4PYIA

Human apo comt
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
207
Chain Sequence
TKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 71
structure length 207
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyiA00
3H2BA 5K0LA 2PT9A 3U81A 4BLUA 3KPWA 3BZBA 3BWYA 1P1BA 3KR9A 4PYIA 5E2BA 4ATNA 3BT7A 1EJ6A 1ORHA 5DPMA 2BH2A 3UJ6A 5GWXA 5HIJA 3KPUA 5FTWA 2EJTA 2VDWA 5K01A 2IH4A 4EKIA 3TKAA 1HNNA 2YTZA 2ZBQA 4DCMA 3THRA 3JWHA 2NP7A 1XTPA 2YVLA 3QOXA 3MCTA 4GOOD 4MTLA 1KIAA 1NV9A 2PX5A 3BWMA 1EJ0A 3FUVA 9MHTA 4X41A 3MGGA 1EG2A 1JTEA 1R8YA 3FRHA 5JR3A 3UA3A 3G2PA 1QYRA 5T6BA 1G8SA 1VIDA 3Q87B 4YV2A 1ZGAA 2Y1WA 5T64A 1QANA 2IFTA 5EEHA 3O31A 2I6GA 3HVKA 4XUCA 1PJZA 5FHRA 3OU7A 2PY6A 5EHIA 2ZBPA 3E8SA 2FK8A 5ICCA 3K6RA 4PIMA 5K0GA 8MHTA 5E9WA 3LECA 3VC1A 5EEGA 2AOTA 1VLMA 3GXOA 3PX2A 3TM4A 1KR5A 4E70A 3EEYA 1FP1D 2I7CA 4PYOA 2NP6A 2GPYA 5EPEA 1QAQA 5HFJA 2XBMA 2UYOA 2C7PA 3FPGA 3ME5A 3P9KA 3CGGA 1XCLA 2EJUA 4DM3A 5K0CA 2VP3A 4RYLA 2QYOA 3R0QA 2P3LA 4MHTA 5K0BA 5FA5A 3MTIA 2ZZNA 2NXJA 2AOWA 2YQZA 2YXDA 3HCFA 5LQJA 4RTSA 3G88A 2FYTA 2XYRA 2CMHA 3EGVA 3HVIA 3KKZA 4C07A 3VC2A 3FPEA 1QZZA 2O05A 3EVDA 5EIWA 1NKVA 3B89A 2ZZKA 1O9GA 2PXXA 5BW4A 5LQKA 2UZ4A 4QDJA 2P40A 3G7UA 4OQDA 1O54A 1NBIA 1AV6A 1N7JA 3KR0A 3P9CA 3P9IA 3TMAA 5K09A 3EVCA 3UWPA 3M6UA 5EMLA 3KQOA 4B17A 3MAGA 4FGZA 2IIPA 1WY7A 4HTFA 1XCJA 1SG9A 3R24A 5EHGA 1EQAA 3KQQA 5EZSA 2ZFUA 5FADA 3SSNA 1BC5A 4EK9A 5ICEA 1ZKDA 1BHJA 2VZ9A 4PONA 4YV1A 2Z6AA 4EVIA 3ELWA 5BW5A 1P1CA 1XDSA 3FUTA 2B25A 3FPHA 3LBFA 3NDIA 4HRAA 1RI1A 4CKBA 4YUXA 1MHTA 3P97A 1Q0TA 2PT6A 1RJDA 4IV0A 4X60A 5KVAA 1I9GA 3HA5A 1M6YA 5EMMA 4C03A 4ER3A 2Y1XA 2JH9A 3B3JA 2C7QA 4GQBA 3T0IA 3HCBA 5EKUA 2YXEA 3SR4A 4DZRA 2CWWA 1R00A 4ER5A 5F2NA 4FSDA 3B3FA 3FTFA 2G70A 5DM4A 3C3YA 3P2KA 3M6XA 2V74B 5FQOA 3HVHA 4RTOA 5U4XA 1NE2A 3DOUA 1G6Q1 2I62A 2PVCA 3OFKA 2PJDA 5DT2A 3RIEA 4DMGA 2B2CA 3NDJA 3QV2A 3TOSA 2N47A 4JXJA 4ER6A 4RTPA 2WA2A 3T7TA 1JQ3A 1P91A 1RI2A 2JJQA 4YV0A 1UIRA 2OZVA 2WA1A 1I1NA 4ISCA 4KIFA 4R6XA 3KQVA 2E5WA 3I64A 3GRYA 1VPTA 4OA5A 3MQ2A 3HA3A 4U7PB 1H1DA 3A27A 4O29A 2QY6A 1WZNA 1KXZA 2XYQA 4RWZA 3EVFA 5C1IA 2BM8A 2O0LA 2NYUA 4G56A 4CWAA 3HA7A 3IV6A 4V0RA 3DMHA 3C6MA 3JWIA 5KQSA 3LBYA 3V8VA 2ZLBA 4MIKA 3BXOA 3KQYA 1RJEA 1SUIA 3HCAA 3LKZA 4BLWA 5K0FA 4BP3A 1QAOA 5LQRA 2ZIEA 5LQUA 5E8RA 1KYZA 2O07A 3THSA 1SUSA 1KPIA 1YB2A 3TKYA 4DKJA 1RJFA 3ER9A 3KPJA 3LX6A 1BKYA 5M5BA 1YZ3A 3DUWA 1KYWA 2QRVA 5HILA 2FCAA 5LSAA 1WS6A 2AN4A 2P7HA 3SGLA 3C3PA 4GC5A 4E30A 4E2XA 4GOLD 4RSRA 2BR3A 4HGYA 2A14A 2IBSA 1L3IA 3KPYA 3P2EA 1U2ZA 4POOA 1UWVA 5FA8A 5DLYA 3SX0A 5EC8A 1NW3A 4RTNA 2PGXA 3M6WA 3R6TA 5EKXA 2OB1A 3WSTA 5KQRA 3PB3A 3EVEA 2CL5A 3HNRA 1YF3A 2C7RA 2V7EA 3M6VA 5FHQA 1FJXA 3NW9A 4R6WA 2UYHA 3QOWA 4R8RA 3RW9A 3A25A 2ZVJA 4QQKA 5KS2A 3DR5A 1KPHA 4OBXA 5P8WA 4QVKA 2UYCA 3DXYA 4YMGA 5EQJB 1X1AA 1SQGA 3B7PA 3CVOA 3KU1A 3DP7A 3V97A 4YUVA 1NW5A 3UJBA 2H1RA 2OPBA 2HV9A 1T43A 2FHPA 5EIFA 1SKMA 2PXAA 4PGGA 5EMKA 2QM3A 5IKMA 5DTQA 2ZCJA 3MB5A 4F84A 3ORHA 2XVAA 3G8AA 4YMHA 4LG1A 2HNKA 3KR2A 2VDVE 3PVCA 3A4TA 3GNLA 3KQMA 3OCJA 4KRGA 3TLJA 4E2YA 3EEOA 3KHKA 5FWAA 4OX9Y 1YZHA 4Y2HA 3GIWA 3UJAA 3O7WA 4GUAA 5EGSA 5K8VA 3UFBA 2G71A 3G5LA 4Y30A 2ZULA 2GB4A 1L9KA 2HWKA 3HVJA 3GGDA 1VP9A 4FSXA 4KVZA 5DX1A 2AOTB 3PTAA 4XUDA 5CVEA 3LKDA 4QVGA 1FP2A 4PCAA 2OY0A 2XYVA 4AX8A 3GCZA 4QDKA 3TRKA 4PNEA 4DA4A 4CXMA 2P41A 4C08A 5K0JA 2R3SA 1F3LA 3B3GA 1AQIA 1B42A 1G60A 2Z6UA 5K03A 1QAMA 3O4FA 5E9QA 3UJ7A 3M4XA 5HIMA 3PLAE 2AOUB 2EFJA 4X63A 1ZHFA 3A7DA 2PX2A 3KQPA 5EOVA 2GH1A 3TPZA 2OKCA 5GIOE 2ADMA 2AVNA 4FZVA 4F86A 5EVJA 1AQJA 3P8ZA 3SM3A 1VQ1A 2JHPA 3GRVA 5F2OA 2Q41A 3AJDA 5CD1A 4PINA 1N2XA 4HSGA 3EMBA 2QRVB 2ZW9A 1R6AA 4PWYA 2YXLA 3NJRA 1DCTA 3OPNA 2O06A 3PS9A 4DQ0A 5GM2A 3BUSA 1YFLA 2ZWAA 3DH0A 5K0EA 4E32A 1FPQA 3F4KA 5CVDA 5CVVA 2IH2A 5DXAA 4FT2A 1P39A 4BP1A 1XXLA 2F8LA 5FULA 3HEMA 2K4MA 2PKWA 3PT9A 5CUQA 1R18A 4MWZA 4GC9A 4C04A 5CCXA 2BR5A 4LWPA 3TQSA 1KHHA 5E9JA 2OB2A 10MHA 2YUIA 5DX0A 2ESRA 3FRIA 4E2WA 1NW7A 5CIYA 2AN3A 1JG1A 2EX4A 2P8JA 3P2IA 1DUSA 2VS1A 3VSEA 3SMQA 5CCBA 1G55A 1BOOA 2PX4A 5DSXA 4L7VA 3FTDA 2B3TA 4GOND 5DX8A 5EG5A 1M6EX 2ZSUA 3HCEA 3KR1A 3MERA 2IBTA 2O57A 3MTEA 2PXCA 4CKEA 3GU3A 2NXCA 3G2MA 4WVLA 4HH4A 2G1PA 3EVAA 1I4WA 3EVZA 3IHTA 3K0BA 1RI3A 3LDUA 3L8DA 4M37A 2AS0A 4K6MA 4GEKA 4C4AA 4PYJA 4GF5A 2HTEA 3DULA 5F2KA 3EGIA 4YUWA 5FWDA 4RTJA 3NVKI 4P7GA 4HC4A 1X1BA 4HG2A 4ZTBA 3ERCA 3FUUA 2LD4A 4RTQA 2ZWVA 2HR1A 1JQEA 4M38A 4V0QA 1KPGA 1L1EA 3GRRA 3DMFA 2PWYA 1L3CA 4PYQA 4FR0A 2JHCA 1XDUA 2IP2A 1R74A 1EAMA 3LSTA 1KP9A 5HZMA 1NW6A 1IXKA 3HCDA 3UJ9A 3SSOA 2BR4A 5LQAA 4HTFB 2EG5A 3ER8A 3ELUA 3SVZA 1D2GA 4P7FA 2NXNA 1DL5A 1XDZA 3GRZA 3NTVA 1F38A 2GA9A 5IH3A 3RODA 4RVDA 3OU6A 3CJTA 5HIKA 5K05A 3DMGA 1NBHA 2PBFA 4IKPA 4EQZA 2PV0A 4FS8A 1G38A 2AOXA 2AR0A 2DPMA 1HMYA 1PRYA 4NECA 4R05A 1RI4A 4M36A 2OBFA 5GP1A 3LPMA 5BXYA 4RTMA 3TR6A 1SQFA 3ELDA 3E23A 5CVUA 4F85A 5KYGA 5B1SA 4KIGA 2GS9A 3AY0A 