4PYLA

Humanized rat comt in complex with sinefungin, mg2+, and tolcapone
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pylA00
1P1BA 1G38A 5K0FA 2PT9A 1FBNA 2B2CA 2EFJA 3B3GA 4MQ4A 3A25A 5DWQA 2Q41A 4PINA 4BY9E 1G8SA 2PBFA 2PKWA 1R6AA 4G56A 2GH1A 2PWYA 3L8DA 2AZTA 2XYVA 1YUBA 4F86A 5K01A 2YVLA 2ZULA 2VDUE 2AVDA 2JHCA 3FUUA 4F84A 1TW2A 3NW9A 5CIYA 2FRXA 4X61A 3GRYA 4FT4A 4KDCA 1R8YA 1L3CA 3E23A 3R3HA 5DT2A 4PNEA 1WS6A 1KIAA 4QPNA 1EQAA 5DM0A 1L1EA 4FS8A 3KHKA 2G72A 2PJDA 4XUDA 4YV2A 3C3PA 4X63A 1H1DA 3SSNA 3FUWA 2UYCA 5DXJA 3GO4A 3HVIA 3JWJA 2ZLBA 3HA7A 3JWHA 3P2KA 1KPIA 2ZW9A 3ID6C 3OPNA 4HC4A 5K09A 5DRYA 1BKYA 3ANXA 2YX1A 4GUAA 4WVLA 4R8RA 5D1NA 5KVAA 2OKCA 2PGXA 2JG3A 1YB2A 3KPJA 3LPMA 4ISCA 3VYWA 5ICEA 5K0GA 1T43A 4KW7A 3AXSA 3MB5A 2AS0A 3ERCA 1NW3A 1EIZA 2PXCA 3OZRA 1ZGJA 4P7GA 3LCCA 3M6UA 3I53A 3DUWA 2K4MA 4P7FA 1KXZA 1MJFA 1PJZA 1X1BA 1XTPA 3G2QA 2IPXA 3HVKA 4KIFA 4B17A 2OO3A 2YTZA 3GWZA 1SKMA 2ZZMA 1BHJA 1V39A 3FPHA 3GJYA 1JQDA 4PGHA 3UZUA 1TW3A 2O06A 1WY7A 2QRVA 3DOUA 3E8SA 5EG5A 1QAMA 2OPBA 3HCCA 4LECA 1JG3A 3A27A 3EVZA 4GOND 3GRRA 3ORHA 5C1IA 5BW4A 4ZTBA 4OQDA 2AOWA 1WXXA 2EX4A 3LBFA 3BWBA 5E1OA 5P8WA 4GBED 4HH4A 4EMSA 5HILA 3ER9A 2P41A 4E2YA 3H2BA 1O9HA 3F4KA 2IDKA 3GRVA 2VZ9A 4PYMA 4V0QA 2AOUA 3FYDA 3DXXA 1F38A 3HCAA 4X60A 2G1PA 2NP6A 2PXAA 2PLWA 2ADMA 4FSXA 10MHA 4JXJA 4DZRA 4OX9Y 1XCJA 3EVGA 2NXNA 4MIKA 2VS1A 5CD1A 4YUVA 3KQVA 3O7WA 4CKEA 3TKYA 3DR5A 2GS9A 1NE2A 1P39A 5E1BA 3I9FA 4U7PB 5CM2Z 3EVBA 5HIMA 4R05A 3O4FA 1B42A 2G70A 5GOZA 5E2BA 3G88A 4FGZA 2IGTA 3TLJA 1RI5A 2O57A 5MHTA 5CVJA 4OQEA 3NWBA 2NNWB 3NJRA 5CVDA 1AQIA 1IXKA 5HFJA 3DMFA 2OZVA 3R0QA 5CVVA 4E70A 2WK1A 4RWZA 2ZBPA 5BP7A 2PT6A 2YQZA 1NT2A 3KKZA 3KQWA 3KQYA 2QYOA 3LKDA 5KQRA 3MTEA 5EMJA 4RVHA 3LSTA 1XJ5A 3AY0A 1D2HA 1XDZA 2O0LA 2V7EA 4FZVA 2YUIA 1QAQA 2ONYA 3BGVA 3KU1A 3AXTA 4PGGA 3HCDA 5LQCA 2PX4A 2UYOA 4E32A 5DTQA 1EJ6A 4POOA 5K0JA 1AV6A 4C06A 2AOTB 4RYLA 4YMHA 5ICFA 3G5LA 3FTCA 4HSGA 5FTWA 3EGIA 3T7SA 1VIDA 2PXXA 3I58A 4GC5A 3OE4A 3TM5A 1WXWA 2ZIGA 4E33A 3PFHA 4LWPA 1Z3CA 4OBWA 5DM4A 2AR0A 4QQNA 4IWNA 3THSA 4ER5A 5LQUA 4MHTA 3PVCA 5FUBA 5JR3A 2P7IA 3LL7A 3MGGA 2B25A 2I62A 3D2LA 3UWPA 5HIKA 3MCZA 5K03A 5HIJA 3LX6A 3BWCA 2QY6A 2BH2A 5DM2A 5EVJA 3ELWA 5FA8A 5GIOE 1EJ0A 1VE3A 3A7DA 1RJGA 3HA3A 5CCBA 3BKWA 4DM3A 3DXYA 3G8AA 4RSRA 3TOSA 3DMGA 5FHQA 4C4AA 1KYZA 4E2XA 4RTNA 2YXLA 5K0EA 5DPMA 1JG2A 3FZGA 3KQTA 2DPMA 1F3LA 2H1RA 2P7HA 5U4XA 3NTVA 4WXHA 5HEKA 5K8VA 3QOXA 3VC2A 1YFLA 2BM8A 2JH8A 3MTIA 4DCGA 5DSXA 2ZBQA 2I7CA 3BUSA 1UFKA 4P58A 3EVFA 4ER6A 2CMGA 4RVFA 2JJQA 2HV9A 5K0LA 3BZBA 1ZHFA 3FUXA 4PYOA 3EEOA 4HG2A 1HNNA 1KPGA 3PT9A 1U2ZA 4QPPA 1FJXA 2Z6AA 5DLYA 1Q0SA 4EK9A 4Y30A 1N7IA 2EJUA 2PX5A 2ZIEA 3FRIA 5DSTA 5H02A 4RTRA 4DF3A 3DMHA 5FADA 4R6XA 3I5UA 3DLCA 3EGVA 3CKKA 1O9GA 5K0NA 3NVMB 4PCLA 5C0OE 9MHTA 5E8RA 5EMMA 4RTPA 3MCTA 2PX2A 5ICGA 2OB1A 4YUYA 1N2XA 2FPOA 2YXEA 3HM2A 3LDGA 1BOOA 3BKXA 1G55A 2GAFA 2HR1A 1X1AA 5EHGA 3UA4A 4FT2A 1RJFA 4OA8A 2JHAA 3O31A 3NMUF 4HTFA 3SSOA 3KPYA 3T0IA 4AZVA 2CMHA 3PS9A 3UJ8A 3X0DA 2ZZKA 3B3FA 3PX3A 2IFTA 4CKCA 3LBYA 2OBFA 4V0RA 5DX0A 4CTJA 3OE5A 4E2WA 4ER3A 4A6EA 3KR1A 5E1MA 3CBGA 4H0NA 3FUVA 2XBMA 5GP1A 2P3OA 5HOQA 3KR9A 5K0BA 2Y1XA 3PX2A 3EEYA 1ORHA 2I9KA 4HRAA 3OU7A 2QRVB 5HIIA 3LECA 3LDUA 3B3JA 5IH3A 2G8NA 4QDJA 5EQJB 3REOA 1YF3A 3KR0A 4AZTA 2OB2A 2VDVE 3ELDA 2IH4A 3AJDA 3EPPA 5E9QA 2JHPA 2ZBRA 2NYUA 3U81A 4YMGA 4ER7A 3CCFA 1ZQ9A 3KQQA 1TPYA 4BP3A 2ZCJA 4C07A 5K05A 3P9IA 3ER8A 4PYKA 5ICCA 2AN4A 4CKBA 4UOEA 2AOUB 3OU6A 1RI1A 3B89A 1IY9A 3THRA 1X1DA 1EG2A 1NBIA 3IHTA 4KRGA 5FWAA 3WSTA 1YZ3A 3BXOA 2P1DA 5KQSA 1RJEA 3EVCA 3BWMA 3E05A 3PTAA 3FTFA 2BZGA 3TQSA 3NVKI 2CWWA 1WG8A 4LWOA 1JTFA 2R3SA 3HTXA 3GGDA 1R8XA 5C9ZA 3G2OA 4KIGA 3KQMA 1P91A 3CJTA 3OU2A 4RTOA 1UWVA 3EVDA 3TMAA 1D2GA 4NECA 2FHPA 3S68A 4GEKA 4RTJA 3IYLW 1NW7A 3K0BA 4PIMA 4PIPA 4MTLA 1Y8CA 2PWPA 4RVGA 2NXJA 3HP7A 4OA5A 4YUZA 5DM1A 4F85A 4P7JA 1IM8A 3KPUA 4M36A 3K6RA 2H11A 1R00A 1X1CA 3UBTA 2LD4A 3AWIA 3G89A 3GRUA 4M37A 1KP9A 3DULA 2Z6UA 3C6MA 3GRZA 1AQJA 1SVUA 3EVAA 3P2EA 1VBFA 1O54A 1JQEA 2ORED 3ELYA 4QTUB 4RVDA 5CVUA 5LQAA 2O07A 3G2PA 4GOMD 2PX8A 5GINE 4RTKA 3KQSA 1VPTA 2PY6A 3HEMA 4P7KA 4PYQA 2P8JA 5EIFA 4E30A 2ZSUA 4EQZA 4ER0A 2ZIFA 3BGIA 5M5BA 1Q0TA 3FTEA 3R24A 5E9WA 3FYCA 5F2NA 5JUWA 5E2AA 4X1OA 3SMQA 3GIWA 4AUKA 4XCXA 2C7QA 3FUTA 3B5IA 1I4WA 1N7JA 1ZKDA 4R6WA 2O05A 3EMBA 5FULA 2YR0A 3TPZA 4HGZA 4A6DA 4PYIA 4LG1A 5LR6A 2NXCA 2WA2A 2B9EA 3C3YA 3EGEA 4AZWA 4PYJA 5GIPE 2Y1WA 2Z6QA 5GM1A 1FP2A 2IH5A 1XCLA 3SX0A 3M70A 5EZQA 3M4XA 3C6KA 4E2ZA 2I6GA 5HZMA 1M6YA 2AN3A 5DX1A 1P1CA 2BR4A 3Q7EA 1NV9A 3HVJA 5E8JA 3CVOA 5F2KA 2OXTA 3DXZA 3TRKA 5DX8A 1VL5A 3NDJA 3HCFA 4GF5A 4K6MA 5FQOA 3UJCA 2HWKA 2P3LA 3VC1A 2NP7A 4L7VA 4BP1A 7MHTA 3FRHA 3FTDA 1YZHA 3GXOA 5FHRA 4Z2YA 4DQ0A 5EMLA 3CJQA 4CWAA 2ERCA 3BWYA 2GB4A 2R6ZA 2QM3A 3SM3A 1WZNA 4RTLA 1DUSA 2AOTA 4X41A 2UYHA 1SUIA 8MHTA 3TR6A 3LCVB 3UJAA 3LGAA 4YUWA 