4PYLA

Humanized rat comt in complex with sinefungin, mg2+, and tolcapone
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
b'TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pylA00
2AOVA 3HP7A 2AN3A 5M5BA 3G2QA 3OFJA 1D2HA 2P1DA 2P40A 4K6MA 4CKCA 4DQ0A 3P97A 3P9NA 3KR0A 4WXHA 1JG2A 2N47A 4X41A 4RTMA 3EEOA 3KPUA 1NW7A 4PONA 3NMUF 1UFKA 1QZZA 1VP9A 1XDUA 3E7PA 1WY7A 3KPJA 1VQ1A 3BWCA 5DTMA 4BP1A 2G1PA 1I1NA 2G70A 1U2ZA 3M6WA 3BKWA 5FWDA 3TOSA 3HA5A 3FRIA 1ZHFA 3I58A 5DTQA 1X1DA 4RTJA 2VDWA 2WK1A 9MHTA 1YZ3A 4OA5A 2PXAA 3FYCA 4CWAA 5K03A 3DR5A 2OYRA 5KQSA 2ZCJA 3OZRA 4M36A 4RWZA 5DM0A 1XTPA 4EQZA 2YVLA 1I9GA 4KWCA 1RI5A 1YB2A 3KU1A 3A26A 3TKAA 1ZGAA 3HNRA 3G7UA 1O9HA 3VSEA 2XBMA 2PWYA 3HVIA 4KRGA 3NDJA 5K0BA 2HTEA 2ZZNA 3QOWA 1YZHA 2I6GA 2P3QA 2XYQA 3G8BA 3OU2A 5FA5A 1SUSA 10MHA 3ELYA 3REOA 2ONZA 5KYGA 3T0IA 2JH8A 1F38A 4MTLA 3DOUA 3E8SA 4QDKA 2IBTA 5T6BA 1PJZA 1XXLA 3O4FA 2YTZA 3M33A 4FP9A 1DUSA 1QAMA 4H0NA 5DSXA 1FP1D 5K0EA 3HA7A 4QQKA 1FPQA 3KR2A 4RTSA 3GXOA 4GOMD 3KR9A 3QV2A 3RODA 4YV2A 1I4WA 4OQEA 3TMAA 4KIFA 2ZWVA 3TR6A 2FHPA 3MCZA 3NTVA 4YV1A 4CXMA 2CMHA 5HFJA 3I64A 3GIWA 2YX1A 3MQ2A 3R3HA 1XDZA 4AZWA 3UJAA 1H1DA 1P91A 3G2PA 4FT2A 2PBFA 5K0FA 1KXZA 1ZKDA 3GWZA 3B5IA 3ANXA 5P8WA 3TLJA 1L3CA 5FADA 4CTKA 2IPXA 1VBFA 4PYNA 5K8VA 1O9GA 4GQBA 4ISCA 5CVEA 5FTWA 1JQEA 3DLCA 3NWEA 3G89A 4YUVA 3AY0A 4KIGA 5GM1A 2NNWB 4C03A 2OBFA 1M6EX 5EMMA 4E2XA 4PWYA 1AQJA 1M6YA 2BH2A 3BT7A 1TPYA 2VP3A 5FQOA 2R6ZA 5CVJA 3PFGA 3FTCA 1RI1A 3FTDA 1YF3A 5JR3A 3R9XB 5GOZA 1D2CA 1VPTA 2G8NA 3BXOA 2GLUA 4F85A 2WA2A 3FUWA 1XCJA 3MERA 4E2YA 2PJDA 2Y1WA 5F2OA 4QVKA 4QVGA 1QYRA 4RTLA 2PV0A 4PYOA 5EEHA 4RTQA 1G60A 1SKMA 2PX8A 3R0QA 3UZUA 4GBED 4GC9A 1Q0SA 3LL7A 5EG5A 4YV0A 4YUYA 2C7PA 4GC5A 3Q7EA 3NDIA 5KVAA 2BR5A 3SMQA 4BLWA 2PGXA 3DXYA 1EAMA 2ZW9A 3MTEA 2ZTHA 3OU7A 4U7TB 3FUUA 2B9EA 1KPIA 2UYQA 3ID6C 3MGGA 4FSDA 1JG4A 4ER3A 3EVDA 1ZG3A 3IEIA 1R74A 4AUKA 4PGGA 1L1EA 1ZQ9A 1YUBA 3SM3A 1X1CA 5BP7A 2O05A 3HCFA 3CVOA 1G8AA 2EX4A 1HMYA 2XYVA 3EVAA 3EMBA 4GOOD 2P3OA 3RIEA 5EHIA 2I62A 3ME5A 3CKKA 3FUTA 4IWNA 4R6WA 2HMYB 5K0NA 4PNEA 3UJ7A 3P9IA 1M0EA 5GIPE 2NXNA 4PYQA 2UYHA 3EVGA 4XCXA 1V39A 2V74B 3A25A 4AZTA 5D1HA 2NP7A 4C08A 2ZBRA 3MB5A 5JUWA 4DKJA 2AN5A 2B25A 2HWKA 4X1OA 1JQ3A 3HCDA 4HGZA 1EIZA 3CCFA 3FPHA 3LX6A 4DM3A 4E2ZA 1WG8A 1IY9A 2Z6QA 4OBXA 2AN4A 4OBWA 4YMGA 1NV8A 1Z3CA 3HA3A 3EVZA 4FSXA 4GOND 3C3PA 3LDFA 1OR8A 2CKDA 4LWOA 2ZLBA 1QANA 4ER5A 3BZBA 5DSTA 1R00A 2O07A 3I9FA 2PT9A 4M37A 3U81A 3ELDA 2OB2A 1Q0TA 3BWMA 3O31A 3O7WA 4X63A 5DRTA 2IH4A 3RW9A 1NW6A 2NP6A 1O54A 3LKDA 1X1AA 3P9KA 3QOXA 4V0QA 5LQNA 2QYOA 2IGTA 3BKXA 3C3YA 1WXWA 