5JUWA 3SSMA 1VE3A 2B9EA 2PLWA 3OU2A 4DCGA 3BKWA 3EVBA 3FPJA 1TPYA 3BGIA 2P1DA 4RTLA 3MCZA 3ID6C 3AWIA 3NWBA 1JG2A 1WXXA 3CKKA 4CTJA 4FT4A 4PYNA 4GBED 2AZTA 4AUKA 2I9KA 3JWJA 5DM0A 1JG3A 5G02A 3BGVA 2P35A 4EMSA 4LWOA 2ZBRA 1D2HA 4PYMA 5DTMA 4P7JA 3KQWA 2ZZMA 5C0OE 4YUZA 4YUYA 2ZIGA 3I53A 2ONYA 3LDGA 3R9XB 1VBFA 4CKCA 3OZRA 1FBNA 5ICFA 1YFJA 1M0EA 4BY9E 4M7RA 3T7RA 2AOUA 3FTCA 3FUXA 4C05A 3HTXA 3NMUF 2AVDA 1O9HA 3M70A 3Q7EA 3OZTA 4PCLA 3A26A 3UJCA 2BZGA 4PIPA 2R6ZA 2IGTA 3I9FA 4PYKA 5E1BA 4Z2YA 1X19A 1SVUA 4X1OA 4UOEA 2G72A 1JTFA 1TW3A 3AXSA 2OYRA 4AZTA 3E7PA 5DXJA 3DXXA 3PFHA 1ZG3A 2OXTA 5D1HA 5EMJA 4AZWA 4RV9A 2YR0A 1WXWA 3CBGA 1D2CA 2JHAA 2HMYB 3FYCA 3HP7A 4P58A 4RVGA 1EIZA 1X1CA 5E1DA 5E8JA 2CMGA 3OFJA 3PX3A 4EKGA 4RTRA 4A6DA 1RJGA 4WXHA 1UFKA 5LR6A 1NW8A 3BWBA 5LQNA 5CVJA 2C7OA 4AZVA 5FCDA 3HCCA 3LHDA 3NWEA 1IM8A 3OZSA 4KWCA 3KQTA 1ORIA 3LCUA 3EVGA 4LECA 2IDKA 4XCXA 1JQDA 7MHTA 3UJ8A 5C9ZA 3EMDA 4R8SA 2ONZA 5GINE 3JWGA 2XVMA 5HOQA 1NT2A 3BKXA 1JSZA 2AOVA 2ZTHA 3EPPA 3PFGA 3DLIA 2B78A 3D2LA 3UZUA 2ORED 1R8XA 2GLUA 1Y8CA 2H11A 2KW5A 3KQSA 4KDRA 5DWQA 1TW2A 3G2OA 2H00A 5T67A 3TM5A 4KW7A 2IPXA 2NNWB 1VP3A 3HM2A 5DTRA 3REOA 3M33A 5E2AA 2PX8A 3LDFA 2ERCA 3CC8A 1JG4A 4QQNA 3UJDA 2AN5A 3BWCA 4QTUB 4ER0A 4GOMD 4E33A 3ANXA 5GOZA 3I58A 3FPFA 2P3QA 2WK1A 5DM1A 3FUWA 2FK7A 4OQEA 2VDUE 4HGZA 3DXZA 4C06A 2FPOA 1V39A 3GWZA 3LCVB 2PSSA 1XJ5A 4FP9A 3X0DA 2Z6QA 5FQNA 4QTTB 1JSXA 3FTEA 2PWPA 3KPVA 4QPPA 3E05A 4KDCA 5LQCA 4BLVA 3CCFA 2P7IA 4RTKA 3G89A 5GM1A 3GRUA 1OR8A 5DM2A 4IWNA 1Q0SA 4X61A 3UBTA 5FUBA 5BP7A 2IH5A 4A6EA 5MHTA 3FZGA 3C6KA 3GDHA 3LCCA 3S68A 3BGDA 2P3OA 1MJFA 5ICGA 4PGHA 2G8NA 3AXTA 3UA4A 1WG8A 2FRXA 5K0NA 3SXJA 1YUBA 1JR4A 1X1DA 2GAFA 3VYWA 3G2QA 1IY9A 3CJRA 5EZQA 5E1OA 1Z3CA 3IEIA 2OO3A 1RI5A 4MQ4A 5HIIA 5DRTA 1INLA 1ZQ9A 4CTKA 3CJQA 3OE4A 3I5UA 4DF3A 4OBWA 2IDJA 2UYQA 3C0KA 5D1NA 4ER7A 4PYLA 3B5IA 1L3BA 3IYLW 3T7SA 5CM2Z 4E31A 5E1MA 2QE6A 4RVHA 1XVAA 1G8AA 3A7EA 3G8BA 4IV8A 4U7TB 2DULA 3OE5A 5H02A 3TFWA 5GIPE 3GJYA 1ZGJA 2JH8A 3G5TA 2ZIFA 3ELYA 3P71T 3GO4A 4XUEA 3DTNA 5DSTA 3LGAA 1AF7A 1N7IA 4H0NA 5DRYA 4RX1A 1NV8A 4QPNA 2JG3A 2CKDA 4OA8A 3NVMB 3MHTA 4AZSA 5HEKA 1VL5A 2NXEA 4P7KA 3DLCA 4E2ZA 3LL7A 2YX1A 2BM9A 5ERGB 3P9NA 4RVFA 3R3HA 3FYDA 3EGEA
chains in the Genus database with same CATH superfamily
4PQGA 4P4GA 1DVRA 2AQHA 3A28A 3K70C 1UP4A 2FZWA 1OH5A 4MV8A 4RQTA 3KPWA 3BZBA 1Y1PA 3E18A 4QTXA 4WHMA 1K4KA 3IEMA 1BMDA 1EJ6A 4O1MA 3GF4A 1H69A 3SM9A 2C3MA 3QBDA 4LSZA 2GPWA 4R1QA 4F2HA 2VDWA 3E9CA 4KUEA 3FGNA 2ZBQA 1F20A 3AV3A 2BUCA 3LX4A 1EVLA 4Q4AA 4JODA 2X8WA 3SD7A 3THRA 3X1MA 4Z4HA 4WERA 1PJ8A 1LVGA 3MCTA 4MAMA 2R8XA 4TMYA 3W8DA 2F43B 2YYAA 1E59A 2XIQA 3TNYA 4KDFA 4DSTA 1UPBA 2HRDA 3UB2A 3MA0A 3DVSX 4NVRA 1QHYA 4II2A 4J0FA 1V9SA 4YV2A 3WLHA 5LMZA 3ORSA 4P35A 3B70A 4M22A 4ND1A 1IN1A 2JAWA 1AUVA 3B1VA 1FMJA 3QPBA 4XUCA 4D43A 3FFTA 1FLDA 4CE6A 2A1TR 3MG9A 4F96A 5B58C 3ZD6A 3CB2A 1U98A 4I50F 1R4MB 3K6RA 5BWOA 5CFLA 5HKAA 1KH1A 2IT1A 1D07A 3DJFA 4J0JA 4WESA 1Z37A 4LI3X 3V34A 1UL1X 1T0BA 2EATA 2OK8A 2ZB7A 1ZK4A 2VVTA 3PKZA 5DWDA 4A16A 3HXMA 2FEAA 2UDPA 1SEPA 3DEAA 3M82A 4R1SA 4K3UA 3BFKA 4BEBA 5BR4A 4B3MB 4BIIA 5A04A 2NZXA 1FNBA 1GT6A 2R6HA 1IY2A 1A4UA 2RBGA 3QBJA 4AX8A 4DM3A 3KYDA 4IDCA 5M7EA 3D4NA 1DQPA 5K0BA 1IHPA 1Z2OX 1ZCFA 2ZYTX 5LQJA 1LBHA 1M3SA 5CD9A 4D9GA 4S05A 3EGVA 2DCMA 1OUMA 2VJQA 2ZI5A 3NHBA 4G1FA 2BGKA 2O05A 4HEA6 2ZZKA 4B48A 2D1FA 1VJCA 1XOIA 4ZGWA 3DNFA 3I9OA 4X3PA 2N1BA 2C92A 4CQMB 1KDOA 1O54A 2ODTX 2ZTVA 2QUIA 5B2FA 2QN8A 2BZ0A 4NLLA 1AKEA 1VHLA 3C97A 4B9EA 1N5DA 4BIMA 1M34A 3JQRA 1SUEA 1ECPA 1ZVMA 3SR3A 2CLCX 3F9IA 2OVBA 3DTVA 4JFAA 2I7TA 1U0SY 1XCJA 3GB9A 3F8TA 3R5FA 4Z1MA 3U7QA 4X65B 3N8GA 5EYPA 3FIJA 5EZSA 3R7FA 5JAPA 4PM4A 1XL1A 1EBUA 1ZKDA 2YNMA 2HXYA 4EFKA 2OYCA 4ZVPA 2ECFA 4EVIA 1A76A 2B25A 1TUGA 2QTVB 3FPHA 1WQ1R 4PZEA 4IEIA 1LXCA 2A86A 3D6TB 1MHTA 4PZLA 5I7WA 4ZV4A 2GWHA 2Z3WA 3PHIA 3QBEA 4DCCA 2GCOB 3II6X 4RK7A 4YO7A 5KDDA 3ZJTA 4QE3A 5E7IA 1ZZGA 5JNWA 3SAJA 3LLUA 4HH3C 5JS2A 1AN9A 3FTFA 1Z6GA 3TBHA 3NBMA 4EYOA 4XX1A 3W5SA 2YFKA 1ZXXA 2IV3A 2HRBA 2JLYA 2B8EA 1FXWA 2JLCA 4H7FA 2XVYA 4PRLA 4XVQA 1M54A 4BC0A 5GV7A 1YS6A 1ZW1A 3W9YA 3OC6A 5AVXA 1ULZA 1UADA 2MSKA 1DAMA 2HMTA 4Y2UA 3SIWA 4HDOB 2JB9A 4I2VA 1R9NA 3ONEA 5KVSA 3K1AB 4RXMA 3KSDO 3F74A 3C5HA 5CB0A 1C1DA 3TZQA 1P5ZB 4WLNA 1ZD5A 4I19A 3AI1A 1KXZA 1SHZA 4ZJZA 2GF9A 2UZAA 4HTAA 3EEBA 5B30A 4BX0A 2G5CA 2PS0A 2ZQYA 4G56A 3IV6A 3DMHA 1IY8A 3T5DA 4JVSB 1EP2B 4JH0A 3SLKA 5LQRA 2XUIA 4PZPA 2PQ6A 1O5TA 1A27A 2YJZA 1N0UA 4HAVA 1KJ9A 1L4EA 1SD5A 1TT5A 4JJ6A 3JZIA 4KV9A 4D9CA 2RH5A 1SHUX 1AURA 1OBVA 3GEDA 1K8QA 3NJ4A 1PV2A 3AETB 3ZDCA 3COYA 4WK0B 2IP1A 4PPYA 1KMHB 2W71A 4YBZA 1G20B 1Q95A 4BUJA 1WZCA 4J07A 3C7KA 4H1HA 4KKXB 1UWVA 1M66A 3WAGA 3GJ0A 4NS1A 3GLIE 4XTCS 2WF6A 4IIJF 1U7TA 2OUKA 4QRHA 3DLHA 1KKUA 1PO7A 2OGTA 4O4LF 1KZYC 4KPYA 2CL5A 2P0AA 3L7MA 3KZ1E 4LE1A 4F4HA 2OHOA 4LCEA 1CF9A 2SKCA 4ZCMA 4HADA 4R6WA 4YAOA 1LNSA 