1X19A 2HTEA 4OBXA 2FK7A 4XUEA 5IKMA 2JH9A 3OZTA 4GOOD 3V97A 5KS2A 1PRYA 3NWEA 4AZSA 5F2OA 3JWGA 3BT7A 3OCJA 2FCAA 5EGSA 5LQKA 3P9CA 3LCUA 2C7PA 2B78A 4C04A 2FK8A 2NXEA 5E9JA 2P35A 5G02A 1SQFA 3M6VA 4YV1A 5KYGA 4DA4A 4FSDA 1NKVA 4Y2HA 2AVNA 2FYTA 1JG4A 1FP1D 5E1DA 5K0CA 4DKJA 1YFJA 3A26A 3EVEA 3Q87B 4CTKA 4DCMA 5EEHA 3LDFA 5EKXA 4GQBA 3ME5A 2YXDA 1RI3A 3M6XA 3LHDA 4R8SA 5CUQA 3TFWA 1M0EA 1L9KA 1ZGAA 3GCZA 3SVZA 3MERA 1I9GA 1XXLA 1KPHA 2QE6A 3C0KA 4PCAA 5B1SA 4RTSA 3QV2A 3R6TA 1JTEA 4KWCA 1SUSA 2GPYA 3G5TA 2CKDA 2E5WA 3FPGA 3HVHA 3DTNA 3UJ6A 3SGLA 3A7EA 2VP3A 3P9NA 3GDHA 2AOXA 2PV0A 3JWIA 4FP9A 3ELUA 2A14A 4PWYA 3UJ7A 4ATNA 3PB3A 2XYRA 1JSXA 5LQJA 1NW6A 2ESRA 2GLUA 4MWZA 3RW9A 1INLA 2BR5A 3KQPA 5CVEA 5EMKA 3UJBA 3CGGA 5LQNA 3SSMA 2IDJA 4GOLD 2OY0A 1DL5A 3DH0A 4IV0A 2OYRA 1G6Q1 4EKIA 3R9XB 1RI4A 5EKUA 3RIEA 5DXAA 2BR3A 2XYQA 1ORIA 4RTQA 1NV8A 3G7UA 1G8AA 5EEGA 2EG5A 4KVZA 4PONA 1QZZA 3T7TA 2PSSA 3CC8A 3P8ZA 3IV6A 1XDSA 4O29A 4C05A 2UYQA 1JQ3A 2N47A 1QANA 1XDUA 1KR5A 3G2MA 5FWDA 3UJDA 2PVCA 3HCBA 3MQ2A 3TKAA 1VP9A 2IIPA 4AX8A 3B7PA 4QDKA 3UA3A 1JSZA 5EHIA 2HMYB 5T64A 3FPJA 5ERGB 3OZSA 4M38A 1NW8A 4KDRA 3T7RA 5LSAA 3KPVA 1MHTA 4EKGA 3MHTA 1NBHA 4C08A 1VLMA 3M6WA 3P2IA 3EMDA 4GC9A 2B3TA 1KYWA 1UIRA 2ZVJA 3OFJA 4QQKA 4BLUA 3HCEA 3DP7A 3FPEA 2F8LA 5CCXA 2ZFUA 2HNKA 3BGDA 5EPEA 2IBTA 5GWXA 1L3BA 3HNRA 4PYNA 5EIWA 1R74A 1D2CA 1NW5A 3FPFA 5T6BA 2IH2A 1KHHA 4CXMA 2P3QA 1G60A 1OR8A 4IV8A 1BC5A 1FPQA 1JR4A 3SR4A 3UFBA 4FR0A 5T67A 4PYLA 2V74B 2ZWAA 1SG9A 2DULA 1RJDA 2H00A 2IP2A 1HMYA 3CJRA 2ZTHA 3HA5A 4E31A 3P71T 2IBSA 1QAOA 4QVGA 2GA9A 2AOVA 3G8BA 4DMGA 5GM2A 2AN5A 4XUCA 1M6EX 4U7TB 2BM9A 5EOVA 5EC8A 2KW5A 3V8VA 4YV0A 2ZZNA 2C7RA 5LQRA 2VDWA 3UJ9A 5D1HA 4YUXA 3PLAE 4C03A 3IEIA 3A4TA 1R18A 5BW5A 1XVAA 1SQGA 1VQ1A 3KQOA 5EZSA 5DRTA 1DCTA 3VSEA 1I1NA 1QYRA 1RI2A 3TM4A 4RTMA 4EVIA 3RODA 4RV9A 3OFKA 3P9KA 2ZWVA 3DLIA 4IKPA 4RX1A 2CL5A 3E7PA 3GU3A 5FA5A 1VP3A 1AF7A 1ZG3A 2ONZA 4QVKA 2XVAA 2XVMA 2P40A 1L3IA 3MAGA 2EJTA 3LKZA 2WA1A 1EAMA 3KR2A 3NDIA 3SXJA 4QTTB 5BXYA 4M7RA 5DTRA 3GNLA 3I64A 3P97A 5FCDA 1JG1A 5FQNA 4BLVA 4BLWA 3KPWA 3PFGA 4HTFB 4HGYA 3QOWA 3M33A 2UZ4A 2C7OA 5DTMA 2G71A
chains in the Genus database with same CATH superfamily
1QIEA 1U4SA 1B8PA 1USIA 1YVEI 4MUIA 4YRGA 2B2CA 3CNLA 1HDCA 2PR7A 4JD5A 3WWZA 3Q3JB 1O4WA 1H66A 3I2GA 3Q9UA 1LX7A 3T3PB 1UIMA 1G5FA 5H9WA 2AVDA 1ODJA 2RGBA 5E0KB 1TRKA 1EHCA 1ZNZA 1P33A 1DJOA 1DFHA 2CLDX 3BCRA 4X61A 3GLUA 2F1JA 3OT4A 4RIGA 4Y6OA 3MJHA 2NACA 3FI0A 2I55A 5GV7A 3Q3EA 3NC0C 1TTTA 1JVBA 1L1EA 1P17A 5A5FA 5C1BA 1CZUA 5BWCA 1JFLA 4IHAA 3PEWA 2EBFX 5C3UA 4EW1A 4M83A 2DTEA 4ZI7A 2XDAA 2JGJA 2Y76A 2ZW9A 3UAYA 1JHOA 3ULKA 4OL0A 4GBMA 5CB4F 2TYSB 3S8MA 2UZ0A 1V8FA 3ZW9A 1XZDA 5FFMA 2H7XA 5ICEA 3PDIA 3ND9A 3R7SA 3MXOA 1Q15A 2VTBB 1B6RA 1H69A 3BD9A 3O4IA 1YL7A 4HX9A 2B8NA 2ECQA 1W2GA 3LCCA 4MYCA 4JP5A 2FQYA 1A8SA 2IT1A 1K06A 4OM7A 4P7FA 3A6LA 2VO1A 5B1IA 4IDCA 2IPLA 2BKLA 1SIOA 1NQ5A 3BIWA 4J7UA 2BHLA 1RM5A 2OECA 3PFFA 5AVXA 3T54A 5KKNB 3JATA 5JI3E 1EH5A 5AVVA 4I55A 2PE5A 2YV5A 3C5CA 3KVNA 2VQEB 3GRRA 4Y2UA 3CZRA 1KO4A 1LH0A 4X85A 5AM1A 3GPLA 2MYPA 1UP6A 4HB2A 2CJPA 1YIAA 4RZHA 3IJ5A 5CU7A 1SK8A 4YP0A 5C7LO 2QSJA 4KQXA 2OV3A 4KI7A 3WMXA 1M0WA 1RWMA 2IDKA 2ACWA 3I2HA 4U7WA 3SC4A 2XB2A 2ZAIA 3MJFA 4YECA 4PYMA 2BFEA 1WZUA 4RLHA 5G0VA 1S7GA 3RIMA 4LJYA 2R79A 3INTA 4EY5A 1I7LA 4HDSB 5JC8A 4ENSA 4WCFB 5F1KA 3NGMA 4M9QA 3ZX4A 3WZMA 4FEYA 3A28A 1GUYA 1OV6A 5DWVA 5BV7A 1CP3A 2OHXA 5B7QA 4IMRA 3RRXA 1GPUA 1EM6A 2A3NA 1WABA 3W04A 3C3DA 5B57C 1WF3A 3H16A 2HB6A 3EVGA 2DUMA 3QP9A 5BV1A 3ROFA 5EJ6A 4GYWA 4ID3A 3SK0A 2OOKA 3T6KA 5DCYA 4D46A 4LC0A 3OHMA 1CUEA 1C2YA 1OA0A 5TLSA 3AZOA 3ICOA 4AJOA 2Q8PA 3FD8A 4FQ5A 2QRQA 2VJBA 4OSEA 5CVJA 4AJKA 3L01A 2M98A 4J76A 4K86A 5K4GA 5M5BA 1A7JA 3H83A 3HRKA 5C8XA 3PF8A 1UEXC 1OKKD 3A1EA 3KKZA 1EFKA 1ND5A 2PA3A 1NQXA 1U5CA 3LKDA 3OE7A 3TWOA 3NFYA 1XJ5A 1NUPA 3R1IA 1TUIA 4X6UA 5KHLB 3UWMA 3Q7IA 2J0EA 4TS4A 3U26A 1HQYE 4KE6A 2PUCA 1ZRHA 3OX1A 2OHOA 1XFDA 5BURA 2QTMA 2L17A 1BKSB 3LE8A 3MMNA 4J0KA 4RMHA 1KSJA 1JIQA 2P6OA 1VA5A 1HI9A 2GCOB 3I9KA 5ECWA 5TV2A 4ALJA 5J5VA 2ZR0A 4DC9A 1K4YA 4OB8A 2ODQA 2XUHA 1TVKB 4MKRA 4S1VA 1PP4A 3TM5A 5TPZA 3E8MA 4OHOA 5BSGA 4R9RA 2C3OA 2C98A 3M6FA 5IDYA 3BICA 4R1UA 3SF8A 3ASYA 1ZI9A 5LQUA 3N8NA 2OO7A 3B1JA 3ESXA 4BV2A 1Q0RA 2GZMA 2IDMA 1XDDA 2ZBUA 4AK9A 5LKRA 3U7EB 4G9BA 3WGJA 5GIOE 1VE3A 2B37A 5KYKA 1I3MA 1ECLA 2O2HA 4IEIA 4DM3A 3G2JA 5FUMA 1N2OA 3DPSA 3IE1A 5TQ0A 1KYZA 1KO1A 2VBIA 3U4GA 1SKBA 3ML1A 2N0SA 2XYPA 3KU4A 4I1UA 2R6R1 5AICA 4HNTA 1IM2A 2Q6OA 2DHRA 4PQRA 4WN9A 1DV1A 5TQVA 4XJVA 4K9RA 3U40A 5A6VA 1JJ7A 2BCJQ 2VEOA 1CS0B 4J4HA 1MC4A 3A4VA 3AR6A 2FPIB 2O48X 2BEKA 4LJRA 4XLZA 2GN2A 2PGOA 1Q22A 3IVXA 3NKFA 1U2ZA 1UXJA 4MQEB 4QPPA 2A0FA 2W98A 3I52A 4ZVNA 2IH5A 1W4BA 3FBTA 5FOTA 1GFZA 2IUSA 3A1WA 4AMVA 1BGWA 1TM2A 5DYIA 4ZV9A 1DEKA 2J7PA 2IYAA 2PO5A 1RQPA 2C2XA 4L51A 4NX2A 4R6XA 3VX4A 2QZZA 1X0XA 2XMPA 4KUGA 