1VIDA 3LDUA 4RVFA 4RTNA 4L7VA 4DCMA 2I7CA 2EJUA 2NXEA 1FP2A 2JHAA 4BLUA 1G55A 1SQGA 2WA1A 5DX8A 2XYRA 2Y1XA 1NW5A 2QRVA 1IXKA 3C6MA 3CJQA 3GRUA 3KQTA 3TFWA 1NW8A 5IKMA 5CVUA 1R8XA 5IH3A 4BLVA 1KYWA 4F84A 2BM9A 3JWHA 1SVUA 2PVCA 4C04A 4F86A 3G2OA 2BR3A 3LSTA 1RJGA 2AVNA 2K4MA 4XUDA 2GS9A 5ICCA 1JSZA 1QAQA 4FR0A 5GM2A 1ZGJA 1KPGA 2XVAA 4PINA 1AV6A 3I5UA 4BY9E 4GEKA 1RI4A 2VZ9A 3CJRA 3KQVA 3PB3A 2R3SA 2ZIGA 2OB1A 4BP3A 4Y2HA 3HVJA 1MHTA 1EQAA 1RJFA 2AR0A 2HNKA 5DX1A 5F2KA 4NECA 1JR4A 1QAOA 3KR1A 1X19A 4PYLA 3P2EA 4RYLA 3UFBA 2OO3A 5E1DA 3UJCA 5LQRA 4RTKA 3X0DA 3KQPA 4G56A 4GF5A 2AZTA 3G5LA 3LECA 3LCUA 3GRVA 4FZVA 2IDJA 3BWBA 4POOA 5LQJA 3P2IA 1FBNA 5LQUA 3ELWA 4KDCA 2QY6A 2GA9A 3CGGA 3JWJA 3MCTA 4HH4A 3KPVA 4U7PB 4QPNA 1N7JA 5LQKA 1YFJA 3GRRA 1P39A 5DPMA 3DXZA 5FULA 4XUEA 4QTUB 4PYJA 3NVMB 1TW2A 2P7HA 4HC4A 3SSNA 2IDKA 4DMGA 2GAFA 2PSSA 4QTTB 4PGHA 4IV8A 3OCJA 1R18A 5BW5A 5K05A 1DCTA 3HCBA 3TM5A 5DLYA 2PX2A 4PYKA 2EJTA 2HV9A 4E30A 5EVJA 5FWAA 5DM2A 3B3GA 4E70A 3KPWA 4Y30A 4FT4A 3ER9A 4GUAA 3M6UA 4HTFB 3M4XA 4X60A 3UJ6A 3KQSA 2BZGA 3KQYA 4RTRA 2P7IA 3EVEA 2BM8A 2YQZA 2P35A 3PX2A 3HCCA 3NW9A 1JG3A 2IIPA 1XDSA 3SXJA 5HEKA 3EVFA 1XCLA 3JWIA 2YUIA 3C0KA 3OE4A 4PCAA 2GPYA 3VC2A 2CWWA 2NXJA 3KHKA 5CD1A 3UJBA 3V8VA 5EC8A 3EVBA 3EGIA 2PX5A 2ZBQA 2FK8A 2FPOA 5E1BA 3FYDA 5EOVA 1SQFA 3TQSA 3UWPA 3DMHA 2Z6UA 5E1MA 2JG3A 5E2AA 2OXTA 5DWQA 3TRKA 5C9ZA 1L9KA 1NV9A 5ICFA 4V0RA 3OE5A 2AOUB 4B17A 4HG2A 4ER0A 3UJDA 3BGVA 2O57A 5H02A 5K01A 4RVHA 4WVLA 1VE3A 1L3IA 1R6AA 5E1OA 3FPEA 3P2KA 3OPNA 5DM4A 1UIRA 2ZZKA 5E2BA 3UJ8A 4AZSA 3CBGA 3DXXA 2NXCA 3B3JA 5LR6A 2E5WA 1BC5A 2PXXA 3SR4A 1ORHA 3BGIA 4RTPA 3LBYA 3SGLA 3MHTA 3GNLA 4O29A 4LECA 2H00A 3PX3A 4X61A 4YUZA 1INLA 1ORIA 5CIYA 4GOLD 4ZTBA 4AZVA 3E05A 3A7DA 5LQAA 1NE2A 4ER6A 2P41A 2PXCA 3OZTA 3R24A 2JHPA 2GB4A 3IV6A 4CKEA 3P8ZA 2ZULA 4R8RA 4AX8A 4C4AA 3DLIA 3MAGA 4MWZA 3IYLW 3M6VA 4QQNA 5E9QA 2V7EA 2VDVE 4C05A 5K0JA 5K09A 3ORHA 1PRYA 2CL5A 1EJ0A 4MHTA 4R8SA 2OZVA 4HRAA 2NYUA 3M70A 5GWXA 2GH1A 5EKXA 3HM2A 1F3LA 3GDHA 3KKZA 2YR0A 4FGZA 4A6DA 1UWVA 1KP9A 5G02A 5E9JA 4A6EA 5EMKA 5CVDA 5FHQA 2HR1A 1WXXA 3FPGA 1NBIA 3LDGA 4PIPA 5K0CA 2YXLA 3HVHA 3KQMA 2FYTA 1SG9A 3EGEA 3FUXA 4OA8A 5DXAA 5F2NA 5K0LA 4DA4A 2C7QA 5HILA 3SSOA 3A4TA 3DULA 4RSRA 3G88A 3THSA 2PLWA 5CCXA 3ERCA 1NKVA 5EZSA 1G38A 1EG2A 2ZZMA 3I53A 3TPZA 5LSAA 4RX1A 3D2LA 1NW3A 3LHDA 4MQ4A 5FCDA 1Y8CA 4YMHA 1JQDA 2C7RA 4P7JA 4RVGA 3PS9A 1AQIA 2IP2A 2G72A 4KW7A 3B3FA 4IKPA 3HTXA 4R6XA 5LQCA 4HTFA 4LG1A 2XVMA 5HZMA 4KDRA 3GGDA 5K0GA 4EVIA 2EG5A 4DZRA 3OFKA 2OY0A 3EPPA 2AOXA 1JTEA 2B78A 3Q87B 2ZIFA 1KPHA 2VS1A 2AOTB 1WS6A 1G6Q1 2ESRA 2ZVJA 