5EQFA 4MGIR 4UM9D 1ENZA 4F11A 1X94A 3J80A 1J97A 4QQKA 1QLHA 4AG5A 5ITZB 5KWSA 1SR8A 4KQGA 5BSEA 3PD1A 4DG8A 1BFDA 2FW9A 2HL6A 4CR6A 1OZAA 3EGOA 4HQLA 4MAAA 2X0NA 4ZAXA 5FD8A 3V7UA 3VTFA 1ZUWA 1X39A 1P9OA 3BBPA 2DR0A 3AJEA 4X7PA 4Z7NB 1BWSA 3K96A 4D4JA 4C14A 2R4UA 4TVKA 2I6TA 1ZR2A 4DCJA 3F6PA 2ZWIA 2MSCB 2DTEA 2BFEA 5D84A 1MO4A 1U3UA 2DM6A 2BLNA 2IHYA 3AUUA 3ZX4A 3CVJA 1XEAA 4WBXC 4DCPA 4N12A 5A2GA 3D0KA 1X7DA 3NDBB 2EGHA 5F1KA 4GRAA 1HBJA 2NT3A 3FZEA 4ZT2A 1DGQA 2J0EA 1U3VA 2K87A 3FBTA 4X1IB 4EBBA 4DJJA 3J81k 2V7TA 1QFJA 2FWRA 2GSDA 2ZULA 2ROQA 4YS6A 2UZIR 1RHUA 4RWEA 4BFUA 3EUWA 5EGNA 1S8OA 2UXBB 3I52A 3GCZA 4UUMA 4ARCA 1RWXA 4UTZA 4BU1A 4HUTA 5B7NA 3ADOA 4D9HA 4QO7A 2IHKA 3RDPA 4KNWA 3UWOA 3EZ2A 2FMHA 5K0JA 4RMGA 4TYYA 2WSSA 2YZ7A 1PGOA 4F0JA 4O25A 5TGZA 5K03A 1LF5A 1PR6A 2VSQA 3EQ6A 2A1UA 3EFOA 3DP9A 5IDVA 2BEUB 5TC4A 1MN6A 4URUR 4QFBA 3ZV7A 3B3QA 1E3IA 1OIWA 1TOAA 2Q5QA 4NTZA 1EX1A 1U7XA 1VA5A 3A9SA 2KMLA 3RS5A 2I87A 2X4GA 3DQZA 1ZCZA 4P5PA 1A88A 2PZJA 2Z9CA 3EMBA 4GZ5A 3P1JA 3SE0A 5BSHA 1FFXB 3WL8A 3KOYA 4C0WA 2HW8A 4B6PA 4GRIA 1HDCA 2ZRKA 5K0EA 1DKNA 3I9V6 4B4DA 2OAEA 4HLUA 5KB3A 2E6KA 1Y82A 3GH1A 2IELA 1JI3A 2H2FA 2F8LA 4XD7A 3PT9A 4R9SA 1YQGA 3HUUA 1RLOA 3ZKWA 2VWQA 1QHEA 4II3A 4RHYA 2AKEA 1E3EA 1J56A 3TTTA 2IITA 1SC1A 4XAQA 1SKUA 1BS9A 2AN3A 4M4SA 3IT2A 1UDRA 3K8QA 4L76A 2BE9A 4YJHA 3U6BA 2WJ3A 5TQ0B 1OC4A 4HPXB 5B7PA 4U7FA 5DSXA 4JA2A 4JC4A 5JRZA 2VK1A 1IJFA 1QIHA 5AJWA 4LMPA 1E5DA 3PT5A 3MTAA 5H82A 2ZSUA 4GL4A 3PNPA 3M4JA 4K40A 5IM4A 3CPJB 4C2BA 4N8SA 1T91A 2EP7A 5MF6A 2HD4A 3G2MA 2YC2C 2R44A 2PFKA 3VO1A 2GN6A 3EVZA 5C8YF 4BVKA 1HA3A 1PW5A 1RXCA 4TWRA 5D3KA 5EMHA 3PYXA 5TEVA 3V4VB 3QZUA 4EZEA 3T4XA 3DULA 4H16A 4ID3A 3ZXXA 3K5WA 2WAXA 3OHPA 1O3YA 1O4WA 1U8EA 3AU8A 3VPFA 1YE8A 5CLIA 3L7YA 4CQLA 4RTQA 4Q93A 4CTOA 3R3ZA 5DHUA 3HGTA 1YJXA 3OPVA 4LOIA 2IEGA 3WMXA 4B4KA 5BUSA 1TPZA 3E7WA 1Q3HA 3DMFA 3WGMA 1UXJA 5KYKA 3RLFA 4L6IA 1I2ZA 3LTEA 2BFWA 1XDUA 4MTCA 2FEKA 4OL0A 2LP4Y 1EAMA 2GD1O 5A2QA 3OH8A 2NU8A 4EX6A 1IXKA 1H9BA 1ENPA 5EXTA 1PZGA 3VI4B 4R8LA 1G8GA 2WUWE 3FWKA 4BNZA 3M49A 3Q15C 1F14A 3KV1A 2R7AA 3UHFA 2PGLA 1X80B 1PNRA 1QRUA 3G2JA 4RXUA 3UPTA 2XUOA 2O59A 3WGLA 1OFIA 1YQXA 2J30A 5HE9A 4WBSA 2P62A 1V8DA 1VMDA 3OIYA 1SC4A 3AUFA 2WFLA 3FOWA 1QQ6A 3HEBA 4BCBA 3WGTA 2GR9A 4KCGA 5DO9A 1AF4A 1TKCA 1GSOA 2F17A 3MTJA 2XWBF 2ASEA 2BRUA 4LOAA 4DCGA 2J9RA 2XQJA 1A9OA 1OMOA 4HAOA 3E5HA 1L5FA 3R7LA 1YHNA 4NATA 3SJUA 3T35A 3AWIA 3GHHA 3L0OA 1C14A 4M54A 4MKZA 3CRVA 2F3PA 3IP6A 1AZTA 1NUSA 3JWJA 1IONA 1W85A 4GPD1 3SBOA 3TIXB 1HGXA 3TECE 4BJ6A 2P35A 2JRLA 3I9JA 1S2OA 3PI7A 2MMCA 1SXJC 1NYQA 4OLHA 3SNHA 2DSNA 1N4DA 2FSHA 3LU1A 4MLCA 3TW8B 3QHQA 4YUYA 2JHGA 4O2AA 3KYCB 2RJNA 3H8JA 4MR8B 3W06A 3GLUA 4U5XA 4DA0A 3PICA 4FNAA 4FFVA 4ZPXA 3PFWO 2HWUA 4C7VA 2AVDA 1MEJA 1O6CA 3F2VA 3ZD8A 3Q3IA 3ZIAD 4D4LA 4OPMA 2O8CA 1A4XA 1MJNA 1PTJA 3U7IA 3VKWA 4O08A 4BZWA 1RZRA 3RYCB 4S1OA 1BHQ1 3RRBA 4BLOA 1PDOA 4R1PA 1HTBA 3R0JA 4ISBA 2PPLA 4OJNA 3CPEA 3JD4A 4AZWA 5AXBA 1ZI6A 2BGIA 3PIIA 1QNLA 2NTJA 1E3LA 2LRHA 3FWHA 4XASA 1V7CA 4Q7QA 1N3IA 2QSZA 3A36A 1C8KA 3JRWA 3T52A 2IXGA 4FINA 5DMXA 3R5KA 2A0UA 2A7XA 3F9CA 1D0SA 3FJ1A 4KO3S 1CJVC 3CF6R 4DMKA 3OOWA 3GA5A 1T25A 1DNPA 1SD2A 3RFUA 1Q1BA 2ZI6A 4DBVO 2AA3A 2E0IA 3OD5A 4R8SA 2D1RA 2FFBA 3K32A 2E7ZA 1G3UA 4Y1RA 1NU6A 2X1MA 3I92A 1QE0A 3FCXA 3WG9A 1R6DA 3V4ZA 3TLXA 1RQ7A 4K8OA 4V0ME 1GTZA 1SBCA 3U40A 1KIFA 3INYA 3NC1C 4MKFA 3CU5A 3UGTA 3KELA 2HSJA 2CDRA 3L7NA 4MWBA 2AHRA 1SMKA 1QIDA 2H92A 4BLTA 3P20A 4EY3A 5THKA 2FWAA 1JEQB 2J33A 4F60A 5FT9A 2G0NA 4M6WA 3S0JA 5JZBA 2I91A 3MMSA 4OX9B 3TVTA 3KYIB 4GSLA 1KOLA 3VV3A 5BVGA 1U3GA 1PGPA 4L50A 5IVDA 1XF9A 4CEHB 1BROA 3AP3A 3WHLA 2CXXA 4PO3X 4FP9A 2PSSA 3X0DA 4QKQA 2ZCUA 1KEPA 2B4TO 3VO8A 2JIDA 3D3KA 4KDCA 4J91A 4M88A 5LP6F 2BFCA 4F92B 2O20A 5HTOA 3SSAA 3HWWA 4JP2A 4DR2B 2PZ8A 3K9QO 2AZXA 1H6CA 3U4QA 2V5AA 1TZMA 4NNOA 4RJLA 4W5HA 3NV9A 2XPCA 2DLNA 5INTA 5JO0A 4TSFA 1TIPA 1LBEA 3DDNA 3H04A 3HBJA 1E8NA 3HP4A 2JCYA 2J45A 3HPRA 3HUFA 1X1DA 1PGJA 3TQTA 3VPHA 3BIJA 1PJTA 2HUNA 4WFQA 3OTOB 4ARZA 5GJWC 3TE6A 4CKYA 3L6RA 4BO1A 2NAPA 2VDMB 2WU4A 4PICA 3QU7A 1HY3A 2C03A 4CMEC 1AV7A 3PI6A 1O6FA 2JI6A 3DJYA 5DB4A 1TYCA 1FFBA 4ITUA 3ACCA 1NATA 3GPCA 1NMYA 4K9LA 5B1YA 3D31A 2IZ5A 3B1JA 3DV0A 1XAHA 5IAOA 1WHTB 3WRWA 2ABWA 5IUJC 3V1UA 2CF5A 5FUMA 2QE6A 1RQNA 4U7TB 3WTBA 2OCAA 3K4HA 3HKBA 1Q21A 4FZ5A 5FH9A 2COEA 3UJ3X 2ZJYA 4U8HA 1ZGJA 2WJZB 1BGXT 1UEIA 3OIFA 4QUIA 2RIPA 1CY0A 1DHRA 3RSQA 3NHZA 4V24A 1XTVA 3L0SA 4QPNA 5A62A 2ODQA 4TVOA 2PT7A 1CZNA 3U62A 3AQIA 4TTAA 1SU6A 3K35A 1QRDA 2X4DA 3OM1A 4AZSA 1F5SA 4E2ZA 3P9QA 4DV3B 3PE6A 3IVRA 2BKLA 3OIDA 3H42B 5A06A 3MK31 3VJRA 4MW0A 2ZE6A 1CERA 5K0LA 4CQJA 2FVYA 5KJFA 4MPPA 5DLQC 1DXQA 5AJXA 1T3HA 4EFMA 4ES6A 1H6DA 1AC5A 1N2HA 4E6PA 3E1SA 3IT1A 2IUUA 1LBSA 1TYBE 1HNNA 3ZU5A 4ENTA 5DVZA 1M7GA 4KN5A 1H05A 4MV6A 5ESRA 5JQGA 1IJKA 2XJ4A 1L0BA 4K03A 3NOQA 1G5PA 3CSDA 1LRKA 1ADYA 3T1NA 4UBMA 1AK9A 4QGHA 4URXR 