U0RC 4H5SB 2UYLA 4NQCB 2H3NB 3QAZB 1U93A 3PV6B 4RMWA 4X6DA 2Z91B 1Q9LB 1PX3A 1T5WB 2WZPD 4KJYA 4WIQA 5D7SL 1U41A 1CT8A 4U6XA 4HLZG 1VGKA 5CHNA 1FZJA 2X4QA 1N8ZB 1BWWA 1B4RA 3EW3B 5HHOB 1ZGLM 2AXGA 4O4YH 2YD1A 1F11A 3GDBA 1U2HA 1B9ZA 1U6AH 1H15A 1BP3B 4HS6B 1WAAA 1KB5A 3MXWH 2DLHA 3IF1B 4UIMB 5C0CD 2ATKB 3KWWA 1EHXA 1PG7H 1YYLH 5L2JA 2DQFB 3FL7A 1CBVH 4TTDD 2CGRH 4P3DA 4YO0A 4RISL 4IBLT 1CTNA 2IPKA 1P7QB 1NGZB 3LMJH 5ALBL 1FL3A 5J1SC 4OTXH 5IB1A 2ZP0T 5I71B 5I1IL 1VGEH 2FJHB 4BQ8A 2P42B 2HFEA 2ADIA 1DE4B 1IGIH 3UYOD 1JZ6A 3L1OH 3HC4L 4R4BA 5SX4I 2HKFH 1UWEL 5A16B 2DQCL 3BGAA 3UEZA 2DWDB 1FJ1B 4AEFA 1KCKA 4UILL 3O8XD 2BVUA 4NT6A 1E28A 4KZDH 4RFNC 5MP6L 1NL0H 2V2WB 1KT2B 3DVNB 3LKOA 3X13A 2RHEA 1OHQA 4I9WD 3MJGX 4Z0XA 4O51B 1N59A 2D03H 3VXNB 3QZWB 4WDIA 3REVB 2B2XL 1J0ZA 1AXIB 3VH8A 1CFVH 3SQBA 3HLAB 5HGAA 1A22B 2Z9TA 1HINH 3BEVB 4NRXA 3KJ4C 4PBXA 1ZOXA 4OSUH 4AG4L 5B39B 5C09A 4LRIC 5DVNA 3QIBA 3WV0A 3UZVB 1O0VA 4XBEH 3CVHB 3GSRA 3SJVE 1I1RA 1I9JL 3E6HB 1R5VA 5EU5B 3IAGC 1JUFB 3BPOB 4JFFE 5C6WH 5HY9A 2F19H 5C07A 4ZSOB 4GUPA 3WIHH 4P2CG 3K7UA 4Q9CA 4LCCC 3HG1B 3IXAB 3SPVA 1QSFD 3MUGA 5CP7A 2XY1A 5IFAL 1DDHB 4W6YB 3KHQA 3TBTB 3SEPA 5EU3B 5DD5L 4Q6YA 5I1CL 1G7PB 4DTGH 5I8KH 4UT6L 1JZ2A 1CFQB 2H1PH 2YRPA 1B88A 4YHOH 4F8TA 5CGYD 1MHCA 4BZ1L 1SBBA 4JKPH 4OV6F 4N8VB 3VWKA 5C0FA 4NWUH 2A6IA 1CE6A 1A02N 4U4BA 1HHGA 5FGBC 1UEMA 5IOPB 3MJ9L 5C0IB 3RZCC 2A1WL 3MLUH 4X80H 3WUWB 4EIGB 4HPYL 1CLOH 1INEH 1QBLH 4FQPA 4ZXBD 2XN9D 3RI5F 3VFNA 5HYSB 2XYCA 3RPIA 3T4AA 1MCKA 2VUYA 4UTBL 4HAFA 1FL6A 5DC4B 4I4WB 4OFYA 1C5DA 3H9HB 1N5YL 4WTZA 4X7EC 3WFDL 4KY1H 2ZOKA 4WI7A 2FSEB 3DGCR 3FB5A 2W65A 3KPNB 4KDWA 3VXUD 1RD6A 2H9GA 3C60B 3IDNA 5HHPB 1U8LB 1HIMH 1QVOB 1K8DA 2A77H 4P9HH 1GGIH 