5A9TA 3R8XA 1DRWA 3WWPA 4BJ1A 4DG9A 1H2RS 1O6BA 3JQ7B 1GARA 5FBQB 1KTIA 3T0GA 4ZN6A 5IAEA 4G1MB 5BN4A 2HU7A 3GLHB 1OGIA 1I6LA 2H9IA 2DPHA 2OORA 2WDPA 5ECGC 4L76A 3HM2A 4ZMBA 1T5SA 3VZDA 1AKMA 4P83A 4RY0A 1AKNA 4HXFB 2Y93A 2HPZA 1UQTA 2J7KA 3DHVA 5JANA 4HNGA 1J20A 1XC7A 4IFIA 5EL0A 1GL9B 3FHCB 5HF5A 5NLLA 3M3DA 3OVMA 1P4AA 1TM4E 3QYJA 4IICA 3DOIA 5KDDA 3AH8A 2CMHA 1XZBA 1LS1A 5ALGA 1UXGA 1V8DA 3AHIA 1M8FA 1K5GA 2Q9UA 3W2HA 4CCYA 1GEEA 3LD9A 4G23A 4E2WA 5CFRA 3JARA 1S9DA 5G1PA 1UBGA 2J9RA 5B3JC 3DTTA 1C3EA 2B0JA 1WRBA 1ZH6A 2YL2A 4NFHA 4UXHA 4XX0B 2IEZA 1DKOA 3AJRA 3L8FA 1HZZC 3QIAA 5C3MA 3EIFA 2ZTMA 4ZV4A 1VL8A 1L8XA 4BB6A 3MBKA 3TNLA 2JLZA 3EVTA 4WWHA 4KYUA 1J1ZA 1G5IA 1PQ4A 4B40A 4CTOA 3BPSA 3I5MA 4GMKA 3WKCA 2GN0A 1ECBA 3E0XA 3BHNA 4B2PA 3AEYA 4GI2A 2HKIA 5BN5A 3HFGA 5JC1A 1OYWA 2WB2A 1EGHA 1GOTA 1ZJ6A 1XFAA 2NZJA 3RUEA 4GG1A 2C5FA 3C39A 4GMHA 3VBEA 3R3SA 5HWSA 2VP9A 4OHRA 3W5UA 4MVJG 2GEUA 3UF0A 3X2EA 4CKBA 3ER8A 2FFBA 3FZNA 1NRXA 4X91A 4DIEA 3E82A 2YYZA 2VNKA 2BGGA 4FFDA 4Y6PA 5IJ0A 4HNVA 1TF5A 1CIVA 1PGQA 2I9PA 4N0PA 5ULLA 4DT1B 3H8WA 4JJFA 1SH7A 2AQ8A 3Q6NA 4GRDA 1V2HE 4UVDA 1Z56C 1ONSA 2OXIA 4BFWA 1SUFA 1W35A 3H5AA 2FR1A 4A8JC 1MVOA 3NVKI 3HRHA 1KEPA 3PKIA 4M8KA 2FLKA 1PLLA 2HDHA 3VAZA 1NVWQ 4D0LB 2AZ4A 2RE8A 4K88A 3ZWXA 2R6DA 3I32A 3QKWA 3KETA 1C4OA 4JFAA 1EE9A 2J4FA 5EZYA 2CDBA 2VYND 1T9ZA 1XZCA 3S68A 3PGXA 4XB6B 4IEFB 2GM9A 4E07A 4F3CA 1ZSYA 3GFQA 3EQZA 4RA9B 2QM7A 1TQ8A 4NMWA 4OA5A 4UUQA 4Q6BA 5I9SA 3TTUA 2NIPA 3VH4A 1XHEA 4YJ3A 1SKYE 1RZUA 3JQAD 2I1LA 1LZLA 1KEEA 2R7KA 1NVGA 1CSEE 2HGZA 1WZEA 1AS0A 3OLYA 4JQCA 3VNUA 1G5PA 2GI4A 4MULA 1WOMA 1ONBA 2D5BA 5CDHA 3B53X 3K5HA 5I5GA 3UPTA 2O8FA 4HADA 3FLBA 5IAOA 3EVAA 3ICVA 3LDHA 3M89A 3BDAA 3TDNA 1PJ8A 1CP2A 4FZ3A 1E94E 2ZYDA 3O8DA 3PNMA 5GINE 3R7NA 5F64A 1U7TA 1JQJC 4HDKB 3RWMB 2IWHA 4D43A 1YASA 3SJBA 1Q0TA 4N03A 3K1TA 4U9HS 2OQVA 3FYCA 1K3FA 2JGDB 4NJMB 4OU5A 3RTAA 4NBLA 4EPRA 1Y5NA 5HQTA 1JILA 2A9PA 4ARAA 4WESB 1EK0A 1QGUA 4HVAA 5FULA 5IBCA 1WW3A 2HJWA 3D6AA 1PT9A 3SFVA 5A4JA 4Q3LA 4LG1A 2W6ID 2OZEA 2W2QA 1E1YA 5T4EA 1VMKA 2R6CA 4TVSA 1GAEO 4Y9UA 4ROSA 3PNSA 5EZQA 3M4XA 5TMPA 1BYIA 3QJYA 2H1SA 1T9CA 4GI3A 4Q34A 4XLTA 5IPFA 3SOZA 4TYWA 1M6YA 1BX0A 3WYGA 1WPRA 5ARBA 2MSWA 3QF4B 1VI6A 3GR6A 4U0JA 2IHJA 1GRNA 4YJHB 3H97A 3I5XA 1S1CA 4K6OA 2A1UB 4KQ6A 2HMSA 4PSVA 1QGOA 3ETEA 2BZSA 1VBKA 4D9BA 4NATA 1YZHA 2J0UA 3EIXA 1KHTA 1Q7TA 4I50B 3ZHSA 3OCZA 4FHCA 2RK6A 1R1DA 1KTVA 2I4MA 5C53B 2HQRA 1YHYA 1KY3A 4ZVKA 5BQOA 3UH1A 1B15A 4B31A 1G8HA 2EKZA 3TVYA 4BVEA 3AKYA 4GOKA 2C00A 2QD3A 2JH9A 4Z7NB 4RM2A 1UPXA 3V97A 3ZD9A 2FOLA 4TQUS 3BT7A 1BOFA 5G3ZA 4WT7A 4Z2AA 5HG0A 2FCAA 1WBDA 3P9CA 4RHUA 1PFYA 1ZC3A 3IP3A 4NBNA 4NCJA 2NMVA 5AXBA 5DW3A 1VCOA 3DL0A 1JG4A 2OMKA 4L15A 4LDNA 4ZKDA 3ZDDA 4GIBA 4FVTA 4HDCA 3UAGA 3W2TA 4Q9NA 4G8DA 3FNIA 1RW4A 4DLRA 1T9BA 1GSAA 1ZD2P 2FSIA 3BERA 3A1NA 2VAMA 2YXDA 4KITB 3LYHA 3RGGA 3NUQA 5IFKA 1QHHA 3BGSA 3O1IC 1L9KA 1W4AA 2HQOA 2RG7A 4U2GA 1ODKA 2WNHA 3T06B 4AX4A 1IN7A 1HYBA 1I9GA 1V1JA 3MD0A 3SEAA 2FQXA 5A03A 3BC1A 3SN6A 4RNDB 3BD6A 4GXRA 4RGQA 4RVOA 1V41E 3LKVA 4EJFA 5KKCA 3WGQA 2AFVA 3SGLA 1RVDA 2VSFA 4C0JA 2GRUA 2QF7A 3M6MD 2IITA 3FH0A 4JEUA 2A14A 1GU1A 3UJ7A 2IL1A 3PB3A 5G40A 1QBGA 2Y0CA 4G0XA 1RXEA 3IVRA 4MGIR 1B74A 1SXJE 1ZXXA 2DOKA 1NMXA 2WWTA 3DBIA 3EHDA 3WWOA 4EB3A 3A6EA 2ZRCA 3NEJA 4LYEA 4GW3A 4OHBA 4BBAA 3S28A 1ILWA 1TGYA 4I4IA 5I7AA 3W9UA 5CDUA 1GPMA 5HTOA 3WAJA 4O1MA 3Q40A 1FX0B 3HWRA 3H2HA 2CXOA 3KXDA 4UDXX 3F8TA 3ZDYB 4Q9HA 4D98A 3E7XA 3OPVA 4I5IA 4PNZA 4CV0A 1KI6A 3PXDA 3WGUA 3KDSE 1PT8A 1OX5A 3SHFA 1JQ3A 2JIPA 2O4CA 2XIJA 3GPBA 3E9NA 1XDUA 1Q0QA 2GBGA 1GLVA 1OAKA 2PFGA 4N01A 3SLRA 4V2IA 5F3RA 3QTTA 5AVRA 1EEXB 4RPLA 4Y9RA 1V71A 2P90A 7ADHA 1C4WA 3L7OA 1A9TA 3M4ZA 5KNCH 3AQ4A 1G17A 4HZUB 1BA3A 5LSAA 4K7JA 2PU5A 3KZCA 2OHVA 4GOJA 2BHRA 4GC9A 1VE9A 3M5WA 1KF0A 2GETA 4QNRA 1HZZA 2QE7A 4F5DA 3AM1A 1D2AA 5JY1A 3PC6A 4ZYVA 4NU8X 4Q3OA 2BL4A 5CFOA 5BORA 5EIWA 1BGXT 2ETVA 3FPFA 1YAJA 1T2UA 3QYFA 2XY4A 4HWPA 4I19A 3UKOA 4X64B 4MVJM 4B3IA 4J91A 2SECE 5DTEA 4GLBA 3T9CA 1ZAKA 4PYLA 2PPVA 4MGHA 1R6VA 1RJDA 2IBSA 1UMCB 1VPEA 4HLUA 3NHRA 3T95A 2GA9A 2D59A 5K20A 1KDVA 4P0QB 1WXIA 4XDHA 2Q5FA 5ELLA 3ST7A 5FWXB 4NARA 1KO8A 5JALA 1DDOA 1ND6A 3U3JA 2Q4BA 2RH9B 2B5WA 3V1UA 3WQSB 2XA1A 1PFUA 2AEFA 2RB4A 3SJZA 4D3DA 2AFIE 5IKOA 1X92A 1XVAA 2IF2A 5DRTA 1L1RA 2HYIC 1ONPA 3RIGA 1RI2A 1G5RA 2Z58A 4EVIA 5JVDF 4IRMA 5TMBA 3W3AH 3SMVA 3NC4A 3DLIA 4BNYA 4LYGA 2AIRA 2EWWA 4EHIA 5JTTA 4IKPA 3I6YA 2ORIA 3DL2A 1JWLA 3ASVA 4JI4B 1TA0A 1PX2A 3IH5A 3K53A 4PZ9A 1CJVC 1DADA 3MA0A 4R01A 2O54A 1BCSB 2GA8A 5A5EA 2FFQA 3GP5A 4JQYA 1QF9A 4DGQA 1JZTA 3EPJA 3TTWA 3UICA 4N12A 5F5XA 2ID9A 2OGZA 2R4QA 3GXBA 3KO8A 3ONEA 4ML3A 4PGAA 4QBHA 4M7OA 4BJ5A 4YXWD 1C4KA 2C5AA 3U3RA 4RBNA 4J1QA 5A7FA 5EYPB 1OJ7A 3QKRB 5JSZB 2Q46A 2GK6A 2BSQA 2PS0A 4WNAB 3BD8A 1VRCA 3HI4A 1T5LA 4N7BA 4QWMA 1P5HA 1WXGA 3ZY3A 1OU4A 2Q3MA 4BU0A 4JC0A 4B32A 1U7HA 3C1TA 2GRJA 