2PD3A 2J3KA 3URMA 2PR2A 4PLHA 1JA9A 1QC5A 2Y1OA 3RS4A 2YMLA 1VL6A 4KUGA 3PCRB 3S8MA 4LQCA 4BKPA 1GP2A 2Z08A 1SK8A 2ZBPA 3WB9A 4C78A 1MW8X 4F5WA 1X2BA 3HC7A 5KYVA 4B71A 4MIEA 5AR1A 1UBFA 3TGLA 1WDLA 1WMEA 4X91A 2XXAB 4MCAA 2B0CA 4GP9A 3PNSA 4MUGA 5JPIA 2HK8A 4PHHA 4QT0A 1YFZA 1AKNA 2I03A 2IY8A 2YWFA 3GUYA 1VLMA 2N0SA 3GXOA 4AN1A 4OREX 1N2CA 1DBPA 4HVCA 3B78A 3L4KA 2DERA 1PR9A 1S89A 3ZCQA 1YMUA 4ZV9A 3H5RA 1M8JA 1QIIA 1QBGA 1MTOA 3CH5A 3D3JA 3MOIA 2P67A 1JJFA 1P3DA 3DCNA 1C1YA 4DGQA 4EARA 1T1SA 3H2YA 4ZHSA 1TGYA 1ZK2A 2ILVA 2Q3JA 1S8FA 2XEXA 5DBGA 3ZNNA 3EEIA 3HUTA 2CMHA 4G97A 3RYHB 2B8JA 4KVAA 2ZI7A 3D8BA 4HDMB 3AH8A 4CV1A 2EFHB 1UKCA 1AQNA 4C7BA 2PXXA 3PTLA 3T06B 1WU7A 3TLZA 3T15A 3W8FA 3EAGA 2H31A 3EBPA 2PEZA 1ICIA 2PMKA 3NHJA 4C3ZA 4Y6GB 3PQ4A 1CPYA 3M89A 4IMIB 1YVUA 2IKSA 4CI0B 4W5RA 1TRKA 2ST1A 3BQ9A 2QQFA 3UK7A 1RAFA 1SB9A 3KR0A 4X71A 2W2KB 4YIKA 2D0PB 5A4KA 2A88A 4W9MC 3PF8A 1VJ1A 3SF8B 2VYNA 3MAGA 1X1SA 1J1UA 4L4UA 4Z0PA 3FAKA 3W2TA 3QXCA 4CIAA 1C3XA 1THGA 4JXXA 2VKQA 3E7FA 5A9SB 5LPNA 3ZEIA 2GERA 2PO5A 4I55B 1H8ED 1OX5A 4RA9A 2APJA 3NHAA 3N07A 4Z99A 1V9CA 5FAXA 1RXWA 1DWUA 2MOKA 2G9UA 3HJHA 5DW0A 3LBFA 3THOA 4FMCF 4N7JA 4BQFA 4DREA 1I6LA 1QF7A 4X93A 3ZC3A 5DASA 1I7PA 3WLJA 3MWYW 2Q49A 1V8FA 2CZQA 5AHRA 2DHEA 1M1YE 2VH1A 3A6LA 1JWBB 2ORVA 1C9NA 4UEWA 1E3WB 5EKUA 3ZBQA 2RI1A 5HCUA 5L40A 3A3PA 2QI9F 1U99A 2XMQA 2BZ1A 3BFJA 1WHSB 1K9VF 4DSZA 3HVHA 4TT3A 1FUKA 4ERNA 3O8NA 2IVZA 3MRVA 4OTZA 2GZHA 3EGDB 1B0PA 1FDTA 1NG1A 3CF4G 2EKBA 2O3TA 2NU6B 2C8LA 3ILHA 3LY8A 5A9SA 5BN3A 4U7DA 1YBAA 1ORTA 7REQA 3A05A 1ZIPA 2KX7A 3WV5A 1G2OA 3TTSA 1QTRA 3L7KA 4DY4A 2C97A 1K66A 3T1TA 2YL2A 5ETJA 2Z30A 1NOIA 2DFTA 3KJNA 3HA3A 1YQUA 2AYXA 4FYPA 1G21E 2D59A 4CEJB 1Q7GA 2XYQA 4EHKA 4LBWA 1QB7A 721PA 3ZGXA 4JZKA 3RHFA 2BI7A 4U3JA 5CCDA 1SCKA 3S7ZA 3VR2A 1O4VA 2OCLA 3OKCA 3ESAA 1E5QA 5F1OA 3QTLA 3REQA 2CLHB 3W34A 4DWOA 5I7FA 5LDHA 1Y6GA 1TVMA 4QEDA 1WY5A 4UXHA 5JD6A 3AQ4A 4OJTA 4P53A 5KI6A 1Q83A 4KU4A 5B6PA 3ETGA 1QWOA 4G2TA 4TQAA 4TS3A 5BYKA 5KC9A 5M5BA 5IT9A 2HMSA 2BCEA 1JECA 4LJ9A 5IYZB 3BTUA 2PYZA 4LX8A 4Y1RB 2QPOA 4C1BA 2BL4A 1BCRB 4FLEA 4FFLA 2JHFA 4GC5A 4R5HA 1HDXA 5ERXA 3TWOA 4UCQA 2IBSA 2GTPA 5DV9A 1DXYA 1QYDA 2AZMA 2OB1A 4AAYA 4N3CA 4AXXA 1MQSA 3KQNA 2B7CA 1J8VA 3CN9A 1SKBA 5IHXA 1AD2A 1WLSA 5EE5B 3U9SA 4FFRA 4PLPA 5HYVA 1Z6PA 1ZNWA 1A7UA 2NLOA 2ZTUA 3QOWA 2D3TA 5CLJA 4LOLA 4KQFA 3WB0A 3WLSA 5G0UA 3AY6A 1EVIA 2Q45A 3AVVA 3VNUA 5J59A 1GNLA 4INJA 2J9XB 1I4DD 1G0OA 1FU4A 1JV2B 5FOTA 1T9GS 1FZQA 1X1AA 2R8BA 3LF1A 1PK7A 3TXYA 5IABA 3O92A 3KU1A 4ALNA 4U63A 1XYGA 3GLGA 2PS3A 4GYWA 2G07A 3EWIA 3ZH9B 2OKGA 3AVQA 3NUGA 2QVGA 1EK0A 5DK4A 2VH2A 4FMBB 5FB3A 2R4TA 3DZIA 3MB5A 1L7XA 1ENYA 4LZAA 3WP0A 4F04A 4K9SA 4K9QA 3LNTA 1Y7TA 2BEJA 2VT6A 3A4TA 2F2TA 3M1IA 3S6JA 1TZJA 1L8OA 2BEKA 4F4UA 3CVWA 3O7WA 5B5SA 1E2PA 4EJSB 2ZUFA 3T12A 1R7RA 4K28A 2PZLA 4KVZA 4Z0TA 4DLLA 2JGLA 3QVLA 5AOCA 5HKKA 5FBZA 2C04A 5EIOA 3R77A 5CTJA 4O0LA 4EHJA 2CFIA 4DA4A 4LCJA 4L5BA 1T5OA 2FMIA 1C0KA 5ECWA 4YMVA 1L7EA 1RQXA 1AA6A 1OH6A 3BK7A 1T15A 1G60A 4E5PA 1SOWA 2IYEA 4DYVA 2WTEA 3GIDA 3K1TA 2QX8A 3BH6A 4N5DA 1RC1A 4LW8A 3A7DA 5HKKD 3O3MB 3TPZA 1GTVA 4P82A 3VH3A 2ADMA 3EPLA 4BNGA 2J3IA 4Q12A 4RIHA 4BO8A 4IGAA 4M8NE 2JHPA 5D6NA 2Q41A 3BM5A 2B1RA 1M1XB 3V55A 1MO5A 2CL0X 4PV7A 2GNAA 5CX1B 4Z1OA 1DJLA 3Q3HA 1H9CA 3CNEA 1AGNA 3QLVC 4J8PA 2E4AA 4E32A 1OH7A 2FEPA 4BP1A 1XTSA 1W96A 2Q1SA 4XIIA 1FFGA 4C04A 2PAAA 3IP1A 5LFAA 1KVSA 4G65A 4X9XA 2RFLA 4EA7A 2F55A 2ATXA 1HYHA 1GZSA 2EOAA 3FRIA 3WGZA 4DBLE 3WGUA 3K20A 4IX9A 4QJ4A 4U2DA 4X8OA 2C61A 1IPEA 3QX8A 1V11A 2DWPA 5F5LA 1FXWF 1YAHA 4MGKR 4QFCA 3SMQA 4IIDA 3WNZA 5ED4A 2BGNA 4ND7A 1HYGA 3TRJA 2HZ7A 1W4LA 3HN6A 1N5IA 3IQGX 3KLPX 1NQ5A 1YAJA 1N0HA 2SCUB 2OHVA 5HGJA 3HN7A 3WLAA 1QH9A 1XQVA 4XGRA 1EXDA 2BD0A 1A9SA 1CQJA 2NNLD 2XE4A 1U2GA 2YS6A 2JJ2D 1R8JA 1FU8A 3ICVA 4GEKA 4MR7B 4DNPA 4LYHA 3GN2A 4WECA 4EVQA 2ZRDA 3NYRA 1VZ2A 3AEQA 3EGIA 3R3UA 4CM9D 4QTYA 3QPUA 4MW2A 2PH5A 2VUTA 1Z88A 3KT6A 4ZTBA 4BMOB 1VCOA 3R3YA 3ZIUA 5FI3A 5H8WA 2O1XA 3RQIA 1RTKA 3BE8A 2C31A 4ZCPA 1L2TA 3GGPA 4RFSB 3AEQB 3BFPA 3KOXA 2I1WA 2EW8A 3REQB 4PYQA 2D5CA 3SC3A 2QPLA 5AFSA 5JCZA 2H2GA 2JHCA 2B82A 3I6IA 2POCA 4UMEA 3KKNA 1CB7A 1EBBA 1UMCB 2QN7A 3OZFA 3WMWA 1OLUA 2YN0A 3AB8A 4EZIA 3QJGA 1E6KA 5FLEX 3RTGA 5EJEA 3EOAI 3RS8A 3STHA 4ZO7A 5DMHA 4US0R 2ZVPX 4PHFA 2P68A 1AKWA 1XPUA 1KRWA 4OXKA 1KI6A 3HXTA 1CF2O 2GA9A 4LXHA 4NYJQ 1QMGA 4QYMA 4RVDA 1B14A 3HI4A 3QTTA 5HDQA 3V1LA 4FFSA 2C99A 1NR7A 1HYQA 3H2JA 4C0JA 3EODA 3V7NA 2WPDA 3QELA 5DDIP 3K6SA 2OBFA 3BICA 2WHPA 1DIRA 1CUEA 1NHGA 3FJOA 5JO9A 1QYCA 3KZXA 4HD8A 3SYKA 1GLVA 3UWDA 4II7A 3LKVA 3RVLA 4QU8A 3IR7A 4LJAA 3FKJA 3LUGA 4RY2A 4MQFA 5J43A 1GZHB 1MENA 3BSFA 1H66A 4NCIA 1V7PC 4E4YA 3O9VA 1DO0A 4ENPA 1WXXA 2OXCA 3CKKA 4D3ZA 4V3BA 1D1QA 2HF8A 1SBTA 3UWKA 4W5QA 1V48A 1KS9A 2XB4A 4QDOA 1NA5A 1X7XB 3WFZA 1BVHA 4HYTA 4FK8A 1KO1A 3TW8A 2V7VA 4GI2A 5DTMA 4JI0B 1YZNA 4R3WA 1HNWB 1RCFA 3OJ0A 2QB5A 