1L3BA 4OQDA 3DUWA 1RI3A 5C1IA 3FTFA 2IH2A 3FUVA 2CMGA 4M7RA 5EIFA 5DXJA 3HCEA 3LGAA 5EMJA 5EGSA 3EVCA 3CJTA 3AXTA 3PLAE 3LBFA 5FA8A 1YFLA 5EEGA 5DRYA 5CM2Z 5DX0A 2JHCA 3A7EA 1SUIA 2EFJA 3GU3A 4Z2YA 3DH0A 2O0LA 5BW4A 5ICGA 3P9CA 1RI2A 2IFTA 3PFHA 3FZGA 5D1NA 4CTJA 4QDJA 3NJRA 5ICEA 2AOWA 1N7IA 4E32A 5EZQA 2PY6A 1B42A 1MJFA 1RJEA 4JXJA 2JJQA 3GJYA 2AOUA 5EHGA 2H11A 2Q41A 4RV9A 2ERCA 4IV0A 3FTEA 2B3TA 5FUBA 2DPMA 3CC8A 3GCZA 3LCCA 1VP3A 3PT9A 1KYZA 1HNNA 3P71T 2DULA 3ELUA 1NT2A 1P1BA 2JH9A 5EMLA 2AS0A 5FHRA 1DL5A 5E9WA 3K6RA 3G5TA 5GIOE 3WSTA 3SVZA 2G71A 2QE6A 3MTIA 3EMDA 4R05A 4PYMA 3AXSA 2UZ4A 3EEYA 5T64A 5GP1A 2ZIEA 3LCVB 4OX9Y 2PKWA 3PVCA 1JSXA 3VYWA 2B2CA 3H2BA 3KQWA 3T7RA 2QM3A 3UA4A 1JTFA 1RJDA 2KW5A 2FCAA 2YXDA 5B1SA 5CUQA 1TW3A 5HIKA 3E23A 2ORED 2UYOA 3R6TA 3V97A 4EMSA 3A27A 3FPJA 4YUWA 4RTOA 3UJ9A 4FS8A 4XUCA 3SSMA 5MHTA 5HIMA 3SX0A 2QRVB 4P7GA 4DCGA 2P3LA 1NBHA 4DF3A 5EIWA 5HIIA 3S68A 2FRXA 2OKCA 4HSGA 2ZWAA 2I9KA 1JG1A 3B7PA 3F4KA 1BHJA 3DMFA 4E2WA 5KQRA 4P58A 1D2GA 3NWBA 5HIJA 5E8JA 2LD4A 5ERGB 2ADMA 5EKUA 2VDUE 3L8DA 8MHTA 5BXYA 1WZNA 5EQJB 2PT6A 2BR4A 2PWPA 1IM8A 2OPBA 2YXEA 3KPYA 3M6XA 1EJ6A 3OZSA 1R8YA 4C06A 4EKGA 3G8AA 3UA3A 4ATNA 3B89A 3IHTA 3K0BA 3KQQA 3OU6A 3BWYA 1XJ5A 5T67A 5EPEA 4C07A 5DTRA 4PIMA 4E31A 3VC1A 2AVDA 3AWIA 1G8SA 3DMGA 4KVZA 3BGDA 3NVKI 2Z6AA 4EKIA 3THRA 2AOTA 3PTAA 3T7SA 3DP7A 4M38A 4E33A 5CCBA 5CVVA 3UBTA 5GINE 3GO4A 3G2MA 2ZFUA 4ER7A 4LWPA 3T7TA 3HEMA 4EK9A 4YUXA 3HVKA 4UOEA 4CKBA 2C7OA 2IH5A 3AJDA 1FJXA 3HCAA 2H1RA 1AF7A 1X1BA 4RVDA 1VL5A 4MIKA 4HGYA 3BUSA 1T43A 7MHTA 4PCLA 2ONYA 3LKZA 3GRYA 2O06A 2A14A 2P8JA 1N2XA 4PYIA 1KIAA 2PX4A 1BKYA 1XVAA 3DTNA 2UYCA 5DT2A 5KS2A 3TM4A 3GRZA 5HOQA 2ZBPA 5FQNA 2F8LA 1KHHA 1P1CA 4QPPA 3FPFA 3LPMA 2IBSA 5DM1A 3C6KA 5E8RA 3KQOA 1KR5A 1VLMA 1BOOA 2FK7A 5C0OE 4P7KA 5U4XA 3ER8A 3FRHA 3TKYA 3JWGA 2ZSUA 3EGVA 4P7FA
chains in the Genus database with same CATH superfamily
4Y9DA 1BE0A 2Q2NA 3UY4A 2YIJA 2ZJFA 4HB3A 1BEEA 3CQ9A 1XA4A 1GPYA 3K1JA 2ZIAA 2HRRA 1XR3A 4LNHA 2DWQA 3S4YA 4FCTA 3HACA 4GE3A 4R5MA 3MSCA 5JSZB 4JI3B 3AB3A 3LP8A 3RVSA 3O3MB 3LC1O 2WR8A 3A36A 2HMSA 4R41A 4QBIA 3SICE 2V5AA 3TNDA 2V7GA 4FLEA 4YQFA 1CDDA 1UJNA 3QXHA 4GMHA 4W1QA 1RM3A 2ZXFA 1MX3A 3KSUA 2O8FA 4KDFA 5FTJA 5DM0A 1ZM4A 1H6CA 1I9GA 2UZ0A 3QITA 1U9IA 7YASA 4F8YA 3KJQA 3TUIC 3KTDA 4WKCA 1TGVA 2HEGA 3ITDA 4QHTA 2ZUBA 3AEKB 3ICQB 1X2EA 2AN1A 1G2OA 2HTEA 3ZXSA 5EINA 3T5GA 2I6GA 3V5NA 1JDUA 2X3YA 1OU4A 5IWCA 1V7ZA 1O96B 3M89A 3IEPA 5IABA 4QYMA 2X0FA 2O8DA 3RJTA 2HDNB 2ONZA 5LXTF 3I37X 4B4OA 1F38A 4ARUA 2XQJA 5T6BA 1II9A 3MMXA 2BMFA 3H2SA 3GHYA 2J0UB 3BWVA 4KN6A 3P7MA 1CZKA 