4PSUA 4G0MA 1CS0A 3GARA 4ZJYA 1YZVA 2O5RA 1A5SB 1M1NA 3HUEA 4H7KA 3B12A 3QKUA 4NZ9A 5IVIA 1ZR4A 5FDFA 2I99A 4NDNE 1MU0A 4BY9E 3FZQA 2D1FA 2PKWA 4BLQA 3BWXA 4BEBA 4PVDA 2VKTA 4R7GA 4CPDA 4ZZ1A 1I4DD 2IYUA 3ABOB 1TW2A 3P0EA 4JHLA 3AEUA 4KV9A 2WB4A 2GYYA 3LY9A 3WJAA 4R2JA 2HLNA 1HX7A 1WHTB 1BROA 4GSKA 4RH3A 2ZJ1A 3T35A 5GZ1A 4BO0A 1UJ4A 2YDYA 3UB2A 3GCDA 1PG0A 1ST3A 1VHLA 2UYCA 1U7WA 3H11B 3RYFA 4QT0A 2IU6A 4MJXA 4DNQA 4NXMB 4HC4A 2DKOA 1WMFA 4OHKA 4B8ZA 1NFFA 4NNJA 2YX1A 4DV6B 3LWNA 2OKCA 1CUZA 1Z0IA 1JB1A 1MX9A 2ZJ8A 1Z6GA 3BWVA 1BFDA 3GRKA 1T43A 4U2DA 5K0GA 3OWOA 3EX7C 2CV0A 3Q8XB 3K9CA 1B8UA 4RZ2A 2HBQA 4XFKA 4C6HA 4DY4A 2A9JA 3JZFA 2HRBA 5AMXA 4N8DA 4E5KA 4RJIA 2QDXA 2X6RA 4ALLA 1IAQA 2A0XA 3LBAA 4KIWA 5L51A 4GKJB 4I5EA 3R3XA 1V39A 3GJYA 1Q0UA 1DXOA 3GYGA 4GLJA 3PEVA 1I8TA 1QYIA 1EA7A 1JWAB 4QWWA 1X86B 3ZHOA 1C7QA 1W0JA 4OI4A 2I4NA 4KQ1A 1NRJB 1WXXA 2FZ4A 1VJ1A 2PZKA 4QVIA 1J6UA 1A97A 5FLEX 2IGBA 3BGOS 1HRDA 4GDFA 1B14A 4L6IA 1DQNA 2BMAA 1JHYA 3GJ5A 3WGZA 4EUEA 1TM3E 1F51E 3ACDA 2NZ8A 3DE7X 3LPNA 5EKTA 3ZIAA 2EWVA 2GXAA 1Y1KE 1N4DA 2FRDC 4LJKA 3EH1A 4AZ3B 1YL5A 3Q0IA 4LXHA 4AY3A 1LDGA 1U7UA 4PZZA 5TR9A 3MM4A 2B1JA 2B8WA 3CLRD 4EG7A 3IQXA 5JG7A 3IDZA 5BO5A 2Q4DA 4ZALA 3AOEC 2G67A 2ZUBA 1JHXA 1HUQA 3GHYA 2XT9A 4AUEA 4EJSB 2V6FA 5INTA 4TXJA 2QEQA 1OLSA 5EZ6B 4A0QA 1Y48E 2WWXA 3TQHA 1RQXA 3DL7A 4EY4A 1VRWA 2GS9A 3LO8A 1V95A 2ZJ7A 3VOBA 5KOIA 1QS0A 3NWJA 3ORYA 4GVLA 4M9RA 5BQPA 5HKLA 1OA1A 3VU0A 2G70A 3GMTA 4ZOLA 1JFSA 2L2QA 3C15C 2X0KA 4B4DA 5JQWA 1N3LA 1NVVR 2D1RA 2QLTA 4PLVA 4TSKA 3V5NA 2BGLA 3JQBC 5FT9A 4XWOA 4OHCA 5IULC 2O19A 3NXSA 3V4ZA 3HYCA 4L4RA 2D4AA 1IXKA 2OZVA 5H3HA 3R6LA 4BNZA 4BUCA 1M10A 2VZLA 4NCNA 1M1ZA 4U7JA 5DI3B 4AZ0B 1EWQA 4B8YA 3JYOA 4POAA 2P1ZA 4IO1A 1U2TA 1C3JA 3BYZA 2BGRA 3P2OA 3FVWA 3HWX1 4GPBA 4LS3A 4OKIA 4GU5A 3NUZA 2UYOA 3QVVA 4TTAA 4CIBA 1NMEA 3ZK8A 1NKTA 2B83A 1DCFA 5TF4A 2AMVA 1HXHA 4D3XA 1KI9A 3EPLA 3FNFA 3G5LA 2FXIA 1VCHA 3WP1B 3O26A 5KC9A 3IX7A 1F8GA 1XQ9A 3RV4A 1L8AA 2QN9A 2R87A 3A2MA 4W9RA 1F8YA 2ZYVX 3E9MA 1WDLA 2AR0A 5AKIA 4Y1EA 4LBWA 2XRZA 3FVVA 1IQPA 3O8LA 4ZAXA 4P22A 3CZ4A 5IF3A 1JNXX 1E79D 2MYNA 4MW0A 4NNPA 3T5MA 3DONA 1YC2A 1G3RA 4CIXA 1ABFA 1JHUA 4A27A 5F33A 3HA3A 5CCBA 5KIAA 4RKFA 2P9EA 3DUFA 2Z57A 4ZCIA 2J48A 3EWIA 3TFQA 2R1TB 3T3OA 2AA3A 3TI9A 2YMQA 2QTAA 3UAZA 3V34A 4TWJA 1Z88A 1H9AA 5C80A 1YFLA 2A9QA 4PQYA 2QTVB 4QEDA 4U2EA 3ZXXA 2ZPTX 3EVFA 3F5QA 2OHGA 4IY1A 1NBWB 3K09C 4WEQA 5A1JA 2ZB7A 3SEQA 2JEZA 3IUPA 3H2YA 5ED0A 3DBRB 4Z4QA 1UM8A 1Z36A 3Q7QA 2QG9A 3IQZA 3ZPXA 4AMUA 3JQ9A 3W5CA 1CQJA 4HN4B 3FDZA 2ZVQX 2GX6A 3EZ2A 5L3QA 5G4KA 4C21A 4ECAA 5JPDA 5JS6A 4A0GA 5K6AA 3NHYA 3O92A 2YRFA 3P0IA 4F2HA 5A02A 5C5DA 1SZCA 2BI8A 4LBVA 5AOAA 3EGVA 3WL7A 1Z37A 3AUJB 5HF6A 3GMIA 1E9CA 1QG4A 2ATEA 2IP4A 1I3LA 3RKSA 3X1YA 5JH7A 5C8DA 2O9JA 4M0EA 1TK2A 2JJ1D 2J6IA 4MUGA 4RK4A 3B6KA 4WI1A 4Y9DA 4C4SA 4G41A 4OLAA 2LRHA 2JI9A 2JD0A 3UW1A 2BFNA 5JHGB 3O8OB 1KQ3A 4V0OA 3MBIA 2A35A 3LUJA 4EG1A 3HJBA 4FINA 4PHCA 4FKBA 3I1YA 1KP2A 1Z28A 3O8RA 1Q3TA 4XVHA 2OQRA 5D5HA 3X0DA 3EDRA 2OGUA 3FHOA 4JBNA 4GPZA 3A4IA 1AXGA 1QRDA 1ECCA 2IFTA 1EFPA 2X2EA 3TSOA 4ER3A 1IRXA 2KLBA 2V1XA 2NU7A 2Y71A 4BNVA 2XBMA 4WACA 3SS9X 5JSHA 3H4TA 4BV9A 1UBLS 1MV8A 1RWBA 1AMOA 5HM6A 4W5RA 4GBJA 4UEWA 4QDJA 4ALMA 5CAEB 2R2AA 4M22A 3U4QA 4WGGA 2XNDD 3ZDZB 3KZXA 1JXMA 2ZDQA 4KQWA 2JCXA 2IH4A 4J0QA 1LXCA 3UG6A 1K8XB 3OJCA 2X14A 2VTKA 4HLNA 3OICA 1PZHA 2PS3A 2QW1A 2F59A 3BHIA 4X6YA 1O94C 3VU9B 3DSRA 2B6HA 1IHDA 2WEKA 3KXKA 1CF4A 4F7WA 5FWAA 3LNTA 1E7SA 1XD2A 1U0JA 5ITZA 4DV0B 4J0IA 2X2OA 2LP4Y 3EA4A 1MFPA 3OKCA 4MVXA 3VISA 5HS6A 3ZXYA 4Z9YA 4RD1A 1KDRA 3ZD8A 5EWJB 3U7QB 5FLYA 5BRNA 3NHSA 4RU1A 1YS7A 3OC0A 1WG8A 3N5KA 5KJEA 2DT8A 4B6GA 3VPAA 1P91A 1G8MA 1ZSVA 3IPAA 1I5RA 4C0HA 1EPUA 2YVUA 3G9XA 4Y2VA 3S44A 1L7QA 1TZJA 2WW8A 2ZIAA 1BX1A 3Q98A 2FE1A 4KE9A 1KOJA 3RWOA 2ZJ5A 3STXA 3WL8A 4JGIA 4CKXA 2JHFA 3LT0A 5COQA 3DVAB 4PIPA 4JI1B 4ZFNA 2NXJA 4PSAA 1Z13A 3O6VA 1B2RA 1JEQB 1YQGA 5ALYA 1IIBA 4F85A 2BHTA 1HFKA 1LWOA 1YDFA 2OGSA 3IDQA 1YJAA 3ITEA 1X87A 3X1XA 4IZ6A 4AD8A 1V5WA 4C0QC 3CVWA 3OX4A 4JJZA 5C1DA 3L6CA 3G89A 4M37A 4BWVA 2CLFB 1Z12A 3DULA 4KSYA 4MHSA 2FEOA 2AEJA 2NV6A 7MDHA 1ICIA 2HFKA 3AF1A 1VBFA 4LISA 2GZ1A 4XR4A 3V1NA 4IF6A 1BD4A 3ILVA 5JEDA 3H65A 5BQ5A 4CM4A 2H8KA 3KSZO 3NALA 2JIMA 4TVKA 5AVKA 3I3SR 1NULA 1KJYA 2CCJA 3LF1A 2O52A 1MTZA 4ENVA 4XIIA 4MDFA 4AUKA 2DAPA 5DMHA 1D4OA 5DCUA 3KELA 1N7JA 1S1MA 2H5IA 4GD3Q 1MGPA 3O8QB 2O05A 4M46A 5FUQA 1RYNA 2YR0A 3U61B 3X2SA 5LR6A 1SVMA 2HF8A 5A9SA 1APBA 5SZHB 3TGLA 3F1KA 2CLHB 4OSPA 3WWYA 4QM7A 4I5GA 2O7RA 2DLCX 2FDCA 5GQSA 2QR5A 5DN6A 1BX3A 1R4AA 2IYEA 5HJ2A 1V5IA 3C6KA 1SULA 3LLSA 3IT2A 5DX1A 2QN6A 3QE2A 2JFWA 3MTAA 4AQYB 3CZQA 1ECJA 3MJVA 3QJGA 4AO6A 4CG0A 4RD6A 5EMLA 4MS3B 1TFRA 4JSTA 2PUGA 4LDPA 4R8MA 1ZIDA 3NTLA 5J5AA 1KDPA 5ILQA 1SHJA 1R5NA 3ETHA 1NY5A 3A6PC 4MP3A 3LT4A 2VH2A 4LYJA 4S0XA 4XUEA 5JZSA 1E69A 1F1BA 1WPXA 2ZOSA 4JCOA 1WKCA 5FXMA 