3U49A 1O1YA 4JC0A 2E4VA 4WACA 5A5GA 1CX9B 3ZE6A 5AKEA 5IZCA 2O2SA 3JD2A 3FTCA 4C05A 1GL9B 1O9HA 2AB0A 3M70A 2HLDA 2BFEB 2WYVA 5F35A 3RJ5A 2C94A 4UEJA 5ICSA 5M2QA 4CHTA 1VE1A 4LY0A 3ZDQA 3ZE9A 3SWWA 3DDCA 4YONB 4DLPA 2WFLB 3IHWA 3ZU4A 3E8XA 1QGED 4OLBA 1MB2A 2BHLA 2BMFA 2FEXA 5G1NA 1FDWA 4AECA 5JSZB 2BSXA 2YZ2A 3IC5A 2F3RA 3AHCA 5E8JA 4FYXA 4ZXPA 4CVNA 4BJ1A 4JLKA 1ORRA 1FB5A 4WXHA 2O8FB 3PDHA 3NKLA 2ZRNA 1SCQA 2Q1XA 5CR9A 1DWQA 2A9FA 1G59A 4G9GA 1KNXA 4K26A 3OIGA 4OMCA 3KQTA 4Z86A 4F12A 2DAPA 3DEJA 3ZNPA 4D99A 4Z49A 1P73A 4YCSA 1Y98A 2GNOA 2HMVA 2VAVA 2VQSA 4HK4A 3V8MA 1P1HA 5AVUA 2GPBA 4L75A 4Y6PA 2DUUA 4RESA 5L3QA 2AW3A 3O8RA 4EA6A 4KWIA 2I6XA 1Y8RA 2Q27A 4PLWA 3OMXA 2B78A 2O2HA 2ZJ4A 3M5DA 1X86B 4KDRA 2Y1CA 3CZCA 5A7GA 3PNKA 1I7SB 3VU9B 4WZBA 4KO4S 3DLPX 5BORA 3B82A 1LCIA 3BQMB 1TLTA 1IMOA 1NP6A 2EJWA 1SZJG 2VNAA 2DWQA 3FXAA 4Y9DA 2PX8A 1F2VA 3KS9A 4RD4A 5GADl 3H18A 3GJZA 2QRHA 3NASA 1XMQB 5CLGA 1FP6A 4MDYA 2V6MA 1AB5A 2IXDA 2P3QA 1RSZA 3FPFA 2D2EA 3HWRA 4JOSA 4X1KB 5DGHA 4DM7A 3FUWA 3X43A 1QR2A 4D79A 3A2KA 1RACA 4YCMA 4UHBA 2GPAA 2GESA 1ST3A 2JCXA 3LC2O 5IN4A 3PHHA 3LRTA 2YXNA 1N7HA 4KR7A 3GFSA 5FQNA 1JSXA 1HUQA 3NIWA 3D3QA 3QA3E 1T36B 4GX2A 4JLNA 3SMVA 2VATA 1QOPB 3S27A 1W75A 3ROGA 3H3JA 2RGNC 3QUCA 3GL9A 5K1ZA 5BN4A 4DANA 2QYHA 1G4HA 1RAIA 3MT9A 2IIVA 4X61A 4B3IA 3QVUA 4MX8A 4CLXA 5JAUA 2OAGA 4Y98A 2XRYA 5AVWA 1ESZA 5JVDA 4M1MA 3ROKA 4PPNA 2PM8A 3HA2A 2G1JA 2IHVA 4OATA 3TD9A 1LW7A 3HVUA 3RAPR 5HUQA 2OOKA 4IQ0A 1Y7IA 4IJ6A 4MI6A 5CNJA 4CIDA 5FUVA 4I3HA 3F4BA 4S1TA 5CFQA 4LYGA 1OW3B 1MIOB 4BJ3A 4MS1A 4ZVSA 3CEAA 4GR9A 4BP9A 3U0VA 1SXJB 5D5HA 4MKHA 4OFZA 3H86A 1DKUA 3HJUA 4PC6A 3QF7A 1G5IA 4MCJA 4CMIA 3SBXA 3GJ3A 5I8PA 2IDJA 3W8RA 2D1TA 2EW1A 2RONA 3AMVA 2ODEA 3KB8A 1Z6YA 4UBOA 3EXEA 3BOSA 3MGAA 1WVGA 5A71A 3HDJA 4DPLA 4ALIA 4KQHA 1J24A 1KY3A 1HDEA 1WMFA 2M98A 2VPPA 3O1IC 3QFSA 4KFTA 1I6KA 1M2GA 4NK4A 4JYPA 3TF5A 3HDTA 3P71T 5ABPA 1OREA 3VPGA 4RJ2A 4JJAA 1GM5A 4BV8A 4OA8A 4TS9A 2WT4A 5DHRA 5KZMB 1LDBA 3QX7A 1MXFA 1G7SA 4KFSA 1VL5A 4ENRA 4HH0A 3RADC 4FNGA 5JFTA 1W52X 3CLVA 1Z0UA 3E4DA 3PEUA 3AVXA 4KR0A 3H17A 3VA7A 3BSYA 4F1WA 3JQAA 3N2LA 1FVHA 1W5EA 4DXHA 4IMRA 4Z7JA 1XRMA 1QS0A 2I7DA 3AC0A 1A04A 4KQIA 4U5QA 3USES 1G42A 1YZUA 3UJ6A 1JDBC 1RHJA 3TIIA 3UT5B 3ESCA 2EJTA 4KQWA 4ZO6A 4V0MA 4DIFA 2PA0A 4YNBA 5GJVC 4WNCA 4DYDA 3HKEA 2IYFA 4LVUA 1Z2PX 3IR6A 4JENA 4M8IA 4EHNA 4TT3D 3SIRA 1HORA 5SY9A 5AJUA 1YO6A 1Z17A 2CLKB 2OWEA 4BJ5A 3C8UA 3GJ5A 3WDSA 4QNNA 5HJEA 1M7BA 5ES4B 4N41A 1BFUA 3G2PA 2BPOA 3NVDA 5AHWA 3RSGA 1O03A 3ZVMA 1UP7A 1ISMA 3B9BA 3L92A 3VU3A 4BECA 2XA1A 3M5CA 1SUWA 3N28A 2B92A 1JEQA 3IUMA 1TX4B 2E82A 1GADO 1JDVA 2EP5A 2B4YA 5A7FA 2FK8A 1ZBQA 3ZVLA 2BFPA 1MX9A 2J3QA 1KSGA 2HBRA 4F2GA 4N5NA 3PYMA 1M67A 1ENOA 2JI7A 2PU7A 2REQA 2Y77A 3SJZA 4R5MA 3SJAA 3PX2A 1CEQA 4YGYA 3DEHA 1SM4A 1PR4A 3KTFA 3NH6A 5JDCA 3R9XA 5JASA 1NONA 3T7IA 2JH3A 2CGEA 5HK9A 4F5YA 3K30A 3ME5A 4BNJA 3G59A 1YFKA 2QMEA 3R2JA 1R6XA 3WKAA 3D54D 2VHCA 3ZU6A 3R0QA 2XZOA 2X5JO 1X7WA 2HPAA 3IP7A 4ZZ1A 1QO0D 3LL4A 3UK2A 1LFDB 2VZ8A 1WXHA 1Y33E 1C4OA 1T5IA 1PNOA 4GKVA 2FZKA 2Y2VA 2VH5R 4NE7A 4WNAB 1TM4E 4D96A 1KQOA 4MW7A 1AT1A 1EVYA 3K09C 1EFPA 5HZKA 5JH7F 1MAVA 2Q07A 4N47A 2RSLA 2QP4A 3C6YA 4G5HA 4XUGB 2P40A 3W2FA 1N2EA 2I4NA 2REBA 3QUSA 3JYOA 3UB3A 1CR1A 3EVCA 4C30A 2CJWB 2FB9A 3LXMA 4PS0A 2ZQ5A 1SC9A 3BRQA 3UXHA 3R0ZA 4MYUA 3VFDA 5EHGA 1E9EA 5IJWA 4DT1B 2G08A 4Z54A 1YNSA 2NYAA 3ZCVA 5E6RA 2F4VB 1NJ6A 3Q5DA 1IN6A 1DBVO 2C88A 4TTTS 4IRXA 1AZWA 4IXMA 2NP7A 3KOOA 1P1CA 4CEIB 1YH3A 3INGA 2C9BA 3PYLA 3GDWA 3FF4A 1K9SA 1DQSA 1NVVR 3P97A 3U3ZA 3WI7A 2IC5A 2G1AA 4M1TA 1E96A 2GYVA 1M6YA 5FFFA 1XVLA 4RE5A 3W5CA 2HYDA 1JIJA 2C4TA 3KG2A 2PD6A 4FEAA 3PUVA 3T7CA 2REQB 2VSNA 3MAJA 5C80A 3BSSA 3VMMA 1ECCA 3U7FB 1F8XA 2OM6A 1ZOIA 4HQNA 2CWWA 2CKMA 3LUHA 1A82A 4TKVB 4ZT7A 3WB2A 4DQLA 1WX1A 1R0ZA 2ZT5A 2ZAYA 1T8YA 1WVIA 3TOCA 4KE7A 3V6MA 4Q00A 3BS4A 3IH5A 3L9WA 3DOUA 4J6EA 2GN9A 4U6SA 1B74A 5DNAA 3ABIA 2CLOB 2YCBA 3MVEA 4P1ZA 5FOQA 2W6OA 3H13A 4ER6A 3DO6A 4RENA 4PNPA 5AYVA 4MPTA 2VCYA 3OQOA 1Q6YA 2H0QA 3GAZA 1N34B 1YTUA 8LDHA 3W5JA 1BOFA 1SQ6A 2BFNA 4NZOA 2I67A 1WZNA 1U8AA 2DPYA 4IO1A 4IXNA 4XH9B 1YQDA 4BNHA 1JEYA 4K0RA 1U6JA 2XD9A 2C54A 1BQ3A 3GARA 1L7QA 1ZWLA 1DOHA 1XIVA 2GTIA 5H59A 1K97A 5JNTA 3AIMA 1NBAA 3DMYA 2I6QA 3HU1A 2XUKA 4UMVA 3IVCA 4M0DA 3TSOA 2FFHA 2OSBA 1V6AA 4DLBA 4L16A 1P74A 3Q9UA 1U4SA 3PC7A 3CR7A 5UKDA 1Z13A 1UP6A 4NBKA 5M34A 4Q4JB 3OFNA 5BV7A 5LSAA 2BGWA 4BRZA 1FJ2A 4G8BA 1LSOA 1P4JA 3CKLA 5JXGA 2XCIA 5KVQA 5CLQA 3Q2KA 4EG4A 3PA6A 3IEVA 1MB4A 2GZ3A 1G17A 3OOYA 4QO8A 1W9HA 3K73O 2ZDHA 1XRLA 3FCCA 3TOZA 1YF3A 4GXQA 3PFNA 1H2AS 2GN0A 1FBTA 4U9UA 1J49A 2IPLA 5BPFA 1P0FA 3PIRA 3RW9A 3LP8A 2FPGB 5H68A 4X90A 1XN1A 4ROTA 1UXOA 2WUGA 2F7SA 1LZLA 3QYAA 2GEKA 1S6YA 2WR8A 4LBYA 4LNUA 4XFJA 4BXOB 2CZCA 4JY7A 2JANA 1JTVA 3C15C 3UEOA 5DBHX 4I6JA 3TD6A 3JQQA 3TIFA 4IDNA 3L7JA 5A02A 1Z0JA 3CS3A 1FS5A 1Z47A 4WH0A 1T9HA 3H16A 4TVSA 5FLXA 3Q98A 