1DIHA 5TIIA 2VTKA 4OBEA 1HFKA 1OJLA 5G1NA 3K2EA 2J3IA 6PFKA 1NVKA 5FUXA 4HADA 2P5TB 3RU2A 4QUAA 4W8GA 1RYYA 2FEMA 5GZ6A 5TARA 1T5OA 2PS9A 4LYAA 4CL3A 4XWOA 4V1CB 2NVBA 5J2UB 2GASA 2QQFA 2DTEA 2QSZA 1YU9A 1K8XB 3U61B 3FCOA 4XDGA 2WG1A 2ZB3A 3IQZA 3OWOA 4DIUA 4R81A 3FCCA 3AVWA 3IIEA 5FADA 4ZCSA 2JATA 5JCOA 4E51A 5DHPA 1UKCA 1C9DB 2WUFA 4EY8A 2QRQA 3WNDA 3ZD9A 3NWEA 4Q1AA 4CLDA 2GSWA 5HMLA 5J5VA 1SUAA 4PWYA 4BIMA 1TPYA 3P26A 2YASA 4YP5A 1SC4A 5CVJA 4NCKA 2C4MA 3FTCA 1V6CA 3FTDA 3V3TA 4MROA 3D3EA 3ON5A 4AJEA 4JI5B 2GEUA 4DR2B 1XCJA 4AN0A 5FP0A 5H7XA 2DLDA 3C98A 2XGMA 2P11A 3O8BA 1DAPA 5WRFA 1NZJA 1QYRA 1OWLA 1U3FA 3QPVA 3OMLA 1TO1E 2JIBA 1JJAA 1TO2E 4NBNA 4HYTA 4QSHA 3TAXA 1LNSA 2AA3A 3AKEA 2LE0A 4V0MA 4Q9HA 3UGJA 5JMPA 1OXVA 3EARA 4QFCA 1QYCA 4GXTA 2DC1A 4Y67A 5LP6A 3CUWA 3T4XA 1JL3A 3OLVA 4X0EA 3G49A 3SMQA 2OHVA 4BLWA 1JHMA 1ZXLA 4BNGA 1ZCJA 5B1YA 2VP9A 3CX4A 2G1KA 1T0IA 2Q0SA 3GEIA 1DKQA 1HEIA 1GGNA 2GO1A 2JLCA 5CW1A 5CYPA 4JXZA 1Y7LA 1O95A 1Q16A 1ZIDA 4QFBA 3R3VA 3R9KA 1U7XA 2POQX 1L1EA 1MO5A 3UUFA 2Q4RA 2V5UA 3QPCA 5AM0A 1RXSA 1E58A 2EX4A 2IXDA 3H17A 4K6CA 3ZQ6A 1FJGB 5DHUA 2VPQA 2IHJA 3TEJA 4GG1A 3LBNA 1YI1A 2HMYB 3H7IA 4IAOA 3MCVA 3IKTA 1ODLA 2CDRA 4HGPA 4KMOA 2VBGA 4RNDB 3DDHA 4KKXB 1W34A 1KWKA 1N32B 3NT2A 1Z6ZA 4FEGA 1ZOLA 3SKXA 1OBOA 1CK4A 4ZVQA 4HEJA 1CZRA 1JSCA 2PMBA 2RAVA 4N7JA 1JQ3A 3EXFA 5GJWC 3G68A 3FPHA 2EX1A 1DFIA 2VDPB 3LX6A 2QP9X 3W9BA 7REQA 2DQ4A 3AHGA 4NONA 3PRKE 4QOGA 3DHWC 4TMKA 5DMXA 1RZUA 1Z3CA 2A7QA 2QTLA 4CF7A 4GYYA 1CEXA 3SYRA 1U0NA 4MZDA 4RE5A 1WNFA 2ZI9A 3L8CA 1OXSC 3TKLA 4HV4A 3K4PA 4XYLA 4U7JA 4TS4A 3OIFA 4GL4A 2W7TA 1DC8A 1LLCA 1ZJJA 5K3BA 4GE0A 3SQXA 4BFZA 2YJZA 1O6GA 4D4KA 2ZSAA 4B2IA 1RQPA 3G02A 2W2TA 1SCNE 2Q0QA 3M7IA 1U8ZA 5EZYB 1DIAA 3TFQA 4DJEC 4RJKA 4EKEA 4EL0A 1XALA 5BWCA 2XUQA 3G2HA 3MELA 1ZK4A 2N1BA 3ZWCA 1OX6A 4NMLA 2NXWA 3OJ0A 2VYND 4OV6B 2AC7A 4JBNA 5GQSA 3RIHA 1Q7BA 1QHSA 3WIEA 2ZT8A 1H0RA 4M9UA 2ZTVA 5T7BA 2Q1XA 1ZLYA 4D0NA 3C87A 3RRBA 2IS1A 3K0CA 1Z25A 2BEWA 4YLYA 4F84A 5HKBA 5C1BA 2QUAA 4DEVA 4HUTA 5JYEA 2C8JA 4OI0A 4HJXA 3CFYA 2WIFA 3D4BA 3Q8MA 3G85A 1OYWA 2V65A 2XVAA 3AL2A 1NN5A 2JCVA 3C1TA 1ZH0A 3E3OA 1E5TA 5AVJA 3EF1A 4FK8A 1O9BA 1RRFA 5FBHA 4A5OA 3HJAA 4DV3B 2CCKA 2EZ8A 3V8MA 5BPHA 1U99A 3F67A 1TVCA 1KZ9A 4PAGA 4TTTS 3VMFA 1KXJA 4CMEA 1LSUA 2FMTA 3FHCB 1CY2A 3WGKA 1MR3F 3HXQA 1KS9A 1NJ2A 1LS1A 1TU3A 2WQZA 1KAOA 4HH1A 4G8DA 4US2R 4EVSA 1QNLA 1F14A 1T1RA 4O4JB 5AXDA 5A5VA 2HJVA 3EMVA 1W88B 3LCUA 2PUEA 2I87A 3NT4A 4JWTA 3ZHQA 5C5IA 1TC2A 3GZTB 2HQRA 2A57A 3N2YA 1N7JA 3IFSA 1US8A 2OESA 4IH1A 5BSVA 1CNFA 1Z4QA 2IE8A 1EDOA 3C5WP 3GJRA 3A14A 4NZOA 4CKWB 3HCBA 3OT5A 