5LAXB 5GGRY 3F7VB 4N0YH 1YY9D 3V0VB 1TFHA 3RWGB 3WL9B 1IZKA 1RUPH 3INUH 4NQSA 3ZE0E 1P84K 2BVPB 2BVQB 1MIML 1K9TA 5CUSL 1ZS8B 3BE1L 3KPLB 3MV7D 2VXQH 2QSQA 4NNYB 1S78C 3U7YH 2QQQA 2W91A 4AQ1B 4ELKB 4U1IA 1MAML 1TZIA 3ROOA 3HZKB 3ROLB 2DIBA 3TV3H 1DQDH 3NCJH 5AZ2H 4HGKC 4DN3H 1GZQB 3G6AA 3RWIB 2LU3A 2QSVA 3Q6GH 4L3EE 4Z7OF 4PJAA 1AD0A 4LLMA 4MLSA 1MRFL 4J3WA 4FP8L 1P9MC 2Y7QA 4WUKH 1RU9H 4I8DA 1BHGA 1CR9L 3RVTC 4JO2L 4JFYA 3KPPB 1WIUA 3BP7B 1JWSA 3SGDI 3PWVB 4KJPC 2D3VA 3C5SA 5L88L 2EYTA 5I19L 1B2WL 1JWUA 4MNQE 4QXUH 4HIIA 4L1HA 4XPHH 3H0TA 4GKSA 4JLRA 5IQ9B 1BAFH 3N85L 2HFGH 3MROB 1WV7T 5AZEL 1PLGH 2FLRT 1H0DA 2DQTL 1F3DJ 4YDIH 1B0WA 1MFCH 5FV2A 3DTXB 1A9BA 3ZTJG 3V95A 4PRBA 3CCHA 1EEZB 1A6UL 4UAOC 2Q86B 3SE9L 3SJVA 2XTJD 5D7JC 3HHRB 4LOUD 3TNNA 3MCKB 5CMAA 4FG6C 2CIKA 4LHUG 1DBKL 1IGJB 1ZTXL 1HK6A 4JFFA 5CJBA 2LAAA 4A6YA 4WWID 4Z7NF 4NO2B 1VEOA 1L6ZA 1QP1A 2P5WE 4PJ8A 4NPYA 3RUGE 4BA8A 3QUZA 3ARZA 4X4ME 3UCRA 8CGTA 4ODWB 4ESKA 1RFDH 2NQCA 2QQNH 3HE6B 4H0IA 4BQBA 3LKSA 1OW0C 3FN0H 4POUB 2AVGA 4X5XA 3N06B 1ND0A 2YPKA 1YMMB 2P46B 2YMXL 1FFOB 2KUTA 5HDQL 1A3LH 2F58H 4NGHH 1YDPA 3RNKA 2CDGB 4JQIH 4YEEA 3QDMD 3CK0L 3QEHA 1CD9B 4PRHD 4LPWA 4ZOBA 2W60A 5E6ZA 2NX5E 3VXOB 1PZUB 3UXFA 5D1QD 3ARFB 4N8VG 1MH5A 4UDUB 1RJLA 4OQTL 4P2RE 4PRNB 1WC7A 4HXAL 1OP5H 1S9WB 2APFA 5E2WL 1RUAH 1F8TL 1I4FA 3N50A 3WUWG 5T3XE 3O6MH 2DDQL 5KVGL 1JPGA 3G6DL 1N4XH 4TQEL 3TJEH 3B4NA 3MLYH 4Y4KC 4F33A 1CICA 3K2UL 4IRSD 4HFWA 3GGWB 2DL2A 3FOLB 2WANA 3FFCD 1FL5B 1IC4L 3L5JA 4MD0A 4Q9BA 2JK5B 5EZIL 5IMOA 5GS0C 1HH9B 3EDFA 2EDBA 2WUBL 3ELAT 1AGDA 4NBYB 4PRDB 1VADB 3IXTA 3ARGC 2XNAB 3RWJB 3Q48A 4TUJA 2R29H 4XRCA 1NGXB 3AC0A 4MAYC 5GS1B 4IRSB 2UY7A 4MNHA 4M1DL 5FV1L 4FQ1H 1YEHH 3UTSB 3T8XB 5IB4A 