2X0RA 4OSPA 4RPHA 4E3WA 3E5MA 5ED0A 3HJGA 2KPOA 4CN8A 4PGGA 1C7QA 3OQNA 1TK3A 4RHEA 1YNOA 3ORHA 5CTAA 1ODIA 2XVAA 3UK1A 1N1DA 2RIRA 2QN2A 2HNKA 4PO1A 3UT5A 5TIIA 3QVTA 1D2AA 1O94A 4YWJA 1AIPA 3AFOA 4ZT6A 1Y1SA 5GTDA 4R01A 1VG1A 4QPZA 3SS9X 2HWKA 3CIOA 2E2WA 3GGDA 3M4YA 4RCYA 1V45E 3IR5A 2BHRA 2ZTSA 2GCGA 1JSCA 3C2QA 1S96A 1RQRA 1XDGA 2OY0A 3AY3A 3O7MA 4E5DA 2QSYA 1F2DA 5TX7A 1GPLA 3N0XA 4OGWA 2AX3A 4HB2A 2EAUA 4C08A 4RXTA 1D8TA 3AUSA 2ECKA 1IAVA 2O8CB 1E2NA 3NFYA 3DOIA 3IRUA 3H5NA 3HYRA 3WZ2A 3GQBA 4RK5A 4NICA 4DLAA 1GAQA 2NVUA 4L02A 4AL4A 4DTIA 3OJEA 4M9UA 1KI2A 1PJQA 2W58A 1TD1A 5LUBA 4DAEA 4UUBA 2Y99A 4Q19A 2OD7A 2XGMA 4KACA 3AB3A 5EZYB 4D9FA 4Z4CA 1E0JA 1AQJA 4P33A 2QU8A 4ZOEA 1LBIA 1XTBA 4TL6A 3VUEA 3WXBA 4E5NA 4Y2VA 5I4KA 4Q9DA 4EYGA 2XWSA 4L4RA 1CR2A 1NGSA 1U2RA 3I42A 3ZWDA 2IVFA 4IF6A 2YWRA 3Q3VA 4HSGA 1KTVA 3M5WA 3AKZA 4RQBA 1E1DA 1PSDA 4NMMA 5FEUA 3UMMA 2EC5A 1AQUA 4PC3A 3E22A 4IDPA 4EP1A 3H4MA 1YR7A 3WSVA 2ENWA 4CLOB 1J1ZA 2PIAA 1DQYA 1Z73A 4JLSA 3W3AH 4TYNA 1HR0B 1KHHA 4TRJA 3F6CA 5A6SB 5G0SA 1O0BA 2HGZA 1HEYA 4HNQA 1W88B 4O33A 3WBFA 5CIYA 1HFKA 1LPMA 1Q19A 5DHPA 4F91B 5C46F 2YWHA 4TV9A 1FNSA 4YX9A 1GQ2A 5J4LA 5KIAA 4OJQA 1G55A 5EJ2A 1BDIA 1J2YA 3GPDG 3KJXA 1C0EA 4P22A 2DTDA 3KR1A 1IQUA 3A4IA 3P2MA 2XDQA 1FDIA 2VBCA 4GMDA 1E9BA 2LZ0A 4O5OA 5G1PA 3RVJA 3BAFA 1LQ2A 2BBTA 1IBKB 4P0TA 1N3LA 2H18A 2OC9A 3DMNA 2YHIB 2D6FA 2SNIE 3PQ5A 2QD2A 2CFSA 5FOSA 1CRLA 5HUHA 4GKBA 3H2KA 1PFQA 3WMEA 4C4AA 2DMRA 2ZSKA 3W79A 2W6QA 4TT8A 4ZU1X 3RKRA 1USVA 5JCXA 1VE6A 1N8TA 3ZCPA 4EDFA 3VMFA 1LRLA 5FI5A 3ERCA 3FUUA 2IDMA 4AMVA 3TS1A 2XQFA 5F52A 4C87A 5KJ1A 1SVIA 1SU4A 1NPDA 3BIXA 2Q9CA 2W6PA 2V6IA 3Q5EA 1E2FA 4JI3B 4DJTA 1Z62A 4XZ3A 1H5QA 1TKBA 5I9LA 1P1FA 2QRLA 4MUMA 4MV0A 4CN9A 2YJ5A 4FOSA 1RAGA 4MUBA 4DG5A 5AXDA 4EY8A 4CIVA 5B3AA 3Q6MA 5HM6A 2BR4A 1ZUNB 1BE1A 2EFDB 3ELUA 2YH2A 5ALIA 1ZGZA 2WFZA 3SVZA 4G0WA 1DEHA 4O2LA 5KSYA 1BJKA 1BO6A 2VQ3A 4EG0A 3I6QA 2YOHA 2CXHA 4MA0A 4LFCB 4WW0A 1A8QA 3PNOA 5A3VA 2HT6A 2ODWA 4JNKA 1PRYA 3D3NA 5FJJA 3F8SA 4PX9A 1D03A 2QLTA 4FOTA 4QHTA 3L6OO 4RK4A 2FSGA 4CZ2A 1X13A 2FFJA 2OT3B 1JX6A 2W6JD 2WU1A 3OJCA 1KYXA 1Z29A 4LRQA 4D9JA 1LC3A 2IXTA 1OXUA 2W4MA 2XODA 2QLLA 4GH5A 3VNAA 2MYUA 2X58A 3WWCA 1MLDA 2MR6A 3KJZA 5BOSA 2G5PA 3WL3A 3MCZA 3WY9A 4E15A 1U0TA 2UZ1B 4F72A 4FI3C 2HHAA 4BLRA 2PO7A 4WK2B 4WXRA 3PQ3A 1ISSA 3UBMA 5EIEA 4OLJA 1JG3A 2GI4A 2HLPA 2JGEA 3DUFA 3LAWA 4TKLA 4PYMA 4RMHA 4UHJA 1X7XA 3DWFA 4TYMA 5JJLA 5K99A 2WJWA 4NPCA 4V3CA 1RP1A 3ILXA 3OZRA 3ZYCA 2CZGA 2H5LA 4RQAA 4RPJA 3Q3GE 4ND8B 3SZGA 5IDWA 4FXOA 3Q7EA 4MROA 3BXFA 2Y67A 1LU9A 3QLUA 2G1KA 5CEEA 4HMQA 4RDIA 1E7RA 1NJGA 4C5CA 1WZ2A 4UCWA 3HBFA 4W7SA 2GF2A 2FW0A 1Q7CA 2PA3A 5BSTA 4EKYA 2ACEA 3BQNB 4OAOA 3V1NA 1P7WA 1KRHA 1T8UA 1TW3A 3Q88A 2O5CA 3HXPA 2P77A 1JJVA 2ORIA 5LC1A 4FEYA 3FYCA 1AGRA 3RG8A 4R98A 3PX3A 3PHGA 1ZVJA 3F49S 4LXUA 3MWEB 4FX2A 4QLOA 3SZLA 4QHYA 1Y8QB 1D4FA 3BWBA 5CVJA 2NO7A 2FH5B 3STUA 1WNFA 3EVGA 4ZI3A 3O0TA 1MD9A 7MHTA 2VUSA 5DGCA 4LZWA 3UJ8A 4ZEVA 1PR0A 3ZDZB 3JXEA 2O2JA 3BXEA 4JQCA 3L8MA 4LK2A 1RXIA 2NXWA 5E6SA 5IH3A 2BKAA 1QV7A 3BD9A 2C2WA 1JSZA 3PFCA 4JLUA 3VDRA 2XVXA 4H7DA 1KO4A 2ECPA 3KQSA 2W93A 1PX2A 4OLFA 3A31A 4PPFA 1S1MA 2Y76A 3HB7A 1N7GA 1SFRA 1QTIA 1U2DA 1UC4B 4BWYA 4YMUA 1TU0A 1TCAA 4NJMB 5HRAA 5F7JA 2ODPA 3ZGOA 5JJ5A 3PNQA 1N1EA 4L2IA 5DEOA 3NHYA 3UJDA 2PZFA 3IUBA 3QQPA 5AKJA 1MVLA 1N4AA 3B2QA 4U4AA 4YAJA 2J5XA 2XA2A 3OZWA 4IEFB 4CODB 2NO5A 4U3JB 4Q0MA 4H31A 1C1XA 1OFUX 1CSEE 2FKNA 4MVJG 1T4BA 2J31A 4BB5A 1UZLA 1J2JA 3CPHA 1DAPA 2JAOA 2QZJA 3A6DA 3DE6X 3GAAA 4KI0A 4NCJA 1QYXA 2GZRA 2C83A 1SB8A 1YJ5A 4O4JB 3OBIA 1BAPA 3R7NA 2BGMA 4CCWA 1UIMA 4PN7A 3U1VA 4V1CB 2Y1FA 4K9KA 4YB8A 3FJYA 4IWNA 5DM2A 3KSRA 1Q0SA 2W42A 3EY9A 3LUCA 4BMVA 2JATA 1XRQA 3TOXA 1I2CA 2P9ZA 4QD3A 3ETEA 3NBAA 3SXJA 3TLAA 3NOXA 4GNKA 5T3YA 2XUFA 1GA1A 3VR3D 4DLRA 4F5EA 3O38A 1J07A 4HZIA 4X62B 2OGZA 1E62A 1NR5A 3RVBA 3TQRA 5H5JA 2OFFA 4MWGA 2H07A 3MBOA 1S9DA 4KMMA 1L7NA 4MV3A 3ILVA 5C5IA 4O02B 1EK2A 4MJ3A 4X8HA 4BAUA 4BN0A 3I5UA 4OQLA 4F93B 2YHIA 3KXIA 3HCOA 3MQ4A 4TXJA 5FO1A 3VHLB 4ER7A 4QIHA 2QTGA 3K9CA 2ORWA 2C95A 4JJKA 4CM8B 3KT0A 1XZJA 4KG7A 3BB4A 3TAHA 1V7ZA 3ANNA 4LKOA 4B3HA 5BUCA 5EJ5A 1AKTA 1P5HA 2HYIC 3NNNA 3G1TA 4XUEA 1EHYA 5T41A 1KK3A 2SICE 3NONA 1TF2A 1C4WA 2F9LA 1EFLA 2PX0A 4HKTA 3I6ZA 5EXXA 1TUEA 2QRJA 5C3MA 3U80A 3MHTA 1AN0A 3UT6A 6GPBA 4NULA 1F4VA 2P78A 3ZBTA 5EWMB 1UDXA 2JLRA 1Q50A 3UH0A 5KYYB 4AY2A 1TKAA 3GFRA 3TSWA 1B8UA 4QWWA 5CDUA 5IWAB 2VDLB 3FE2A 1CEYA 3H9CA 3O2JA 4O4HB 3OQIB 5K3OA 2EYUA 1BMFA 1ZUD1 3OQJA 3ZGLA 1X77A 4BBJA 5FPPA 3DHYA 2ZTLA 4LWQA 4NX2A 2G7MC 1E1RD 2CNKA 2IH4A 3BXHA 3H0CA 1XQ9A 3JWHA 1SC6A 1MNQA 2EFYA 1OI3A 2PVPA 3CYFA 3GR6A 1ZNZA 3KKEA 5FBHA 3OKFA 1U8XX 2GAJA 4IL5A 3F6RA 4U8GA 4YA6A 1EG2A 2MSLA 2XYPA 3NI2A 1IUNA 2CLEB 5EI5A 4C1NA 3ON5A 2GDJA 4JQSA 4IIJA 5FIUA 4BPRA 4ALKA 4ARUA 3ADCA 4E07A 2XADA 2PV7A 3JS5A 3O8CA 3LOUA 1GN8A 3HV0A 3QPDA 4GX5A 2H1CA 5EKDA 3ZI4A 5L8VA 1ZI8A 