1X9HA 3ECAA 2NU6A 2BZ1A 1U3UA 2CDBA 2C9YA 1LV7A 2PQ0A 4QOSA 4CKZA 4CV1A 1AKYA 3PSHA 1Q44A 3RC8A 2WFLA 3MXOA 5HKOA 3ITKA 2GJSA 3GG9A 5KNBH 3IE1A 4MRRA 5JASA 4OF4A 4DJFC 2D2IA 3VX3A 4P93A 3ZDQA 1CUBA 4MS3A 5J5CA 1LA2A 2A86A 4JYZA 5JMWA 5B4VA 3R74A 2WWIA 1EVJA 4P4SA 1A5TA 3I6MA 3OO1A 1KGDA 3O9MA 2Z2YA 2DTDA 5CD1A 4ARCA 2YS7A 3B2EA 1XN1A 4R84A 1WDMA 2QTNA 2OBMA 1T4CB 3I9MA 3U7FB 3MRSA 4N0DA 1BX3A 1HOXA 5A7HA 3IDAA 3QKRA 3R7WB 2VO1A 2P78A 2OGWA 4DIBA 3Q11A 4CLOB 4I19A 4YYZA 5ICFA 2IY8A 2HFKA 3ROTA 1Y7PA 2X2OA 3DAPA 3DKRA 3O3NB 4H6VA 4DNOA 2ZSBA 1NVWQ 2Q45A 1D07A 2NADA 3AERB 3LOUA 4RIHA 1XYGA 5DBOA 3I9V1 4DVJA 1QTQA 3PRJA 1CUSA 2OSVA 4YCJA 4FDUA 3I73A 3ZHCA 1U7DA 3OT1A 1P9WA 3GNLA 3JZDA 3NNSA 4O29A 4PLHA 4PO1A 4Q4AB 2ANBA 3ZK8A 3U80A 3T1HB 3E05A 5JG7A 1Y80A 4IHKA 4B48A 2P41A 3PHLA 1NJ1A 4M0KA 2GB4A 1MO2A 1U3VA 2B2XA 3DS8A 2QPTA 2H5JA 2XRYA 3IV6A 5J63A 3VNAA 1XEAA 4BX8A 1I14A 5GV7A 2P2LA 3OCUA 3ZI7A 3GVIA 1ISPA 2RJOA 2QNIA 4NG5A 3TGWA 1AU9A 5A4AA 1Y81A 2QE7A 2C5AA 4Q34A 4C2AA 3IX7A 4MHTA 1VLJA 4KE9A 1ZNZA 4UHFA 1U0GA 4HB2A 4G8BA 1FFYA 4C76A 8GPBA 2E2WA 2ZRPA 3V8QA 2VA9A 3G5UA 1N7GA 4GPTA 3AVXA 1HC7A 3OSUA 1KK1A 1NVAA 5JE8A 4K6KA 2FOIA 2R8EA 1TM3E 5CVDA 5FHQA 3UO8B 4AJHA 1H4QA 1XCGB 1FPMA 4AF6A 4ZDKA 2O5EA 2QHXA 2ZKLA 3TOCA 2PK3A 4YMIA 3I0ZA 3LT4A 4IKOA 4MV3A 5KVCA 4TUYF 4QXMA 4Q24A 5FR2A 1MJHA 1C14A 2WAXA 4U7HA 5CB4A 1OE0A 1SC9A 3I53A 3MRXA 4KLNA 5BV7A 1CR1A 1J07A 4IVNA 2JBAA 2JPDA 1W4ZA 1Y8CA 4LRTB 4IHJF 3TTYA 4BMPB 3WLHA 4FCVA 1KK3A 4GMKA 2GQ0A 2AN9A 3I6ZA 3EWIA 4MK4A 3ZWWA 1SOAA 2GKSA 5F7JA 2YWCA 3CTPA 2BE9A 1SCDA 1RBMA 1KPHA 4CIVA 3ANLA 4DC1A 1G6Q1 5C1IA 3R1IA 2UXBB 4Q1VA 4WZAE 1XKQA 4NZ9A 4XVCA 1GEEA 2NUAA 4A0SA 2P8SA 2JRLA 3BILA 3QG1A 5EGSA 3QKWA 4F9TA 3RU3A 1XCPA 3LBFA 5DX0A 3FETA 4Z9AA 2JC3A 2JL1A 1V5WA 4NENA 2PWBA 3V4SA 1UBKS 3E0XA 3LQYA 1IBSA 3FCEA 3Q41A 3WK4A 2CSXA 2QR2A 2ZDGA 5GVRA 1FK8A 3MM4A 5HGJA 4A2PA 2ACKA 1JJ7A 4CM8B 5K8UA 3BF7A 3EAFA 3L7AA 3HUEA 4QUIA 2B82A 2JJQA 1EFVB 3KP1A 1PGJA 3F71A 3ZV5A 4LOJA 1CRPA 1L8QA 4R8VA 2IY9A 2OV2A 2JW5A 1F0NA 1GCUA 4G1BA 3GJ4A 1VP3A 4LVUA 3BSSA 2P9GA 3PT9A 3P2JA 3WRYA 3TK1A 1ID1A 3A1VA 2C2MA 2NU9B 3RV4A 2HIMA 3ZZ0A 2V7UA 4KQCA 4RQAA 1U2PA 4NQZA 3EMDA 1J9ZA 5CR9A 2PFSA 1JBQA 2FZ4A 1Q0RA 2PGLA 1VBNA 1VG1A 1WMAA 2FR0A 2W90A 3QFHA 4OG2A 1W75A 5D3MA 1Q2XA 3RUCA 3SDZA 4EHFA 2FGJA 1WW8A 4A8TA 1MJ5A 3KTAB 3BMOB 4IJVA 1IBKB 2CV0A 2FCAA 1ECLA 2DMRA 5CFMA 3ZGVA 4D81A 1N2BA 2OBXA 4Y6OA 1KNXA 3TLYA 1Z56C 3WNVA 4EY6A 3KVNA 1U7ZA 3T9CA 3DO8A 3A2MA 3LA8A 1YK1A 1VBKA 3E70C 1U4NA 2CVFA 1LJUA 4TV9B 2QN8A 2FRXA 1DJMA 1USIA 3UB4A 2P9JA 4HOYA 5EPUA 3S2ZA 5KQRA 1GZ4A 1Z8DA 1RVDA 2XWBF 4HX5A 