4PYAA

Moac k51a in complex with 3',8-ch2gtp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'ETVREARAEAFVTMRSETLAMIIDGRHHAGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein MoaC
molecule tags Translation
source organism Escherichia coli k-12
publication title Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
pubmed doi rcsb
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4pyaA00
1EKSA 3JQKA 4PYAA 4PYDA 2IIHA 3JQJA 1EKRA 2OHDA 3JQMA 2IDEA 2EKNA 2EEYA 4FDFA
chains in the Genus database with same CATH superfamily
3L09A 1RAEB 2LYVA 4B3RJ 3NOCA 2J9CA 2RF2B 2HHXA 5ETTA 3QFHA 2O66A 4WU2A 5K20B 3ELHA 2RRAA 1CJKA 3HXMA 2OIHA 4KJIA 3BPSP 1OO0B 4ZHRB 3D1HA 1M90T 3QRQA 2DY1A 2G9OA 2DGTA 3HX9A 4WTYA 1VI7A 2XMAA 1VBXA 3TR5A 2R7XA 3R7BB 4NLDA 3OJUA 4XPEA 1X0PA 4PR6A 2UVRA 2QG9B 1NBEB 2MQNA 2UUCF 2F1FA 4WPAA 3DLGB 4DUTA 3FCWA 5AXMA 3UPFA 5DDRC 3GV8B 3DU5A 2FJVA 5BR8F 4AUKA 4TNOA 3A12A 1JLBA 5HP1B 1H2VZ 2CRLA 2DEIA 3B82A 3RUBL 3GR0A 2ZOGA 2CUYA 2GJFA 1RAOA 1V9OA 2ACYA 2CQDA 2DTJA 4V19X 2Z8QA 3IWNC 2AJFE 2QE5A 4DS4A 2HQFA 2EFPA 4X66J 1YJ9S 2NLWA 3CD0A 2VHGA 4CLFA 4OL8A 3OV7A 3C14A 3OR1B 2MSSA 1WG4A 3CJKA 2NUUG 3HFKA 4LF4F 1YBUA 2PSZA 2HVEA 1FFGB 1O5JA 2J7UA 4Q43A 4Z7CA 2HLTA 1WC6A 1HWUA 3VCDA 3MFHA 2J7KA 5HROB 3W8GA 7FDRA 4DSKA 2QYGA 5CYQA 4U7UK 1VIOA 2F5GA 1PAEX 2I1RA 2Q1LA 2ZNZA 4HLBA 3VTIA 4ZLLA 2I6WA 3K2YA 1W26A 2NSCA 4DU8A 4KHRA 2CQ2A 4JV2A 2I8EA 2BQUA 2PEBA 1FT8A 2BJ7A 4P74A 3GLJA 3R1HA 4NXMJ 1D3WA 2OFHX 4NLXA 4ED0A 1U6FA 2ZEJA 1IR1A 1NU4A 2ZUGA 2YKAA 4F0HA 1QVFR 2NR0A 2B4UA 4PABA 2P9CA 2ASDA 2B9EA 4ZCIA 1JLGB 3C6UB 3GB0A 2R7SA 5A6PA 4QIVA 4U7CA 4FS2A 4JI7F 2H4YB 3FMWA 5KFLA 1ZZNA 1KQSR 2C3YA 2MKCA 3RRHA 1V3SA 2N3LA 2YVSA 5A6WA 3TYTA 2PI4A 2W4PA 4J90A 3KLFB 2YH0A 3GJTB 3M30B 2VJUA 3R5CA 1WTBA 2KTQA 4DV6J 4RW4B 4JI5F 4OZJA 4YOEA 3L9ZA 5KG6A 1UKUA 2HNDB 2HZCA 2IM0A 3JB9k 1ZA2B 4NXNF 3DGVA 2KM8B 5C25A 4J9VA 2PDAA 4KQZA 2LEPA 3RAMA 2CJ9A 2DNGA 2K06A 2VPYB 8AT1B 5LMNJ 2JSXA 2KXFA 1J2VA 4ZJLA 2QIFA 2WAQD 1HL6A 3C66A 1DTTB 2E5GA 3F44A 4OI3A 5JJBA 3BSOA 5KFUA 4GC7A 1T9WA 1N56A 5J2QB 2CPEA 1FESA 4LRDA 2CDRB 2MHEA 4QYRA 3NS7B 3TX8A 5F8HA 5DDPC 2CQ3A 3CCES 2H1YA 1C1CA 3MPUB 3J7YI 2F7VA 4Y28C 4B3TF 2HIQA 5KFXA 1LV5A 3L95X 1KHWA 1VK8A 3VAKA 5LXRA 4LF8J 2BRLA 1RSCA 1S1UB 4KY3A 1QY7A 3KLGB 3CJ2A 5DM7Q 3GG0A 4K4VA 3LH2S 1S1VA 1TKTA 2F63A 1DJ0A 2D1CA 4IKAA 4EUVA 1SV5A 2VQEF 4DV3F 4ZVPB 2ZDOA 3DMJA 3MCNA 3SCJE 1SQFA 3KK1B 4JI4J 1G2EA 3SSRA 3H2VE 2NXEA 1RAHB 4DHVA 1TK5A 1Q81T 4MK8A 5DS7A 1HR0F 2QEXS 4MTPA 5D4PA 4F0MA 2E5LF 1WSRA 1FJ7A 5CCMA 5HK4A 1NDPA 2EC0A 2E66A 4ZCMA 4ER8A 1U1NA 1RAFB 1NK6A 4ZP9A 5HMXA 2COLA 4ZJQA 2HS3A 2O3DA 3W5ZA 3C14B 1SJ4P 2CJQA 2M52A 4HT7A 1IBKJ 4KT0C 1T0TV 1N32J 1WKLA 3NEKA 3MEEB 2IDEA 3LPYA 1BHNA 2CKWA 1TK8A 1URRA 4ZA1A 2DGSA 4OJHA 1WEXA 3N79A 4K4TA 1XC9A 2D3ZA 3IBWA 2B5JA 4QWEA 3OL8A 3TARA 2B5JB 4NLUA 1HWIA 1UA1A 3CJQA 4B9SA 4X62J 1U45A 3PW0A 2Q6BA 3E51A 4TQRA 2JC0A 1WC3A 2CDQA 2FQQB 4FYXB 4OX7A 3OR2B 5KG2A 2FLOA 4F4WA 2RS2A 1QUPA 2PI5A 2UXCJ 5GAGI 3EWGA 4BC9A 3GQCA 4EZ6A 3QFWA 3T19A 2VA2A 4PRFA 2ZH4A 3A8IA 3RU0A 2XZDB 1FTRA 2UUWA 2ZVSA 4I0WA 2M88A 5GMKa 2CQPA 1NO8A 2XS2A 4TKTA 7FD1A 2FVCA 3RR8A 1FDAA 2C3UA 1XK8A 3C19A 3QAEA 2EFQA 3AJDA 3SCLE 4YUDA 3ILIA 3K89A 1LWFA 5L1IA 4GKJF 2Y1LB 1XMQJ 2KJVA 3CD5A 2WW4A 3CW2C 4RUBA 4O3NA 2EBEA 1WELA 1NJZA 4ZN1A 2DHXA 2YX1A 3BGLA 2AX0A 3T5KA 5ETRA 3HSZA 2JEIA 2CQ4A 1L3UA 1WC4A 1X60A 4MIAA 3PYGA 4UOCA 1YZ6A 2BACA 3US5A 2OPRB 5CQGA 4N7TA 4NA1A 1H0HB 2V2ZA 2B3TB 4PXDA 4ZIWA 2J6SA 2UUBF 4ZVHA 4OZLA 2CYYA 4Y3CA 2MKKA 1M5HA 1NSAA 1M5OC 5SZTA 2HK3A 3AHPA 4D3GA 3LWLA 3V6DA 4B3SF 2QL7B 1MSWD 8ATCB 3M4XA 1GTEA 1U47A 1FRJA 1DTTA 1SPBP 4F4XA 4HDHA 2WSEC 3MM6B 4NYZA 1TP7A 5J2QA 1JMTA 1N8RT 3QMQA 4OZ5A 1VRTB 2EWHA 3R2DJ 4WXWA 3UN5A 3Q0AA 3ET6B 1RWWB 5DZ7A 3VF0B 5E3AA 3GILA 1CC7A 2JVOA 4YB6A 1FD8A 1QAJA 2PFDA 5E3RA 2RU9A 1D1UA 3TWZA 2VONA 4IOAQ 2IM3A 1DARA 4ES2A 2G1HA 1S57A 3P5TL 5HQ8A 3GFXA 4OV1A 3PJXA 3R5DA 2RDJA 1VC0A 4C2MA 1VBYA 3HDSA 2FLNA 5AJ3J 4I2QA 4OX8A 3MM9A 2W2NP 5JXSA 5F8JA 1V3RA 4F7VA 5DQHA 4C48A 3NKYA 4QBUA 2ZZTA 1T9VA 3KHHA 1SXLA 5KFFA 1DBDA 3CO0P 1JLGA 5THWA 5AE1A 1F9HA 5KFSA 4RX6A 3CJ3A 2MZTA 2HKEA 3B54A 2NYHA 1S1WA 4I6AA 1VQYA 3MECA 2AZ1A 2CNKB 1H7WA 3NLCA 2UP1A 4B9UA 4LSNA 2IAJB 4KFBA 1W2IA 2BE7D 4MFBA 5ETVA 5AT1B 2NYIA 2Y9HA 3BH7B 3MR7A 1YZ7A 3K8VA 5LMUF 4JI4F 3JS9A 1KSPA 1HYSB 4O44A 4P2FA 4WU3A 4YR3A 3NNAA 3UW1A 2YNFB 2DNRA 2Z56B 2PIIA 4AYBD 4BCAA 5F9LA 1FRKA 2KJWA 3GYNA 5IT4A 1SIWB 2DHSA 2UXDF 2RQCA 1SV5B 2HWTA 4IO1A 4C98A 1KOOA 3OHBA 2BOAA 1WHXA 2BZ2A 3MMBB 2RE1A 4MFBB 3KK1A 2W8LA 3OT9A 4DR5F 4F4KA 4F26A 1SUQB 1SL0A 4ELUA 2YQ1A 1KBRA 2PE8A 1Q8BA 1S1VB 2Z58B 4G1QB 4F3OA 3AQOA 5AXKA 3T1AA 3RG6A 1DRZA 2K7KA 4DR2F 4MIBA 4R5PA 4CH0S 1IR2A 3UR3C 3VZIA 2RRBA 1KQFB 4DQSA 3I6PA 4UOHA 3S1TA 4IFYB 1O8BA 5CD4A 2NCKL 3BPDA 4X4UA 5CHCB 4ECXA 5H9FK 1OWXA 1YI2S 4WP9A 2K3KA 4UUXA 3DLGA 1IJEB 1R8AA 5DQGA 5BYQA 2MLYA 3I0RB 1UTAA 2WB4A 4NA3A 1K47A 4ID8A 4WK1A 4J9RA 1YJTA 3C8YA 3N28A 8RUCA 2BJDA 1NKBA 3ET6A 1SQGA 3BYPA 1U48A 2IY5B 4ED2A 1BY9A 2JLEA 3H20A 2HHHJ 2E1PA 4ECRA 5H1SV 2BA9A 4RW8A 1NHVA 4CO2A 3JQKA 3BH6B 4ECQA 1JJHA 3SQGB 4R0JA 2YKMB 4F04B 1XNRJ 2KL8A 3LAKA 2VL1A 3V6DB 2ATCB 3NBPB 4HHHA 1MG7A 4J91A 1RA7A 1S12A 3MXHP 4ED1A 2KT2A 4BBYA 1MN9A 3IP0A 1DZ5A 2YNIA 4DR7F 1MNEA 3FNNA 4ZVSB 2ZH5A 1FNMA 5BJRA 4G1QA 2F9JA 2EK1A 2QGFB 5KFTA 2FLPA 2HRTA 2UUAJ 1C0TA 4QU7A 4Y65A 1GMWA 1JJ2R 2FIUA 4TYAA 3T9ZA 5A8RA 3TZZA 4OYWA 1MLAA 2DNYA 2JH3A 3NGKA 4HHUA 5GADU 2C2EA 4GKJJ 2HHWA 4FXWA 2NXCA 2OMLA 2IBOA 1HBUB 2QMXA 1U2CA 3Q83A 1SKUB 3FK4A 2W9CA 2JEJA 3POTB 2BKOA 3TZXA 3V4IA 3CCJS 4CM0A 2CPZA 3FJ2A 2GS8A 4J9LA 2U1AA 1CJTB 2WOMB 4J37A 5FDLA 5H9EJ 2GVZA 1CSJA 2J0XA 3UVJB 3QSYB 1TKXA 1NDKA 2PO4A 4BHQA 4PAAA 1SKRA 1RAAB 3QLHB 3C3LA 2DR7A 4DXLA 1IWGA 2VBXA 3PACA 3QGIA 1FWLA 1RTDB 4BWMA 3HVWA 5L9XA 2JC1A 3G6VA 2HSEB 3FQKA 1E6YB 2VF3A 4Q2MA 6FD1A 3I56S 3CULA 4IFVA 4G65A 3D2WA 3OBIA 4DCOB 3BDPA 1PG5B 1YJNS 3D28A 4DQRA 3S7RA 1N5SA 2XQCA 1N5YB 2AJ1A 2KXNB 5I3UB 4NCBA 2V4JA 3K5PA 4OYXA 2HFOA 4ZPVR 1ZH5A 2H65B 5KFJA 3DU6A 1EIYB 2VICA 2DGXA 1A7GE 1JXVA 2H5JB 5F8GA 4BDPA 1RDRA 1J5OB 3B6BA 3P4UB 4ZHRA 3M9MB 2Y1JA 3IA0A 1SC6A 2A1BA 3W62A 2ZZMA 1SBRA 2VFTA 2NXJA 1RT6B 3FBFA 3F41A 4FZVA 4NPOA 2ZFHA 4F36A 3HD1A 3MM6A 1Z2ZA 2N82B 3LWMA 4V19J 4TY8A 3Q86A 1FE4A 4HTJA 1HBNA 1HNZF 1GMVA 1S6UA 3NAHA 4LT6A 4CRJA 5A76A 4Y2AA 2QSFA 3SDEB 1XIQA 1Y3JA 1LW0A 2R9LA 3RBDA 2FVPA 2XY6A 4JOUA 5HAOA 2E5LJ 4DUZJ 3OFHA 4GC6A 2MQMA 5C42B 3ZZUA 4DQIA 3IM8A 2BXJA 3N6LA 4Y34A 1VS3A 2LU2A 2WBMA 3FRZA 1FI4A 1TL3A 3MDFA 3VAGA 2CPHA 1ULRA 1WD6A 3DOKA 5ADZA 1X4GA 4USWA 1VJWA 2ZBPA 4YY3F 1WSVA 3DGPA 4ZP8A 1LWCA 3WX8A 1S9FA 2DR9A 2GFFA 3ENWA 2QN6B 2VG6B 2VZ9A 3QT7A 2QL9B 3K58A 4IO9Q 4IRCA 4JI7J 5IQQA 3DNCA 3X1LB 1WF2A 4AT1B 4RW9A 2OPSB 4ERDA 3FEZA 2JLFA 4M5DB 3JAMU 1SKSA 5KFRA 4ECTA 4W92B 3PFEA 5KFKA 4C8YA 4HEA9 3KUEA 1H98A 3W64A 3HVRA 1UA0A 4OJGA 1PYOB 1AZSA 2HHPA 4IQMA 3GMGA 4TXSA 4F25A 2R8JA 3CD7A 3TUPA 5J1PA 1Q82T 2W7PA 2K2PA 1LK5A 2V67A 3R7NB 3PM9A 5D0RA 2DYAA 2CZVC 2RJZA 2YKQA 5F3TA 3V81A 3IGVA 4B3OB 1UFLA 2O67A 5I3QA 3OLAA 3CCSS 2OKQA 4KGMA 2W9CB 4DR4J 3O1LA 2FYXA 1RWPB 2OI2A 4NRUA 4WFAQ 5DO2A 2D41A 4RO0A 1GX5A 5KG1A 2WONA 1WEZA 1Q0NA 3R9LA 2EFVA 3FCVA 2D9OA 2MQ8A 2P8IA 2IAJA 4LIWA 1IM4A 4UOFA 1RI7A 1S79A 4NCGA 2ILZA 4H54A 4FN5A 1TR0A 3MI7X 1I5OB 2NZCA 3LAMA 2PN6A 2GX8A 2CIMA 4ZN3A 3NXZA 2HIYA 2I38A 3DM2A 3DRXA 1FFWB 2H3EB 4KO0A 4CH7A 4QW9A 3MUTP 3G71S 4DV0F 2R2SA 2N4DA 1E6VB 3A13A 4XDCA 2CJKA 3G6ES 1UW9A 2CPIA 2E1CA 1RWVB 4U8VA 2KN4A 2CG4A 3GIIA 1HQ2A 2VBWA 3S6EA 3NRBA 3UCGA 2GIRA 3UD4P 1K9MT 3QJPA 4OHYA 2G2ZA 3VHQA 5D3GB 2FHKA 2V69A 1NHKL 1BXNA 4LR8A 1S1UA 4NLOA 3KLGA 2W1BA 4ELVA 4UW2A 1RHMB 1RABB 1S59A 3CTRA 2W4CA 4ID5B 4XTTA 4P75A 3C15A 1YJUA 2C28A 5LSLA 1XR5A 4G1IA 1KC8T 3IR7B 1DLOA 5GAHI 1X4CA 4HT5A 3KNGA 5ETMA 3V4MA 5HP1A 1WHYA 2MY7A 3KJVA 1T03B 1RTZA 2G13A 4O4GB 3W66A 2LQ5A 1IKWB 1ZM3A 1H6KX 1SC4B 4G6VB 4USMA 2X1FA 2ZBQA 3TA1A 2IFXA 4FDFA 2DNLA 4OI1A 3P49B 2FZGB 5HATA 2YWWA 2RQMA 4LF9F 4CLUA 2ERRA 1B0TA 4GRSA 3MD1A 3MPDA 4LIRA 2UU9F 2LEAA 2R7QA 4ATNA 1M1GA 4ZOSA 2N7YA 1JLCB 3T9NA 5AE3A 3MAAA 3RRKA 1MWQA 4YR0A 1WF1A 4DLEA 1Y7PA 5EGYA 4AL5A 3BKFA 2VOOA 2J0WA 1TVRB 7AT1B 1U26A 4OZ1A 2GQCA 2E9TA 2X7IA 4XAKA 3IS9A 4B3MJ 1LW2B 1NPKA 1OQ3A 5HBMA 2BJEA 1KP6A 5BYRA 3M1VB 2DH8A 4CI0B 3GIJA 2HMIA 2KG1A 2Y3YA 2CQ1A 3OFGA 4WKYA 3N6MA 3PEJA 1LNQA 3HSDA 1ROFA 1S99A 1WF0A 4I4BA 4ZPCA 3TO8A 1KTVA 2FVRA 3EE3A 3TOQA 3UDEA 4YR2A 2DRAA 4K0KJ 2E5JA 1REGX 2M9KA 2DVIA 2VFVA 1IBMF 1HHSA 2DPIA 3QRRA 2HFVA 3NGRA 4PXEA 4RNOA 1KWMA 1S1WB 5L8RC 5KOXA 1IKVA 3OTDA 5T7LA 3R97A 4DCPB 1FJGF 4FPIA 1QLNA 3W2WA 4WXOA 3SEOA 4X4SA 3MM8B 3BGFA 3MUVP 3R5JB 5KFDA 2M70A 4Z2XA 2FTRA 1S0VA 2JL9A 1J27A 4WP8A 1JX4A 3CCVS 1HWLA 4DX6A 3KLHA 3H4DA 4I64A 2F8HA 4C8NA 2GJ2A 2LECA 4RUCA 4Z37A 2X51A 2XSJB 4CQ1A 2CADA 2VUGA 4K4XA 2GVZB 3V6JA 3W2VB 2WOMA 4HH0A 3DC2A 3PHEA 3RBXA 3W2VA 3UE2A 4OLPA 3UR0A 5E5NA 3UVJA 4YQWA 3BSNA 5GMEA 4MYUA 1RB0A 4M5KA 5DG9A 4LF6F 2W01A 2BDPA 4RW7A 1TV6B 3WIUA 1N34F 1C1CB 2MKSA 1R89A 3NMRA 4X64J 1UWAA 2OPSA 2ZKTA 3GFYA 3NWGA 5KG3A 5RUBA 1VHFA 1F1BB 3D9BA 1N6QA 1WNEA 4UY8T 1T03A 4CWBA 1JKHB 1TL1A 2IPOB 1SQEA 1WDDA 2JVRA 2VPXB 1RCOB 4ZMMA 3EMTA 4ID5A 2C2OB 4NXMF 3E8OA 4DG1A 1SH0A 4YY3J 4N5SA 2IBKA 2R7RA 4P71A 2GV1A 2E5HA 4ZKAA 1Q5VA 2I5JB 1CJUB 1W25A 4RL1A 2V68A 2XHWA 2YX4A 3AQPA 1O0PA 3MEGB 2ILYA 1OSCA 3QNWB 4KHPF 1SCJB 1UVLA 2DHGA 2P5VA 1F9EB 2EKYA 2BRKA 2DNKA 4I6WA 1RYRA 3TVYA 4ILMA 1OIAA 2XMTA 4PWWA 2WK4A 1QUVA 4E8UA 1HHQA 1X4FA 3GV5B 2BJ9A 3BYRA 2X3GA 2HLUA 3NGUA 3UD5A 3ZZ0A 4ETXA 4ZCLA 1AT1B 1VBKA 3MR3A 1NSPA 2CQGA 2AX1A 3GP9A 4GVBA 2V50A 2FJWA 1T94A 4RW6B 4RNHA 4H4MA 4Q0BB 2YX7A 1TL4A 2KT3A 1YSJA 1RJJA 2OHDA 1TUVA 4QR0A 2XO6A 1GXTA 2XMKA 3D6HB 5IC6B 1TL1B 3RGIA 3IFEA 