3RSOA 4DFDA 5IASA 2PWZA 4DZTA 5LU8A 1J2RA 1R3UA 1RLTA 3PJDA 2QX9A 3JWGA 3O4RA 4J1TC 4O2AB 3HDJA 4NV0A 5H83A 4XZ3A 3RS9A 1TAHA 2C5GA 4JJIA 4ZARA 4EW6A 4WBNF 4OBBA 1KE1A 3PITA 4AO7A 2P91A 5TJHA 1MC8A 1X7DA 2QRJA 2PUFA 3FOZA 1MOQA 4MQFA 1AKUA 5ALPA 1E8DA 1PL6A 3OP1A 2Q5LA 1MAVA 4F2DA 2DEUA 2L18A 4FUQA 2MSLA 2AXEA 4DPMA 1MW8X 3GEGA 1RI3A 4MP6A 1SOVA 1VKZA 3BCUA 1SC4A 2XDQA 3DMDA 4EUFA 3IODA 2RGYA 4O4JA 4RTSA 3ACBA 1Z2CA 1PF7E 5E0OA 2R25B 1USWA 2LBPA 3RYIB 4E2FA 4GXQA 1E9BA 2MSDB 3PWZA 1FSPA 3TEMA 1FLNA 1DP4A 2YHBA 3T1NA 4B81A 3JQAB 2X13A 4ZQCB 5J2TF 4Q82A 1Z4LA 3FMVA 5K6RA 2A5LA 3RE1A 4ACAA 5MGBA 5HDBB 3R6DA 3PDWA 4LRTB 1L7BA 3LQKA 1Y4SA 4FEEA 2FDRA 2FPGA 2VVTA 3BTSA 3LP6A 3RVQA 4ZEMA 3I62A 5ALTA 2G1AA 4LJ8A 2GD2A 1DL5A 3U5ZB 2HPHA 3OWXA 3R0ZA 1GILA 1L4YA 4B85A 5AW1A 1PSWA 3MUNA 4AY4A 1QP4A 2BR3A 4DWOA 5KOYA 2GZ3A 1U3GA 4L9SA 3PD1A 1ZMRA 1J09A 4TZKA 4O25A 3R7LA 3T5BA 4Y9TA 5AVYA 2IEAA 1TQHA 1XNRB 3REQB 1ULZA 2YYYA 4BZWA 4Q4CA 3N70A 1WSBA 2Y4NA 3DFMA 5BR7A 2N47A 3UPUA 3DAYA 4E5SA 1KOLA 2OV8A 4F6LA 4YJ2A 1JWBB 4AF8A 7REQB 1UXKA 1JYSA 4G85A 3V4FA 4XYLA 4DMCA 3RYCB 4E11A 1C0IA 2P2DA 3F6PA 3LRTA 4HX5A 3SF0A 3KTAB 4YPOA 4AI6A 2JJYA 2PQ2A 3SF8B 2PH1A 2ZJ3A 3RAFC 1NAHA 2QRPA 3QU2A 3LL4A 4J3JA 1PJSA 4FDUA 3IUEA 5EZYF 1IH8A 5ALFA 4DBLE 4P5DA 5DH9A 3EOAI 4PCLA 2E1RA 1YNOA 3KYDB 3ADBA 1K75A 4OJTA 4L0QA 4OYYA 4ZQBA 4BRUA 1G20B 4ZJUA 3INRA 1PW7A 4C7XA 1SU6A 3DWFA 3C1OA 5CCXA 1CVRA 2P2ZA 4L95C 1G2QA 3WA6A 1SXHA 3ZE7A 1Z6ZA 4JU8A 4D0SA 4NYJQ 5ALNA 4QJ5A 4PO9A 3IBYA 3U4IA 4G1BA 4LXTA 3SR4A 1UT6A 2Y2UA 1SUEA 3AFMA 4TM8A 1AQJA 3E3LA 4F06A 4K1LA 1V1RA 2Z2KA 1OX4A 2PZEA 2UDPA 1W87A 3ZLUA 1X8JA 3VM6A 1ZD1A 2P2NA 5EIHA 4CG2A 1S7CA 4B3FX 3NKLA 4RH1A 2X9VA 1J8FA 2R85A 2VN8A 1IQUA 2LDBA 5EWMB 3RM3A 3KK0A 4I4NA 4YT2A 2BTEA 2FLWA 3PLAE 5CFNA 1WHSB 3U4AA 4RY2A 2Z9CA 3IJEB 1RYEA 2GYVA 4GPD1 2BGMA 5D01A 4DWWA 2G83A 1TYEB 5HZHA 1OUMA 3GB9A 4O2AF 4IDQA 1Z4KA 3QPAA 3IEUA 3R76A 2A78A 2BI4A 3K0AB 4AG5A 5AKEA 4A1FA 4Q4LA 1ZGGA 3QFSA 1VIAA 1TM7E 3D3WA 3MWLA 4BMZA 5E3JA 1EUQA 4PS1A 1GG9A 1M9NA 2WA1A 1XQYA 4DMLA 1XX6A 2WYVA 1VE1A 1WCXA 4Z7QB 2I2FA 5KOHA 3OA0A 5K51A 4C5CA 1RADA 1CUSA 4IS3A 1UMKA 4BLWA 4F9TA 4KO1S 4BJ3A 2QM0A 1DMSA 2GJ4A 5LFAA 1STOA 3TIVA 4FFSA 3BSSA 4JWKA 4BQOA 3Q7TA 3VKUA 2CBZA 4X3PA 4IZOA 3VRHA 1Z4QA 2IU4A 2KI5A 3OQBA 1LJUA 1L7XA 3LMKA 3OAAA 2A5YB 2RGDA 4TLEA 4UQOA 4EVSA 5B12A 5J2TB 1IVNA 2N42A 2PBFA 4WY2A 4CMJA 4NFLA 2PX0A 1UPBA 4IZHA 4PFQA 3MJCA 2VNIA 3AUUA 4KU4A 4BOYA 1QGUB 3OZAA 2GN9A 1ZWLA 3AHCA 1W9MA 1S2DA 2WY2D 2QMUA 4AIIA 1F06A 3LPDA 4EX7A 3PC7A 1GCOA 1KIAA 2IYRA 3LH5A 2A4KA 3VH1A 2QSZA 3MS4A 4ZGBA 2EFGA 2O2YA 4YJHA 2B1RA 4B3JA 3AG6A 3KDAA 5CLGA 3K0FB 3QPCA 2EEZA 3DP9A 3OJEA 3T3HA 3K0EA 3VR6D 5DRYA 5B1EA 4GUAA 5CYPA 1G4HA 4IHJB 2ATIA 3WYFA 5JSFA 5LLTA 1XNGA 5E4JA 4K6FA 4OG2A 3FVRA 4DJEC 4DREA 5IT0A 5CK5A 3OLZA 1EDDA 4NYIR 1N9KA 1YZTA 3LQQA 3N2EA 4UATA 4ZVTA 4EJ0A 5I47A 3TIIA 3U7HB 4WHMA 3TR5A 3JARB 1FYFA 3HCWA 1E7YA 1CUJA 3OFND 3PUIA 1P3Y1 1Z0UA 4XM0A 4ZU6X 1IWBB 2YZMA 5EZYB 2HMWA 3ZVLA 1YU6A 2IZ0A 3LZCA 3Q3IA 2XJ9A 4K8OA 1BU5A 3AKEA 5EIBC 3TNYA 5AKZA 2FW8A 3AKZA 2V5VA 4HFMA 2BYTA 5LXTF 3WYNA 3ZHZA 3AP2A 1KY5A 4YAWA 1U0HC 5DN9A 2IX3A 1GRQA 3CRVA 3E2IA 4UHKA 2JZOA 3LBFA 1IHUA 4BAGA 1TCVA 3KWJA 2FZVA 1YE5A 2RGXA 3EFBA 1NMYA 2D3TA 4LRUA 4WCDA 5FLKA 4Q3DA 2ZRAA 3B6EA 3F4KA 2IZ1A 1Q2UA 1X1TA 2ZT5A 3HQ4O 5LA6F 5L7YA 3UV6A 2XUFA 3U1VA 2WUGA 1UBMS 4GPAA 4CIDA 3ZZ1A 4B6JA 3CRMA 5CHEA 4D41A 4E09A 2G1PA 1GPDG 2IPOA 4HDKA 3PUHA 1P7PA 3EA0A 4JOSA 1P2SA 1PQYA 1YQXA 1GTZA 4NQZA 5J4VA 1BXRB 3CPJB 2NZ2A 1OB5A 3BB4A 1PIWA 3SC2A 1GITA 2RARA 2DSNA 1LC0A 2DUJA 2XX3A 4F2PA 3HG7A 3IOEA 1UDWA 4GR9A 4HDRB 4PIVA 4OFBA 3K0CC 3NT2A 4D9CA 2HM7A 2WIKA 3PPWA 1JDNA 5E1BA 1EWVA 1PK8A 3CVJA 3EGDA 3EVBA 1CFZA 1I2ZA 5E2BA 1RWVA 2C4HA 1L7RA 2ZR7A 3HR7A 3PUVA 3HXPA 3PXUA 4PE5B 5SZKB 1QVAA 1XI2A 1U99A 3GPIA 1ZD5A 1OE0A 1O95A 5HFJA 3CLSD 1PTKA 4QPZA 4E70A 2DQYA 4M99A 1MLDA 4C1BA 3FMGA 1NT2A 1RXVA 1GZ7A 2RH5A 3BD7A 3FJ1A 1DU4A 4R84A 4AO8A 5KQRA 2PWBA 3OT5A 1ESCA 5L95A 2C82A 5L9AA 1XDZA 4YB8A 4GBGA 4Y7CA 4AN0A 2QTTA 2QKYA 1UPFA 2ES4A 3UWSA 1THGA 1KMQA 3ZLBA 9ATCA 1SO8A 2DF8A 3DR3A 1OXMA 1QVZA 1EJ6A 4POOA 4UCFA 4JUIA 4W7IA 4AECA 4KR3A 4ZVVA 1QO7A 3I30X 3L0DA 3W0LB 1NMSA 5A4KA 2I29A 1ZISA 3FTCA 4UCXA 1SA0B 4AP9A 1ZLYA 1GYPA 3DC2A 3LHKA 5UKDA 1WXWA 3NOOA 4EGAA 4PZLA 2XMRA 5DM4A 2ORWA 3HJUA 1Z0AA 1Z45A 4IXWA 5FOUA 1P77A 2CLLB 3ZKAA 1GTVA 4AKEA 3U7IA 3ISTA 3SQXA 1W85A 2JF0A 3PG5A 1P0PA 3AIMA 1O0BA 2XNDA 1WTAA 3O2NA 1A5AB 1ETHA 1T9AA 3WI7A 3S2EA 4NONA 2WOOA 4LF5B 2OVBA 3F9CA 1OZ0A 2I1WA 1JIIA 1SOWA 3F6YA 3A3KA 4G5OA 4HHEA 3T7KA 1U2GA 1U0BB 1QRTA 1H05A 3AYXB 2G5GX 3HY3A 4E03A 1VXRA 3O75A 1EK1A 4ZYUA 1TTPB 5DSXA 1E1RA 3SNHA 1K6EA 4QUDA 4J9UE 1CWUA 3A3NA 3G2LA 1PLKA 2RHTA 3JTMA 2HXGA 5TQ2A 3AR7A 4M9SA 2JJQA 3FCEA 3LK6A 2XNKA 4P0TA 5B6PA 1OTXA 5K0LA 4Z3OA 5FD8A 5CB0A 1AMNA 1SM4A 3AG5A 1DSSG 3PT9A 1J8DA 5SZIA 2H7VA 1XRPA 4PCUA 4D3SA 2RI1A 4DPLA 