5HIJA 3RI3A 5JZBA 3H6HA 1L9XA 4LVCA 4PG7A 3WG9A 3ZW8A 4NAHA 1BN7A 4BRUA 2OAEA 4TV8B 5LU9A 5CYGA 2PT6A 5DTRA 2J1LA 3AFOA 3ISVA 5KX5A 5IT9A 2ZS7A 2O8DB 3OP4A 1A8UA 3TSCA 2QX7A 4MW1A 4FX5A 1J8MF 3E3LA 2OM6A 5C7YA 1E96A 1L6IA 1UKYA 3BX1A 4F8JA 2H59A 3V33A 4IOKA 1RWMA 3AF0A 4B6EA 2SECE 1J5XA 4S05A 1JVNA 1SCBA 3LZCA 1N6LA 3LRXA 3VR4A 1NI4A 2XWPA 3U7QA 2F90A 3BN3A 5E3JA 3WSWA 1Y8QB 1F12A 4MULA 1C3EA 4MYRA 4KQFA 5DN6A 1P9NA 3T7TA 1IYZA 1L2TA 3OFVA 2PZJA 5H4GA 4Q1DA 5SZHB 4EAAA 5KDLA 3UC5A 1NSYA 2J41A 2C7OA 3K15A 2GWHA 3AUJB 3CW2A 4G85A 3TB6A 1J49A 4AZ0A 1VL5A 3ND7A 3TI9A 4BEWA 3P9YA 4HD8A 1IOWA 2NUPB 3PYMA 2A14A 1KEKA 4ENTA 1H0SA 8AT1A 3D7LA 2WNSA 1IWPB 1J33A 1HRDA 4YCDA 5EXDA 1G42A 4PSKA 4UM9B 1TEHA 4EKNB 3DBLB 3BCHA 4K9KA 4MS4B 3TRFA 5GJVC 3PQ3A 3RBZA 1G5IA 5LVAA 2ECKA 5JSYA 1XZQA 3FPFA 1T0UA 2R7AA 1TA4A 3G1TA 3OTWA 4MYDA 5DM1A 3K4HA 3KYJB 4DDUA 1Z6TA 1G2QA 1VLMA 5IJZA 3OURA 1M6HA 2GPSA 4JODA 3GLIB 1ONBA 2XE8A 1C1XB 5IFKA 1FXSA 4MVJP 5E3IA 1NF2A 4KBFA 3JALB 1KSJA 2QG9A 4HDCA 3UH1A 3DP9A 5IPFA 3MUOA 3M6FA 1ARZA 3MWFA 4DJDC 2P1DA 4IJWA 4L78A 4KNYA 3M1IA 1BZYA 5ELXA 4WXHA 4ZYZA 3I4FA 1EXMA 2C8LA 2ZJZA 4GWKA 1QZXA 1T6YA 2PLAA 4JV5B 1RQRA 3U44B 4X7PA 4LJRA 2G1PA 3RRZA 4LIPD 1BRTA 2CYCA 2Y4NA 1SH7A 1PQUA 2P3SA 3AF3A 2QVBA 1JNXX 3T9FA 4AKTA 1TT7A 4M99A 4Y1RA 1CQIB 2JAOA 2MU1A 3K9WA 4JLAA 3THYA 4IW3B 1NN0A 2HWUA 5DDIP 1V1RB 1ZWKA 1AK2A 3HNOA 1NJ6A 2GA8A 3PFNA 4KAXA 4QBKA 2P9FA 5AOBA 1M8KA 2YIDA 5H3HA 4OJTA 1N5JA 2WV9A 4ERNA 1PW5A 4MH0R 2QN3A 1CZNA 4F91B 2CSUA 2P2CA 4GZ6A 2C9BA 4FZRA 3H9UA 3S81A 1HDIA 5DGXA 2Q6LA 2I8CA 1YR7A 2O5VA 2GAAA 3QVMA 4GYKA 3WGIA 2ET6A 2D2EA 2VJPA 2CLMB 4QBTA 1VCOA 1EX7A 2RK4A 5FLYA 1Q91A 1N5IA 1FP6A 3IKMB 2UVQA 5KSOA 1KBZA 2ZCVA 1TUBA 4KQIA 3FTNA 1QIHA 5BUSA 4IG4A 4P86A 3ESDA 3L8YA 4P33A 4MLDA 2FG6C 2VT7A 1FSFA 2BSXA 2P4UA 1JMYA 2WD7B 1EYZA 1TCAA 5B3AA 1PV2A 1OILA 4R9NA 4JT4A 2DY0A 4DR6B 3LHKA 4J3FA 3ZDRA 3NP9A 5EXSA 4DJ5X 4I5DA 3PD1A 3S5JA 2F3UA 4UNRA 2CUNA 4F38A 2RGNC 3TMKA 5JATA 2O2JA 2DT5A 1VC2A 5BT9A 1R8JA 4OJKA 4BP8A 2G9RA 3CNOA 3WBBA 4N6NA 3C7KA 4NMXB 3IO5A 1JAZA 1OTXA 1QMGA 3BMCA 4PYNA 2ZTUA 4LXYA 1M6YA 1Y5LA 4E5NA 3Q2KA 4MYUA 4RHCA 1QU3A 2PSEA 1IAVA 2AXNA 3BK7A 3VH3A 2CMFA 4V39A 1D4FA 1NYLA 5FI5A 3ZD8A 1YU6A 2GD0A 2X7XA 2ODAA 1QH0A 3CMCO 4N76A 3P5SA 4JY7A 3K53A 4XZ3A 1U8TA 1R0ZA 2W93A 4DE5A 2JASA 2X9LA 1Z74A 2ZRDA 4I6EA 1SQ0A 4EPRA 2B5OA 2G9ZA 3JQ9C 1M0WA 1JAHA 2EW8A 1WEKA 3CZPA 3NX4A 4FYXA 2F1JA 5MN5A 1AO0A 2FMFA 3FWYA 3LYUA 2LCQA 3GLHA 3W9UA 3PJRA 2GBLC 3BJZA 4P2GA 5H9VA 1N1EA 4R2KA 3OF5A 5DISB 1I7LA 2GZ2A 3RS7A 3MNFA 4NFSA 3KCQA 1XZBA 3JQFC 4P4GA 3KOYA 1SVMA 2FE4A 2RH8A 4BLTA 3RQIA 5CCEA 