2NUHA 3ILOA 2YWHA 2ZD1A 2IRYA 3R3TA 2RVJA 5IS2A 2ASLA 1B4SA 4E2FB 3Q8RB 2CXEA 2J76E 3CJKB 1UFWA 4J9QA 1NJXA 4KPYA 1H2TZ 1KHVA 1X9MA 3CJSA 3CCTA 3DOLA 4X4QA 1KQGB 3IRWP 4A8KA 2BM0A 1IBKF 1BWEA 3OL6A 1S10A 2CZ4A 2HGNA 2OELA 4K4WA 1RISA 4OI0A 1CVJA 2ZH1A 1EZZB 3WX4A 5D8HB 4AQYF 1FCAA 3MTJA 5LL6d 1SUQA 1Q5YA 2PMHA 3HVAA 2AU0A 5KT4A 3AH6A 2E7WA 1SL1A 1WHVA 2EW9A 3SV3A 1HMVA 2BX6A 3PIOQ 4USVA 3TEHB 5CZVA 4ANEA 4DN0A 2P6SA 4CYUA 1CG2A 5T7LB 2GVDA 3W2WB 3QATA 4ES3A 1BWVA 1RWMB 3D68A 2X1AA 3TJ9A 2D3OR 3BGRB 1QVGR 3PJ9A 3BQ2A 1DQAA 2HPUA 1PGZA 3G6XA 1KTQA 3KTQA 3PW4A 5D4OA 1RT3B 3MECB 1KFDA 3ONQA 3SIPB 5C42A 3I5CA 4LSNB 4DV4F 3AT1B 2HQGA 3K17A 1NK5A 2ZH7A 1VQ5S 2BJ8A 5EUHA 2DH7A 1X5TA 4K7QA 4NX9A 3NP5A 1RZMA 3NBPA 2RD5C 3QPIA 2V4QA 4QIFA 1HQEB 3UDCA 3ZTQA 3LP0A 2LQBA 4I1TA 4LF9J 5DGBA 3THTA 2J8SA 4CLSA 3EICA 3PKYA 3M8RA 2XO7A 1BQXA 1V5VA 4IH7A 4QIGA 5D0HA 4K4YA 2YTCA 1L3SA 3OFEA 1DY3A 2E1RA 2YNGB 4CM2A 4CO5A 4WWSA 1W7WA 2VKZG 3HI9A 4USKA 1T3OA 5D0EA 3J81Y 2YH1A 1YTYA 2I2YA 4QJVA 4O3QA 1RT2B 4ZVTB 5A0YA 1G4CA 1JLEA 4NLYA 3K8WA 2B43A 3NGSA 5DDOC 5L1LA 2R4FA 2DKOB 1PJ6A 2FD2A 3DYAA 2VV5A 3AD9C 1IKWA 3V6KA 4C0BA 3QRPA 1HI0P 4O4GA 3KJFB 3KLFA 1UVIA 1XN9A 4DU7A 2DNNA 5F0UA 1QAIA 1TV6A 4X84A 2MQOA 2ZBCA 2U2FA 4OI4A 3NL0A 1Y11A 2GO8A 1IBMJ 2F4VF 4OFZA 2HW3A 4PPZA 3FBBA 3QIPB 4H4KC 4JI6F 3MPWA 4XDDA 1HWKA 5FLXU 2SXLA 1KKHA 1RT1A 2ZC4A 1HNIA 4YEAA 4LUBA 3TAPA 4LF7J 3PKMA 3D7SB 3MCSA 5K8MA 3KDNA 5H9EK 1RWOB 3DDNA 4LRBA 1J5EJ 1QTNB 1RU1A 2QFIA 3LP1A 3R7SB 5A8WB 1E6VA 5CXTA 1K73T 2MKHA 2OD4A 4LF6J 1VQ8S 5KOWA 4LMZA 2X3DA 3U1LA 2PD1A 2AIRB 2YPYA 3CCWA 4MK7A 5B0FA 3QYYA 4IG3A 2UXDJ 3KK3B 3KK3A 1VQ7S 2PEHA 2KFZA 2DNQA 4JV5J 2XM3A 2QL5B 2WONB 4BS2A 1UEUA 1S1TB 3CJ0A 1RWXB 1X4AA 3R27A 2XCAA 4FF1A 3EGNA 3MEDA 5M2UA 1XJWB 1C4AA 1BD6A 1Y00A 3FUYA 3OSNA 2OPQA 1AFJA 2ATLA 3UQSA 4R8UA 4C6AA 1SJ3P 3P45B 2RKIA 4FYWB 1JIHA 1T05A 4K0KF 2IM2A 2YBVA 3MM8A 2ZH8A 3QQCD 1RT4B 1JJCB 2FPHX 4QW8A 3OSPA 5AE2A 4C97A 3CJ5A 3BSAA 4DR1F 2QC3A 3KLIA 1UL3A 3ENQA 4KKOA 3F73A 4EYIB 1NSKL 2ROGA 4DV2F 3LW5C 5HJXA 4AQYJ 2HNZA 4KGXB 5ETPA 3JSYA 4YB1P 4PCQA 4W90B 1UVNA 2AWZA 2AW0A 1Y5NB 1OMSA 2MZSA 3NNHA 1NHUA 4F3MA 4C0OC 2R7WA 1FKPA 4DL7A 1R0CB 3QWUA 2DCLA 3ZZRA 2DR5A 1RADB 2BUNA 1NH8A 1Q8IA 4KTQA 1A9NB 1QAYA 3VQTA 5KG0A 3G8TA 2VG6A 4TU7A 2GMHA 4UZBA 1T95A 2C1EB 4HACB 1FJEB 1H72C 5KG4A 2VQEJ 1N88A 2R8GA 3KYLA 4OZ2A 4B3MF 4TU9A 2IVMA 4QWAA 1YHQS 3Q8UA 4NLRA 2B4VA 2DRBA 3BO4A 1S4EA 5D3GA 5G0RA 2RHSB 3M2RB 2QLWA 4U7UD 1P6TA 3OUYA 3BN7A 1T3NA 4A46A 2AP6A 2D69A 1NB2A 1WOPA 2F8EX 4ZPWR 1DAXA 3T6BA 3SV4A 4DL2A 1XNQF 4YFUA 1HARA 3BR9A 2DHAA 3VQSA 2J0SD 4JYAF 1LWEB 1LK7A 3EVWA 3ITHA 4QPXA 1LQ9A 4I68A 2B7CB 3R5GA 3RYLA 5J2PA 2E1MC 3OTBA 1XR7A 1EETA 2HAIA 3B4DA 3PTWA 4NEZA 3WQPA 3JTNA 2RDDA 4PZVA 1VISA 2Y8WA 3MCOA 5KFBA 4PKDB 2FY8A 1VHIA 1MU2B 3HD2A 1FHTA 3GG1A 3Q8PB 4FNHA 3A8KA 5EWEA 4ED8A 4Y0FA 1N5YA 1F2GA 1N34J 4HDGA 3T5HA 2DK2A 3CCLS 1ZZFA 2YWGA 4F4YA 1R8HA 3C2PA 5EWFA 2RKIB 1X4BA 2HBRB 1TUGB 2MQQA 2Z4PA 1YKWA 1S72S 4NMLA 1JK9B 4NLQA 2BKPA 2PGCA 3AD7C 1S1TA 3FKBA 3MR5A 1TFYA 3HZGA 2ZDPA 3ZZTA 1SKWA 4DUYJ 2CAJA 4IG3B 3OW2R 3MMBA 5KFZA 4L75A 4QYZJ 1PBUA 3GV7B 4B9TA 4PQUA 1R6YA 2QMWA 1TMMA 1LFWA 4NE9C 2J8AA 4QQBA 2V8DA 4IOBA 1HBUA 2AF6A 3D3BJ 1WOOA 3KLEA 4MK9A 3DLEB 1AA1B 4M5LA 3THVA 1F2HA 3DGPB 3N5FA 2G2OA 3G2XA 1F9FA 4C4WA 3IWLA 3SSSA 1PJ7A 5CYMB 1EARA 1AUSL 1M5SA 1UJ4A 1VIXA 3DI6B 4X4VA 3R5AA 2MMYA 4EGLA 2H9ZA 3ILLA 1B64A 4IRKA 3RB6A 1D9AA 2CQCA 4Y2IA 3LQVA 2BV3A 2QRRA 3U7JA 4JI8F 3MFIA 5KFWA 5A8KA 1UETA 2XG8A 3E3XA 4ZJOA 4U6PA 3J80U 2GNKA 2CVIA 2KM8C 1WJ9A 4B3SJ 2QLBB 3SBMA 4UF4A 4JUZA 3T6JA 4URSA 1RCXB 3LF0A 4RW8B 3P8BB 3L7PA 4ZVEA 1P27B 4LR9A 1KNZA 5G4DA 1CJVA 4J9NA 4JI6J 2LXFA 3ETMA 3SCKE 3UCZP 3M8QB 4X2BA 5IWAJ 5ETNA 3OR2A 1YGYA 2OEKA 1U09A 4DL4A 1KEKA 5AXLA 4A4JA 2KH9A 1KR4A 4IH5A 1NK9A 5EHHA 3MOJB 4WIQA 5E3QA 3UO0A 3RB0A 4UZCA 2XYPB 3NGTA 4C8MA 3AA8A 2AGOA 5T14A 1S97A 1ZPWX 3BN4A 1WEYA 1S7HA 5J2NB 5A2QU 3GJRB 4WK3A 4X66F 4WCEQ 2MLZA 3FBEA 1AUDA 1M5PC 2X1GA 3D66A 3G9CA 2BBEA 1SH2A 2GMLA 3ZZYA 4EZ9A 2B6AB 2OFGX 6FDRA 4XIUA 1WORA 2GIFA 2CG8A 1MMNA 1NM2A 3DI6A 1TQLA 2WBRA 3FBCA 3GSIA 3QGGA 1ACMB 5I3PA 4CNZA 1XERA 2ZJRQ 3TUZC 4KC5A 4CIOA 1N36F 5JUMA 3M6WA 5KFCA 4DV4J 3CMES 2OPPB 1RK8A 2FHJD 3BGRA 5KFIA 3Q8QB 4DZ6A 1HLWA 1GEHA 4J5OA 4USJC 4DR5J 4L72B 5A8WA 2ADBA 2AJ0A 2C2NA 3O8WA 2YNFA 3DDIA 3CF5Q 5IV3A 3LGHA 1IQZA 2J6UA 2VG5A 2KI2A 1VR6A 2XMJA 2VBZA 2D9PA 3BGOP 5EX0A 4X4RA 5A8RB 2JEFA 4PUOB 4FXVA 1RBOB 4C3MA 5BXIA 2LLZA 3CCRS 4LFCF 4OYAA 4J9PA 2W2MP 1ITPA 2XHCA 3DOLB 4MT1A 4P52A 5LJ3Y 3KDOA 2AYEA 4HKQA 1C0UA 1FFSB 1NEEA 3I9V9 3A8EA 3MEKA 4NXNJ 2PT0A 3EX7B 5DLGA 2AYGA 4PWDA 1WI8A 2Y0BB 5C24A 3TANA 3NNCA 1R43A 2XYHB 1NKCA 4TYBA 4ZITA 5L1KA 4DV7F 5I4MA 4JI5J 4LF5J 4C0HA 1UVJA 4C11A 3ZXWA 2ZWOA 2K3IA 2Z2LA 1T11A 2ASJA 5HN0A 1R7IA 3M8SA 1XTZA 3JTPA 3N4WA 5DG8A 3CWJA 5DJBA 4ZDNA 3GJSB 1IWAA 3CJ8A 4I6YA 4OZNA 1VLOA 2HGLA 3MEEA 2WW8A 4J9OA 3HFVA 3OTOJ 1PO6A 1L5UA 4F3QA 4USIA 3CCZA 2C2RA 2ZH2A 3QJJA 2JZ5A 3MOZA 2NPFA 1N48A 2DXFA 1N54B 5L46A 4K5RA 2M5YA 3OTCA 2CJXB 4BC7A 1RTHB 2IC3B 1R8BA 2OD6A 3I4HX 4KV8B 3FSYA 2OLWA 2WVEA 4MAKA 4LFAF 2ZM6J 2NS1B 5D6GA 1QSYA 2W7OA 3HK2A 5KFPA 2R42A 3EVMA 4DMZA 4OYPA 5HVGA 2DGWA 3DRSB 1UW4A 3HFZB 3M2RA 2E1AA 1M5KC 1RT1B 2B51A 1YJVA 4Q45A 4J7CA 4N8NA 4C7QA 3MUMP 4ZVOB 3U1NA 5KFAA 1RE1B 2DIVA 2WVBA 3PIPQ 3G4SS 4MH8A 1PCAA 1Q16B 1Q7YT 2G0JA 4E0DA 2UV8G 2LQ9A 3L4BC 3IMQJ 2YXLA 4L73A 5B08A 1XWLA 3W9IA 2HFZA 2R8IA 2QA4G 3FGVA 5B0EA 3PDNA 1TZ0A 5KFMA 4CYUB 3KK2B 4NASA 1YLXA 1VQKS 4Q8FA 2V8HA 4IR1A 5B0BA 1KVKA 3RR7A 1LWFB 1HBOA 2GHWA 3PCOB 2HHVA 3EJMA 1NCLA 1OPIA 3BR8A 2AYMA 5HJYA 2J7WA 2KKHA 3ETOA 3VALA 1YJWS 3W5XA 1CULA 1JXEA 2OSRA 4DPWA 4NLGA 2VPZB 3MWBA 1U8WA 2VFRA 2MJUA 3I9ZA 3W1YC 3AOAA 3W3SA 3DLKB 4DI6A 3UD3P 4NWBA 1X9WA 1WG5A 3GIMA 3PFOA 4KKOB 1YBTA 2Z2ZA 2CPDA 4DL3A 2V5HG 2HNYB 5B09A 1FTCA 1VJQA 4GVLA 2DNHA 3TQ1A 1RHKB 4ECZA 1FVQA 1VOMA 4A8YA 4KGZB 2ZD1B 3H7HB 1D8ZA 1NZ8A 3DOMA 3VGTA 1Y10A 3SZ2A 2ADCA 4KO0B 2IIHA 1EKRA 3CMQA 2E7XA 5LXYA 3OPKA 1SJQA 1UFKA 1RBLA 1GMWD 2M8HA 4MYTA 3HPOA 2RQ4A 1EX8A 2V63A 4U9RA 2XSFA 1Q1KA 4ALZA 3THPA 3O44A 2XS5A 4LSLA 4L3NA 4O4RA 1VC6A 3Q24A 1MMDA 2YPZA 4FPRA 4AD6A 4B08A 3EDRB 4X4PA 1FX4A 3KMSA 4M95A 1NLKL 1LFPA 5F41A 4NZ7A 1UJ6A 1YG0A 4RJVA 4QZVB 4EO6A 1L3KA 4JBCA 1RTJB 3GFZA 3IS9B 1FA0A 2FY1A 1FEEA 1I6JA 2UUBJ 2L9NA 1X7VA 1CJUA 2J6TA 2HNYA 1GXLA 2DO4A 3SMZA 1F5BA 1M1KT 3A3NB 4I69A 4HTIA 2XMMA 3QSIA 2BQRA 3M8YA 1TU0B 1VYAA 4FF2A 4HACA 5HO4A 1CBKA 1YVFA 3EGWB 3PZPA 1R27B 2AGPA 4A8FA 4PPDA 3G86A 1ZAWA 5L39A 3OTEA 1EQMA 3IBFB 2B7BB 2LQJA 1F60B 2CWXA 1NDCA 3CDWA 2W9BB 1KVIA 2RAQA 1B0VA 4USUA 1S0MA 2OH2A 3BBFA 1UZDA 2N7CA 1WC5A 2JNJA 3KMQA 5E33A 3CGIA 3JSMB 1CQMA 1N5TA 3M8QA 3JQMA 1HNXF 1HD1A 1U02A 3PJWA 3FEYB 3PO4A 4HR2A 3FFIA 5I3UA 4EBEA 1BQMB 2GIQA 4CLZA 3T5LA 4ED5A 3GCWP 2EVZA 3HHKA 5ITHA 2VH7A 4IOCQ 4OJ1A 5KFNA 1T9UA 4RKUC 1LW0B 2R7OA 5HVHA 5F8MA 5KG5A 2C3PA 1MMLA 3I96A 1IN0A 4RNNA 2E7VA 4O3RA 5LJ5Y 3BS9A 1NH7A 2HBQB 2V8VA 4TVAB 1BE4A 1RT6A 4BLGA 5JMNA 2YNHB 2P2CB 2HRUA 4NI2A 2DXDA 2IC3A 3TA2A 1RA6A 3R6GB 4ED3A 2DR8A 2OTLS 4XO0A 1RXOB 1VRQC 3W63A 5I42B 2V8PA 5FDLB 1HPZB 4U67Q 2B8PA 1Y4ZB 2RQKA 2IJFA 4ICLA 1TL7B 2JOQA 2KHDA 3NAIA 3HP6A 3CJTA 4IR9A 1P1TA 2L3MA 4WE1A 4YB5A 3A4TA 4CP5A 3T1HJ 5ETQA 4WIIA 4NI2B 1R0AA 1IVZA 2GVDB 1FWKA 1ELOA 3D6TB 2FJEB 3BM7A 3I5BA 3EXCX 1NZAA 3BKUA 3LOUA 2ZNYA 3M1VA 4C11B 2ZH9A 1H38A 2DGQA 3ZNUA 3LP1B 4M5GA 2KYXA 2XGPA 4LFBF 3A3PB 5T41A 3DRRB 2UXBF 4N76A 1B70B 2Y1RI 2CPJA 3MMAB 9ATCB 4DV2J 1C0UB 1JXLA 3Q2SC 4LSZB 2FGOA 4NLWA 1LEOA 2PA8D 4OHVA 2BANA 3W9JA 3T41A 3HMJG 4CCHA 1G1XA 1HIYA 3CD6S 3JSRA 4Q7AA 3DRPA 4FF4A 1U8SA 2QLJB 1NJYA 4CDIA 3M9OB 1CULB 3J81j 2M2BA 3EZ5A 4W4MA 4M5IA 3GONA 3KLHB 3IBCB 4AE5A 2BYCA 4M5DA 4TLQA 5MLCV 4C3KA 1HNWF 1EQ0A 2EFGA 4DFPA 4U96A 2KFYA 3CNQP 4N77A 3H5SA 4QPTA 2DGOA 2OSQA 2LA6A 1IKVB 4QWDA 1TL3B 1EETB 4KGVB 2LMIA 1X5SA 1ZOTA 1Y0HA 3IAS9 2G2YA 2R3VA 3D4JA 2YNIB 1RT7A 1VQ9S 4OIXA 1U25A 5FLXY 2XYGB 1ZYQA 5J2MA 3H42A 2HS4A 2G4BA 2AZ3A 4IG0A 3DRSA 4URGA 2GC8A 2HQCA 2B4OA 4DR3J 2R7TA 4DL0C 3TP2A 2UZAA 5H9FJ 1YRUA 4ZP6A 2G0IA 1RAIB 2LFVA 2ZHAA 5F3ZA 4K50A 3VWSA 4JI3F 4DR7J 2BQ3A 3PW5A 1RYSA 1NK0A 3DM2B 4CH1A 3W5YA 1EJ7L 2Q66A 2VC0A 3I55S 2Y8YA 2HBZB 2ZOMA 3T1YF 3B78A 3EZUA 4YHHF 2JEGA 1EP4A 1N5QA 1PYTA 2J0QD 3NGDA 1FRHA 1WKJA 2IVFB 2ZBRA 3Q2TC 2KB2A 1Q86T 1G6BA 2GCFA 1H2UX 1K44A 1VK3A 3G6YA 4ELTA 3HO1A 2P6TA 3GYGA 3BDEA 4E98A 1Y3KA 3CJRA 2QA2A 4IDKA 3UWTA 2HG4A 3CB4A 4RBTA 4UOGA 3J81U 3X3UA 3WDOA 3CVKA 4ES1A 3IRXA 1V3ZA 1TKDA 1YBAA 4DLGA 2YKOA 1DURA 4OYZA 1CC8A 4C8KA 4B9MA 3LANA 2A10A 5EX3A 1F3FA 1RWNB 5K9FA 5DLFA 1RTDA 1APSA 1T02A 4NYOA 1R31A 1KQKA 3HLUA 3BREA 3CCMS 2KXHA 3AXMA 4FNIA 5C2CA 3M9NB 4MKVA 2DNPA 3PNIA 3DLKA 2F8MA 2QZ8A 2C2ZB 2VFSA 3M8PA 3H90A 5E3PA 3ZFVA 2UUCJ 2AKWB 5GAEU 1PSDA 1QSSA 2ZZNA 2L41A 3EXYA 2ZH6A 2MDAA 2D3O1 4DPXA 2QTWA 3VVUA 5GAEI 5KT3A 1SVDA 1JNRB 1VRUA 3G82A 1FX2A 2C22A 1C4CA 3CO9A 4FKYA 1SJRA 4PEOA 4TQSA 5FJ4A 2ZWPA 2IJRA 2QYCA 4QCLA 3H8YA 4FVMA 1GAOA 4CLLA 1XEZA 2MSTA 2LCWA 4L6V3 4PG6A 2YKPA 3MD3A 3RW6A 1NAQA 2DXEA 3RB3A 2R7VA 3TAMA 5B7WA 3N5BA 3H25A 1HNZJ 5CH7B 5D78A 1RWUA 4WFXA 3TI0A 1FEHA 5FD1A 3RBEA 4EI2A 4H4KA 3QT8A 2E29A 3D0IE 3VGUA 1B3TA 1IM6A 2CJAA 3P6YC 3MM9B 4DF8A 3QO9A 4I2QB 2KDOA 3MEGA 3MF5A 4NLVA 4WJBA 5DGAA 5CA5A 2KU7A 4R25A 5KFVA 4KV8A 2UU9J 3K0JA 2VC1A 5B0CA 4ITSA 2CNNB 1QDUB 5IXUA 2APOA 3VAIA 1HNXJ 3J80Y 3MMCA 1QD1A 3JAMY 3GJQB 4AL7A 1BQMA 2M4MA 3TA0A 3MAAB 1KS2A 2ZKUA 3K5MA 1LKZA 4GKKF 4XK8C 3TJAA 5CABA 5CAAA 2HGMA 1S5ZA 1SB6A 3IWXA 1S49A 4GO5X 1KLNA 4NMXA 1JKHA 4K8RA 1PAUB 3PX6A 1X0FA 4DV5F 3I31A 3TUIC 4RW7B 2VQFF 3WC2A 3U27A 2HHSA 4JI1J 1OY6A 4DR6F 4B3RF 3TJ8A 2HVZA 3M2UA 2ZC3A 5K8NA 4DUZF 3DRPB 4Y6IA 4DFJA 2YNGA 1X5PA 4Q2LA 4C8ZA 3IGNA 3OVBA 1S1XB 