5LNK1 2QBYB 2NZ8A 4G0UA 1JDNA 2B4QA 2A4KA 2VXCA 3TI9A 2IS4A 1SBHA 1UC9A 1U5AA 4GBGA 4KSCA 1G19A 2FLVA 1QIMA 1NLUA 4W5JA 1DAKA 4MQ5A 3VR6D 1BQEA 4DIEA 1J0CA 5C8YB 2WWXA 1XTUA 3QMVA 3HHPA 1XQYA 1WMBA 1SBIA 3A4NA 2P2NA 2RCNA 1P18A 3CF0A 5LU9A 1KNQA 1C7FA 1QHGA 4I0WB 1E94E 5E3HA 4EB6B 4P93A 2R60A 1IG3A 1X38A 4D46A 3ONWA 4ZV7A 1NNI1 3F71A 3KZNA 1FY2A 2AOWA 2YQZA 1VECA 2YXDA 4G5RA 3W3ZB 1EPUA 3QU5A 4UUOA 4BZQA 4F97A 3HVIA 2YCLA 2IS6A 5K2MA 1LPNA 3FPEA 2WFAA 3I5YA 1ZD1A 3EVDA 5CA0A 4LVOA 2D1SA 2QF7A 4G5FA 2VDPB 4K9PA 2HQSA 5A0FA 1HFWA 2QD3A 3OX1A 4QM7A 2CJFA 1JFSA 2R6GA 2PKCA 3CX6A 3GT0A 4OQDA 3WLPA 3GFGA 1K68A 3EA4A 5SZHB 2DCUA 2RAPA 2VCHA 3FHCB 4JLWA 2A78A 4AQYB 1A69A 3MIIA 4D6XA 4XRGA 5ELLA 4CV3A 4HAZA 2IRWA 2XCRB 3GEGA 4PXYA 2QJTA 3E2PA 4OMDA 1UKYA 4J3JA 1V3UA 1TCUA 1WY7A 2X6QA 4R2HA 3HI6A 4M60A 3TNDA 5IFKA 3LI2A 3V4LA 1SC3A 2PN1A 1JR3A 2VNHA 4FE3A 1SK9A 3DZJA 3O2NA 4NENA 4MEBA 1WHTA 4E09A 3BMCA 3I30X 4EJ0A 4E94A 3L4JA 3E9MA 1CLEA 6REQA 1W29A 2P9JA 5EJGA 4R71A 3RD5A 3IT3A 1RFGE 4OHZA 1N2CE 5DTJA 4DJ5X 3AJ9A 1MRZA 1WD5A 2C57A 3HCBA 1NQXA 3IAXA 4WK6A 3ROFA 4EENA 4M76B 2HSDA 1WXIA 1K06A 1OZ0A 3ODGA 2R6DA 1F8FA 1W0KD 3L8HA 3M6XA 3PWTA 2QZZA 1U2PA 4V0LA 5FQOA 2ODBA 4GPAA 2WZQA 4YWHA 1HETA 4NQRA 1U0HC 3SHOA 4W5TA 2QVBA 3FR7A 1GPYA 3DF7A 1OLSA 3QTBA 4RTPA 4WJKB 4KQEA 5H16A 3S99A 1ZM3A 4AYWA 2RGGA 2FQ1A 3A10A 4QGFA 4N76A 3BORA 4A36A 3T7JA 1ULSA 4EUFA 4R7TA 3IKVA 1C8LA 3I64A 3GRYA 3PUJA 1DTEA 3ETHA 2Q4DA 5JXIA 2HA4A 1H1DA 4IYJA 2QUHA 1PW7A 3EULA 1VKRA 3A2LA 2JBAA 3L7DA 2CHVA 4HS9A 4JD5A 4BVGA 5BVGB 5I48A 2IH2A 4FILA 3UYKA 3H5TA 3C5WP 4JU8A 3VZQA 3QNUA 4FGUA 4KXUA 4B9AA 2JPDA 1XZMA 1GFIA 1HMPA 5KTYA 1F7VA 2R9VA 2NZWA 3IBCA 4H7KA 2V4UA 1YB2A 2X6RA 1WMAA 4BKQA 4ZP1A 2FTKE 3B8HA 1BXGA 4Q37A 4LXXA 4CT4B 4J7XA 3UKJA 1YZ3A 1LD3A 4AKSA 1I8TA 4JBHA 4PEVA 4X8LA 1U0JA 2J9ZB 3DL0A 1MPXA 4REQB 3VSBA 1UK9A 4KBGA 1GD1O 2O5VA 2P2GA 2VHTA 3INNA 1SPBS 1KBZA 5AO9A 3DG9A 4UAVA 1DC5A 1LDYA 2O0MA 3HDYA 3KVNA 4ILKA 2A9VA 4HN9A 1JI0A 1SBNE 3DMRA 1EVZA 3KKOA 3P7MA 4R51A 3LA6A 3UMSA 4QUDA 1PEDA 2AJCA 3W3AD 5K6TA 3ROMA 1GTL1 4CF6A 2PRYA 4G9BA 4HAWA 3U3XA 1VYVA 3PR1A 4C76A 2CD7A 5IZ4A 1Z5OA 5L95A 4JYCA 4K88A 3CF4A 4Y2SA 1HT1E 3IURA 1L4NA 2MIIA 2WD7B 4DB4A 2WU3A 1WW3A 3QU4A 3EGWA 4RGQA 2P6MA 1LV8A 3F7TA 4HN2A 3OAAD 4KYIB 5FTJA 3U4HA 3G2HA 3W3AA 1EFAA 2FP3A 1FDSA 3JW8A 4WTOA 1P2SA 2O7SA 2ZU0C 1BXKA 3D6HA 3OCWA 5CLHA 4WKOA 4YT5A 4JYZA 1GV1A 2QAJA 3CRNA 1N6NA 2MSWA 3CB4A 5JRDS 2PXAA 2W2MA 3JALB 2VDRB 3H6GA 5DT9A 5FI1B 4F06A 1U7DA 4ZK6A 2GD0A 4W9RA 2YRFA 5BWBA 3DKIA 4G86A 2VDVE 1ACMA 1C7EA 2M6SA 3PFIA 2HJWA 5BQOA 1L4KA 3VPAA 3P0HA 2IWHA 1D0IA 2NSYA 4QBKA 2O2EA 4YN3A 4B1FA 1UM9B 1ECJA 2GPTA 2EG9A 4IH1A 4KAFA 3PWZA 2B36A 3BMNB 3WLFA 4HAUA 4WNYA 5ALFA 4PR0A 3B9RA 3MMZA 2BHTA 4XUDA 4C4OA 3FDIA 3ROTA 2VP0A 3N2IA 4TMKA 1H1LB 2NUAB 2DWUA 5JYDA 3K09A 5CW2A 2O8NA 1SRQA 4HB3A 4K9DA 4CXMA 4MV7A 5D7BA 3AZOA 2IYPA 2D7JA 2WFMA 3HLYA 3V8QA 1RQPA 1B42A 1SG6A 2QGNA 4BB9A 1T2CA 4D56A 3QYJA 3AF2A 1RR6A 1G2IA 4YPVA 1MG5A 3WK4A 3RC8A 1GTJ1 4YRFA 1FLNA 1RHKA 3OM9A 2P9QA 3SQLA 4E5YA 5JZOA 1SA0A 4KHPB 4PQYA 4HMPA 2F64A 3A1WA 4B83A 4F7WA 5K0ZA 3HWSA 1FS4A 4MJXA 1X80A 4BNIA 3AJDA 1XHEA 4CG2A 4Q4JA 2PYDA 3TNFA 4BGDA 1Y4SA 2RHBA 4PANA 2R96A 3UO8B 1AGPA 1YZQA 4U2KA 3ZU2A 5A9RA 2ZWAA 4XDHA 1HZJA 2P9TA 4CCYA 1NDQA 2BM1A 2BEVA 1V96A 4PSCA 2CWDA 5CVDA 3W77A 4Y9SA 4B33A 1M7HA 4H77A 1TMGE 4J2OA 1Z5ZA 4EQ6A 1VE5A 1M2HA 3PWSA 1Q74A 2CJXA 1GY8A 4UHEA 1DAFA 1HL7A 3PJEA 2VI5A 1YCFA 1ZM4A 1MHPA 2ZAIA 3BJZA 1XYVA 3GRKA 5C7YA 4YACA 1TJ3A 3WNVA 5LJLA 1COZA 4IHQA 1Y0BA 1E3JA 2EZ9A 3FPBA 4DV4B 5CCBA 4BFLA 5EJ4A 1ZMTA 3ABSB 3CQ9A 1KY2A 3GMIA 3IILA 4I2NA 3AJ8A 5E6UA 2V65A 3B13B 5DKFA 1XD9A 4TYQA 3WLNA 4Z4QA 4NL4H 2GOYA 3L6EA 3KUXA 1QRAA 2ZAGA 2ACWA 1JUDA 2PXCA 2QA5A 3HEAA 2R00A 2QU7A 3GU3A 1IG0A 3NHPA 4W99A 4AULA 1S5PA 2CMFA 2PMCA 2XGOA 4N9QA 4CL2A 4LE2A 2JA1A 2ZRMA 1T0JB 2CXOA 3AYZB 5BYBA 3QXSA 3TEFA 1NWCA 3LBAA 5TV2A 4X6YA 3BHNA 4N0DA 2XLCA 3MBIA 2B4RO 4GF5A 4AO8A 4YUWA 3O3NB 4NJEB 3VR2D 5HRUA 1AZLA 3EFHA 4F3KA 1O6ZA 4QC2A 2O1EA 1E6UA 1KJIA 4J3NA 4I7EA 4M8KA 3RASA 5ALRA 3D4BA 4HLQB 1QDLB 3WBBA 1PR1A 2OORC 1J2UA 2C42A 3VNSA 3OZXA 4FR0A 4ENUA 3ZDRA 3H2ZA 1JMKC 3LIPA 4J4HA 4R4JA 5JRJA 1CP3A 4UU1A 5LQMA 3OF3A 3FCOA 1I0ZA 1JL3A 1P1IA 2L0XA 1HLPA 1XA3A 4CNBA 4DT1A 4HTFB 3TGWA 4ZFNA 3V48A 3E2MA 1CP2A 2GN1A 4NQZA 2FN3A 3CTMA 2HBYA 5EIBD 4Z7OB 2JFGA 1QF9A 2C2XA 3K9LA 3OU6A 4BO0A 4R2XA 4U9HS 3VXKA 5I4IA 1G38A 1Z2DA 3JR7A 2AG0A 4D57A 4N0EA 1JR3E 1NZDA 3NFRA 3VOAA 4BKOA 1IH8A 3CR8A 4G5YA 1XCGB 3VVMA 2VNKA 3ZX5A 1EFPB 2GFIA 3AY0A 5DLDA 3VU0A 2DPHA 3EXHC 2ET6A 5KTOA 4KIWA 1IRIA 3OU2A 5ESXA 4B6QA 2F1JA 2QL6A 2Y0CA 1TQDA 4DA7A 1C81A 1JPVA 1N6RA 4RTLA 1AKUA 1X3SA 2Z5FA 4FEEA 4QPCA 1TTQB 4RLFA 2UUBB 2WZDA 2QL7A 3N6VA 2C20A 1XF1A 3O94A 3BF7A 1Z39A 3CR3C 1W5FA 4G63A 3DO8A 2O0HA 2H2IA 2DT5A 4TKZA 3TQCA 2CW5A 4UBJA 4COKA 1OI4A 2YV2A 5AKHA 2C7BA 2NSHA 1C50A 4NV0A 4YMSA 3V1YA 4QJBA 1MX1A 3DAGA 4XDGA 