3OC6A 1GA6A 1L4NA 1T34A 1YH3A 2B4YA 3BCRA 1P9LA 3ZCXA 1G7CA 3T7JA 4YR7A 4DQLA 5C5DA 3A2KA 2A1UA 3SM3A 1E2QA 2I7TA 1A9YA 1Q0QA 2J45A 1JR3A 2TYSB 1T3ZA 2I2WA 1ULUA 3B20A 4ONEA 5EWMA 2FSIA 4XSHA 1BCRB 1Q5PA 1G5TA 4GOOD 3X2FA 1A69A 5EESA 3M2PA 2VPPA 2PLNA 3FKSA 1K3UB 5TQ0B 2C1ZA 2NU6B 5HKKD 1E94E 2XMDA 3GV0A 3B1XA 1YL7A 3IT0A 3P9IA 4CF6A 5J2UF 3A4MA 2J08A 4ND6A 4JLWA 5D1HA 1PVOA 2EBUA 4P5PA 5IUNC 3SQLA 2B25A 2QPLA 5ALSA 2ZSIA 4Q12A 2EWWA 3O4RA 4NULA 1NF9A 4LI0A 4BLSA 2YY5A 5B1IA 3DCIA 3IS3A 1M6NA 3O1IC 4MS3B 1JMKC 4LQCA 4D96A 3EPJA 1AG9A 4PXSA 3EVZA 3FW1A 1BDMA 4C5BA 5KOIA 1HL7A 4R3NA 2QJWA 3TZQA 1R0BA 1P3Y1 2C0CA 4P4SB 4Q21A 3VDRA 4BEBA 1IJKA 2ATIA 4E6PA 5DI3A 4Q16A 2JNWA 4F4UA 4DAEA 5CDGA 4K87A 1R00A 1VJCA 1NLFA 2NZJA 3LF2A 3BWMA 1NONA 4ZO8A 4J7UA 1QIJA 4OXYA 1QVWA 5DRTA 1E8DA 2ZE7A 3ONEA 2GZSA 3WNZA 3UAOA 1UBGA 1U65A 1TCBA 1T9HA 2J3LA 5LKRA 2GCOA 3C6QA 2FCRA 2VWHA 4GR9A 4DCSA 1ODJA 2AFVA 3QE0A 3WBJA 5LQNA 3G0HA 3HKEA 2J87A 4RSMA 4GECA 1JKXA 2GAIA 2G9VA 1Z2OX 3ORFA 3ZE8A 4G5GA 4OQNA 2ZVDA 2WZQA 1EH5A 4UHKA 3G3EA 3A2LA 3K7EA 5K3DA 2QUKA 5DHRA 1MQSA 1MABA 2ZE8A 2Y1FA 4BE9A 3V4RA 1DGQA 3GRUA 2HSEA 3KQTA 4I55A 1JAIA 2A9FA 2LWIA 3COVA 4GBMA 4O2LA 1LDNA 2BBWA 4WK0B 1Z5UA 4L8GA 5C18A 1JFRA 3BERA 3AR3A 2BR3A 3LSTA 4G1FA 1YB6A 2WMDA 3I9V6 3VU0A 1E3WA 2RIPA 3GZNA 4YAGA 3NBQA 1AK9A 3IVXA 4RGVA 5LL6P 5LZ4A 1ZGJA 3LX8A 4FKBA 3JCZA 4TZTA 2I71A 4MVJM 4KVGA 3QOYA 3OIYA 1XZLA 2HLDA 3CJRA 1OY1A 5EJ9A 4WNIA 2CCJA 3I12A 3DFMA 3HVJA 1KSGA 1R64A 4IO1A 1BIFA 4CM4B 1W1IA 2Z3WA 3ZC3A 5K45A 1QAOA 1GPKA 2ZJBA 3LM8A 4W82A 4AYWA 5BUZA 1L7MA 3ANMA 3AW8A 2O6HA 4GF5A 2WJPA 2C7BA 5B6IA 2JFXA 1DBPA 2C95A 2WTAA 1ZN8A 2HSDA 2P75A 3C8UA 2GPTA 4MAFA 1IM2A 5EGNA 1F8FA 3TAHA 2LTAA 4P3XA 3O82A 1E69A 1XZCA 1JDPA 2XRFA 2FSVA 1UKEA 2JLXA 1C4OA 3KNZA 3PCRB 1HT0A 3BSYA 3ZOKA 1K5PA 2PPLA 4CUZA 2FPSA 4NCIA 4DNFA 2EBHX 1TW2A 2P7HA 4HC4A 2V6BA 4MQBA 5BW5A 2JBAB 4IDOA 1SZCA 1LK0A 4F21A 1YR1A 4GI1A 4PX3A 5C53B 4MW9A 2XNJA 1YZYA 3IR7A 4P3KA 3ZHUA 4RDCA 1RAIA 4U02A 2Q3BA 1IY0A 1M1YA 1R4NB 5EZYF 3U3DA 4DADA 2AXEA 1AGRA 1TQDA 1J20A 1DFGA 2IZ7A 4BFXA 1KAGA 1R15A 4A0HA 2XKAA 2G63A 1ENOA 4DABA 2RC6A 4N48A 1C81A 3Q0EA 3VO1A 4D3SA 4KG7A 2Q7OE 2IEZA 4G3XA 2PO5A 4UKDA 2DRIA 3HCCA 3RBXA 4MZXA 3UENA 3MPUA 2NUAB 1XDSA 4K28A 5P21A 3ZK7A 1PL7A 2MCFA 1E20A 4M76B 4MX8A 4FFWA 3ETLA 1K8ZB 2NIPA 5IC5A 1KQOA 3Q7PA 4C0QC 2HN9A 3H1FA 4BXOA 1QDEA 1SK8A 5ESWA 3QVVA 4B2LA 4M0MA 2QZPA 3UWPA 3TQSA 3DMHA 3P0IA 1ZNWA 4E5UA 5A62A 4UM8B 4HMQA 3WNCA 2X0NA 3NDBB 2BMJA 2WWVD 3SC6A 1M34B 4HO1X 2G7MC 3TRDA 1ZK1A 3SYNA 4Q19A 4YCSA 3NATA 4O4JF 3GG2A 4UEQA 3CRZA 1WV0A 3DXXA 3JRWA 2OZLA 4EJSC 1Y4ZA 1G8JA 