5IC4B 4AXIA 6AT1B 4UY85 2H5EA 5C5JA 1SJFA 4CLTA 1S6QA 1UAWA 4YP3A 1U1MA 1VQ4S 2P9GA 4CO4A 2WVCA 4OJ3A 3QZ7A 2VA3A 1RUSA 1LXJA 5KT6A 1QM9A 3U02A 5D15A 5DDQC 2UV8A 1EHWA 2PA3A 2QA4S 2EEYA 1D9FA 4RZRA 1HQUB 2UUTA 2WRMA 1VMBA 3DRRA 3NCRA 1NNDA 4OQJA 4P2MA 1FKOA 3M32B 4KRWA 4ZS6A 3V6HA 3HSGA 1SJ1A 3MEDB 5KFOA 4YHHJ 3E01A 4ECUA 3WZ0A 3AJ1A 2ZH3A 1WWHA 2EG1A 4P2SA 2W8KA 3OXGA 1GTHA 4ICLB 3O6QA 2FZCB 3KLVA 1TAQA 1HWJA 2ZOFA 4DV0J 1T7PA 2CA9A 1TL7A 2XZTB 1GT8A 3IXQA 2CJYB 2W7AA 4NZ6A 4PG4A 1WC0A 3KLIB 4B02A 5LSOA 1BGXT 2FUG9 5D77A 1KD1T 4OYBA 3SFGA 4Y00A 3QAUA 2ZUAA 1YDLA 3OQ2A 5J1EA 4ECYA 2MQPA 3FEXB 2W2OP 2KVQE 1O6XA 4LVNP 4M5JA 4M5NA 3OTOF 1PC5A 4NCAA 1VQOS 3VR1A 2F4FA 3AAWB 3IR6B 1N4LA 4WFBQ 4LRCA 2B56A 4LQ3A 1FVSA 2XLKA 3MGJA 1TVRA 3AY0A 2NQPA 1E6YA 1TKTB 1BQNB 3CE8A 5KFGA 1IKXB 1H74A 3RBZA 4FVCA 2RB7A 1S6QB 3CDEA 3CUNA 3AXKA 1YITS 3GIKA 4I67A 2J9DA 1KLMB 3J7Z5 1PILA 2EG2A 5FIIA 3EDQB 3KXDA 1WACA 3TZYA 4DV1F 4F8RA 4KHMA 3T1YJ 3FZ2A 4ZLJA 4DR3F 2J5AA 2O5DA 9RUBA 1NJWA 3BKTA 2R2TA 2UXCF 2UXBJ 1OJ4A 5D0GA 1MROB 3LP2B 4JI3J 4OYOA 4RW9B 2EFNA 4CLPA 3SI8A 1U1OA 3PYDA 3ZTRA 4C8LA 2A6MA 2IJNA 2WHOA 3D5MA 1MN7A 3Q8YA 3HVTA 4U8YA 4DFMA 1U6BA 2LA4A 4RUAA 3C15B 4MKBA 1U0SA 3KK2A 5JVHQ 3BB5A 4OZ3A 5KAKA 2EFOA 3MAHA 2HRYA 4H4MB 5F0WA 4YN3B 4WP3A 3TQEA 4DV3J 1NK4A 4LBIA 1OSDA 2MYFA 3ENAA 4FYYB 1U1LA 3DLHA 3CMAS 1URNA 3QIDA 1RQ0A 1GX6A 3MMCB 1RAGB 3I0SA 4PG7A 2IA6A 3BV8A 2IYIA 4WFYA 3EVOA 5LMNF 3T1HF 3K5LA 2ZVIA 1NB7A 4WZMA 4EEYA 1IKYB 2AMCB 5GADI 3T3FA 2DB1A 2VB6A 5U47A 2RMLA 2BVZA 1JNZB 3OJSA 1U1KA 2BM1A 4YB7A 4XPCA 4B9VA 2HVHA 4ED4A 1VQMS 2MKYA 1HNVB 1RTHA 3JXOA 3NG8A 2MTLA 3OHAA 4FS1A 3VGSA 1JLEB 1ZAVA 5KT5A 4ANCA 4WBFA 2G1DA 1V6HA 3DRYA 3VV2B 1WOSA 1KLMA 2GAHC 3M2VA 2HFSA 4HL9A 3TNVA 2AGQA 2XY5A 2QA1A 1JLQB 3PXGa 3MM7B 3HZEA 4ZPDA 3SCIE 1FKOB 1SC3B 3V81B 2XMVA 1KONA 3S01A 4NLPA 2VJVA 3E2EA 5DM6Q 3BQ0A 1F6TA 1XMBA 2MZRA 4CO1A 4R8UB 2KVIA 2JWNA 1CLFA 1I1GA 1VQLS 4L74A 4CO3A 4IFYA 2ROEA 4ETZA 3OLBA 3HHDA 2C2KB 4MKAA 1FK9B 1MU2A 5D4NA 1JLQA 4EMDA 5IT9Y 4RLEA 2F40A 5GAGU 1OYDA 2FJDB 2BEFA 3NS5A 3S8SA 4ECWA 3PY8A 5IZHA 3BQ1A 3TEGA 1YQHA 3GSDA 1C2PA 4FKXA 3PYFA 5CZXA 3ZZZA 5F8IA 1VC5A 2IRXA 4TY9A 1RKIA 2IA0A 3CJ4A 3SFUA 1B99A 4DBQA 3HT3A 4DWIA 1TELA 2KZMA 2CFXA 4P7TA 1LWEA 1AFIA 4ZPAA 1Q8KA 3GR1A 2FVQA 3GIRA 4FYVB 2F9DA 5HROA 2CJBA 3RAXA 1FJGJ 1AB8A 3TW0A 3M05A 1WKKA 2E5IA 3A8JA 3VZHA 3G8SA 4FP9A 1WHWA 2IRUA 2KT5A 4FBTA 3HT0A 3BEGB 5CYJA 3KFWX 2B8QA 1H3DA 4Q5VA 1I3OB 4P72A 2LDIA 3ISNC 1VQNS 1XNQJ 4HI2A 1FF2A 5HSPA 2V4RA 2YWKA 3UNYA 4DL6A 4KH1B 1HI8A 5KT2A 3DLBA 1FRIA 2GQQA 3HHNB 1N32F 2AV5A 2DGVA 2W24A 1VCTA 2X1BA 3SQOP 1XNRF 2A2DA 3QO9B 4KBIA 4L3KA 3LTOA 1ZAXA 4PXCA 2OTJS 2AD9A 3CC7S 2XCPA 4OLOA 1MW7A 3AOCA 4QOTA 2CQBA 2DH9A 2HWIA 2YKNA 1S6OA 3BSCA 2HK2A 3DFEA 3O5TB 2DNOA 1LOUA 1H7XA 1P9QC 1S6PA 2H4WB 2W25A 4H4OA 3KHRA 4KR0B 1S76D 1JLCA 2OP5A 5C25B 4DPTA 3DKDA 2XMWA 3BBCA 2WCXA 3R6LB 1ZETA 2M3DA 4ZPBA 4I56A 3J7YU 1RKJA 3RJMB 4CO0A 3RTVA 4JI2J 3VAHA 2N3OA 2RF2A 2LQ8A 2C3OA 2WVFA 2A6OA 2FJXA 2FVSA 4M94A 5HANA 4H4OB 5HQMA 1I94F 1RT4A 1Z1ZA 4YMEA 2A0FB 1F0XA 4KHPJ 2B4PA 1FWPA 1WI6A 2GQ2A 1RACB 3BBBA 2VOPA 2XS7A 2FHJA 2K1RA 5C2GA 4EBDA 5EN1A 4PWDB 1S0NA 3O2IA 5J1EB 4UQGA 3B4MA 4G1PA 1T9XA 2I5JA 1T9TA 1XMOF 2KG0A 1P9YA 2V8GA 2HQ3A 2IM1A 4PUOA 4DG1B 2BE2B 2FC8A 3QWPA 2FHOB 1KDNA 5J1NA 4DDFA 4ZVRB 4K2XA 2VG7B 3QBCA 5IOLA 3EM1A 5GAHU 3MURP 3H5YA 4DF4A 2LXUA 3HF5A 4X65F 3FSIA 2R8HA 1ZTWA 1QE1B 2DPJA 3MAQA 4PQUB 1HW9A 2FB0A 3KJQB 3MHYA 4OYMA 3HHLB 1D09B 1Q4RA 3I32A 3QGHA 2XLJA 4EYHB 4PWUA 4F2RA 4I2PA 4J9SA 3BZQA 4NCGB 3RZAA 3M8ZA 4DZDA 3QGPA 4M1KA 4ECVA 2B6AA 1C0TB 2EK6A 2V6AA 3H2LA 5AJ3F 5HI7A 4ECSA 5DG7A 1S77D 1FK9A 5KG7A 4GKKJ 2XSJA 3CDAA 2NSBA 3TUJC 2OO4A 4QYZK 2EI5A 1UJ5A 1JLBB 4PYDA 5KFQA 3JYTB 4WTOB 1AXQA 2YKMA 5B0AA 1Q7LB 3TAQA 2DJWA 4LF4J 4JV5F 1ZA1B 2GHVC 4O23A 2QX0A 2KRRA 2VODA 3HHEA 1EKSA 1HI1A 1RLDA 4KSEB 3ZTOA 1F5CA 3C6TA 5IWAF 4DV5J 2HVIA 2DRDA 1ZS6A 2OMOA 5KFEA 3M6XA 2ZJPQ 5JVGQ 2HQIA 1RWKB 4K5SA 2GAGC 2YWEA 3OL9A 4HH1A 1S7IA 2XEXA 1XQIA 3KJNB 2MQLA 4P2XA 2ALYB 4CTAB 4X4NA 2DO0A 1FERA 2JLGA 2ALZA 4LF2A 4LRFA 4KH0B 1Q95G 2JFDA 4DX5A 1M5VC 4F4AA 1HNVA 2QJ3A 2DGUA 2VU5A 5IT0A 3LGNA 2DD8S 4M5MA 2ZHBA 3RB4A 4DR6J 4J9UE 3DXSX 4Y2MA 4ED6A 3Q23A 2B9YA 4KPCA 3D6FB 1L3VA 2OJ3A 2ROPA 4B9NA 1YRTA 2DT9A 4LF1A 3D1QA 3VAFA 1Q8LA 3C46A 3R2CJ 5K14A 4DV1J 4JYAJ 2VASA 3LA0A 3LPEA 1N5VA 1N36J 4S0MA 4QU6A 3V2UC 1FDBA 4FXDA 2FHMA 3IAM9 2HAFA 2XULA 2DBBA 2OPRA 3A1YG 3DDKA 4F0KA 1XMQF 4A8WA 1FRXA 1FE0A 2NXNA 3L7OA 1IBLJ 2AT1B 1X4DA 2AJQA 4RWXA 5CYMA 1X5OA 1SI9A 1U24A 4ZVUB 4HHJA 3IN5A 4A8OA 1GXUA 1QAXA 5CCLA 1IQTA 3DLEA 1Y9OA 1FKPB 2HFUA 4Y2KA 4DJBA 2BKNA 1RU2A 1FXRA 4LRAA 3W9HA 1U1RA 1N6QB 3KNAA 1KOHA 1I51B 2DY9A 3W65A 2HHUA 1FD2A 4O44B 2CQHA 3D54A 3MM5B 2IMWP 1FRMA 2LKZA 1X9SA 1YJRA 2R7UA 3PEHA 2OUGA 1DQ9A 2YY3A 4MJKA 3G8QA 4OV6A 1K8AT 1G7CB 1VDHA 1RTIB 3DCAA 4LREA 4JI2F 2XY7A 1K1SA 1YX2A 2KFNA 1HBMB 2UUAF 3EPGA 4B17A 2MY8A 1NMEB 3D67A 3AB2B 1IKXA 4A48A 4B3OA 4RBVA 3H5UA 3KG4A 3PRVA 3CIMA 4KB7A 4CLYA 4DPYA 5C24B 1T9YA 5HL7Q 2OPQB 3EGZA 2FC9A 1Q79A 3PR4A 1J5EF 4FYDA 2W2PP 3PG9A 3F0NA 4DPUA 1U1QA 3L3CA 2F3JA 1HBMA 3MZIA 4USHA 4A47A 4GO7X 3D0HE 1UVMA 2W4DA 1U2RA 1BLUA 5KTQA 4WE1B 1TTHB 2CNOB 2XTJP 2ZE2B 3NS6A 1RAJA 3GPAA 2W2QP 1HPZA 2ZJQQ 2MKIA 1IUJA 3V5RA 3OVSA 1VRTA 1NK7A 2C2MB 2HQDA 3ISZA 3ITHB 2RDIA 1BMQB 3N6NA 2ZHOA 3MM5A 5J2PB 4RUHA 2HMIB 1GMUA 5KFHA 3RAQA 4ZP7A 2MXYA 2POKA 2Z0GA 4JB8B 4OMFG 3GFHA 4ENOA 4NEYA 1LW2A 2H5IB 2CQ0A 3ZTPA 2OPPA 2WB1D 5HBMB 2MZJA 4F4ZA 4DSEA 4FBUA 2VG7A 2FJAB 1ZBTA 2CNLB 3UDVA 4EK2A 2DNZA 2H51B 3I0SB 4TN2A 1SIZA 4Q44A 3QIPA 4RNMA 1X8DA 3I87A 2EPIA 1S1XA 3NWRA 1LXNA 4ZIVA 1Q78A 5ETKA 4U95A 1TL5A 2VQFJ 4OHWA 1B0PA 2DCUB 2H48B 3M2UB 1ZM4A 3UNGC 1JJ4A 2IHR1 1RHUB 2HS0A 2Z30B 5IQ6A 1U0HA 3HVTB 3PX4A 2K1RB 3K5OA 2B9XA 5E7OB 1S9EB 1G3OA 2QLFB 1SL2A 4JI8J 2XMUA 2WSFC 3UDLA 4YDDB 3DYAB 3DXBA 4ZVGA 1DLOB 4MKYA 3OVAA 4B9LA 2V0NA 2HNZB 3DN9A 4HI1A 3LUYA 4KE5A 3R5BA 4D3HA 1UMJA 4YS2A 3H0PA 4PQAA 2NXUA 3W60A 1F5AA 2I9SA 1XBWA 2V4JB 4LR7A 4Y2CA 2R2RA 4RW4A 2FGCA 1ZM2A 2AQ4A 3A3OB 1JLFA 3ISND 5M2RA 5F8LA 5B0GA 3H5XA 2QO3A 3C6TB 3FZBA 1IR0A 1S48A 3WHIA 5A8KB 2HFNA 3VAJA 3WC0A 3LP0B 2MZQA 2V9KA 5IT9U 5K5MA 2PMWA 2CPYA 4R5PB 2HHHF 4DCJB 4YDXA 2KRBA 1D0EA 2LEBA 3JYTA 4ZCKA 4ZVQB 1R0AB 3CDBA 4LFCJ 4LSLB 2VKRA 1NK8A 1J5OA 1OPZA 1N33J 1XR6A 1NSQA 5ETLA 5LOQA 1N0UA 2RRNA 5LSRA 1IXKA 2XNRA 3J7A1 3KG0A 2CQIA 4PXBA 4I2PB 4CZCA 3VVTA 3MR2A 2WTFA 1B7FA 3HHLD 3MR6A 3HSJA 3HHLA 1QE1A 2DNMA 1HQUA 2Z57B 3CDUA 3HKWA 3DHWC 3W7BA 2AJ2A 2G0CA 1YK9A 4TU8A 1XMOJ 1TAUA 3MPVA 1HNIB 2E9RX 2NPIA 3M8WA 3AFGA 3HCXA 2HHQA 3DMJB 4KFBB 4RR5A 1TKZA 4HYKA 3D6MB 3OR1A 4KIAA 4LFAJ 1U7LA 3SSQA 3R8YA 1TFWA 1CEZA 3D0GE 4KAIA 2NZ4A 2KYZA 2E44A 1TKXB 2DISA 4MMOA 2K7JA 3PR5B 2VPWB 3Q8VA 4A8SA 2IYGA 1RGVA 4K4UA 3M6UA 5CD4H 3JTOA 4O3PA 5F8NA 4C8OA 3CIZA 4MIWA 2OEMA 4NOHA 1WG1A 5HVFA 3LGMA 3D3CJ 3HJVA 2JHEA 3WBZA 4OZ0A 2HZVA 1S4FA 2ABYA 4F02A 3SQGA 2RUSA 4NA2A 1R0BG 2VFUA 3P96A 3SYZA 4IDKB 2GA7A 2YQ3A 4IQXA 1O51A 2QSWA 2W9BA 1X4HA 3P5BP 2LU1A 4X64F 1Z4UA 1ZTTA 1TUWA 2KZZA 1REVA 1RT2A 2DITA 5A0YB 4JI1F 1Q53A 3Q89A 3GCXP 3FSXA 4KGKA 2GHPA 3W8PA 3IR5B 3JSBA 4X4TA 1VQ6S 3CXCR 4WZQA 4CTAA 3BGUA 3HULA 2RHQB 1S6PB 2FZKB 2L9WA 3GWCA 5A2QY 1K1QA 3FMBA 1OQ6A 4DR2J 1PBAA 2BABA 2W9AA 2YKNB 3W61A 3SDEA 1WUUA 4DSLA 1HBNB 4DX7A 4X65J 3CC4S 4ILLA 1GK8A 1R3NA 2EKNA 3C6UA 1NRKA 3H2UB 2LXIA 5HLFB 1TK0A 3OUYB 3HM9A 1HQEA 1NJIT 4JP8A 4LBPA 2EBGA 3N9UC 2L9DA 4PG5A 4CNYA 5ETSA 4CT9A 5J2MB 4QR1A 3T5JA 1FNOA 2QT7A 1FKAF 3J7AN 1SC1B 5GMDA 2MJNA 2VDIA 3PRBA 2YQ0A 1FO1A 2PC6A 2V2KA 3R1LA 1MWZA 2QMUB 1RT7B 3GZ7A 2RU3A 2JDJA 2KHCA 1EB0A 2HURA 2RNEA 3EZOA 1RT3A 4A8MP 4RBUA 2YWFA 2AHOB 2F65A 2VG5B 2XGQA 5CYQB 4PYAA 4DSIA 3NMAA 3M32A 4LVOP 4P9SA 4DX8H 3G82B 4IUFA 3PX0A 2XNQA 1FJCA 3DOMB 1HYSA 2HHTA 3BF4A 2AJ4A 1IBCB 1M0SA 2Q79A 3N0VA 2MGZA 4QIEA 4W98A 5DZ6A 1CPZA 2ACMA 2BW7A 5D4LA 3AD8C 4OHZA 3HHLC 5LM7E 1UCNA 2GZOA 5MAOA 2BE2A 1BUXA 4OX9J 1KVJA 1WTFA 1SH3A 2V2QA 2QLXA 2MB0B 4O0IA 4JV0A 4DFKA 2V9WA 2IVYA 4CLKA 2GW8A 4WF9Q 5DETA 4DN9A 2A2CA 5ETOA 3CC2S 4ED7A 4C3LA 4KYZA 1R8CA 2MLXA 4WYWA 2RUGA 2MGZB 4IRDA 3AJ2A 1VGYA 3AOBA 3NY0A 3V4IB 3AODA 1HW8A 2CZ9A 5BR8J 2VD3A 1DHMA 1S9GA 2Q6CA 1Y5LB 3GE9A 4K4SA 1HBOB 1DQ8A 3AA9A 3EYZA 1JLFB 2ZM6F 2BR0A 2VIHA 3QZ8A 2CPFA 3NOGA 3MM7A 2ZBIA 4I7FA 4JI0F 3ZC4A 3I4PA 4EU0A 5BYSA 5IFMA 2C2DA 3RRGA 4RPFA 1N33F 1RHRB 2V34A 4RW6A 3JQJA 4J9KA 1DFDA 3ICLA 5L38A 3K57A 4DQPA 1PIEA 2D74B 5HQLA 4ZVFA 5EDWA 1GQEA 4Q0BA 3BO2A 1UEKA 4P7VA 1RP5A 4P73A 2OEJA 1QTMA 4X62F 2XWXA 5I42A 2GJIA 5HMYA 1MWYA 5M2PA 5E3CA 3KWMA 5SUHA 1Z2LA 5K8PA 3U1MA 2YNHA 3B8HA 2DR6A 2RS8A 4RWWA 2XI3A 4ANDA 5GVQA 5IM0A 1N52B 2ASYA 4USTA 4WFZA 4QWBA 3VGVA 2CWKA 1IKYA 1N0VC 1RLCL 3KHLA 3O3LA 4DV7J 1FDDA 1U1PA 4LF5F 3VAMA 2MKJA 1CS4A 3TVKA 5E0OA 2PMZD 1UPPA 5G0RB 3G96A 1R8PA 2RSQA 1QJHA 1YJ7A 2JJ4D 1A6LA 2XI2A 1FNXH 3LO3A 4F50A 1GNKA 3FRYA 1KRPA 3FFIB 4JV1A 4N8OA 2WZ1A 1U6ZA 4QWCA 1REVB 1AYEA 3TX0A 1CJVB 1K0TA 3C16B 4Z7YA 1UP1A 2A3JA 2JRSA 2O01C 3L7UA 2Q43A 3DHXA 1WDTA 2CPXA 3HJFA 2BE9B 3PV8A 2MZ1A 1S9EA 2XB2D 3H98A 5L1JA 3BO3A 1S9GB 2V2VA 2C3MA 1MROA 2N4CA 3KUHA 3LP2A 1YWXA 3PYEA 3J7ZT 5F9NA 3FDSA 3KJVB 2UVWA 1C1BB 5KFYA 4F67A 3G87A 4UUWA 1ZPVA 2HEKA 1UWBB 3M8PB 5IV4A 1CQNA 5EWGA 3KOAA 2HNDA 3QLHA 2FJBB 2MEWA 3ZNJ1 2BW2A 4DEZA 2AYBA 2HWHA 3GYXB 1VLYA 1CJTA 4HVZA 3CT9A 2M0GB 1AW0A 4OI2A 1TKZB 2MHNA 2EC2A 1VBZA 2R8KA 3TZWA 1EAYC 3IC1A 4GMKA 1CS4B 1YIJS 4QIWD 1NKEA 1KN6A 1HKAA 2VDHA 1YRXA 1VQPS 2E9ZA 2RH3A 4L76A 4QR2A 5AXNA 2IMOA 4ZK7M 3CSKA 1U49A 1RTIA 3CEDA 4OX6A 2GMJA 3M2VB 4LF8F 1JLAA 1B7YB 2BMBA 4M5HA 4DPOA 3QJLA 1L3TA 1PC4A 4LJMA 1D9DA 4UQTA 1U4BA 1V5IB 3OFFA 4LF7F 1UEVA 4M63A 3K59A 2O1PA 4A8QA 1T8EA 1S0OA 4NZ0A 3N01A 2I0XA 4RU2A 3E01B 1P1LA 4DSFA 