2ICWI 2HKHL 5ECJE 4HG4K 2VERN 4Z78A 4MD4B 1HYRC 4NZJA 4OB5L 2RR3A 2F5AL 4L3EA 4HJ0D 1BVZA 2ZSWA 3DSFH 2P8PA 3BIBX 2EDNA 4LVHC 4U1NB 3EOBA 1I8IA 1JHKH 2PTVA 3BO8B 4U1LA 5KANI 3VXQA 3C9NA 5IB3A 1OSZB 5A2KH 3MCG1 3SCMB 1RZJC 2HT4C 4Y1AD 4MNQA 4KMQA 5GIRA 3OG6B 5FUZL 4AIXA 1QPPA 3BRFA 4QF1B 1QD0A 4JQVC 2QLVB 3Q3GB 1NEZA 1IGCL 1KYOJ 4GW5A 2MKLC 3TO4C 4U3CA 4EI6A 1RZIA 3KPMB 5F3BA 1RI8A 3CFKA 3EO1A 4FFWD 2XPGB 1R3HA 4LNRA 3G6JB 2VR9A 1F6LL 4XVJH 4D9QD 1IQWL 3CX2A 5BOZG 1FYTB 4QWWD 4E5XA 2P5WA 1OPGL 4I2XE 4OLXL 4F37F 5C2UB 5CSZA 3RUGA 1T3FA 4WW2A 1C12B 4X4MA 4XPGL 1N5AB 3L3KB 5MEQB 1T20A 1W72A 3MRJA 4NC2B 1RIVH 2E7CA 5KSUB 4PREA 3GSVA 3UDWC 2JJTC 1TPXC 3RWFA 2HT2C 3DVFA 5JHDD 3QWOB 3Q0HA 3MRNA 5JHLH 1BOYA 1QLFB 5DD6A 5DQ9B 4PB9H 1XF3B 4RRPA 1CQYA 4Z7WB 2EDDA 1OAUH 1G7MB 1FE8L 4XNMB 1SQ2N 3WS3B 5FGRA 2P5EB 1JGLL 2NX5A 2NY3D 2DB8A 1X5ZA 3HAEA 2HJKA 1J8HE 3MUHL 3GSNH 2R15A 5D6CA 1BJMA 1FVEA 3SKNB 1A5FL 4BYHA 4I3SL 4HEME 4P2RA 2VSDA 3IDJA 3HC3H 3TBYA 1Q9OB 4PTTB 1JJUA 1S7TB 4RSVA 1X5XA 4K8RD 4ZUUA 3V9FA 4PJ9C 5E8NA 1S5IL 1S8DA 4P23B 1XEDA 4UIKL 3UYRH 5J57B 4RNRA 5AYUH 4WI4A 2FRGP 5DHVH 1LO3H 4NKQB 2VL5B 1XZ0A 1YNKL 2WIIB 1UM5H 2ZKHL 3KYMB 4HDIB 5ACZA 1M05A 2Q7NA 5JXEC 3S96B 2J8HA 4MDJB 5KBNC 1JFQH 4YK4C 4HLJA 4KKBC 1Y6NR 2FJFA 3MRFA 2FHCA 1BOGA 5BV7L 4LQ1A 5B22A 1CXLA 3OAUH 5E2UL 3QQ3A 1OVZA 3WIFB 1W8OA 5E9DD 5IMMA 2GTZA 1UACL 1GC1L 5GGVH 3MBEB 1JGEA 4RGOH 3ZLQC 2VISB 4J3TA 3W2DL 4HIJB 3CX5K 2J6EA 5E6IB 5HDLA 4NRZA 3V2AR 3I3BA 5D93C 3GKZA 3UBXI 3EDDA 4YAQA 4M1CD 5E9DB 5I1AA 3MRCB 2VDQH 4YHNA 3F7RA 4XAKD 5CEZH 2AEQH 1A1OA 4WRLA 2P7TA 3QCVL 2LU4A 5I1DA 5F1IB 4DK6A 3CFDA 5FHAL 1EHAA 3BGMB 5DQJA 3GRWH 1CE1H 2NY7L 1PZ5B 1QNZL 2E7MA 2X4RB 4IJ3C 3BN3B 5ANMB 3VXSD 3WSQL 2AJSL 