2CMDA 1XUOA 4H1WA 3A9RA 1GQRA 3DBLA 4GI5A 5FI0B 1T2AA 1M2VB 1NF2A 1KYIA 2WP8J 3OZUA 5ELXA 1WPQA 3VR5D 1GSIA 3PF9A 2TECE 3F3YA 4PAOA 2E85A 4JLOA 3USZA 4OFXA 1ZL2A 3IODA 4R9NA 4Y2PA 3WDKA 4DYHA 3TKLA 3QV1A 4BQQA 4Y3UA 1DBIA 1LPAB 1DFGA 3WK8A 2ZWPA 1Z7GA 1ZVQA 5DXJA 3HVRA 2P9GA 3N2KA 2RI6A 4HVLA 5LXTB 1F1BA 3OZEA 3Q12A 5AVYA 1QHSA 1SQ5A 4NNPA 3SDBA 1CUIA 3N58A 2Z95A 1DRVA 2WNSA 5HZHA 3RYIA 4ENVA 3GRCA 5MN4A 4MWSA 3NH9A 2C2ZA 2QNIA 3AR5A 3QYPA 2FLWA 3ZOZA 5TQVA 2GVDC 3HCCA 4BQRA 4KQCA 4XWYA 3DWEX 1GJRA 3E53A 4PO9A 2WKQA 5IAEA 3A32A 2EIHA 2EJBA 3JWGA 5FUYA 5HOQA 1O7JA 2B7LA 2AOVA 2QM8A 2Y66A 4RPKA 2H7VA 3DLIA 3QW2A 4JUIA 2HO5A 1XCPA 2Z9BA 4LJ6A 4AY3A 4NF2A 4TL8A 5KWIA 3EFEA 3CT6A 1DV1A 4C4SA 4F71A 1EWRA 3WBJA 1EP1B 4AMUA 5A1TA 3ZQ4A 3H8VA 2ETVA 3JQ7B 2A5DA 3BD8A 2BC9A 2V98A 4ER0A 3VAZA 3LLVA 1OHHA 3I58A 4KXYA 2QS9A 1UOPA 4TV9F 4GBJA 3FB1A 2XBLA 3TRDA 4YHHB 3K9GA 2G9RA 3QELB 3BIOA 2VDUE 4YRTA 1WM1A 3SS8A 3Q2OA 1FDVA 1THTA 1RJWA 1YJQA 4ZCTA 3B36A 2C7VA 5DBEX 4A73A 3GD7A 3GMTA 3LZDA 2CUKA 5FWXA 5LQCA 4IHJA 1ELOA 3MTGA 4IDQA 1OLXB 2HFJA 1OR8A 2I3GA 2JFZA 4OXQA 4D4IA 1P2DA 1LPOA 5ALJA 5C51B 3DM9B 4XSHA 5BP7A 2V7QD 3B12A 3E15A 4JBGA 3FZGA 5M29A 2C0PA 4IVQA 1QVZA 4ZOAA 3AFMA 2P3OA 4XB6B 1RABA 1N5JA 4JHLA 4YROA 3OLXA 4OUDA 1OZFA 4TTRA 3U48A 3GLIB 5CAEA 4ZVTA 4YJ3B 2CYCA 2R86A 2D4AA 1RDFA 1PFWA 4B79A 1M74A 3FGZA 4RZSA 4IR7A 5JU6A 3TTUA 2WF9A 3SHVA 3L0ZA 1I13A 1JU3A 3JVUA 2JLQA 1QVAA 5DI9A 3V1MA 4ZCRA 2PJUA 1CHDA 4HZUB 3K92A 3TJZA 3DFZA 2UYQA 1L5QA 4NABA 1CHNA 1G8JA 5J63A 1LLUA 4RD6A 2PRKA 2I1QA 3R7WA 1XQXA 1XXHB 3KHTA 1RCTE 1GUAA 1DTWA 3NP9A 3R3XA 3L6DA 4HN4B 5HW0A 3LOQA 1WV0A 3JAKA 2VAPA 4MRPA 1GZ6A 1W1UA 3U16A 1DFIA 3WLQA 5JAZA 5B58T 5E6UB 5FPTA 1H2FA 2WSYB 2JLSA 4I8DA 3DC7A 4H3KB 3FPCA 1E5VA 2J48A 3NG1A 3PUIA 4RVOA 1YZVA 4X5OA 4BU0A 1FW6A 2XOXA 4FQ7A 5F3DA 4M86A 3MOSA 4YAUA 4QYWA 1XYYA 4S3MA 3BK2A 5IAGA 3I9NA 3OEWA 3OIVA 4C20A 3DAOA 2YRXA 3IV7A 3T3IA 1V1RB 1MGOA 4G26A 2V1UA 1B41A 4TWIA 2X1VA 1OI2A 1U90A 2YFHA 2ZR9A 2FDXA 1B0UA 4QL3A 4QUHA 1UBUS 3FHLA 1G6HA 4N6OA 5BXQC 1BD4A 4M89A 2BH2A 1DJPA 2CC2A 2GXQA 2BMWA 3LT5A 2VP5A 5E9AA 3TW6A 1BQ4A 2DE0X 1P75A 4PR3A 2ZYWX 1JW9B 3ZZ1A 2VTKA 3QOXA 3PC2A 2CBZA 3AFHA 3O4GA 2P2DA 1SZDA 4C6TB 4AP6A 1NRJB 4MP8A 1TK2A 621PA 1BNCA 1HKHA 3HS3A 3TZEA 4EG7A 1BEZA 1KK0A 1TCBA 3SVLA 5IXYA 5IF9A 5KDLA 5LXTA 2OV6A 1QYRA 4TV8B 1C9EA 2X8AA 4GU5A 2Z2ZA 3STWA 1LWOA 2Y1WA 3I12A 3RTCA 5LCXA 1QANA 3DE0X 4CGZA 3BX1A 3ETNA 4U02A 2Z8XA 2H4ZA 1ZONA 3W4IA 1JHOA 2AFIA 3CUSA 4GQAA 5CFRA 4Q4HA 3FSEA 1KDZA 4DQDA 1UR5A 1N92A 1TYZA 2MU1A 1CV2A 2UKDA 3ILSA 3O4RA 4CIXA 5JCJD 1Z34A 1E63A 1NBMA 1OXSC 2WVAA 4TMZA 3BDIA 5U9CA 2WM8A 1MNAA 3GW8A 3HU5A 3C4JA 4OGFA 5HF6A 1P19A 1SCUA 3BWDD 1HDRA 3RB8A 4NCKA 2NP6A 1QLWA 5HFJA 1QAQA 3GJ6A 2UYOA 1F06A 3N70A 3Q1KA 4ZALA 2HT1A 2P5YA 4NFLA 4IICA 1F3OA 2VP3A 5A4IS 4LWZA 4HQ0A 4IPTA 1OIVA 1JLHA 3AUXA 5JCOA 2IEBA 2GYUA 1O6GA 4OMFG 3MS2A 4C07A 3LYHA 4RETA 1CCWA 5EIWA 5ALVA 2FJ0A 1II9A 3NB0A 4LPKA 5AVKA 2ODNA 5BW4A 1GNSA 4KXNA 4PLVA 4B45A 3IJ5A 4UBIA 2CCKA 1D5WA 4CQMA 1OBCA 2C4HA 4ZOLB 3MQFA 2AD1A 3MJ4A 2WUDA 1JDPA 3P9CA 4KO1S 4BVAA 4R7GA 4F2WA 5K09A 4V1CA 4ZD6A 1GEGA 1H2ZA 3O74A 4AWAA 2ZM5A 1IWOA 2NTVA 3M6UA 3EASA 4XJVA 1IN5A 1DBSA 4DARA 1ZR4A 1RWQA 3D64A 4H4EA 2EBHX 1HNXB 1NI5A 3CW8X 2AG8A 3HQ4O 2IIPA 2FI1A 4RM3A 3UAOA 1R9JA 3KSUA 1XZDA 3PVSA 3D6FA 4OHUA 5T4HA 4UVDA 1WL8A 1VGVA 4BL5A 1U7WA 4PPQA 4DFDA 4GVPA 4CIBA 4DRZA 3MUOA 2GBCA 4LDAA 1XWIA 2MWMA 2J8ZA 4W6ZA 1TM7E 4OKNA 3SJBA 3ZDEA 2PHZA 4PRYA 2PT6A 1ZN2A 1NVXQ 4RIGA 1Z0KA 1I9GA 4JLBA 3TTYA 4AJJA 4B76A 2CCGA 2C7QA 4JASB 1ULAA 3WOHA 3RU7A 2L82A 5HJ2A 1PYOA 2WTXA 2B34A 2BH9A 4PAMA 5IDYA 4MGYR 1ZSYA 3WLTA 5FTLA 2VWPA 4DLSA 5CFOA 2Q0QA 2V74B 3AF1A 1K7XB 3K5IA 3OLYA 4LDQA 3RSOA 3T1QA 4KIJA 5DT2A 1E0SA 1E2MA 4KWHA 4OHFA 1YJAA 3LQFA 4QGSA 2R48A 1JQBA 2WA2A 3V2HA 2JS7A 4H1VA 1TVKA 1YHYA 2VT2A 3VI3B 2ZYAA 3JSXA 3QEMA 3KU4A 1FMLA 3CRW1 1UPXA 1KETA 2VWGA 1G8PA 1Q1GA 2W00A 1IEXA 3D7NA 3OG9A 4PYRA 4ZQBA 2Q7DA 5DBOA 4N5LA 4MB6A 4C4YA 1DIHA 3Q0IA 4BMYA 1SUFA 4OQXA 3B1YA 3PD7A 3F46A 1VL0A 3SKVA 3CRRA 1J5XA 3GBPA 1U5BA 5JDIC 4ENQA 2VQFB 1PJSA 2PFGA 4MIKA 2B69A 1PK8A 1RJEA 3UKDA 2IY7A 2Y4OA 2AQ8A 1YMVA 3PLRA 2OFOA 3G6KA 4H4DA 1L5NA 2Y2UA 3IE1A 1Z16A 2IUYA 2J5RA 3M8KA 4ILEA 4DKJA 5JWHA 1IY0A 1EP3B 1OFUA 1TU4A 3DE4X 1PEAA 1SUDA 3LCMA 3EZFA 3QWAA 3AERA 2UZ3A 3NC4A 4RYDA 4CKCB 3PNLA 2YKGA 1EFUA 3PR3A 1G2QA 4U1RA 1UPTA 2ATIA 3MWKA 3IVGA 4F7DA 3D7RA 4RSRA 1GO2A 4POOA 2VC2B 3RAFC 4WQMA 2QMHA 1EQUA 1W4AA 3B1ZA 1MX5A 1LX7A 1Y4UA 1J2TA 1TECE 2J67A 2PGJA 3E61A 3PUKA 5EIAA 2WSMA 3EIEA 4ZOQI 2HIHA 4UAUA 1O96A 2YYZA 3DFKA 4BO9A 2CE2X 5J5AA 3S28A 2GX6A 3VDNB 2GJAA 3ICWA 5KS2A 4EZBA 7GPBA 1CJBA 3OP4A 3GT7A 1HE8B 1E1NA 1UPUA 2CXPA 4FHZA 4FZRA 4GW3A 4IKEA 3PSHA 4MICA 1O0SA 5P8WA 1AQYA 1OC2A 3EJWA 4A5OA 1T8PA 3AUJB 1USKA 4YCCA 4HYYA 1DMSA 1IQ0A 1NBMD 5B55A 2JFBA 2CK3A 2HA5A 5AK0A 4EG1A 4MO2A 3KEQA 5B7GA 2OECA 1LV7A 3ZXSA 4ZJPA 3F5FA 2YWJA 2H1RA 4ESHA</