3ULHA 1RHJB 3FC9A 3DLLQ 1JWWA 1VQSA 2KO1A 1HMVB 2LP4A 3D1OA 4P6QA 2Z2MA 5J2NA 1NXIA 3UI3A 2DEJA 2Q3PA 1R6VA 1HFEL 2P9EA 4IG0B 3ZO7A 2XC9A 4OX9F 3SXLA 3Q22A 4AL6A 2C42A 2UVVA 1OY9A 1RHQB 5LT5A 3NCPA 3M7VA 3BJYA 2XBPA 4ILRA 3H40A 1X31C 2J9EA 3ADAC 3EUNA 4NLTA 4TLRA 2GGPB 4B3TJ 3I82A 2DHHA 1AROP 2BJ1A 2OAUA 2WVDA 3AB4B 4K59A 2RILA 4CT8A 3PHTA 3K5NA 3I0RA 1D8YA 1H73A 3RW7A 2UVUA 4LQ9A 3IG1A 1FDNA 3GTYX 3KG1A 3IG1B 3LALA 4ZPTR 1OYEA 1ZM9A 1M1HA 1A0OB 2D7SA 1GFWB 4WKRA 3FVYA 4NLSA 3OD2A 4AXJA 3PW2A 2AEFA 2GGPA 3DLJA 2HZAA 3EGVA 2H54B 3FQLA 3ILJA 4M8LA 4NL5A 3PW7A 2PFFB 1HNWJ 4OI6A 2RT3A 4ZLNA 2JFKA 2BANB 4DV6F 1ICEB 1PKUA 1CJKB 2HYIB 2BJ3A 3I5AA 2R2UA 5C7PA 1IJFB 1HHTP 1K0VA 1LWXA 3M30A 1BQNA 4IYQA 3WIVA 1X4EA 1RTJA 4IH6A 4DOZA 3Q8SB 4DSJA 2JX2A 4TY8B 2B0GA 2DIUA 5B0DA 3NCQA 5KT7A 3KLEB 1T05B 4Q8EA 5HLFA 2L08A 3UN3A 4EFAC 2MPUA 1JB0C 4NRTA 2D3UA 2K8GA 4BWJA 5DQIA 3ZZOA 1RBAA 1FXDA 4K4ZA 4DQQA 1WC1A 3OXLA 1F3VA 5K8OA 3TAMB 3OXFA 2AEJA 1DTQB 1OS5A 1FXLA 3OL7A 2ZE2A 3QT6A 4NYPA 1PYSB 4AFFA 2IDLA 3KUGA 1W2BR 4G3IA 2ZITA 4P10A 4EO8A 1JLAB 3IO1A 3MCMA 3P3DA 5E2QA 2XZWA 4ZLPA 1HD0A 4O0NA 2Y1IA 4JI0J 4I7FB 2QV6A 1VFJA 3ENVA 3GU0A 4EBCA 1KFSA 2LDYA 3PVXA 4PG8A 3EPIA 3UN2A 4IFVB 4N47A 3M6VA 4DS5A 4DL5A 2F4VJ 3FCHA 4C9DA 1VRUB 2OGUA 4UT4A 4LBHA 1NPRA 2HVDA 2M7SA 1TMJA 2HBYB 2AEMA 1RT5A 4A8XA 2M8DB 4F2SA 1NPPA 1Y5IB 2QFJA 3QT5A 1UZHA 3MPYA 2BOPA 2A18A 4FF3A 3H4BA 1PJ5A 1AZSB 3ZZPA 3JSMA 3KHGA 3KKFA 1C1BA 4EWTA 1HR0J 1JQGA 1RT5B 1UWBA 2J9DE 3POTA 4RNFA 3MMAA 4OYIA 2B9WA 4WYLA 3UCUP 2L48A 2FDNA 2LVWA 5L9NA 4OHXA 5HMZA 3HKZD 4UTGA 2Z2YB 3MMJA 4DUYF 3F56A 1HA1A 3IRXB 4V1Ak 2NREA 5HMWA 5E41A 4N56A 4O3SA 3CCQS 3C16A 1U0HB 1NDLA 2CVEA 4LFBJ 4O3OA 1NUEA 1P8GA 4DR4F 2EXUA 3UFCX 1LWCB 2WSCC 4URQU 1GH8A 3K7RA 1DTQA 2XWYA 2GO9A 2V94A 2RIJA 3DOKB 1EP4B 2Y0SD 4GVBB 4X4OA 3CPWR 1UPMB 3CCUS 3TRGA 4RU9A 2XLIA 1BC6A 4K2JA 1OY8A 3MTKA 5LMUJ 4CLWA 3IM9A 1I94J 2FLLA 3TVZA 1UVKA 4N41A 1FRLA 5DRKA 3H59A 1IBLF 3PO5A 1U2FA 4DR1J 5K14B 3PRDA 5IM0B 4WFNQ 2VBYA 4J9MA 4R0EA 1QSLA 3ZTSA
chains in the Genus database with same CATH topology
1EKSA 3JQKA 4PYAA 4PYDA 2IIHA 3JQJA 1EKRA 2OHDA 3JQMA 2IDEA 2EKNA 2EEYA 4FDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKS A;  3JQK A;  4PYA A;  4PYD A;  2IIH A;  3JQJ A;  1EKR A;  2OHD A;  3JQM A;  2IDE A;  2EKN A;  2EEY A;  4FDF A; 
#chains in the Genus database with same CATH topology
 3L09 A;  1RAE B;  2LYV A;  4B3R J;  3NOC A;  2J9C A;  2RF2 B;  2HHX A;  5ETT A;  3QFH A;  2O66 A;  4WU2 A;  5K20 B;  3ELH A;  2RRA A;  1CJK A;  3HXM A;  2OIH A;  4KJI A;  3BPS P;  1OO0 B;  4ZHR B;  3D1H A;  1M90 T;  3QRQ A;  2DY1 A;  2G9O A;  2DGT A;  3HX9 A;  4WTY A;  1VI7 A;  2XMA A;  1VBX A;  3TR5 A;  2R7X A;  3R7B B;  4NLD A;  3OJU A;  4XPE A;  1X0P A;  4PR6 A;  2UVR A;  2QG9 B;  1NBE B;  2MQN A;  2UUC F;  2F1F A;  4WPA A;  3DLG B;  4DUT A;  3FCW A;  5AXM A;  3UPF A;  5DDR C;  3GV8 B;  3DU5 A;  2FJV A;  5BR8 F;  4AUK A;  4TNO A;  3A12 A;  1JLB A;  5HP1 B;  1H2V Z;  2CRL A;  2DEI A;  3B82 A;  3RUB L;  3GR0 A;  2ZOG A;  2CUY A;  2GJF A;  1RAO A;  1V9O A;  2ACY A;  2CQD A;  2DTJ A;  4V19 X;  2Z8Q A;  3IWN C;  2AJF E;  2QE5 A;  4DS4 A;  2HQF A;  2EFP A;  4X66 J;  1YJ9 S;  2NLW A;  3CD0 A;  2VHG A;  4CLF A;  4OL8 A;  3OV7 A;  3C14 A;  3OR1 B;  2MSS A;  1WG4 A;  3CJK A;  2NUU G;  3HFK A;  4LF4 F;  1YBU A;  2PSZ A;  2HVE A;  1FFG B;  1O5J A;  2J7U A;  4Q43 A;  4Z7C A;  2HLT A;  1WC6 A;  1HWU A;  3VCD A;  3MFH A;  2J7K A;  5HRO B;  3W8G A;  7FDR A;  4DSK A;  2QYG A;  5CYQ A;  4U7U K;  1VIO A;  2F5G A;  1PAE X;  2I1R A;  2Q1L A;  2ZNZ A;  4HLB A;  3VTI A;  4ZLL A;  2I6W A;  3K2Y A;  1W26 A;  2NSC A;  4DU8 A;  4KHR A;  2CQ2 A;  4JV2 A;  2I8E A;  2BQU A;  2PEB A;  1FT8 A;  2BJ7 A;  4P74 A;  3GLJ A;  3R1H A;  4NXM J;  1D3W A;  2OFH X;  4NLX A;  4ED0 A;  1U6F A;  2ZEJ A;  1IR1 A;  1NU4 A;  2ZUG A;  2YKA A;  4F0H A;  1QVF R;  2NR0 A;  2B4U A;  4PAB A;  2P9C A;  2ASD A;  2B9E A;  4ZCI A;  1JLG B;  3C6U B;  3GB0 A;  2R7S A;  5A6P A;  4QIV A;  4U7C A;  4FS2 A;  4JI7 F;  2H4Y B;  3FMW A;  5KFL A;  1ZZN A;  1KQS R;  2C3Y A;  2MKC A;  3RRH A;  1V3S A;  2N3L A;  2YVS A;  5A6W A;  3TYT A;  2PI4 A;  2W4P A;  4J90 A;  3KLF B;  2YH0 A;  3GJT B;  3M30 B;  2VJU A;  3R5C A;  1WTB A;  2KTQ A;  4DV6 J;  4RW4 B;  4JI5 F;  4OZJ A;  4YOE A;  3L9Z A;  5KG6 A;  1UKU A;  2HND B;  2HZC A;  2IM0 A;  3JB9 k;  1ZA2 B;  4NXN F;  3DGV A;  2KM8 B;  5C25 A;  4J9V A;  2PDA A;  4KQZ A;  2LEP A;  3RAM A;  2CJ9 A;  2DNG A;  2K06 A;  2VPY B;  8AT1 B;  5LMN J;  2JSX A;  2KXF A;  1J2V A;  4ZJL A;  2QIF A;  2WAQ D;  1HL6 A;  3C66 A;  1DTT B;  2E5G A;  3F44 A;  4OI3 A;  5JJB A;  3BSO A;  5KFU A;  4GC7 A;  1T9W A;  1N56 A;  5J2Q B;  2CPE A;  1FES A;  4LRD A;  2CDR B;  2MHE A;  4QYR A;  3NS7 B;  3TX8 A;  5F8H A;  5DDP C;  2CQ3 A;  3CCE S;  2H1Y A;  1C1C A;  3MPU B;  3J7Y I;  2F7V A;  4Y28 C;  4B3T F;  2HIQ A;  5KFX A;  1LV5 A;  3L95 X;  1KHW A;  1VK8 A;  3VAK A;  5LXR A;  4LF8 J;  2BRL A;  1RSC A;  1S1U B;  4KY3 A;  1QY7 A;  3KLG B;  3CJ2 A;  5DM7 Q;  3GG0 A;  4K4V A;  3LH2 S;  1S1V A;  1TKT A;  2F63 A;  1DJ0 A;  2D1C A;  4IKA A;  4EUV A;  1SV5 A;  2VQE F;  4DV3 F;  4ZVP B;  2ZDO A;  3DMJ A;  3MCN A;  3SCJ E;  1SQF A;  3KK1 B;  4JI4 J;  1G2E A;  3SSR A;  3H2V E;  2NXE A;  1RAH B;  4DHV A;  1TK5 A;  1Q81 T;  4MK8 A;  5DS7 A;  1HR0 F;  2QEX S;  4MTP A;  5D4P A;  4F0M A;  2E5L F;  1WSR A;  1FJ7 A;  5CCM A;  5HK4 A;  1NDP A;  2EC0 A;  2E66 A;  4ZCM A;  4ER8 A;  1U1N A;  1RAF B;  1NK6 A;  4ZP9 A;  5HMX A;  2COL A;  4ZJQ A;  2HS3 A;  2O3D A;  3W5Z A;  3C14 B;  1SJ4 P;  2CJQ A;  2M52 A;  4HT7 A;  1IBK J;  4KT0 C;  1T0T V;  1N32 J;  1WKL A;  3NEK A;  3MEE B;  2IDE A;  3LPY A;  1BHN A;  2CKW A;  1TK8 A;  1URR A;  4ZA1 A;  2DGS A;  4OJH A;  1WEX A;  3N79 A;  4K4T A;  1XC9 A;  2D3Z A;  3IBW A;  2B5J A;  4QWE A;  3OL8 A;  3TAR A;  2B5J B;  4NLU A;  1HWI A;  1UA1 A;  3CJQ A;  4B9S A;  4X62 J;  1U45 A;  3PW0 A;  2Q6B A;  3E51 A;  4TQR A;  2JC0 A;  1WC3 A;  2CDQ A;  2FQQ B;  4FYX B;  4OX7 A;  3OR2 B;  5KG2 A;  2FLO A;  4F4W A;  2RS2 A;  1QUP A;  2PI5 A;  2UXC J;  5GAG I;  3EWG A;  4BC9 A;  3GQC A;  4EZ6 A;  3QFW A;  3T19 A;  2VA2 A;  4PRF A;  2ZH4 A;  3A8I A;  3RU0 A;  2XZD B;  1FTR A;  2UUW A;  2ZVS A;  4I0W A;  2M88 A;  5GMK a;  2CQP A;  1NO8 A;  2XS2 A;  4TKT A;  7FD1 A;  2FVC A;  3RR8 A;  1FDA A;  2C3U A;  1XK8 A;  3C19 A;  3QAE A;  2EFQ A;  3AJD A;  3SCL E;  4YUD A;  3ILI A;  3K89 A;  1LWF A;  5L1I A;  4GKJ F;  2Y1L B;  1XMQ J;  2KJV A;  3CD5 A;  2WW4 A;  3CW2 C;  4RUB A;  4O3N A;  2EBE A;  1WEL A;  1NJZ A;  4ZN1 A;  2DHX A;  2YX1 A;  3BGL A;  2AX0 A;  3T5K A;  5ETR A;  3HSZ A;  2JEI A;  2CQ4 A;  1L3U A;  1WC4 A;  1X60 A;  4MIA A;  3PYG A;  4UOC A;  1YZ6 A;  2BAC A;  3US5 A;  2OPR B;  5CQG A;  4N7T A;  4NA1 A;  1H0H B;  2V2Z A;  2B3T B;  4PXD A;  4ZIW A;  2J6S A;  2UUB F;  4ZVH A;  4OZL A;  2CYY A;  4Y3C A;  2MKK A;  1M5H A;  1NSA A;  1M5O C;  5SZT A;  2HK3 A;  3AHP A;  4D3G A;  3LWL A;  3V6D A;  4B3S F;  2QL7 B;  1MSW D;  8ATC B;  3M4X A;  1GTE A;  1U47 A;  1FRJ A;  1DTT A;  1SPB P;  4F4X A;  4HDH A;  2WSE C;  3MM6 B;  4NYZ A;  1TP7 A;  5J2Q A;  1JMT A;  1N8R T;  3QMQ A;  4OZ5 A;  1VRT B;  2EWH A;  3R2D J;  4WXW A;  3UN5 A;  3Q0A A;  3ET6 B;  1RWW B;  5DZ7 A;  3VF0 B;  5E3A A;  3GIL A;  1CC7 A;  2JVO A;  4YB6 A;  1FD8 A;  1QAJ A;  2PFD A;  5E3R A;  2RU9 A;  1D1U A;  3TWZ A;  2VON A;  4IOA Q;  2IM3 A;  1DAR A;  4ES2 A;  2G1H A;  1S57 A;  3P5T L;  5HQ8 A;  3GFX A;  4OV1 A;  3PJX A;  3R5D A;  2RDJ A;  1VC0 A;  4C2M A;  1VBY A;  3HDS A;  2FLN A;  5AJ3 J;  4I2Q A;  4OX8 A;  3MM9 A;  2W2N P;  5JXS A;  5F8J A;  1V3R A;  4F7V A;  5DQH A;  4C48 A;  3NKY A;  4QBU A;  2ZZT A;  1T9V A;  3KHH A;  1SXL A;  5KFF A;  1DBD A;  3CO0 P;  1JLG A;  5THW A;  5AE1 A;  1F9H A;  5KFS A;  4RX6 A;  3CJ3 A;  2MZT A;  2HKE A;  3B54 A;  2NYH A;  1S1W A;  4I6A A;  1VQY A;  3MEC A;  2AZ1 A;  2CNK B;  1H7W A;  3NLC A;  2UP1 A;  4B9U A;  4LSN A;  2IAJ B;  4KFB A;  1W2I A;  2BE7 D;  4MFB A;  5ETV A;  5AT1 B;  2NYI A;  2Y9H A;  3BH7 B;  3MR7 A;  1YZ7 A;  3K8V A;  5LMU F;  4JI4 F;  3JS9 A;  1KSP A;  1HYS B;  4O44 A;  4P2F A;  4WU3 A;  4YR3 A;  3NNA A;  3UW1 A;  2YNF B;  2DNR A;  2Z56 B;  2PII A;  4AYB D;  4BCA A;  5F9L A;  1FRK A;  2KJW A;  3GYN A;  5IT4 A;  1SIW B;  2DHS A;  2UXD F;  2RQC A;  1SV5 B;  2HWT A;  4IO1 A;  4C98 A;  1KOO A;  3OHB A;  2BOA A;  1WHX A;  2BZ2 A;  3MMB B;  2RE1 A;  4MFB B;  3KK1 A;  2W8L A;  3OT9 A;  4DR5 F;  4F4K A;  4F26 A;  1SUQ B;  1SL0 A;  4ELU A;  2YQ1 A;  1KBR A;  2PE8 A;  1Q8B A;  1S1V B;  2Z58 B;  4G1Q B;  4F3O A;  3AQO A;  5AXK A;  3T1A A;  3RG6 A;  1DRZ A;  2K7K A;  4DR2 F;  4MIB A;  4R5P A;  4CH0 S;  1IR2 A;  3UR3 C;  3VZI A;  2RRB A;  1KQF B;  4DQS A;  3I6P A;  4UOH A;  3S1T A;  4IFY B;  1O8B A;  5CD4 A;  2NCK L;  3BPD A;  4X4U A;  5CHC B;  4ECX A;  5H9F K;  1OWX A;  1YI2 S;  4WP9 A;  2K3K A;  4UUX A;  3DLG A;  1IJE B;  1R8A A;  5DQG A;  5BYQ A;  2MLY A;  3I0R B;  1UTA A;  2WB4 A;  4NA3 A;  1K47 A;  4ID8 A;  4WK1 A;  4J9R A;  1YJT A;  3C8Y A;  3N28 A;  8RUC A;  2BJD A;  1NKB A;  3ET6 A;  1SQG A;  3BYP A;  1U48 A;  2IY5 B;  4ED2 A;  1BY9 A;  2JLE A;  3H20 A;  2HHH J;  2E1P A;  4ECR A;  5H1S V;  2BA9 A;  4RW8 A;  1NHV A;  4CO2 A;  3JQK A;  3BH6 B;  4ECQ A;  1JJH A;  3SQG B;  4R0J A;  2YKM B;  4F04 B;  1XNR J;  2KL8 A;  3LAK A;  2VL1 A;  3V6D B;  2ATC B;  3NBP B;  4HHH A;  1MG7 A;  4J91 A;  1RA7 A;  1S12 A;  3MXH P;  4ED1 A;  2KT2 A;  4BBY A;  1MN9 A;  3IP0 A;  1DZ5 A;  2YNI A;  4DR7 F;  1MNE A;  3FNN A;  4ZVS B;  2ZH5 A;  1FNM A;  5BJR A;  4G1Q A;  2F9J A;  2EK1 A;  2QGF B;  5KFT A;  2FLP A;  2HRT A;  2UUA J;  1C0T A;  4QU7 A;  4Y65 A;  1GMW A;  1JJ2 R;  2FIU A;  4TYA A;  3T9Z A;  5A8R A;  3TZZ A;  4OYW A;  1MLA A;  