3ZEIA 2JLWA 4C20A 5IZCA 1A1VA 4BKMA 1ZW1A 3RF6A 3DLHA 3ENVA 2PYIA 4ROTA 1FYWA 4BATA 2GF9A 1KK0A 1TZBA 2DZDA 2GJKA 4L8FA 1YQ9A 1ODIA 2Y27A 3ZGVA 4DQDA 3KT6A 1Z73A 3AR9A 2OHJA 4UHFA 5ICGA 4P80A 3RKUA 2CVQA 3A70A 1E8NA 4ND4A 1U0LA 4H0CA 3DJFA 5GTDA 2PH7A 1XU4A 1ISJA 2H0QA 4GM4A 4I9FA 2HR1A 3AP3A 2FEWB 2CFSA 1HH4A 2EL9A 1K2VN 2G76A 2QRHA 3PDIB 3NVAA 3PC3A 3QYAA 5I4CA 2AFIA 1YZYA 4WZAE 3PGKA 3I83A 2ONCA 4JC8A 4NJEB 4QXAA 1XMSA 1YDHA 3NHFA 4RD2A 1U28A 4YNBA 1R10A 2H1OA 1WPGA 3AILA 3A1CA 5E1MA 2DGDA 5E4TA 5I9NA 1TOAA 2UYYA 5LP6A 2Z8YM 4MI3A 1E2UA 2C2MA 2ZPAA 3WGNA 6Q21A 3PJEA 4L75A 3JATB 4OTZA 1W36B 1J49A 2R44A 4I55B 4LSMA 3TPCA 1EHYA 4CMCA 5AK3A 4LSGA 4Z51A 2F9LA 5IWCA 3QM1A 4IVPA 3U0BA 1VMDA 2I6XA 1BVRA 3E9RA 3JAKA 4QG3A 4QRDA 4DMKA 4ZHQB 1DOAA 3DW3X 1MO5A 4IOJA 4GKVA 4GZ6A 4OJKA 2FP3A 4G26A 5TPWB 1NASA 1ZR2A 2P4HX 3EZYA 2Q1TA 4C07A 4G25A 4WCVA 1KC1A 2X0RA 3VTZA 2NTJA 5JMPA 3EN0A 1LFDB 1X1DA 2ZRQA 3WSTA 4XTCS 2W6QA 4NSNA 1OI7A 2JGFA 2E85A 3FMOB 4JL8A 3ZCVA 3EVCA 2SHKA 4ZZIA 1G6OA 1L7EA 3FWYA 3I01A 2VDKB 1CE8A 3OO0A 4NR0A 3TTSA 5JPCA 2OBBA 4Q1VA 4JYAB 2Z5VA 2ZIXA 1VLHA 1FNCA 3OU2A 2RH4A 3DNMA 4RPGA 2QLJA 3GCXA 3IAFA 1N25A 1UWVA 4C4YA 3UK6A 2GZRA 4ZD6A 3O9MA 4RY8A 1ZY2A 1NR5A 2HQSA 3AVPA 4NECA 4YS6A 2JGLA 2NPFA 4ENQA 4Z4EA 4PS0A 4URUR 1TLFA 1OWOA 4NFYA 3ZD7A 1DUIA 2FUKA 2QAIA 2Z5GA 5A04A 3JCZA 1BMTA 4FQ8A 4WY5A 2ZB3A 4MAFA 5C8ZA 2XYGA 3SR0A 2D6FA 1ACLA 2MU1A 5D7BA 3CF4G 1UJCA 1D6MA 1YCFA 1WNFA 2XTNA 3HMKA 3RR2A 1SBCA 3AWIA 1LDBA 1MW9X 2WF9A 4FFRA 3EXHA 4C6TB 4L8VA 1E4VA 3ELYA 4WFQA 3HR4A 1CD5A 4WY8A 4Z8YA 1A7AA 3VYSB 4ZDJA 2YQ5A 5JBQA 5JOQA 1V1MA 3RJ5A 4HUJA 3MWEA 5CXXA 2Y1EA 1DE0A 2DWUA 1Q3KA 3EZXA 5E9WA 4FJ0A 3VNBA 5HE8A 3PNBA 1CZLA 2VTEA 4G0YA 4OJNA 1QFSA 3L4EA 5K8LA 1WBJB 1AUQA 4B83A 1X70A 5I48A 3NV9A 3IUYA 3U7FB 1W25A 1UWKA 1I1OA 1NBME 3OY7A 1TC1A 4KKVA 3WHIA 5JVDA 4UNPA 4FFNA 1OREA 4QJ4A 1AN9A 4ZZ0A 3OFSA 2HHAA 4TZ6A 4UNNA 4AN4A 1W19A 2BR4A 3TB6A 1MENA 5ES3A 1XYGA 3GCWA 4UFPA 1CF2O 1VB3A 3ZDCA 5DMXA 1JU3A 2ZUCA 1EVQA 3I04M 3HV0A 2DCMA 4KP7A 5JSZA 4CI0B 3K70C 4CEHB 2H54A 2PBZA 4CR7A 1ZMOA 4ZOQI 1N0IA 5FJJA 3MIZA 3OPYA 5ALWA 3MW8A 5D87A 4FDAA 3X1DA 5TQJA 1K89A 3ABIA 4TMVA 5IBRA 4UXIA 4TTJA 1X19A 1HF3A 3TL2A 4OB7A 5IKMA 3QLJA 3AVXA 2GASA 1CTQA 3QUCA 4GKBA 5AOVA 3WSWA 3B13B 4AZSA 5F2OA 4L85A 3OCJA 2VSYA 3NBZC 2V6IA 1C81A 4MH0R 5CH5A 4C5BA 4DA4A 3NKVA 5ELXA 4MUBA 1SQFA 4EGQA 2JIRA 2WJVA 4FSDA 5KQGA 1FP1D 1VLLA 4BNNA 1KAEA 4RADA 1O97C 1VYTA 4YAJA 1XLVA 3E84A 2ISCA 4TTIA 1NAIA 1PGNA 9GPBA 2HSWA 3EC7A 1RPAA 3M6XA 5I7RA 3CUWA 5DYYA 3SX2A 5E6RB 3CINA 3C3WA 4ME6A 4BQNA 4PCAA 2UZ1A 4L73A 3ZQJA 1MABA 1CEQA 2PT5A 2YVQA 4RHFA 5IF9A 1ZO8A 2CKDA 2I4OA 3V2HA 1C9YA 1SVOA 2R7NA 2EVWX 4D4GA 4FZ5A 5LXTA 3VU1A 2QP9X 2JLAA 3JWIA 5ADVA 4X93A 1O95D 4P6VF 5FI5A 4K03A 1NW6A 2YOHA 4LA4A 3U5TA 2JAWA 1EFUA 5ILGA 1EFVA 1ZUNB 3MJEA 4C89A 1PUJA 2W2TA 1H65A 4FDLA 3PYXA 1RCUA 3WLOA 1PV2A 1QYVA 3FWHA 3ZY2A 3HS3A 3CT4A 4RE6A 4G89A 4NOJA 4IKOA 3IBFA 3UMCA 5AVWA 1NI3A 1ODFA 2SKDA 1ZGBA 3AI3A 4YONB 2PSSA 1O6FA 2NU6B 1OJLA 3JD3A 4XEHA 2MYUA 3S99A 1J8YF 1FF9A 3JAMA 1E3DA 3U37A 5D7NA 3G2MA 1T10A 2D2VA 1ZCJA 4LSWA 1T36B 4B71A 1ZM7A 1ZVKA 2GARA 3K5IA 1T15A 1SURA 4KQHA 2CFCA 3P0RA 4C7KA 3OT1B 3UA3A 3CW2A 1OPRA 1BXRA 2X9GA 2VDMB 5TJ9A 1XRQA 3IXLA 3DYBA 2Y68A 3L8EA 3M3HA 4DKXA 4LK3A 2H1IA 5BN1A 3ANSA 2HN9A 1ZGZA 3C14C 5JISA 5EN4A 3PFWO 2VWGA 3UW3A 4UMVA 2WC1A 1BS1A 4DB4A 3RTBA 4X44A 2E89A 4NC9A 4XB2A 5F51A 1KYWA 3TBKA 3LXMA 2C78A 2R48A 1FDVA 2BKUA 4RW0A 2IELA 2O0JA 3QVOA 2ZFUA 4W5QA 4AP5A 5JMTA 5KHOC 1BMQA 1F2TB 3VYTB 5T6BA 1K0FA 1T2EA 3HL4A 1CJMA 4JB2A 1G60A 3LZ6A 3ZBUA 1XU9A 4L8GA 3UFBA 4TYNA 1CY1A 5HBGA 1Q1AA 2CUKA 2FGJA 3KVVA 4JUBA 3QXHA 2R6HA 3V48A 4D3ZA 1Y6FA 1BJTA 4WOCA 4UU0A 3CJRA 2C4UA 3OZFA 3DTVB 2JLVA 4BN0A 4X20B 2ID8A 3WBKA 4P3YA 5EOVA 4JBHA 2KW5A 1T5BA 4G0ZA 3AHJA 3DKIA 3EMKA 1TO6A 3E03A 5ESRA 3WLMA 2A9RA 2H08A 1RRFA 3NHAA 1Q77A 1ZN2A 3FVTA 5IBPA 3A1VA 4RV9A 3VZSA 2YJGA 5KTMA 4GPTA 1KVRA 4B6OA 5KUTA 3VOTA 1J2EA 3WLPA 4EIWA 3SS7X 4BVFA 5BUSA 4K9QA 2JFOA 1ZG3A 2IE0A 2ONZA 4B5LA 5AM2A 2BD0A 4L2IB 2CY0A 3AUTA 5M7EA 3BFKA 5F7OA 1JALA 3LKZA 4WECA 4YJ3B 1I01A 1AK9A 3KR2A 3SXJA 4DSAA 1JDJA 3C5WP 2R1TA 4NDZA 2A1UA 4QOSA 5AI4A 1EQUA 1FLVA 3C8MA 3P97A 4L08A 1KMHB 2GPSA 3KJQA 1US8B 3GBVA 1D8AA 1ZEJA 4HAYA 2GM5A 1BSVA 1DKPA 4FX5A 2P11A 2ODPA 2QAGA 3V42A 2BEWB 2W8ZA 1OYVA 2X76A 3E9CA 3AWDA 4LZLA 2OAQ1 4YFYA 3X1MA 5MDHA 5DV9A 1NT4A 1VKHA 5F5LA 5CB8A 1I0IA 1P72A 3CF2A 2QI9F 5IANA 1TQDA 1YONA 3QA9A 4WNIA 1BQ4A 1LB1B 2GT1A 2JAXA 2V4MA 3MZ0A 2YVLA 2DM6A 3B2NA 4HAUA 4ZQHA 1SXJB 2ERYA 6REQA 1AT1A 2B5VA 1LU9A 2JFBA 2XE7A 1HOXA 3K1AA 1U3DA 2XUAA 2OCDA 3HB5X 4KDCA 4M0DA 1WKVA 2LDXA 2YMMA 3EF1A 3G5UA 4ND1A 5AIAA 1XAIA 1EQAA 3KHKA 4A7PA 2QXYA 1WXEA 4FD2A 4Q00A 1MJNA 2ECOA 3L0ZA 2GEKA 4DLZA 1R6BX 3INNA 3L46A 2PYZA 4ZI5A 1WCV1 3L5OA 1G0OA 1KFKB 4FHEA 5FYQA 1PHPA 3P2KA 2NG1A 4HAZA 2OA0A 3WOHA 1YJBA 1SCKA 2NTEA 3EW9A 3ID6C 2JLSA 1YUMA 3KTFA 5HK9A 