1AQKH 1WWWX 3G08A 4MQ7B 5H94B 1HQ4A 3KDMB 4QRSB 5KJRL 4R3SB 4PJ5B 4NC1E 5CCKH 3EFDL 5FYJL 3ECBA 2WWMD 1KTDA 2WV3A 1OP5K 5BOPA 3OR6B 1D5BB 4QCIA 4JDTH 2DMBA 43C9A 3ARBA 5B8CB 4B7IA 3S5LA 2XTLA 1YYLL 1CK0L 2NY6D 2J4WH 4I2XA 3TVMA 1MWAH 3RBGA 1FCGA 1XIWD 3OKMB 5EBMB 5I9QB 1UM6H 2NY4B 3O2DA 3LMJL 4WW1A 5GS2H 3E6FB 3BQUA 4OTXL 1G7LB 1KJVA 1N6QH 4LAQH 4KDTC 4LPXA 2R1YA 1JPTH 4CVXA 4BH7B 1V7NL 4HS3A 4X7DC 4KGLA 3F7YA 3TESA 3TFKC 2YRZA 1A4JA 1DBMH 1BBDH 2XZQH 4XVSL 4WEMB 3V7AE 3ETBF 1RK1B 2E8YA 1SMOA 4RGNB 4PJXA 3SDAB 1QSVA 3IFPB 1D5MB 3BJ91 4WNQA 1SY6L 2HKFL 2YSSA 3G5VB 1P4IH 1LP9E 1WBXB 1J8HA 1ZHKB 4KZDL 5CLWA 3D0LA 1NL0L 2VDLH 2ICEA 1MCCA 4ZO9A 2XWBA 2BOBA 1QHOA 5HYJD 4OLEA 1W0VA 4F15B 1XGYL 2D03L 5J9PB 2VLKB 3BX7C 5B3JF 4BZ2L 2AERT 2PXYC 1CIUA 1U8IA 5ACLA 5I76B 3G6JF 4D0CA 4KWUA 5BCAA 3PL6D 1HOCA 5KG9A 3OKLA 5DFVD 1RZ8B 3OL2A 4MDIB 1WZLA 4JM2B 3O6FB 4XBEL 4GG6A 3T1WA 4XCNA 3HC0B 3QAZC 4R2GC 1Z3GH 3V5HB 4C56B 4XAWH 1X5JA 4RX4D 2HVJB 3VD4A 1D9KB 4ZS7H 2J3SA 3QNZB 3D39B 4N0RA 1WFTA 4E9LA 3SDDA 3K74B 4N1EA 4XPTL 2E9IA 1JPSL 4I13B 2XWTB 3PL6B 3GMLA 4PGDA 4Z7WF 4DGYL 5K9JH 4PG2C 4GKNA 1ZLWH 4NQVB 4BSWB 1U58B 3KXFE 1NMCB 5HI4D 5L0QB 4NBZB 2H2SD 4H8WH 5LQBH 5HD8C 3OR7A 3MJ6A 2R0WL 3HCVA 2BJMH 4YC2B 5GRJL 3JWDH 5L2KE 2PYED 5GRXG 3HNVH 1TVBB 2ZOLA 3PHQB 5IESH 4HWUA 4NRYB 4HUWB 3WKML 1HILB 5DD1L 4Y4FA 3L3HB 1II4E 4JR9H 1SEBA 1E4XL 2GYSA 3T0XA 5I71C 1TVDA 3LKQA 2LTQC 4NQEB 4UUJA 5GJSH 5ESVA 3R06A 2AK4D 1R24A 4IOIA 4TTDC 3OXSB 1H5BB 4G5ZH 4L4VB 5ICXA 2ERJB 5SWSB 1MRDL 4P9MH 2H32A 4YDJB 3VG0L 3G5ZA 1YEFH 4OCRH 1EA9C 1CF8H 1PFCA 4KQ3L 4AK1A 2F54E 5KZCB 4V2CB 3GSUA 3MCLH 2K3TA 3X12B 3MGTB 4YQXH 3DJ9A 4N0YL 2ESVE 2EYSB 1RUPL 4PRAA 2FX8L 2H26B 4G6JL 4F7EA 1NCAH 3P4MB 4H25B 2VZ3A 3V4PL 