2DNY A;  2JH3 A;  3NGK A;  4HHU A;  5GAD U;  2C2E A;  4GKJ J;  2HHW A;  4FXW A;  2NXC A;  2OML A;  2IBO A;  1HBU B;  2QMX A;  1U2C A;  3Q83 A;  1SKU B;  3FK4 A;  2W9C A;  2JEJ A;  3POT B;  2BKO A;  3TZX A;  3V4I A;  3CCJ S;  4CM0 A;  2CPZ A;  3FJ2 A;  2GS8 A;  4J9L A;  2U1A A;  1CJT B;  2WOM B;  4J37 A;  5FDL A;  5H9E J;  2GVZ A;  1CSJ A;  2J0X A;  3UVJ B;  3QSY B;  1TKX A;  1NDK A;  2PO4 A;  4BHQ A;  4PAA A;  1SKR A;  1RAA B;  3QLH B;  3C3L A;  2DR7 A;  4DXL A;  1IWG A;  2VBX A;  3PAC A;  3QGI A;  1FWL A;  1RTD B;  4BWM A;  3HVW A;  5L9X A;  2JC1 A;  3G6V A;  2HSE B;  3FQK A;  1E6Y B;  2VF3 A;  4Q2M A;  6FD1 A;  3I56 S;  3CUL A;  4IFV A;  4G65 A;  3D2W A;  3OBI A;  4DCO B;  3BDP A;  1PG5 B;  1YJN S;  3D28 A;  4DQR A;  3S7R A;  1N5S A;  2XQC A;  1N5Y B;  2AJ1 A;  2KXN B;  5I3U B;  4NCB A;  2V4J A;  3K5P A;  4OYX A;  2HFO A;  4ZPV R;  1ZH5 A;  2H65 B;  5KFJ A;  3DU6 A;  1EIY B;  2VIC A;  2DGX A;  1A7G E;  1JXV A;  2H5J B;  5F8G A;  4BDP A;  1RDR A;  1J5O B;  3B6B A;  3P4U B;  4ZHR A;  3M9M B;  2Y1J A;  3IA0 A;  1SC6 A;  2A1B A;  3W62 A;  2ZZM A;  1SBR A;  2VFT A;  2NXJ A;  1RT6 B;  3FBF A;  3F41 A;  4FZV A;  4NPO A;  2ZFH A;  4F36 A;  3HD1 A;  3MM6 A;  1Z2Z A;  2N82 B;  3LWM A;  4V19 J;  4TY8 A;  3Q86 A;  1FE4 A;  4HTJ A;  1HBN A;  1HNZ F;  1GMV A;  1S6U A;  3NAH A;  4LT6 A;  4CRJ A;  5A76 A;  4Y2A A;  2QSF A;  3SDE B;  1XIQ A;  1Y3J A;  1LW0 A;  2R9L A;  3RBD A;  2FVP A;  2XY6 A;  4JOU A;  5HAO A;  2E5L J;  4DUZ J;  3OFH A;  4GC6 A;  2MQM A;  5C42 B;  3ZZU A;  4DQI A;  3IM8 A;  2BXJ A;  3N6L A;  4Y34 A;  1VS3 A;  2LU2 A;  2WBM A;  3FRZ A;  1FI4 A;  1TL3 A;  3MDF A;  3VAG A;  2CPH A;  1ULR A;  1WD6 A;  3DOK A;  5ADZ A;  1X4G A;  4USW A;  1VJW A;  2ZBP A;  4YY3 F;  1WSV A;  3DGP A;  4ZP8 A;  1LWC A;  3WX8 A;  1S9F A;  2DR9 A;  2GFF A;  3ENW A;  2QN6 B;  2VG6 B;  2VZ9 A;  3QT7 A;  2QL9 B;  3K58 A;  4IO9 Q;  4IRC A;  4JI7 J;  5IQQ A;  3DNC A;  3X1L B;  1WF2 A;  4AT1 B;  4RW9 A;  2OPS B;  4ERD A;  3FEZ A;  2JLF A;  4M5D B;  3JAM U;  1SKS A;  5KFR A;  4ECT A;  4W92 B;  3PFE A;  5KFK A;  4C8Y A;  4HEA 9;  3KUE A;  1H98 A;  3W64 A;  3HVR A;  1UA0 A;  4OJG A;  1PYO B;  1AZS A;  2HHP A;  4IQM A;  3GMG A;  4TXS A;  4F25 A;  2R8J A;  3CD7 A;  3TUP A;  5J1P A;  1Q82 T;  2W7P A;  2K2P A;  1LK5 A;  2V67 A;  3R7N B;  3PM9 A;  5D0R A;  2DYA A;  2CZV C;  2RJZ A;  2YKQ A;  5F3T A;  3V81 A;  3IGV A;  4B3O B;  1UFL A;  2O67 A;  5I3Q A;  3OLA A;  3CCS S;  2OKQ A;  4KGM A;  2W9C B;  4DR4 J;  3O1L A;  2FYX A;  1RWP B;  2OI2 A;  4NRU A;  4WFA Q;  5DO2 A;  2D41 A;  4RO0 A;  1GX5 A;  5KG1 A;  2WON A;  1WEZ A;  1Q0N A;  3R9L A;  2EFV A;  3FCV A;  2D9O A;  2MQ8 A;  2P8I A;  2IAJ A;  4LIW A;  1IM4 A;  4UOF A;  1RI7 A;  1S79 A;  4NCG A;  2ILZ A;  4H54 A;  4FN5 A;  1TR0 A;  3MI7 X;  1I5O B;  2NZC A;  3LAM A;  2PN6 A;  2GX8 A;  2CIM A;  4ZN3 A;  3NXZ A;  2HIY A;  2I38 A;  3DM2 A;  3DRX A;  1FFW B;  2H3E B;  4KO0 A;  4CH7 A;  4QW9 A;  3MUT P;  3G71 S;  4DV0 F;  2R2S A;  2N4D A;  1E6V B;  3A13 A;  4XDC A;  2CJK A;  3G6E S;  1UW9 A;  2CPI A;  2E1C A;  1RWV B;  4U8V A;  2KN4 A;  2CG4 A;  3GII A;  1HQ2 A;  2VBW A;  3S6E A;  3NRB A;  3UCG A;  2GIR A;  3UD4 P;  1K9M T;  3QJP A;  4OHY A;  2G2Z A;  3VHQ A;  5D3G B;  2FHK A;  2V69 A;  1NHK L;  1BXN A;  4LR8 A;  1S1U A;  4NLO A;  3KLG A;  2W1B A;  4ELV A;  4UW2 A;  1RHM B;  1RAB B;  1S59 A;  3CTR A;  2W4C A;  4ID5 B;  4XTT A;  4P75 A;  3C15 A;  1YJU A;  2C28 A;  5LSL A;  1XR5 A;  4G1I A;  1KC8 T;  3IR7 B;  1DLO A;  5GAH I;  1X4C A;  4HT5 A;  3KNG A;  5ETM A;  3V4M A;  5HP1 A;  1WHY A;  2MY7 A;  3KJV A;  1T03 B;  1RTZ A;  2G13 A;  4O4G B;  3W66 A;  2LQ5 A;  1IKW B;  1ZM3 A;  1H6K X;  1SC4 B;  4G6V B;  4USM A;  2X1F A;  2ZBQ A;  3TA1 A;  2IFX A;  4FDF A;  2DNL A;  4OI1 A;  3P49 B;  2FZG B;  5HAT A;  2YWW A;  2RQM A;  4LF9 F;  4CLU A;  2ERR A;  1B0T A;  4GRS A;  3MD1 A;  3MPD A;  4LIR A;  2UU9 F;  2LEA A;  2R7Q A;  4ATN A;  1M1G A;  4ZOS A;  2N7Y A;  1JLC B;  3T9N A;  5AE3 A;  3MAA A;  3RRK A;  1MWQ A;  4YR0 A;  1WF1 A;  4DLE A;  1Y7P A;  5EGY A;  4AL5 A;  3BKF A;  2VOO A;  2J0W A;  1TVR B;  7AT1 B;  1U26 A;  4OZ1 A;  2GQC A;  2E9T A;  2X7I A;  4XAK A;  3IS9 A;  4B3M J;  1LW2 B;  1NPK A;  1OQ3 A;  5HBM A;  2BJE A;  1KP6 A;  5BYR A;  3M1V B;  2DH8 A;  4CI0 B;  3GIJ A;  2HMI A;  2KG1 A;  2Y3Y A;  2CQ1 A;  3OFG A;  4WKY A;  3N6M A;  3PEJ A;  1LNQ A;  3HSD A;  1ROF A;  1S99 A;  1WF0 A;  4I4B A;  4ZPC A;  3TO8 A;  1KTV A;  2FVR A;  3EE3 A;  3TOQ A;  3UDE A;  4YR2 A;  2DRA A;  4K0K J;  2E5J A;  1REG X;  2M9K A;  2DVI A;  2VFV A;  1IBM F;  1HHS A;  2DPI A;  3QRR A;  2HFV A;  3NGR A;  4PXE A;  4RNO A;  1KWM A;  1S1W B;  5L8R C;  5KOX A;  1IKV A;  3OTD A;  5T7L A;  3R97 A;  4DCP B;  1FJG F;  4FPI A;  1QLN A;  3W2W A;  4WXO A;  3SEO A;  4X4S A;  3MM8 B;  3BGF A;  3MUV P;  3R5J B;  5KFD A;  2M70 A;  4Z2X A;  2FTR A;  1S0V A;  2JL9 A;  1J27 A;  4WP8 A;  1JX4 A;  3CCV S;  1HWL A;  4DX6 A;  3KLH A;  3H4D A;  4I64 A;  2F8H A;  4C8N A;  2GJ2 A;  2LEC A;  4RUC A;  4Z37 A;  2X51 A;  2XSJ B;  4CQ1 A;  2CAD A;  2VUG A;  4K4X A;  2GVZ B;  3V6J A;  3W2V B;  2WOM A;  4HH0 A;  3DC2 A;  3PHE A;  3RBX A;  3W2V A;  3UE2 A;  4OLP A;  3UR0 A;  5E5N A;  3UVJ A;  4YQW A;  3BSN A;  5GME A;  4MYU A;  1RB0 A;  4M5K A;  5DG9 A;  4LF6 F;  2W01 A;  2BDP A;  4RW7 A;  1TV6 B;  3WIU A;  1N34 F;  1C1C B;  2MKS A;  1R89 A;  3NMR A;  4X64 J;  1UWA A;  2OPS A;  2ZKT A;  3GFY A;  3NWG A;  5KG3 A;  5RUB A;  1VHF A;  1F1B B;  3D9B A;  1N6Q A;  1WNE A;  4UY8 T;  1T03 A;  4CWB A;  1JKH B;  1TL1 A;  2IPO B;  1SQE A;  1WDD A;  2JVR A;  2VPX B;  1RCO B;  4ZMM A;  3EMT A;  4ID5 A;  2C2O B;  4NXM F;  3E8O A;  4DG1 A;  1SH0 A;  4YY3 J;  4N5S A;  2IBK A;  2R7R A;  4P71 A;  2GV1 A;  2E5H A;  4ZKA A;  1Q5V A;  2I5J B;  1CJU B;  1W25 A;  4RL1 A;  2V68 A;  2XHW A;  2YX4 A;  3AQP A;  1O0P A;  3MEG B;  2ILY A;  1OSC A;  3QNW B;  4KHP F;  1SCJ B;  1UVL A;  2DHG A;  2P5V A;  1F9E B;  2EKY A;  2BRK A;  2DNK A;  4I6W A;  1RYR A;  3TVY A;  4ILM A;  1OIA A;  2XMT A;  4PWW A;  2WK4 A;  1QUV A;  4E8U A;  1HHQ A;  1X4F A;  3GV5 B;  2BJ9 A;  3BYR A;  2X3G A;  2HLU A;  3NGU A;  3UD5 A;  3ZZ0 A;  4ETX A;  4ZCL A;  1AT1 B;  1VBK A;  3MR3 A;  1NSP A;  2CQG A;  2AX1 A;  3GP9 A;  4GVB A;  2V50 A;  2FJW A;  1T94 A;  4RW6 B;  4RNH A;  4H4M A;  4Q0B B;  2YX7 A;  1TL4 A;  2KT3 A;  1YSJ A;  1RJJ A;  2OHD A;  1TUV A;  4QR0 A;  2XO6 A;  1GXT A;  2XMK A;  3D6H B;  5IC6 B;  1TL1 B;  3RGI A;  3IFE A;  2NUH A;  3ILO A;  2YWH A;  2ZD1 A;  2IRY A;  3R3T A;  2RVJ A;  5IS2 A;  2ASL A;  1B4S A;  4E2F B;  3Q8R B;  2CXE A;  2J76 E;  3CJK B;  1UFW A;  4J9Q A;  1NJX A;  4KPY A;  1H2T Z;  1KHV A;  1X9M A;  3CJS A;  3CCT A;  3DOL A;  4X4Q A;  1KQG B;  3IRW P;  4A8K A;  2BM0 A;  1IBK F;  1BWE A;  3OL6 A;  1S10 A;  2CZ4 A;  2HGN A;  2OEL A;  4K4W A;  1RIS A;  4OI0 A;  1CVJ A;  2ZH1 A;  1EZZ B;  3WX4 A;  5D8H B;  4AQY F;  1FCA A;  3MTJ A;  5LL6 d;  1SUQ A;  1Q5Y A;  2PMH A;  3HVA A;  2AU0 A;  5KT4 A;  3AH6 A;  2E7W A;  1SL1 A;  1WHV A;  2EW9 A;  3SV3 A;  1HMV A;  2BX6 A;  3PIO Q;  4USV A;  3TEH B;  5CZV A;  4ANE A;  4DN0 A;  2P6S A;  4CYU A;  1CG2 A;  5T7L B;  2GVD A;  3W2W B;  3QAT A;  4ES3 A;  1BWV A;  1RWM B;  3D68 A;  2X1A A;  3TJ9 A;  2D3O R;  3BGR B;  1QVG R;  3PJ9 A;  3BQ2 A;  1DQA A;  2HPU A;  1PGZ A;  3G6X A;  1KTQ A;  3KTQ A;  3PW4 A;  5D4O A;  1RT3 B;  3MEC B;  1KFD A;  3ONQ A;  3SIP B;  5C42 A;  3I5C A;  4LSN B;  4DV4 F;  3AT1 B;  2HQG A;  3K17 A;  1NK5 A;  2ZH7 A;  1VQ5 S;  2BJ8 A;  5EUH A;  2DH7 A;  1X5T A;  4K7Q A;  4NX9 A;  3NP5 A;  1RZM A;  3NBP A;  2RD5 C;  3QPI A;  2V4Q A;  4QIF A;  1HQE B;  3UDC A;  3ZTQ A;  3LP0 A;  2LQB A;  4I1T A;  4LF9 J;  5DGB A;  3THT A;  2J8S A;  4CLS A;  3EIC A;  3PKY A;  3M8R A;  2XO7 A;  1BQX A;  1V5V A;  4IH7 A;  4QIG A;  5D0H A;  4K4Y A;  2YTC A;  1L3S A;  3OFE A;  1DY3 A;  2E1R A;  2YNG B;  4CM2 A;  4CO5 A;  4WWS A;  1W7W A;  2VKZ G;  3HI9 A;  4USK A;  1T3O A;  5D0E A;  3J81 Y;  2YH1 A;  1YTY A;  2I2Y A;  4QJV A;  4O3Q A;  1RT2 B;  4ZVT B;  5A0Y A;  1G4C A;  1JLE A;  4NLY A;  3K8W A;  2B43 A;  3NGS A;  5DDO C;  5L1L A;  2R4F A;  2DKO B;  1PJ6 A;  2FD2 A;  3DYA A;  2VV5 A;  3AD9 C;  1IKW A;  3V6K A;  4C0B A;  3QRP A;  1HI0 P;  4O4G A;  3KJF B;  3KLF A;  1UVI A;  1XN9 A;  4DU7 A;  2DNN A;  5F0U A;  1QAI A;  1TV6 A;  4X84 A;  2MQO A;  2ZBC A;  2U2F A;  4OI4 A;  3NL0 A;  1Y11 A;  2GO8 A;  1IBM J;  2F4V F;  4OFZ A;  2HW3 A;  4PPZ A;  3FBB A;  3QIP B;  4H4K C;  4JI6 F;  3MPW A;  4XDD A;  1HWK A;  5FLX U;  2SXL A;  1KKH A;  1RT1 A;  2ZC4 A;  1HNI A;  4YEA A;  4LUB A;  3TAP A;  4LF7 J;  3PKM A;  3D7S B;  3MCS A;  5K8M A;  3KDN A;  5H9E K;  1RWO B;  3DDN A;  4LRB A;  1J5E J;  1QTN B;  1RU1 A;  2QFI A;  3LP1 A;  3R7S B;  5A8W B;  1E6V A;  5CXT A;  1K73 T;  2MKH A;  2OD4 A;  4LF6 J;  1VQ8 S;  5KOW A;  4LMZ A;  2X3D A;  3U1L A;  2PD1 A;  2AIR B;  2YPY A;  3CCW A;  4MK7 A;  5B0F A;  3QYY A;  4IG3 A;  2UXD J;  3KK3 B;  3KK3 A;  1VQ7 S;  2PEH A;  2KFZ A;  2DNQ A;  4JV5 J;  2XM3 A;  2QL5 B;  2WON B;  4BS2 A;  1UEU A;  1S1T B;  3CJ0 A;  1RWX B;  1X4A A;  3R27 A;  2XCA A;  4FF1 A;  3EGN A;  3MED A;  5M2U A;  1XJW B;  1C4A A;  1BD6 A;  1Y00 A;  3FUY A;  3OSN A;  2OPQ A;  1AFJ A;  2ATL A;  3UQS A;  4R8U A;  4C6A A;  1SJ3 P;  3P45 B;  2RKI A;  4FYW B;  1JIH A;  1T05 A;  4K0K F;  2IM2 A;  2YBV A;  3MM8 A;  2ZH8 A;  3QQC D;  1RT4 B;  1JJC B;  2FPH X;  4QW8 A;  3OSP A;  5AE2 A;  4C97 A;  3CJ5 A;  3BSA A;  4DR1 F;  2QC3 A;  3KLI A;  1UL3 A;  3ENQ A;  4KKO A;  3F73 A;  4EYI B;  1NSK L;  2ROG A;  4DV2 F;  3LW5 C;  5HJX A;  4AQY J;  2HNZ A;  4KGX B;  5ETP A;  3JSY A;  4YB1 P;  4PCQ A;  4W90 B;  1UVN A;  2AWZ A;  2AW0 A;  1Y5N B;  1OMS A;  2MZS A;  3NNH A;  1NHU A;  4F3M A;  4C0O C;  2R7W A;  1FKP A;  4DL7 A;  1R0C