2VSXA 1REQB 3L1HA 4KN5A 3A4NA 4UFNA 1X7HA 1PR1A 2B20A 3C7TA 3TQRA 3W4JA 3ORFA 5IKXA 1KJZA 3MT8A 3AXSA 2ISQA 1NWCA 1GGEA 1R0SA 2AC7A 1Z8DA 1R6DA 3LKBA 5IVDA 4RKRA 1MX5A 1LY1A 4IGIA 4EF5A 3THYA 1EFPB 1MXFA 2POQX 3O93A 3VZQA 5JASA 4KIFA 4G0WA 3LAWA 4IIEA 4HX2A 3JYQA 1BHJA 3FPHA 4FXPA 5I01A 4BIMA 1ZOPA 3V80A 1KJJA 1WMEA 4G07A 2O06A 2Q50A 4I36A 4US1R 4ZZ2A 3B8EA 3PFBA 1J42A 4HQFA 1QOQB 4N7MA 2EAUA 2FW9A 1JEQA 4F91B 2F7SA 3B2QA 3RTDA 1V16A 1KEEB 2HF9A 4B33A 4JUDX 1FX0A 3EZLA 4KPUB 4N5IX 2HO5A 2QVZX 3U4DA 2K87A 2EFCB 4URZR 4WOBA 1IUNA 3E7WA 5J59A 3KM0A 5KAMA 5L4LA 3DOFA 5FBHA 1NURA 4UTZA 4YACA 3H0KA 3QBTA 4MPPA 4DXDA 5J23A 2COKA 1ISGA 1K7CA 4BV3A 2VZ9A 3NATA 3OTIA 4P4GA 5LIRA 4GX5A 4CT5A 3V8MA 1FUEA 1OILA 3DKRA 2HZ7A 1Q14A 2FW0A 4MI6A 2XNCA 1G1MA 2I7XA 3CY6A 4CM7A 1FFAA 1Y33E 5C7IO 3I92A 1D9XA 4AAYA 3W79A 1JHQA 3ROZA 4Z9FA 2QLMA 3Q5EA 5DLDA 5TY0A 3ZWAA 5CD1A 1HDZA 2Q3BA 4QAJA 1QU3A 3EIQA 4L6AA 2P27A 2UVPA 4OL9A 2QWXA 4NPCA 4RA6A 4QRIA 3I9FA 4GECA 5FAKA 3AV3A 2X7JA 3GUYA 3DE5X 1FS4A 1P6XA 3QH4A 1Y9JA 3KP1A 3AR2A 1Z4NA 1XO1A 3M9XA 6LDHA 2W2XA 3HUTA 2CE2X 3WGGA 1AQIA 2YFHA 2V4ZA 2ZITA 3DMFA 4MVJE 3OM9A 3SXUA 2OC9A 4JB3A 1KQNA 4B7UA 2PT6A 5BP7A 1OYOA 1FQKA 3ND8A 2C97A 1SU7A 2QUAA 5EMJA 3L41A 3L79A 1POXA 1QGZA 2H1FA 5JQGA 4X8MA 5LLSA 2O8BA 1ADBA 1JDPA 3G7SA 4BL5A 2V0CA 5KSPA 2P4UA 2XNSA 2AKEA 1RHQA 2P6MA 2Q0HA 1ULUA 3FKSA 4MR9B 4H9GA 1P4SA 1SUBA 5AKHA 4CM3A 2I7VA 3H5RA 1AV6A 1E1DA 4P92A 7REQA 2B0CA 5J4KA 1D0SA 1K7XB 2UUAB 3I58A 4R1TA 2AFHB 1ZM9A 1EBBA 1NYLA 3TR0A 1H6DA 1YVUA 4QXRA 4Z3KA 4ITUA 4EI9A 4MHTA 4YN3A 3ORSA 1QMPA 4QRHA 1JSCA 4MRVA 4HH3C 2LGJA 3EG9B 1PFQA 4MZXA 1SFRA 3PDJA 4EFMA 1HL7A 2BGJA 2IQIA 2J3EA 3EXIB 4LRQA 4C4ZA 1JFFA 2I78A 3BWCA 4XD2A 4EFKA 2HBYA 4KPGA 1M2VB 3O38A 1ZX1A 1W1WA 5JECA 1IIRA 3IQHX 4ENRA 1PW5A 5HKOA 1S2GA 2P2GA 1E2GA 3E7FA 4RSRA 3JR3A 1WTCA 4YO7A 1K92A 2G07A 2I2DA 3U13A 4N48A 2FW7A 5DPMA 3LBIA 2AEMA 4EG8A 2CWDA 1NU8A 3CCCA 4EVQA 3SHOA 2YV2A 3AETB 2RBGA 4I99A 4LJ7A 3W5IA 2QZJA 4NJOA 1EGVB 3WGMA 4H35A 4PLPA 5CT6A 4CMHA 4YREA 3BUSA 1C5KA 1YMUA 4YJGA 1FTYA 4FYWA 2MJLA 3ZW7A 1B43A 1ULHA 4R3UC 4JLSA 4IFBA 3G1UA 1ADFA 2HV9A 3KB2A 3N7TA 3V7FA 2FUEA 2VATA 3FN4A 4GM0A 1HNNA 1KPGA 4YLEA 5DGCA 1NJGA 1A88A 2PU7A 5KYUB 2NW6A 3O74A 4FUTA 1Q0SA 2WUFA 4G5XA 4Y30A 1LQ2A 1ECPA 4RTRA 2AHRA 1RQGA 3CMMA 4LZNA 4CF3A 3FZEA 1TYBE 1FDWA 2QLLA 5A4AA 2XA2A 3ZV3A 3I5UA 3MNFA 1QE5A 1DAGA 2VJCA 1HEUA 3FDXA 3HSYA 3NIDB 3I61A 4C2BA 1FRZA 3BJIC 4IJKA 3Q8LA 4PZCA 5F21A 1MRSA 3FPAA 3L18A 4Q48A 4PO3X 3MCTA 4WZBB 5A62A 4CKWB 2H6EA 3H9EO 5K4AA 3VYRB 3WHKA 3NDBB 3R20A 4IO0A 4JLBA 2F2TA 4PG7A 4X9XA 3IERA 4HAOA 3ONWA 4H7IA 4P86A 2Q9AA 5AUOB 1UMDA 1RJFA 4OH1A 3PLNA 3W06A 4B4WA 1X8KA 4C4PA 4HTFA 3KL4A 5A9RA 4QJBA 5CBKA 1MPTA 2ZB8A 3PX3A 4KMRA 2P68A 4M1TA 5K99A 4V0RA 1WJGA 3ZHBA 3HYNA 2WG1A 3JVVA 3QLVC 5GP1A 2O5VA 4MW2A 4RFSA 1VPDA 2CHEA 4XWKA 3B5JA 4LUCA 1VLZA 2F6RA 4ZI2A 1P8JA 5HIIA 3UUFA 1AY0A 1K7SN 2VIIA 2UUPA 4D9JA 4EH1A 3D0KA 1DG1G 4PO8A 2HADA 3IUSA 3MPUA 4INOA 1P81A 3V32A 4TTQA 4BGIA 2V59A 3CNBA 3AM4A 4LXGA 4P4SB 4RD0A 2HJVA 5E9QA 4RDCA 5IVHA 3ZQUA 1X7YB 1JJIA 4JR2A 5H3CA 2D62A 2NYUA 4FDMA 4LY6A 3JQ9C 2X1VA 2QVXX 5ALOA 2NPOA 1WHTA 4FKMA 1WMAA 1PZFA 1V11A 2QW8A 2PD6A 3QI7A 1GA1A 2VWPA 4G5GA 4ICIA 4KWIA 3L07A 4MV4A 2EFYA 4O8CA 2ZSHA 3PFKA 4PW0A 3T3MB 2W2NA 3TSWA 2PL3A 1IQRA 1N9GB 1S01A 2OC4A 5TVGA 2JEYA 4DWVA 3W5DA 1N6OA 4IQ4A 5F7ZA 4Q9KA 4JBGA 1A96A 5JZMA 1P9WA 4X1YA 1MNAA 4TMYA 1JHDA 1ZAYA 1IPFA 3AUKA 2R3SA 4ZIRA 1SD1A 3CEPB 4TV9A 3KLPX 2O2XA 3BEDA 4Q1EA 5IABA 4AJ9A 3P2MA 2J3MA 1J5PA 2WTEA 2FHPA 4RAOA 4G5SA 3VKHA 2BHSA 3WQRA 4N6NA 3ZU4A 4MVJP 2H4YA 3RC1A 3NV7A 4DZZA 1M2JA 2IXAA 4PAOA 1G7SA 1OOEA 1N8SA 3HL0A 4JLMA 2P69A 1KK3A 2VQDA 4BNWA 3F6BX 3HR8A 1YJ5A 3OJFA 2QTLA 5DI3A 1T1SA 2X2FA 4W1RA 1F2TA 2VCEA 5CK4A 2ZWIA 1ZM4A 1X1CA 1R00A 1W47A 1FSZA 1OW3B 1M1YE 2HRZA 2ZAMA 4FBLA 5TSDA 5SYAA 4AURA 3L1KA 1JP7A 4KFCA 5EJ8A 1IDOA 4TRMA 3TJRA 1Q19A 4JQSA 1JQEA 4XWYA 5LQAA 3HKDB 3UFXB 2EERA 2EV9A 3CX3A 4AJPA 5LUAA 1FUIA 1RE1A 2P6NA 2EFDB 2A59A 3PE6A 2B8JA 1YR6A 2P5YA 4FK8A 4DDUA 3N2IA 5BW8A 4M7PA 3WNVA 5KWSA 2J33A 1N9ZA 4YJFB 3OWHA 3UQYS 1QVWA 2FRVA 5TGZA 4H6WA 1TVMA 1OFVA 5CA0A 1O8CA 3FTEA 3OO1A 3PQEA 3EQ2A 4XR9A 2GSWA 3JQRA 4KQ9A 5T3UA 1R8SA 5DSZA 3ECSA 2WQ7A 3D7RA 4IAOA 3PQ5A 1GQOA 4A6DA 1UFOA 4XH9B 3KX2A 1FOEB 2V0GA 4OH7A 1A2KC 4E4RA 1OZAA 3D02A 4HGPA 2WD9A 3M70A 1CYDA 1MO6A 5TQ0B 4M87A 3Q3GE 2QHXA 4RVSA 2R8YA 1Z6QA 4FMDB 4FYKA 4BMCA 4MO2A 5E8JA 3OM1A 4JLVA 3PSAA 4AZ0A 1I4OA 2OO5A 4S1NA 4IKEA 3R41A 4HJRA 1IL0A 2YOGA 1M34B 3PHLA 4DJDC 1XKQA 3GXOA 3L5KA 2B69A 3AW9A 3B1YA 3WHLA 5M29A 4RMGA 3E58A 3BF7A 1HTTA 2QM3A 1WZNA 1L1FA 1A27A 1PJLA 3ZXUB 1GZ6A 1OTYA 1ZM2A 3K15A 3AJ9A 3EGOA 3P96A 4JDPA 4IDFA 2D0DA 4MRMB 3FFTA 3HXMA 2XB9A 1WBBA 4S05A 4K6CA 2GBFA 1GNRA 3PF9A 2HXSA 3OZTA 1A0OA 3GL9A 2IV3A 4CV2A 1HPLA 1IVSA 4R2HA 4YPFA 2EYQA 2FETA 1Z5VA 2Z4TA 1D1TA 3Q72A 4ALKA 2O7QA 2RCYA 5A5DA 3CVYA 2APJA 2B92A 2J5KA 3I45A 