1IEBB 4WFFD 2IG2L 2GHWB 1K85A 4B50A 3EYSL 1KFAL 5HXMA 4YHKL 5HHQA 4N0UB 4EN3D 3S34L 2EO1A 2VAJA 4DN3L 4Z5RB 2Z31D 2IWGA 3BPOC 3OXRB 4Y88A 3VFWB 1GRWA 4NWTL 4MVBC 1IKNA 5I1HH 3VRIA 1YNTA 3T65B 3L95B 4ELMF 5MEOA 2JIXA 4D2NA 1BZ7A 1X4XA 2DTMH 4M6ML 1LP9A 1J1OH 4RWHA 5IEKA 4WUKL 2Q7YB 4Q97A 4HC1L 2MKWA 2R56L 5FK9B 3A0OA 1FN4B 1CLYH 5HHNA 5J6GB 1GIGH 1QHPA 4OV5A 3MUJA 1BAFL 3U46A 4M8VA 3KLAB 1XGPB 4HV8A 3FT4A 3C8KB 1KXQE 3K0WA 4KRNA 4C54A 4ZS6D 4J8RB 3GK8L 3FO0H 3O41A 5D9SB 3T2QA 4FQJH 5M95B 3ULSA 4H0HB 5IMKB 4JFZL 3ALXA 4U2YA 1MVUA 4HHAB 4PIRF 2VLME 1HHHB 4YFLI 1B0GA 2CIIB 5CGYC 1AO7D 1U92A 5C0GA 4L9LA 3PV7A 5IW3A 4NZUH 4TSBH 4AMKH 4ZD3L 3LQZA 4GRMB 4HKZA 3RY5A 1A7NH 5GZNC 3EKCA 1RZKL 3SKOA 4K9EH 2RAMA 3KXFA 1S7SA 1XF5A 1U8OA 5FEBA 1JHTB 1MY5A 4JVUA 4PRIA 1LO4L 3VDBA 4HUXB 4NGHL 1GZPB 2Z4QB 4TRPL 3MUZ1 5EU6E 4S1SL 1YYMH 1A1NA 5MENB 1DQJA 1KXTB 5L2KA 4OF7A 5D5MB 3FQXB 5K9KA 3F5WA 3L3OB 2WLZA 4IMKC 2MTPA 1IT9L 2PW1B 4M03A 5C0DA 4JPWL 5D8JL 4JFED 3C6SA 2C7UA 5DEFB 4JM2F 3U30B 4P5MB 4OAWB 2VXVL 1P7KA 3L3GB 1NFDA 1MFAH 3S6CA 1RUAL 1UVQB 1IC5H 1Q0YH 4JFXB 4LRIA 2YPLB 3TIDA 4BKLA 3O6ML 1EBAA 4G8GE 4QTHA 1R5WB 3P4NB 2R2BB 3T4YA 3MLYL 3THML 2W9DL 4NO5A 1JP5A 4YIQB 4HF5H 2C3GA 5JXAL 2BNRE 2BSSA 2Z8RA 1J12A 2F54A 4LCCA 1RUML 4G6KH 4HWNA 2CK0H 4CBPA 1RULL 2ESVA 3O3BA 4LCWE 2EKSB 4JPVH 1Y0LA 3MBXH 4KRLB 2C1OA 3FHAA 2C26A 1D5XB 2AV7A 4NQDD 2EZ0C 2CO7B 1HH6A 4PJBE 4NUGH 1OTSD 4F58L 3NFSL 4PY8J 3MSPA 3BZEB 4NDMB 4GFTB 4QOKD 3B6SA 2FHFA 4JZJC 5CLTA 1HXYA 2VH5L 1UCTA 4WEUD 4I0PD 3RZCA 4G9FE 4HEPG 2OR9H 3RNQA 5GRUL 1LNUA 4KAQL 3HI5H 1KG0B 5IBUB 1ZLWK 1KCSH 2EH7L 3BKML 3BDYL 1BQSA 3HE6C 4RAUB 3EJYC 5BZDA 1FG2B 4G8IA 4LOUC 1VEPA 5H35B 4ORGA 4IDLA 5DJ8B 4ZFOL 1TZGH 3TO2A 2CR3A 4I0C