B;  3QWU A;  2DCL A;  3ZZR A;  2DR5 A;  1RAD B;  2BUN A;  1NH8 A;  1Q8I A;  4KTQ A;  1A9N B;  1QAY A;  3VQT A;  5KG0 A;  3G8T A;  2VG6 A;  4TU7 A;  2GMH A;  4UZB A;  1T95 A;  2C1E B;  4HAC B;  1FJE B;  1H72 C;  5KG4 A;  2VQE J;  1N88 A;  2R8G A;  3KYL A;  4OZ2 A;  4B3M F;  4TU9 A;  2IVM A;  4QWA A;  1YHQ S;  3Q8U A;  4NLR A;  2B4V A;  2DRB A;  3BO4 A;  1S4E A;  5D3G A;  5G0R A;  2RHS B;  3M2R B;  2QLW A;  4U7U D;  1P6T A;  3OUY A;  3BN7 A;  1T3N A;  4A46 A;  2AP6 A;  2D69 A;  1NB2 A;  1WOP A;  2F8E X;  4ZPW R;  1DAX A;  3T6B A;  3SV4 A;  4DL2 A;  1XNQ F;  4YFU A;  1HAR A;  3BR9 A;  2DHA A;  3VQS A;  2J0S D;  4JYA F;  1LWE B;  1LK7 A;  3EVW A;  3ITH A;  4QPX A;  1LQ9 A;  4I68 A;  2B7C B;  3R5G A;  3RYL A;  5J2P A;  2E1M C;  3OTB A;  1XR7 A;  1EET A;  2HAI A;  3B4D A;  3PTW A;  4NEZ A;  3WQP A;  3JTN A;  2RDD A;  4PZV A;  1VIS A;  2Y8W A;  3MCO A;  5KFB A;  4PKD B;  2FY8 A;  1VHI A;  1MU2 B;  3HD2 A;  1FHT A;  3GG1 A;  3Q8P B;  4FNH A;  3A8K A;  5EWE A;  4ED8 A;  4Y0F A;  1N5Y A;  1F2G A;  1N34 J;  4HDG A;  3T5H A;  2DK2 A;  3CCL S;  1ZZF A;  2YWG A;  4F4Y A;  1R8H A;  3C2P A;  5EWF A;  2RKI B;  1X4B A;  2HBR B;  1TUG B;  2MQQ A;  2Z4P A;  1YKW A;  1S72 S;  4NML A;  1JK9 B;  4NLQ A;  2BKP A;  2PGC A;  3AD7 C;  1S1T A;  3FKB A;  3MR5 A;  1TFY A;  3HZG A;  2ZDP A;  3ZZT A;  1SKW A;  4DUY J;  2CAJ A;  4IG3 B;  3OW2 R;  3MMB A;  5KFZ A;  4L75 A;  4QYZ J;  1PBU A;  3GV7 B;  4B9T A;  4PQU A;  1R6Y A;  2QMW A;  1TMM A;  1LFW A;  4NE9 C;  2J8A A;  4QQB A;  2V8D A;  4IOB A;  1HBU A;  2AF6 A;  3D3B J;  1WOO A;  3KLE A;  4MK9 A;  3DLE B;  1AA1 B;  4M5L A;  3THV A;  1F2H A;  3DGP B;  3N5F A;  2G2O A;  3G2X A;  1F9F A;  4C4W A;  3IWL A;  3SSS A;  1PJ7 A;  5CYM B;  1EAR A;  1AUS L;  1M5S A;  1UJ4 A;  1VIX A;  3DI6 B;  4X4V A;  3R5A A;  2MMY A;  4EGL A;  2H9Z A;  3ILL A;  1B64 A;  4IRK A;  3RB6 A;  1D9A A;  2CQC A;  4Y2I A;  3LQV A;  2BV3 A;  2QRR A;  3U7J A;  4JI8 F;  3MFI A;  5KFW A;  5A8K A;  1UET A;  2XG8 A;  3E3X A;  4ZJO A;  4U6P A;  3J80 U;  2GNK A;  2CVI A;  2KM8 C;  1WJ9 A;  4B3S J;  2QLB B;  3SBM A;  4UF4 A;  4JUZ A;  3T6J A;  4URS A;  1RCX B;  3LF0 A;  4RW8 B;  3P8B B;  3L7P A;  4ZVE A;  1P27 B;  4LR9 A;  1KNZ A;  5G4D A;  1CJV A;  4J9N A;  4JI6 J;  2LXF A;  3ETM A;  3SCK E;  3UCZ P;  3M8Q B;  4X2B A;  5IWA J;  5ETN A;  3OR2 A;  1YGY A;  2OEK A;  1U09 A;  4DL4 A;  1KEK A;  5AXL A;  4A4J A;  2KH9 A;  1KR4 A;  4IH5 A;  1NK9 A;  5EHH A;  3MOJ B;  4WIQ A;  5E3Q A;  3UO0 A;  3RB0 A;  4UZC A;  2XYP B;  3NGT A;  4C8M A;  3AA8 A;  2AGO A;  5T14 A;  1S97 A;  1ZPW X;  3BN4 A;  1WEY A;  1S7H A;  5J2N B;  5A2Q U;  3GJR B;  4WK3 A;  4X66 F;  4WCE Q;  2MLZ A;  3FBE A;  1AUD A;  1M5P C;  2X1G A;  3D66 A;  3G9C A;  2BBE A;  1SH2 A;  2GML A;  3ZZY A;  4EZ9 A;  2B6A B;  2OFG X;  6FDR A;  4XIU A;  1WOR A;  2GIF A;  2CG8 A;  1MMN A;  1NM2 A;  3DI6 A;  1TQL A;  2WBR A;  3FBC A;  3GSI A;  3QGG A;  1ACM B;  5I3P A;  4CNZ A;  1XER A;  2ZJR Q;  3TUZ C;  4KC5 A;  4CIO A;  1N36 F;  5JUM A;  3M6W A;  5KFC A;  4DV4 J;  3CME S;  2OPP B;  1RK8 A;  2FHJ D;  3BGR A;  5KFI A;  3Q8Q B;  4DZ6 A;  1HLW A;  1GEH A;  4J5O A;  4USJ C;  4DR5 J;  4L72 B;  5A8W A;  2ADB A;  2AJ0 A;  2C2N A;  3O8W A;  2YNF A;  3DDI A;  3CF5 Q;  5IV3 A;  3LGH A;  1IQZ A;  2J6U A;  2VG5 A;  2KI2 A;  1VR6 A;  2XMJ A;  2VBZ A;  2D9P A;  3BGO P;  5EX0 A;  4X4R A;  5A8R B;  2JEF A;  4PUO B;  4FXV A;  1RBO B;  4C3M A;  5BXI A;  2LLZ A;  3CCR S;  4LFC F;  4OYA A;  4J9P A;  2W2M P;  1ITP A;  2XHC A;  3DOL B;  4MT1 A;  4P52 A;  5LJ3 Y;  3KDO A;  2AYE A;  4HKQ A;  1C0U A;  1FFS B;  1NEE A;  3I9V 9;  3A8E A;  3MEK A;  4NXN J;  2PT0 A;  3EX7 B;  5DLG A;  2AYG A;  4PWD A;  1WI8 A;  2Y0B B;  5C24 A;  3TAN A;  3NNC A;  1R43 A;  2XYH B;  1NKC A;  4TYB A;  4ZIT A;  5L1K A;  4DV7 F;  5I4M A;  4JI5 J;  4LF5 J;  4C0H A;  1UVJ A;  4C11 A;  3ZXW A;  2ZWO A;  2K3I A;  2Z2L A;  1T11 A;  2ASJ A;  5HN0 A;  1R7I A;  3M8S A;  1XTZ A;  3JTP A;  3N4W A;  5DG8 A;  3CWJ A;  5DJB A;  4ZDN A;  3GJS B;  1IWA A;  3CJ8 A;  4I6Y A;  4OZN A;  1VLO A;  2HGL A;  3MEE A;  2WW8 A;  4J9O A;  3HFV A;  3OTO J;  1PO6 A;  1L5U A;  4F3Q A;  4USI A;  3CCZ A;  2C2R A;  2ZH2 A;  3QJJ A;  2JZ5 A;  3MOZ A;  2NPF A;  1N48 A;  2DXF A;  1N54 B;  5L46 A;  4K5R A;  2M5Y A;  3OTC A;  2CJX B;  4BC7 A;  1RTH B;  2IC3 B;  1R8B A;  2OD6 A;  3I4H X;  4KV8 B;  3FSY A;  2OLW A;  2WVE A;  4MAK A;  4LFA F;  2ZM6 J;  2NS1 B;  5D6G A;  1QSY A;  2W7O A;  3HK2 A;  5KFP A;  2R42 A;  3EVM A;  4DMZ A;  4OYP A;  5HVG A;  2DGW A;  3DRS B;  1UW4 A;  3HFZ B;  3M2R A;  2E1A A;  1M5K C;  1RT1 B;  2B51 A;  1YJV A;  4Q45 A;  4J7C A;  4N8N A;  4C7Q A;  3MUM P;  4ZVO B;  3U1N A;  5KFA A;  1RE1 B;  2DIV A;  2WVB A;  3PIP Q;  3G4S S;  4MH8 A;  1PCA A;  1Q16 B;  1Q7Y T;  2G0J A;  4E0D A;  2UV8 G;  2LQ9 A;  3L4B C;  3IMQ J;  2YXL A;  4L73 A;  5B08 A;  1XWL A;  3W9I A;  2HFZ A;  2R8I A;  2QA4 G;  3FGV A;  5B0E A;  3PDN A;  1TZ0 A;  5KFM A;  4CYU B;  3KK2 B;  4NAS A;  1YLX A;  1VQK S;  4Q8F A;  2V8H A;  4IR1 A;  5B0B A;  1KVK A;  3RR7 A;  1LWF B;  1HBO A;  2GHW A;  3PCO B;  2HHV A;  3EJM A;  1NCL A;  1OPI A;  3BR8 A;  2AYM A;  5HJY A;  2J7W A;  2KKH A;  3ETO A;  3VAL A;  1YJW S;  3W5X A;  1CUL A;  1JXE A;  2OSR A;  4DPW A;  4NLG A;  2VPZ B;  3MWB A;  1U8W A;  2VFR A;  2MJU A;  3I9Z A;  3W1Y C;  3AOA A;  3W3S A;  3DLK B;  4DI6 A;  3UD3 P;  4NWB A;  1X9W A;  1WG5 A;  3GIM A;  3PFO A;  4KKO B;  1YBT A;  2Z2Z A;  2CPD A;  4DL3 A;  2V5H G;  2HNY B;  5B09 A;  1FTC A;  1VJQ A;  4GVL A;  2DNH A;  3TQ1 A;  1RHK B;  4ECZ A;  1FVQ A;  1VOM A;  4A8Y A;  4KGZ B;  2ZD1 B;  3H7H B;  1D8Z A;  1NZ8 A;  3DOM A;  3VGT A;  1Y10 A;  3SZ2 A;  2ADC A;  4KO0 B;  2IIH A;  1EKR A;  3CMQ A;  2E7X A;  5LXY A;  3OPK A;  1SJQ A;  1UFK A;  1RBL A;  1GMW D;  2M8H A;  4MYT A;  3HPO A;  2RQ4 A;  1EX8 A;  2V63 A;  4U9R A;  2XSF A;  1Q1K A;  4ALZ A;  3THP A;  3O44 A;  2XS5 A;  4LSL A;  4L3N A;  4O4R A;  1VC6 A;  3Q24 A;  1MMD A;  2YPZ A;  4FPR A;  4AD6 A;  4B08 A;  3EDR B;  4X4P A;  1FX4 A;  3KMS A;  4M95 A;  1NLK L;  1LFP A;  5F41 A;  4NZ7 A;  1UJ6 A;  1YG0 A;  4RJV A;  4QZV B;  4EO6 A;  1L3K A;  4JBC A;  1RTJ B;  3GFZ A;  3IS9 B;  1FA0 A;  2FY1 A;  1FEE A;  1I6J A;  2UUB J;  2L9N A;  1X7V A;  1CJU A;  2J6T A;  2HNY A;  1GXL A;  2DO4 A;  3SMZ A;  1F5B A;  1M1K T;  3A3N B;  4I69 A;  4HTI A;  2XMM A;  3QSI A;  2BQR A;  3M8Y A;  1TU0 B;  1VYA A;  4FF2 A;  4HAC A;  5HO4 A;  1CBK A;  1YVF A;  3EGW B;  3PZP A;  1R27 B;  2AGP A;  4A8F A;  4PPD A;  3G86 A;  1ZAW A;  5L39 A;  3OTE A;  1EQM A;  3IBF B;  2B7B B;  2LQJ A;  1F60 B;  2CWX A;  1NDC A;  3CDW A;  2W9B B;  1KVI A;  2RAQ A;  1B0V A;  4USU A;  1S0M A;  2OH2 A;  3BBF A;  1UZD A;  2N7C A;  1WC5 A;  2JNJ A;  3KMQ A;  5E33 A;  3CGI A;  3JSM B;  1CQM A;  1N5T A;  3M8Q A;  3JQM A;  1HNX F;  1HD1 A;  1U02 A;  3PJW A;  3FEY B;  3PO4 A;  4HR2 A;  3FFI A;  5I3U A;  4EBE A;  1BQM B;  2GIQ A;  4CLZ A;  3T5L A;  4ED5 A;  3GCW P;  2EVZ A;  3HHK A;  5ITH A;  2VH7 A;  4IOC Q;  4OJ1 A;  5KFN A;  1T9U A;  4RKU C;  1LW0 B;  2R7O A;  5HVH A;  5F8M A;  5KG5 A;  2C3P A;  1MML A;  3I96 A;  1IN0 A;  4RNN A;  2E7V A;  4O3R A;  5LJ5 Y;  3BS9 A;  1NH7 A;  2HBQ B;  2V8V A;  4TVA B;  1BE4 A;  1RT6 A;  4BLG A;  5JMN A;  2YNH B;  2P2C B;  2HRU A;  4NI2 A;  2DXD A;  2IC3 A;  3TA2 A;  1RA6 A;  3R6G B;  4ED3 A;  2DR8 A;  2OTL S;  4XO0 A;  1RXO B;  1VRQ C;  3W63 A;  5I42 B;  2V8P A;  5FDL B;  1HPZ B;  4U67 Q;  2B8P A;  1Y4Z B;  2RQK A;  2IJF A;  4ICL A;  1TL7 B;  2JOQ A;  2KHD A;  3NAI A;  3HP6 A;  3CJT A;  4IR9 A;  1P1T A;  2L3M A;  4WE1 A;  4YB5 A;  3A4T A;  4CP5 A;  3T1H J;  5ETQ A;  4WII A;  4NI2 B;  1R0A A;  1IVZ A;  2GVD B;  1FWK A;  1ELO A;  3D6T B;  2FJE B;  3BM7 A;  3I5B A;  3EXC X;  1NZA A;  3BKU A;  3LOU A;  2ZNY A;  3M1V A;  4C11 B;  2ZH9 A;  1H38 A;  2DGQ A;  3ZNU A;  3LP1 B;  4M5G A;  2KYX A;  2XGP A;  4LFB F;  3A3P B;  5T41 A;  3DRR B;  2UXB F;  4N76 A;  1B70 B;  2Y1R I;  2CPJ A;  3MMA B;  9ATC B;  4DV2 J;  1C0U B;  1JXL A;  3Q2S C;  4LSZ B;  2FGO A;  4NLW A;  1LEO A;  2PA8 D;  4OHV A;  2BAN A;  3W9J A;  3T41 A;  3HMJ G;  4CCH A;  1G1X A;  1HIY A;  3CD6 S;  3JSR A;  4Q7A A;  3DRP A;  4FF4 A;  1U8S A;  2QLJ B;  1NJY A;  4CDI A;  3M9O B;  1CUL B;  3J81 j;  2M2B A;  3EZ5 A;  4W4M A;  4M5I A;  3GON A;  3KLH B;  3IBC B;  4AE5 A;  2BYC A;  4M5D A;  4TLQ A;  5MLC V;  4C3K A;  1HNW F;  1EQ0 A;  2EFG A;  4DFP A;  4U96 A;  2KFY A;  3CNQ P;  4N77 A;  3H5S A;  4QPT A;  2DGO A;  2OSQ A;  2LA6 A;  1IKV B;  4QWD A;  1TL3 B;  1EET B;  4KGV B;  2LMI A;  1X5S A;  1ZOT A;  1Y0H A;  3IAS 9;  2G2Y A;  2R3V A;  3D4J A;  2YNI B;  1RT7 A;  1VQ9 S;  4OIX A;  1U25 A;  5FLX Y;  2XYG B;  1ZYQ A;  5J2M A;  3H42 A;  2HS4 A;  2G4B A;  2AZ3 A;  4IG0 A;  3DRS A;  4URG A;  2GC8 A;  2HQC A;  2B4O A;  4DR3 J;  2R7T A;  4DL0 C;  3TP2 A;  2UZA A;  5H9F J;  1YRU A;  4ZP6 A;  2G0I A;  1RAI B;  2LFV A;  2ZHA A;  5F3Z A;  4K50 A;  3VWS A;  4JI3 F;  4DR7 J;  2BQ3 A;  3PW5 A;  1RYS A;  1NK0 A;  3DM2 B;  4CH1 A;  3W5Y A;  1EJ7 L;  2Q66 A;  2VC0 A;  3I55 S;  2Y8Y A;  2HBZ B;  2ZOM A;  3T1Y F;  3B78 A;  3EZU A;  4YHH F;  2JEG A;  1EP4 A;  1N5Q A;  1PYT A;  2J0Q D;  3NGD A;  1FRH A;  1WKJ A;  2IVF B;  2ZBR A;  3Q2T C;  2KB2 A;  1Q86 T;  1G6B A;  2GCF A;  1H2U X;  1K44 A;  1VK3 A;  3G6Y A;  4ELT A;  3HO1 A;  2P6T A;  3GYG A;  3BDE A;  4E98 A;  1Y3K A;  3CJR A;  2QA2 A;  4IDK A;  3UWT A;  2HG4 A;  3CB4 A;  4RBT A;  4UOG A;  3J81 U;  3X3U A;  3WDO A;  3CVK A;  4ES1 A;  3IRX A;  1V3Z A;  1TKD A;  1YBA A;  4DLG A;  2YKO A;  1DUR A;  4OYZ A;  1CC8 A;  4C8K A;  4B9M A;  3LAN A;  2A10 A;  5EX3 A;  1F3F A;  1RWN B;  5K9F A;  5DLF A;  1RTD A;  1APS A;  1T02 A;  4NYO A;  1R31 A;  1KQK A;  3HLU A;  3BRE A;  3CCM S;  2KXH A;  3AXM A;  4FNI A;  5C2C A;  3M9N B;  4MKV