4KMSA 2IS2A 4E3WA 1VSVA 2P35A 3M6VA 3WDLA 1WP4A 4F97A 1ZJZA 1XLWA 5E1DA 4WRRA 3K72B 1K97A 1HE1C 4RCYA 4IXDA 1DXYA 2JFZA 2PVSA 4LXYA 4X3OA 1E3MA 3TF5A 4KXVA 3DEAA 3AVYA 3PFCA 5IN4A 1P0QA 3UN1A 4UQPA 2BKAA 2FZGA 4MIOA 4F3KA 3QU5A 4QL3A 3S1SA 821PA 5U9CA 1OIVA 2QN7A 3MAAC 4B3GA 5A4FS 1VJ0A 1Z26A 4MKZA 1JT2A 4UVIA 3PXGA 4U02A 1T2VA 2GPYA 2G9ZA 3U4MA 2V7BA 2VRNA 1AKEA 4BUJA 4OLBA 3NRJA 4NLLA 3CLSC 2G0AA 3V7YA 3MWDB 2J3KA 2IV2X 3HJGA 3UHOA 4XGRA 4K2AA 2IQ5A 3KB1A 3UWOA 3WQQA 4CIAA 5TS2A 3F6RA 4O33A 1IOZA 1M6VA 3BMNB 3M9LA 3BJMA 1JR3D 2FWAA 2IDJA 3VO2A 3ENNA 1AZWA 2DYKA 4GOLD 4YRMA 4O4LF 4RF2A 2HK7A 1NOJA 2JLXA 1RCTE 5EMHA 4B1FA 2DFVA 4UCWA 5EPUA 1Z6AA 4BO2A 1RU3A 1H9CA 4TN5A 1HDGO 1PJAA 2F64A 7YASA 2XMZA 4KVZA 4FYPA 2CZGA 2EYUA 4YAUA 1IZ0A 1P6QA 3IR6A 4F4FA 3SS8A 1TK9A 2VBFA 3O8OA 4IJ5A 3CH6A 3K20A 5CX1B 2SCUA 2OCXA 3DYVA 4BP9A 5G0WA 2GKOA 4JNCA 4UD6A 2GAAA 2FEAA 1VP9A 4GT1A 4QBGB 1KAQA 1U8TA 4LHSA 4DDWA 4YAKA 3O95A 2ET6A 3H1AA 3RCBA 3SOPA 4ZREA 4CLXA 4D6PA 3HJRA 4E6EA 3PL1A 1KYXA 1C3OA 1ZBQA 1HEIA 1H8EA 2PKXA 3OIDA 1GPKA 5B3JA 3QLVA 2V9PA 3PNOA 2GXUA 2Y1LA 4WNCA 1JF8A 3PE4A 1GA6A 1FFGA 1CQPA 3TE7A 1H2HA 1I24A 4MROA 1A9ZA 3QFFA 4ZEVA 3JZMA 1TXGA 2ARKA 3P20A 2AN9A 2J1LA 4HUQB 1YRAA 4MB2A 3SPXA 4Q66C 1L3BA 3GJTA 4D99A 3BZWA 2QY9A 1N2ZA 3P0JA 4L0MA 5AW0A 4MTCA 2GJSA 1X80B 3AUYA 1DC7A 1SVIA 3JYNA 4FLFA 3V46A 1L4FA 1XKLA 1TU3A 2YOFA 4CLRA 3BEOA 3OQ6A 4I3FA 1U5BA 4W9NA 2NV2B 3ZWVA 3K70B 1QOZA 3IVGA 1U1GA 4J6EA 3Q7RA 4H27A 4P2GA 1M7HA 2WAOA 4MWCA 4TQ9A 4UTXA 2WU1A 5SYNA 4BNMA 4OCZA 4U7TB 4XDZA 5LP1A 3VPFA 1R9JA 2ZJBA 4BVBA 5T4HA 3V8VA 1UEIA 2FE4A 5LBTA 3V4PB 4CF4A 1FS5A 3D4OA 2AJ8A 5KYXA 1PCXA 1T9DA 1ZH0A 4JAVC 2WFZA 2ZBDA 4D8WA 3KQOA 4K9MA 4A8JA 4MCAA 3T9FA 4FMBB 4P5PA 3TM4A 3I2IA 1NUHA 1PWEA 4RL6A 2PIDA 3A6HA 2KSQA 1NJ6A 1AUOA 2QN8A 1H2WA 1X6VA 4FPXA 4NABA 3RVJA 6PFKA 5CFLA 4LF4B 2J6BA 3QOFA 4RS3A 2X4DA 2ZS9A 5JJ5A 1PTJA 1UK9A 1NNLA 4TWIA 3DE2X 1M73E 4DIMA 2HHJA 5EPOA 3TW8A 4ETMA 3C70A 4TTRA 3MMZA 4Z53A 1IWPB 4UZFA 5JXIA 1QH1B 2O5EA 3MIIA 1YQEA 2OXCA 2ZYTX 4Q1FA 1GTRA 1FFWA 2IXTA 2XDYA 3R3YA 4UC0A 4ZQIA 4A36A 1JEEA 3OPXA 4E7PA 1Y81A 3WYAA 4F4DA 2FSFA 2ZU0C 3FJYA 4N3NA 1P1BA 2J30A 4I14A 1NFQA 4Q9IA 2P75A 1EVEA 4IEEA 3VV3A 3N53A 1R9MA 1OXVA 3COJA 4PGFA 3V4OA 4CRWB 4B3MB 2PWYA 3V8RA 3QQPA 4LW8A 4QYIB 2ZYGA 2ZULA 3VO9A 3ZWQA 4GUDA 1DJLA 1FB5A 4BNIA 3UANA 4UAVA 1RJWA 5AUQA 5G0TA 5A1TA 2DERA 1U28C 5JZBA 5JE8A 1YR3A 1ONOA 2I2CA 3MBOA 3V1KA 4PNEA 1NBAA 5TPWA 2HU2A 3ANTA 3HU1A 4ZC1A 5KOJB 1NATA 4MR8B 3RBVA 1ZJYA 5MFPA 3GX1A 3CKLA 3PHGA 5EJ4A 4QFBA 3HA7A 1W73A 2WZBA 4MX8A 2ZE6A 1OFIA 1MJ5A 2WHEA 4YC7A 3ZTYA 3ZLVA 4B6EA 4J0CA 2AG0A 1LDMA 2WDZA 1LSUA 2FPMA 3CS3A 4JIGA 1MA0A 5EXTA 1P7YA 1RAGA 2G28A 2XBLA 5EWJA 2BJWA 3RYIA 3MB5A 3PR3A 8GPBA 1QB8A 3EJ6A 1W48A 5TARA 1YMQA 3YASA 5I8PA 4P7GA 3MMXA 2FB9A 1GAWA 3I53A 4YRFA 4Y2QA 3DDWA 5F23A 5IHPA 1A4RA 3HCNA 1M0TA 1DJNA 3B1FA 2WHPB 4MHOA 2E4XA 3IV9A 4Q18A 5ALKA 1WSWA 4MYUA 4HEA1 3GVIA 1EX7A 4PEVA 1G21A 3LLMA 5L3ZA 1KU6A 3I9LA 2X1HA 4A92A 3V7UA 4O2AA 3A27A 2OKGA 4O6VA 3FYTA 2CVFA 4H3SA 4J16A 2HQBA 4GBED 4MA5A 1X7YA 4EJ6A 5GV8A 2NVOA 1TQ2A 1XCBA 2QZSA 3OOSA 3RUIA 5HA5A 2DBVO 4OHXA 1RR6A 5BV2P 5JDCC 2QTGA 2NU8A 4ARSA 2UUCB 3IIMA 1P4GA 2QU7A 1F38A 1V1MB 3HXLA 4H1VA 5TRTA 3RO7A 4BO8A 4URXR 4YJ2F 5FUYA 1KMNA 3B51X 2CBGA 4FLEA 4BFYA 4HNQA 3RYCA 1F6WA 3DVQX 4BRSA 1IJEA 3O2SB 2PKYX 3QKIA 3AI2A 1MEEA 1DT5A 1XDGA 2NUAA 4W5HA 2OTCA 2HUPA 5D6OA 1QONA 3LLCA 5LXTB 5JS7A 2VJMA 4FI3F 2ZYIA 1FUYB 4YQYA 4UTPA 3VZBA 1JQKA 2JCYA 4LBYA 4U7PB 4QBKA 5LZ5A 1F4PA 3K9FC 3EZFA 2CLOB 4Q24A 3KSDO 2BBSA 2HSZA 2RC5A 4KXXA 8ADHA 3HU3A 1FZQA 2Q3HA 3VPGA 3ZLJA 4L4SA 3OLVA 1VA4A 3EZGA 3ZIAD 5SY6A 2HEIA 5CVDA 3U09A 1NZJA 3RBXA 1JKJA 2EZTA 1GR1A 2JI4A 3DPUA 2VHQA 5ESWA 1H4SA 1JQ5A 2VXBA 4PLWA 6YASA 3VDQA 1ZRMA 2XUZA 1I14A 5JATA 2DX7A 3NBQA 1P60A 1QAQA 4FFBB 3CX7A 1JR3E 4PAWA 2ZSBA 2IODA 4PC3A 4PX5A 1JFTA 4CEHA 4NCAA 4CDGA 4WA7A 4A16A 2IEYA 2V7WA 5K3DA 1NIJA 3OF2A 2YW9A 5I7SA 4R1MA 5EE5B 1A1SA 3GMDA 2W83A 3F3YA 4HT3B 1QIHA 2OUIA 1GGJA 1DWUA 3A58B 4HWGA 5FTWA 3T7SA 1MRZA 3E27A 3NOVA 5FPYA 2W2LD 3EH2A 1Z17A 3OE4A 1RTTA 4LGCA 4LWPA 4PANA 3V33A 4ZCLA 1H3EA 2JGRA 2Q49A 5FPSA 3EZ9A 3QUSA 4GH5A 5CJ2A 2JD1A 2FWNA 1PBNA 2P7IA 2YKGA 2BFPA 1R37A 3D2LA 3K0AA 1DIAA 2BI7A 2EC5A 5HIJA 3PDHA 1C3VA 2PZGA 2Z8ZA 1CIPA 3ELWA 1PKXA 4UKDA 4YGYA 2C3UA 5EE9A 1HT2E 1T6BY 4G37A 3JV7A 4LE2A 1AURA 3ODGA 3BKWA 4BXOA 4UE3S 1OAAA 2OT3B 3IAEA 2O0HA 4GM1A 1V6SA 2V7QA 2RHDA 4CMEC 2RFLA 3N07A 4QA9A 2EW1A 4E1AA 4I1PA 1M2GA 2UZ4A 2JH8A 4XDGA 4X7MA 1R0XA 1KA9H 2VHWA 2ZBQA 2LE0A 4YFVA 2OD9A 5BMVB 5M04A 1N3IA 3DEFA 5CDFE 4X65B 1Z4IA 1OXKB 1KE2A 3WICA 2GGSA 3DV0B 4F9FA 5CNKA 5K8JB 3PNVA 3FUXA 5TB5A 3RB8A 1WW2A 3CZAA 3IC5A 3TZCA 3ZHCA 5B36A 2RD2A 3QVXA 2JCSA 4LNAA 3I42A 3UK0A 4ND3A 4AXBA 2CLKB 3T3NA 2YIMA 2UYGA 3ZZUA 1T1JA 1G8GA 3LP8A 1BD3A 4LMPA 3ROPA 4BPRA 1T1IA 4I9HA 3FLMA 1QK5A 1N2HA 3GDGA 1HL3A 1KARA 2TMDA 3RQSA 2JFQA 4BHTA 4XRGA 3AUFA