A;  2DNP A;  3PNI A;  3DLK A;  2F8M A;  2QZ8 A;  2C2Z B;  2VFS A;  3M8P A;  3H90 A;  5E3P A;  3ZFV A;  2UUC J;  2AKW B;  5GAE U;  1PSD A;  1QSS A;  2ZZN A;  2L41 A;  3EXY A;  2ZH6 A;  2MDA A;  2D3O 1;  4DPX A;  2QTW A;  3VVU A;  5GAE I;  5KT3 A;  1SVD A;  1JNR B;  1VRU A;  3G82 A;  1FX2 A;  2C22 A;  1C4C A;  3CO9 A;  4FKY A;  1SJR A;  4PEO A;  4TQS A;  5FJ4 A;  2ZWP A;  2IJR A;  2QYC A;  4QCL A;  3H8Y A;  4FVM A;  1GAO A;  4CLL A;  1XEZ A;  2MST A;  2LCW A;  4L6V 3;  4PG6 A;  2YKP A;  3MD3 A;  3RW6 A;  1NAQ A;  2DXE A;  3RB3 A;  2R7V A;  3TAM A;  5B7W A;  3N5B A;  3H25 A;  1HNZ J;  5CH7 B;  5D78 A;  1RWU A;  4WFX A;  3TI0 A;  1FEH A;  5FD1 A;  3RBE A;  4EI2 A;  4H4K A;  3QT8 A;  2E29 A;  3D0I E;  3VGU A;  1B3T A;  1IM6 A;  2CJA A;  3P6Y C;  3MM9 B;  4DF8 A;  3QO9 A;  4I2Q B;  2KDO A;  3MEG A;  3MF5 A;  4NLV A;  4WJB A;  5DGA A;  5CA5 A;  2KU7 A;  4R25 A;  5KFV A;  4KV8 A;  2UU9 J;  3K0J A;  2VC1 A;  5B0C A;  4ITS A;  2CNN B;  1QDU B;  5IXU A;  2APO A;  3VAI A;  1HNX J;  3J80 Y;  3MMC A;  1QD1 A;  3JAM Y;  3GJQ B;  4AL7 A;  1BQM A;  2M4M A;  3TA0 A;  3MAA B;  1KS2 A;  2ZKU A;  3K5M A;  1LKZ A;  4GKK F;  4XK8 C;  3TJA A;  5CAB A;  5CAA A;  2HGM A;  1S5Z A;  1SB6 A;  3IWX A;  1S49 A;  4GO5 X;  1KLN A;  4NMX A;  1JKH A;  4K8R A;  1PAU B;  3PX6 A;  1X0F A;  4DV5 F;  3I31 A;  3TUI C;  4RW7 B;  2VQF F;  3WC2 A;  3U27 A;  2HHS A;  4JI1 J;  1OY6 A;  4DR6 F;  4B3R F;  3TJ8 A;  2HVZ A;  3M2U A;  2ZC3 A;  5K8N A;  4DUZ F;  3DRP B;  4Y6I A;  4DFJ A;  2YNG A;  1X5P A;  4Q2L A;  4C8Z A;  3IGN A;  3OVB A;  1S1X B;  5IC4 B;  4AXI A;  6AT1 B;  4UY8 5;  2H5E A;  5C5J A;  1SJF A;  4CLT A;  1S6Q A;  1UAW A;  4YP3 A;  1U1M A;  1VQ4 S;  2P9G A;  4CO4 A;  2WVC A;  4OJ3 A;  3QZ7 A;  2VA3 A;  1RUS A;  1LXJ A;  5KT6 A;  1QM9 A;  3U02 A;  5D15 A;  5DDQ C;  2UV8 A;  1EHW A;  2PA3 A;  2QA4 S;  2EEY A;  1D9F A;  4RZR A;  1HQU B;  2UUT A;  2WRM A;  1VMB A;  3DRR A;  3NCR A;  1NND A;  4OQJ A;  4P2M A;  1FKO A;  3M32 B;  4KRW A;  4ZS6 A;  3V6H A;  3HSG A;  1SJ1 A;  3MED B;  5KFO A;  4YHH J;  3E01 A;  4ECU A;  3WZ0 A;  3AJ1 A;  2ZH3 A;  1WWH A;  2EG1 A;  4P2S A;  2W8K A;  3OXG A;  1GTH A;  4ICL B;  3O6Q A;  2FZC B;  3KLV A;  1TAQ A;  1HWJ A;  2ZOF A;  4DV0 J;  1T7P A;  2CA9 A;  1TL7 A;  2XZT B;  1GT8 A;  3IXQ A;  2CJY B;  2W7A A;  4NZ6 A;  4PG4 A;  1WC0 A;  3KLI B;  4B02 A;  5LSO A;  1BGX T;  2FUG 9;  5D77 A;  1KD1 T;  4OYB A;  3SFG A;  4Y00 A;  3QAU A;  2ZUA A;  1YDL A;  3OQ2 A;  5J1E A;  4ECY A;  2MQP A;  3FEX B;  2W2O P;  2KVQ E;  1O6X A;  4LVN P;  4M5J A;  4M5N A;  3OTO F;  1PC5 A;  4NCA A;  1VQO S;  3VR1 A;  2F4F A;  3AAW B;  3IR6 B;  1N4L A;  4WFB Q;  4LRC A;  2B56 A;  4LQ3 A;  1FVS A;  2XLK A;  3MGJ A;  1TVR A;  3AY0 A;  2NQP A;  1E6Y A;  1TKT B;  1BQN B;  3CE8 A;  5KFG A;  1IKX B;  1H74 A;  3RBZ A;  4FVC A;  2RB7 A;  1S6Q B;  3CDE A;  3CUN A;  3AXK A;  1YIT S;  3GIK A;  4I67 A;  2J9D A;  1KLM B;  3J7Z 5;  1PIL A;  2EG2 A;  5FII A;  3EDQ B;  3KXD A;  1WAC A;  3TZY A;  4DV1 F;  4F8R A;  4KHM A;  3T1Y J;  3FZ2 A;  4ZLJ A;  4DR3 F;  2J5A A;  2O5D A;  9RUB A;  1NJW A;  3BKT A;  2R2T A;  2UXC F;  2UXB J;  1OJ4 A;  5D0G A;  1MRO B;  3LP2 B;  4JI3 J;  4OYO A;  4RW9 B;  2EFN A;  4CLP A;  3SI8 A;  1U1O A;  3PYD A;  3ZTR A;  4C8L A;  2A6M A;  2IJN A;  2WHO A;  3D5M A;  1MN7 A;  3Q8Y A;  3HVT A;  4U8Y A;  4DFM A;  1U6B A;  2LA4 A;  4RUA A;  3C15 B;  4MKB A;  1U0S A;  3KK2 A;  5JVH Q;  3BB5 A;  4OZ3 A;  5KAK A;  2EFO A;  3MAH A;  2HRY A;  4H4M B;  5F0W A;  4YN3 B;  4WP3 A;  3TQE A;  4DV3 J;  1NK4 A;  4LBI A;  1OSD A;  2MYF A;  3ENA A;  4FYY B;  1U1L A;  3DLH A;  3CMA S;  1URN A;  3QID A;  1RQ0 A;  1GX6 A;  3MMC B;  1RAG B;  3I0S A;  4PG7 A;  2IA6 A;  3BV8 A;  2IYI A;  4WFY A;  3EVO A;  5LMN F;  3T1H F;  3K5L A;  2ZVI A;  1NB7 A;  4WZM A;  4EEY A;  1IKY B;  2AMC B;  5GAD I;  3T3F A;  2DB1 A;  2VB6 A;  5U47 A;  2RML A;  2BVZ A;  1JNZ B;  3OJS A;  1U1K A;  2BM1 A;  4YB7 A;  4XPC A;  4B9V A;  2HVH A;  4ED4 A;  1VQM S;  2MKY A;  1HNV B;  1RTH A;  3JXO A;  3NG8 A;  2MTL A;  3OHA A;  4FS1 A;  3VGS A;  1JLE B;  1ZAV A;  5KT5 A;  4ANC A;  4WBF A;  2G1D A;  1V6H A;  3DRY A;  3VV2 B;  1WOS A;  1KLM A;  2GAH C;  3M2V A;  2HFS A;  4HL9 A;  3TNV A;  2AGQ A;  2XY5 A;  2QA1 A;  1JLQ B;  3PXG a;  3MM7 B;  3HZE A;  4ZPD A;  3SCI E;  1FKO B;  1SC3 B;  3V81 B;  2XMV A;  1KON A;  3S01 A;  4NLP A;  2VJV A;  3E2E A;  5DM6 Q;  3BQ0 A;  1F6T A;  1XMB A;  2MZR A;  4CO1 A;  4R8U B;  2KVI A;  2JWN A;  1CLF A;  1I1G A;  1VQL S;  4L74 A;  4CO3 A;  4IFY A;  2ROE A;  4ETZ A;  3OLB A;  3HHD A;  2C2K B;  4MKA A;  1FK9 B;  1MU2 A;  5D4N A;  1JLQ A;  4EMD A;  5IT9 Y;  4RLE A;  2F40 A;  5GAG U;  1OYD A;  2FJD B;  2BEF A;  3NS5 A;  3S8S A;  4ECW A;  3PY8 A;  5IZH A;  3BQ1 A;  3TEG A;  1YQH A;  3GSD A;  1C2P A;  4FKX A;  3PYF A;  5CZX A;  3ZZZ A;  5F8I A;  1VC5 A;  2IRX A;  4TY9 A;  1RKI A;  2IA0 A;  3CJ4 A;  3SFU A;  1B99 A;  4DBQ A;  3HT3 A;  4DWI A;  1TEL A;  2KZM A;  2CFX A;  4P7T A;  1LWE A;  1AFI A;  4ZPA A;  1Q8K A;  3GR1 A;  2FVQ A;  3GIR A;  4FYV B;  2F9D A;  5HRO A;  2CJB A;  3RAX A;  1FJG J;  1AB8 A;  3TW0 A;  3M05 A;  1WKK A;  2E5I A;  3A8J A;  3VZH A;  3G8S A;  4FP9 A;  1WHW A;  2IRU A;  2KT5 A;  4FBT A;  3HT0 A;  3BEG B;  5CYJ A;  3KFW X;  2B8Q A;  1H3D A;  4Q5V A;  1I3O B;  4P72 A;  2LDI A;  3ISN C;  1VQN S;  1XNQ J;  4HI2 A;  1FF2 A;  5HSP A;  2V4R A;  2YWK A;  3UNY A;  4DL6 A;  4KH1 B;  1HI8 A;  5KT2 A;  3DLB A;  1FRI A;  2GQQ A;  3HHN B;  1N32 F;  2AV5 A;  2DGV A;  2W24 A;  1VCT A;  2X1B A;  3SQO P;  1XNR F;  2A2D A;  3QO9 B;  4KBI A;  4L3K A;  3LTO A;  1ZAX A;  4PXC A;  2OTJ S;  2AD9 A;  3CC7 S;  2XCP A;  4OLO A;  1MW7 A;  3AOC A;  4QOT A;  2CQB A;  2DH9 A;  2HWI A;  2YKN A;  1S6O A;  3BSC A;  2HK2 A;  3DFE A;  3O5T B;  2DNO A;  1LOU A;  1H7X A;  1P9Q C;  1S6P A;  2H4W B;  2W25 A;  4H4O A;  3KHR A;  4KR0 B;  1S76 D;  1JLC A;  2OP5 A;  5C25 B;  4DPT A;  3DKD A;  2XMW A;  3BBC A;  2WCX A;  3R6L B;  1ZET A;  2M3D A;  4ZPB A;  4I56 A;  3J7Y U;  1RKJ A;  3RJM B;  4CO0 A;  3RTV A;  4JI2 J;  3VAH A;  2N3O A;  2RF2 A;  2LQ8 A;  2C3O A;  2WVF A;  2A6O A;  2FJX A;  2FVS A;  4M94 A;  5HAN A;  4H4O B;  5HQM A;  1I94 F;  1RT4 A;  1Z1Z A;  4YME A;  2A0F B;  1F0X A;  4KHP J;  2B4P A;  1FWP A;  1WI6 A;  2GQ2 A;  1RAC B;  3BBB A;  2VOP A;  2XS7 A;  2FHJ A;  2K1R A;  5C2G A;  4EBD A;  5EN1 A;  4PWD B;  1S0N A;  3O2I A;  5J1E B;  4UQG A;  3B4M A;  4G1P A;  1T9X A;  2I5J A;  1T9T A;  1XMO F;  2KG0 A;  1P9Y A;  2V8G A;  2HQ3 A;  2IM1 A;  4PUO A;  4DG1 B;  2BE2 B;  2FC8 A;  3QWP A;  2FHO B;  1KDN A;  5J1N A;  4DDF A;  4ZVR B;  4K2X A;  2VG7 B;  3QBC A;  5IOL A;  3EM1 A;  5GAH U;  3MUR P;  3H5Y A;  4DF4 A;  2LXU A;  3HF5 A;  4X65 F;  3FSI A;  2R8H A;  1ZTW A;  1QE1 B;  2DPJ A;  3MAQ A;  4PQU B;  1HW9 A;  2FB0 A;  3KJQ B;  3MHY A;  4OYM A;  3HHL B;  1D09 B;  1Q4R A;  3I32 A;  3QGH A;  2XLJ A;  4EYH B;  4PWU A;  4F2R A;  4I2P A;  4J9S A;  3BZQ A;  4NCG B;  3RZA A;  3M8Z A;  4DZD A;  3QGP A;  4M1K A;  4ECV A;  2B6A A;  1C0T B;  2EK6 A;  2V6A A;  3H2L A;  5AJ3 F;  5HI7 A;  4ECS A;  5DG7 A;  1S77 D;  1FK9 A;  5KG7 A;  4GKK J;  2XSJ A;  3CDA A;  2NSB A;  3TUJ C;  2OO4 A;  4QYZ K;  2EI5 A;  1UJ5 A;  1JLB B;  4PYD A;  5KFQ A;  3JYT B;  4WTO B;  1AXQ A;  2YKM A;  5B0A A;  1Q7L B;  3TAQ A;  2DJW A;  4LF4 J;  4JV5 F;  1ZA1 B;  2GHV C;  4O23 A;  2QX0 A;  2KRR A;  2VOD A;  3HHE A;  1EKS A;  1HI1 A;  1RLD A;  4KSE B;  3ZTO A;  1F5C A;  3C6T A;  5IWA F;  4DV5 J;  2HVI A;  2DRD A;  1ZS6 A;  2OMO A;  5KFE A;  3M6X A;  2ZJP Q;  5JVG Q;  2HQI A;  1RWK B;  4K5S A;  2GAG C;  2YWE A;  3OL9 A;  4HH1 A;  1S7I A;  2XEX A;  1XQI A;  3KJN B;  2MQL A;  4P2X A;  2ALY B;  4CTA B;  4X4N A;  2DO0 A;  1FER A;  2JLG A;  2ALZ A;  4LF2 A;  4LRF A;  4KH0 B;  1Q95 G;  2JFD A;  4DX5 A;  1M5V C;  4F4A A;  1HNV A;  2QJ3 A;  2DGU A;  2VU5 A;  5IT0 A;  3LGN A;  2DD8 S;  4M5M A;  2ZHB A;  3RB4 A;  4DR6 J;  4J9U E;  3DXS X;  4Y2M A;  4ED6 A;  3Q23 A;  2B9Y A;  4KPC A;  3D6F B;  1L3V A;  2OJ3 A;  2ROP A;  4B9N A;  1YRT A;  2DT9 A;  4LF1 A;  3D1Q A;  3VAF A;  1Q8L A;  3C46 A;  3R2C J;  5K14 A;  4DV1 J;  4JYA J;  2VAS A;  3LA0 A;  3LPE A;  1N5V A;  1N36 J;  4S0M A;  4QU6 A;  3V2U C;  1FDB A;  4FXD A;  2FHM A;  3IAM 9;  2HAF A;  2XUL A;  2DBB A;  2OPR A;  3A1Y G;  3DDK A;  4F0K A;  1XMQ F;  4A8W A;  1FRX A;  1FE0 A;  2NXN A;  3L7O A;  1IBL J;  2AT1 B;  1X4D A;  2AJQ A;  4RWX A;  5CYM A;  1X5O A;  1SI9 A;  1U24 A;  4ZVU B;  4HHJ A;  3IN5 A;  4A8O A;  1GXU A;  1QAX A;  5CCL A;  1IQT A;  3DLE A;  1Y9O A;  1FKP B;  2HFU A;  4Y2K A;  4DJB A;  2BKN A;  1RU2 A;  1FXR A;  4LRA A;  3W9H A;  1U1R A;  1N6Q B;  3KNA A;  1KOH A;  1I51 B;  2DY9 A;  3W65 A;  2HHU A;  1FD2 A;  4O44 B;  2CQH A;  3D54 A;  3MM5 B;  2IMW P;  1FRM A;  2LKZ A;  1X9S A;  1YJR A;  2R7U A;  3PEH A;  2OUG A;  1DQ9 A;  2YY3 A;  4MJK A;  3G8Q A;  4OV6 A;  1K8A T;  1G7C B;  1VDH A;  1RTI B;  3DCA A;  4LRE A;  4JI2 F;  2XY7 A;  1K1S A;  1YX2 A;  2KFN A;  1HBM B;  2UUA F;  3EPG A;  4B17 A;  2MY8 A;  1NME B;  3D67 A;  3AB2 B;  1IKX A;  4A48 A;  4B3O A;  4RBV A;  3H5U A;  3KG4 A;  3PRV A;  3CIM A;  4KB7 A;  4CLY A;  4DPY A;  5C24 B;  1T9Y A;  5HL7 Q;  2OPQ B;  3EGZ A;  2FC9 A;  1Q79 A;  3PR4 A;  1J5E F;  4FYD A;  2W2P P;  3PG9 A;  3F0N A;  4DPU A;  1U1Q A;  3L3C A;  2F3J A;  1HBM A;  3MZI A;  4USH A;  4A47 A;  4GO7 X;  3D0H E;  1UVM A;  2W4D A;  1U2R A;  1BLU A;  5KTQ A;  4WE1 B;  1TTH B;  2CNO B;  2XTJ P;  2ZE2 B;  3NS6 A;  1RAJ A;  3GPA A;  2W2Q P;  1HPZ A;  2ZJQ Q;  2MKI A;  1IUJ A;  3V5R A;  3OVS A;  1VRT A;  1NK7 A;  2C2M B;  2HQD A;  3ISZ A;  3ITH B;  2RDI A;  1BMQ B;  3N6N A;  2ZHO A;  3MM5 A;  5J2P B;  4RUH A;  2HMI B;  1GMU A;  5KFH A;  3RAQ A;  4ZP7 A;  2MXY A;  2POK A;  2Z0G A;  4JB8 B;  4OMF G;  3GFH A;  4ENO A;  4NEY A;  1LW2 A;  2H5I B;  2CQ0 A;  3ZTP A;  2OPP A;  2WB1 D;  5HBM B;  2MZJ A;  4F4Z A;  4DSE A;  4FBU A;  2VG7 A;  2FJA B;  1ZBT A;  2CNL B;  3UDV A;  4EK2 A;  2DNZ A;  2H51 B;  3I0S B;  4TN2 A;  1SIZ A;  4Q44 A;  3QIP A;  4RNM A;  1X8D A;  3I87 A;  2EPI A;  1S1X A;  3NWR A;  1LXN A;  4ZIV A;  1Q78 A;  5ETK A;  4U95 A;  1TL5 A;  2VQF J;  4OHW A;  1B0P A;  2DCU B;  2H48 B;  3M2U B;  1ZM4 A;  3UNG C;  1JJ4 A;  2IHR 1;  1RHU B;  2HS0 A;  2Z30 B;  5IQ6 A;  1U0H A;  3HVT B;  3PX4 A;  2K1R B;  3K5O A;  2B9X A;  5E7O B;  1S9E B;  1G3O A;  2QLF B;  1SL2 A;  4JI8 J;  2XMU A;  2WSF C;  3UDL A;  4YDD B;  3DYA B;  3DXB A;  4ZVG A;  1DLO B;  4MKY A;  3OVA A;  4B9L A;  2V0N A;  2HNZ B;  3DN9 A;  4HI1 A;  3LUY A;  4KE5 A;  3R5B A;  4D3H A;  1UMJ A;  4YS2 A;  3H0P A;  4PQA A;  2NXU A;  3W60 A;  1F5A A;  2I9S A;  1XBW A;  2V4J B;  4LR7 A;  4Y2C A;  2R2R A;  4RW4 A;  2FGC A;  1ZM2 A;  2AQ4 A;  3A3O B;  1JLF A;  3ISN D;  5M2R A;  5F8L A;  5B0G A;  3H5X A;  2QO3 A;  3C6T B;  3FZB A;  1IR0 A;  1S48 A;  3WHI A;  5A8K B;  2HFN A;  3VAJ A;  3WC0 A;  3LP0 B;  2MZQ A;  2V9K A;  5IT9 U;  5K5M A;  2PMW A;  2CPY A;  4R5P B;  2HHH F;  4DCJ B;  4YDX A;  2KRB A;  1D0E A;  2LEB A;  3JYT A;  4ZCK A;  4ZVQ B;  1R0A B;  3CDB A;  4LFC J;  4LSL B;  2VKR A;  1NK8 A;  1J5O A;  1OPZ A;  1N33 J;  1XR6 A;  1NSQ A;  5ETL A;  5LOQ A;  1N0U A;  2RRN A;  5LSR A;  1IXK A;  2XNR A;  3J7A 1;  3KG0 A;  2CQI A;  4PXB A;  4I2P B;  4CZC A;  3VVT A;  3MR2 A;  2WTF A;  1B7F A;  3HHL D;  3MR6 A;  3HSJ A;  3HHL A;  1QE1 A;  2DNM A;  1HQU A;  2Z57 B;  3CDU A;  3HKW A;  3DHW C;  3W7B A;  2AJ2 A;  2G0C A;  1YK9 A;  4TU8 A;  1XMO J;  1TAU A;  3MPV A;  1HNI B;  2E9R X;  2NPI A;  3M8W A;  3AFG A;  3HCX A;  2HHQ A;  3DMJ B;  4KFB B;  4RR5 A;  1TKZ A;  4HYK A;  3D6M B;  3OR1 A;  4KIA A;  4LFA J;  1U7L A;  3SSQ A;  3R8Y A;  1TFW A;  1CEZ A;  3D0G E;  4KAI A;  2NZ4 A;  2KYZ A;  2E44 A;  1TKX B;  2DIS A;  4MMO A;  2K7J A;  3PR5 B;  2VPW B;  3Q8V A;  4A8S A;  2IYG A;  1RGV A;  4K4U A;  3M6U A;  5CD4 H;  3JTO A;  4O3P A;  5F8N A;  4C8O A;  3CIZ A;  4MIW A;  2OEM A;  4NOH A;  1WG1 A;  5HVF A;  3LGM A;  3D3C J;  3HJV A;  2JHE A;  3WBZ A;  4OZ0 A;  2HZV A;  1S4F A;  2ABY A;  4F02 A;  3SQG A;  2RUS A;  4NA2 A;  1R0B G;  2VFU A;  3P96 A;  3SYZ A;  4IDK B;  2GA7 A;  2YQ3 A;  4IQX A;  1O51 A;  2QSW A;  2W9B A;  1X4H A;  3P5B P;  2LU1 A;  4X64 F;  1Z4U A;  1ZTT A;  1TUW A;  2KZZ A;  1REV A;  1RT2 A;  2DIT A;  5A0Y B;  4JI1 F;  1Q53 A;  3Q89 A;  3GCX P;  3FSX A;  4KGK A;  2GHP A;  3W8P A;  3IR5 B;  3JSB A;  4X4T A;  1VQ6 S;  3CXC R;  4WZQ A;  4CTA A;  3BGU A;  3HUL A;  2RHQ B;  1S6P B;  2FZK B;  2L9W A;  3GWC A;  5A2Q Y;  1K1Q A;  3FMB A;  1OQ6 A;  4DR2 J;  1PBA A;  2BAB A;  2W9A A;  2YKN B;  3W61 A;  3SDE A;  1WUU A;  4DSL A;  1HBN B;  4DX7 A;  4X65 J;  3CC4 S;  4ILL A;  1GK8 A;  1R3N A;  2EKN A;  3C6U A;  1NRK A;  3H2U B;  2LXI A;  5HLF B;  1TK0 A;  3OUY B;  3HM9 A;  1HQE A;  1NJI T;  4JP8 A;  4LBP A;  2EBG A;  3N9U C;  2L9D A;  4PG5 A;  4CNY A;  5ETS A;  4CT9 A;  5J2M B;  4QR1 A;  3T5J A;  1FNO A;  2QT7 A;  1FKA F;  3J7A N;  1SC1 B;  5GMD A;  2MJN A;  2VDI A;  3PRB A;  2YQ0 A;  1FO1 A;  2PC6 A;  2V2K A;  3R1L A;  1MWZ A;  2QMU B;  1RT7 B;  3GZ7 A;  2RU3 A;  2JDJ A;  2KHC A;  1EB0 A;  2HUR A;  2RNE A;  3EZO A;  1RT3 A;  4A8M P;  4RBU A;  2YWF A;  2AHO B;  2F65 A;  2VG5 B;  2XGQ A;  5CYQ B;  4PYA A;  4DSI A;  3NMA A;  3M32 A;  4LVO P;  4P9S A;  4DX8 H;  3G82 B;  4IUF A;  3PX0 A;  2XNQ A;  1FJC A;  3DOM B;  1HYS A;  2HHT A;  3BF4 A;  2AJ4 A;  1IBC B;  1M0S A;  2Q79 A;  3N0V A;  2MGZ A;  4QIE A;  4W98 A;  5DZ6 A;  1CPZ A;  2ACM A;  2BW7 A;  5D4L A;  3AD8 C;  4OHZ A;  3HHL C;  5LM7 E;  1UCN A;  2GZO A;  5MAO A;  2BE2 A;  1BUX A;  4OX9 J;  1KVJ A;  1WTF A;  1SH3 A;  2V2Q A;  2QLX A;  2MB0 B;  4O0I A;  4JV0 A;  4DFK A;  2V9W A;  2IVY A;  4CLK A;  2GW8 A;  4WF9 Q;  5DET A;  4DN9 A;  2A2C A;  5ETO A;  3CC2 S;  4ED7 A;  4C3L A;  4KYZ A;  1R8C A;  2MLX A;  4WYW A;  2RUG A;  2MGZ B;  4IRD A;  3AJ2 A;  1VGY A;  3AOB A;  3NY0 A;  3V4I B;  3AOD A;  1HW8 A;  2CZ9 A;  5BR8 J;  2VD3 A;  1DHM A;  1S9G A;  2Q6C A;  1Y5L B;  3GE9 A;  4K4S A;  1HBO B;  1DQ8 A;  3AA9 A;  3EYZ A;  1JLF B;  2ZM6 F;  2BR0 A;  2VIH A;  3QZ8 A;  2CPF A;  3NOG A;  3MM7 A;  2ZBI A;  4I7F A;  4JI0 F;  3ZC4 A;  3I4P A;  4EU0 A;  5BYS A;  5IFM A;  2C2D A;  3RRG A;  4RPF A;  1N33 F;  1RHR B;  2V34 A;  4RW6 A;  3JQJ A;  4J9K A;  1DFD A;  3ICL A;  5L38 A;  3K57 A;  4DQP A;  1PIE A;  2D74 B;  5HQL A;  4ZVF A;  5EDW A;  1GQE A;  4Q0B A;  3BO2 A;  1UEK A;  4P7V A;  1RP5 A;  4P73 A;  2OEJ A;  1QTM A;  4X62 F;  2XWX A;  5I42 A;  2GJI A;  5HMY A;  1MWY A;  5M2P A;  5E3C A;  3KWM A;  5SUH A;  1Z2L A;  5K8P A;  3U1M A;  2YNH A;  3B8H A;  2DR6 A;  2RS8 A;  4RWW A;  2XI3 A;  4AND A;  5GVQ A;  5IM0 A;  1N52 B;  2ASY A;  4UST A;  4WFZ A;  4QWB A;  3VGV A;  2CWK A;  1IKY A;  1N0V C;  1RLC L;  3KHL A;  3O3L A;  4DV7 J;  1FDD A;  1U1P A;  4LF5 F;  3VAM A;  2MKJ A;  1CS4 A;  3TVK A;  5E0O A;  2PMZ D;  1UPP A;  5G0R B;  3G96 A;  1R8P A;  2RSQ A;  1QJH A;  1YJ7 A;  2JJ4 D;  1A6L A;  2XI2 A;  1FNX H;  3LO3 A;  4F50 A;  1GNK A;  3FRY A;  1KRP A;  3FFI B;  4JV1 A;  4N8O A;  2WZ1 A;  1U6Z A;  4QWC A;  1REV B;  1AYE A;  3TX0 A;  1CJV B;  1K0T A;  3C16 B;  4Z7Y A;  1UP1 A;  2A3J A;  2JRS A;  2O01 C;  3L7U A;  2Q43 A;  3DHX A;  1WDT A;  2CPX A;  3HJF A;  2BE9 B;  3PV8 A;  2MZ1 A;  1S9E A;  2XB2 D;  3H98 A;  5L1J A;  3BO3 A;  1S9G B;  2V2V A;  2C3M A;  1MRO A;  2N4C A;  3KUH A;  3LP2 A;  1YWX A;  3PYE A;  3J7Z T;  5F9N A;  3FDS A;  3KJV B;  2UVW A;  1C1B B;  5KFY A;  4F67 A;  3G87 A;  4UUW A;  1ZPV A;  2HEK A;  1UWB B;  3M8P B;  5IV4 A;  1CQN A;  5EWG A;  3KOA A;  2HND A;  3QLH A;  2FJB B;  2MEW A;  3ZNJ 1;  2BW2 A;  4DEZ A;  2AYB A;  2HWH A;  3GYX B;  1VLY A;  1CJT A;  4HVZ A;  3CT9 A;  2M0G B;  1AW0 A;  4OI2 A;  1TKZ B;  2MHN A;  2EC2 A;  1VBZ A;  2R8K A;  3TZW A;  1EAY C;  3IC1 A;  4GMK A;  1CS4 B;  1YIJ S;  4QIW D;  1NKE A;  1KN6 A;  1HKA A;  2VDH A;  1YRX A;  1VQP S;  2E9Z A;  2RH3 A;  4L76 A;  4QR2 A;  5AXN A;  2IMO A;  4ZK7 M;  3CSK A;  1U49 A;  1RTI A;  3CED A;  4OX6 A;  2GMJ A;  3M2V B;  4LF8 F;  1JLA A;  1B7Y B;  2BMB A;  4M5H A;  4DPO A;  3QJL A;  1L3T A;  1PC4 A;  4LJM A;  1D9D A;  4UQT A;  1U4B A;  1V5I B;  3OFF A;  4LF7 F;  1UEV A;  4M63 A;  3K59 A;  2O1P A;  4A8Q A;  1T8E A;  1S0O A;  4NZ0 A;  3N01 A;  2I0X A;  4RU2 A;  3E01 B;  1P1L A;  4DSF A;  3ULH A;  1RHJ B;  3FC9 A;  3DLL Q;  1JWW A;  1VQS A;  2KO1 A;  1HMV B;  2LP4 A;  3D1O A;  4P6Q A;  2Z2M A;  5J2N A;  1NXI A;  3UI3 A;  2DEJ A;  2Q3P A;  1R6V A;  1HFE L;  2P9E A;  4IG0 B;  3ZO7 A;  2XC9 A;  4OX9 F;  3SXL A;  3Q22 A;  4AL6 A;  2C42 A;  2UVV A;  1OY9 A;  1RHQ B;  5LT5 A;  3NCP A;  3M7V A;  3BJY A;  2XBP A;  4ILR A;  3H40 A;  1X31 C;  2J9E A;  3ADA C;  3EUN A;  4NLT A;  4TLR A;  2GGP B;  4B3T J;  3I82 A;  2DHH A;  1ARO P;  2BJ1 A;  2OAU A;  2WVD A;  3AB4 B;  4K59 A;  2RIL A;  4CT8 A;  3PHT A;  3K5N A;  3I0R A;  1D8Y A;  1H73 A;  3RW7 A;  2UVU A;  4LQ9 A;  3IG1 A;  1FDN A;  3GTY X;  3KG1 A;  3IG1 B;  3LAL A;  4ZPT R;  1OYE A;  1ZM9 A;  1M1H A;  1A0O B;  2D7S A;  1GFW B;  4WKR A;  3FVY A;  4NLS A;  3OD2 A;  4AXJ A;  3PW2 A;  2AEF A;  2GGP A;  3DLJ A;  2HZA A;  3EGV A;  2H54 B;  3FQL A;  3ILJ A;  4M8L A;  4NL5 A;  3PW7 A;  2PFF B;  1HNW J;  4OI6 A;  2RT3 A;  4ZLN A;  2JFK A;  2BAN B;  4DV6 F;  1ICE B;  1PKU A;  1CJK B;  2HYI B;  2BJ3 A;  3I5A A;  2R2U A;  5C7P A;  1IJF B;  1HHT P;  1K0V A;  1LWX A;  3M30 A;  1BQN A;  4IYQ A;  3WIV A;  1X4E A;  1RTJ A;  4IH6 A;  4DOZ A;  3Q8S B;  4DSJ A;  2JX2 A;  4TY8 B;  2B0G A;  2DIU A;  5B0D A;  3NCQ A;  5KT7 A;  3KLE B;  1T05 B;  4Q8E A;  5HLF A;  2L08 A;  3UN3 A;  4EFA C;  2MPU A;  1JB0 C;  4NRT A;  2D3U A;  2K8G A;  4BWJ A;  5DQI A;  3ZZO A;  1RBA A;  1FXD A;  4K4Z A;  4DQQ A;  1WC1 A;  3OXL A;  1F3V A;  5K8O A;  3TAM B;  3OXF A;  2AEJ A;  1DTQ B;  1OS5 A;  1FXL A;  3OL7 A;  2ZE2 A;  3QT6 A;  4NYP A;  1PYS B;  4AFF A;  2IDL A;  3KUG A;  1W2B R;  4G3I A;  2ZIT A;  4P10 A;  4EO8 A;  1JLA B;  3IO1 A;  3MCM A;  3P3D A;  5E2Q A;  2XZW A;  4ZLP A;  1HD0 A;  4O0N A;  2Y1I A;  4JI0 J;  4I7F B;  2QV6 A;  1VFJ A;  3ENV A;  3GU0 A;  4EBC A;  1KFS A;  2LDY A;  3PVX A;  4PG8 A;  3EPI A;  3UN2 A;  4IFV B;  4N47 A;  3M6V A;  4DS5 A;  4DL5 A;  2F4V J;  3FCH A;  4C9D A;  1VRU B;  2OGU A;  4UT4 A;  4LBH A;  1NPR A;  2HVD A;  2M7S A;  1TMJ A;  2HBY B;  2AEM A;  1RT5 A;  4A8X A;  2M8D B;  4F2S A;  1NPP A;  1Y5I B;  2QFJ A;  3QT5 A;  1UZH A;  3MPY A;  2BOP A;  2A18 A;  4FF3 A;  3H4B A;  1PJ5 A;  1AZS B;  3ZZP A;  3JSM A;  3KHG A;  3KKF A;  1C1B A;  4EWT A;  1HR0 J;  1JQG A;  1RT5 B;  1UWB A;  2J9D E;  3POT A;  4RNF A;  3MMA A;  4OYI A;  2B9W A;  4WYL A;  3UCU P;  2L48 A;  2FDN A;  2LVW A;  5L9N A;  4OHX A;  5HMZ A;  3HKZ D;  4UTG A;  2Z2Y B;  3MMJ A;  4DUY F;  3F56 A;  1HA1 A;  3IRX B;  4V1A k;  2NRE A;  5HMW A;  5E41 A;  4N56 A;  4O3S A;  3CCQ S;  3C16 A;  1U0H B;  1NDL A;  2CVE A;  4LFB J;  4O3O A;  1NUE A;  1P8G A;  4DR4 F;  2EXU A;  3UFC X;  1LWC B;  2WSC C;  4URQ U;  1GH8 A;  3K7R A;  1DTQ A;  2XWY A;  2GO9 A;  2V94 A;  2RIJ A;  3DOK B;  1EP4 B;  2Y0S D;  4GVB B;  4X4O A;  3CPW R;  1UPM B;  3CCU S;  3TRG A;  4RU9 A;  2XLI A;  1BC6 A;  4K2J A;  1OY8 A;  3MTK A;  5LMU J;  4CLW A;  3IM9 A;  1I94 J;  2FLL A;  3TVZ A;  1UVK A;  4N41 A;  1FRL A;  5DRK A;  3H59 A;  1IBL F;  3PO5 A;  1U2F A;  4DR1 J;  5K14 B;  3PRD A;  5IM0 B;  4WFN Q;  2VBY A;  4J9M A;  4R0E A;  1QSL A;  3ZTS A; 
#chains in the Genus database with same CATH homology
 1EKS A;  3JQK A;  4PYA A;  4PYD A;  2IIH A;  3JQJ A;  1EKR A;  2OHD A;  3JQM A;  2IDE A;  2EKN A;  2EEY A;  4FDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...