3KEOA 5BSWA 3NQ41 5J47A 3MHTA 1Q1NA 2CJXA 3CR3C 4C7OB 3BS4A 4X71A 4F7DA 4ZVNA 2QGFA 4RIFA 1WMSA 4MEAA 3A7DA 3KJXA 1KFEB 1NE2A 4Q00A 2PUTA 4V0LA 4WXRA 4DW8A 4EJFA 2CVZA 4P22A 1G1MA 4CKEA 5JSUA 3R8CA 4B76A 3I9JA 5CVCA 2DQKA 2R9VA 4CETA 1CE8B 3QXCA 4HQOA 1I8TA 4YT4A 3GELA 3ACBA 2E37A 4J6FA 8LDHA 3DZJA 1NSTA 1NBME 1CQWA 2VDVE 1C5KA 1XRLA 2XUIA 2O19A 2RHBA 4UMFA 3GLGA 2AR7A 4RPIA 4HRAA 3UVEA 3D59A 3L9WA 3M9WA 3DT8A 3WGGA 1PJBA 2FWIA 2O54A 3GFVA 4RK0A 3KKZA 1A88A 2FB9A 4YP1A 4WZ6A 2HY7A 2XT9A 2PYDA 4PU0A 1EXNA 2ZATA 2ZS8A 5E9JA 1IJFA 1V9SA 2B36A 3BHMA 3HKDA 1WXXA 1AKMA 1A82A 2QUIA 1RLOA 2R751 4OLAA 1JFFA 4E5PA 2LKDA 1SG9A 3SN6A 3PGXA 1L4KA 1J0XO 1U7WA 2V7BA 2A1TR 3GLSA 3N5CA 3A4TA 4HNQA 1F6DA 4I81A 4ZREA 5H4HA 3VOSA 3WKCA 3WQHA 4B7ZA 1IN5A 5G3YA 5JNLA 1TMGE 3ZV7A 5ABPA 1U28C 1FVXA 1F5NA 1V7QA 2BTOA 3ZDDA 4YMLA 4ZEWA 4D92A 1PZXA 4R5HA 3DEHA 1GFWA 3NBKA 2HSZA 3L6UA 1C7QA 1QFSA 2PU5A 1I5OA 4OMFG 2WWYA 1W8DA 3DBVO 1AC5A 1Q1QA 1Z6AA 3IBCA 4KWEA 4ZO6A 3TZBA 1CRZA 3LWDA 4L16A 4C6SA 3FHJA 5HZMA 2JI6A 1AMUA 1XEWY 4MR7B 3SQWA 2F43B 4QLOA 2NTVA 3RTAA 2Q3LA 3TR0A 3QUSA 2B78A 3B36A 4UU1A 1SUFA 2PBZA 3RHSA 3WWEA 3JQ6A 1RKVA 5LMNB 3EIOA 4L5AA 3B7GA 1LSOA 1MRZA 3I2KA 4HMOA 3U49A 3KB1A 2GHRA 4DIMA 4I50A 1P6XA 4LBVA 1KDZA 3VPGA 4YO8A 5JU6A 5E2IA 1JH8A 2HRZA 3RS8A 2FRVA 2OG1A 5HMMA 4KBGA 1CU1A 4RVOA 3I30X 5K0ZA 3K1AB 3S44A 5TDHA 4QGHA 5DM60 5ADWA 1YGYA 5HZKA 2NN3C 1AQNA 2CDCA 4ACAA 2G17A 2Q1TA 2X5OA 1JHZA 3N0VA 1CB7A 3IVAA 1NIJA 3OEWA 2F7SA 1M1UA 4ZV4A 2V55B 4Z4EA 3BE8A 4QO7A 2F4NA 2WLTA 2Z43A 2DKFA 3GIDA 2B3TA 4KNVA 4G84A 2NQTA 2Q1SA 3GUYA 3VR2D 2I1WA 3U4HA 1YXMA 1T5HX 1ZSYA 4AJ9A 3DF9A 2GSDA 2IKSA 2VJAA 3TRJA 4MQFA 3H2IA 5KKNB 2V9ZA 2N0SA 5L9AA 4KAFA 1I0LA 2LP4Y 2WTUA 5FHRA 2EZ9A 4Y2GA 1RZRA 1ZW1A 4DNXA 4H7FA 4Q0MA 1BNCA 3TZLA 2E3JA 2WJYA 1QGUB 2QE6A 5KQLA 2OAP1 4BNNA 4EWLA 3HXOA 3ZIAA 2QVZX 2SKEA 2DR2A 2XOEA 1FJHA 1VMDA 1O94C 1WIWA 3O92A 4IWXA 3WLPA 3BD7A 5J2TB 1P2GA 3VHQA 2O8NA 3D7KA 4JMLA 1PWEA 3OWHA 1LPMA 3OUZA 4KXVA 1M2GA 1OTHA 1N5RA 3HBJA 5F1KA 4AF7A 1L7PA 3ETJA 4NV1A 3TZHA 4FW9A 3V97A 4ZCMA 3FPJA 4JJ7A 3CWZA 2OOSA 4TXMA 5K51A 3ENWA 3NKVA 2NUBA 1KRHA 4B85A 1B16A 1BXRB 4J4HA 4WAUA 2P3LA 2VQ3A 3JD1A 3UGQA 4CG0A 5IWAB 1TI7A 1O6BA 4KYUA 2ZWAA 4MHSA 4DG8A 2I9KA 2GZMA 4N3AA 4S35A 2BTEA 1BHJA 3DMFA 3LS2A 3O95A 4P58A 4D0RA 3TG2A 4CMGA 4IDQA 2JCBA 4UHHA 4Q3AA 1Y89A 4R1LA 5I9IA 1KMHB 5EQJB 3TBKA 1JHVA 1QKIA 5BUQA 4B40A 1Y4AE 5JCOC 3K9QO 3VOTA 1GP2A 1PAUA 5KTYA 3M49A 1GYQA 4GI2A 3DC7A 4LHSA 5TPZD 3V8EA 1P81A 4C3VA 3GPIA 3UQYS 3DVQX 4I7EA 4R1TA 5EPEA 1SBHA 1R5JA 2PJZA 5ALDA 3CHYA 3B38A 3AG5A 2JIPA 5KWVA 1FFEA 4RF2A 4EPYA 2VJNA 5EJ7A 2CLSA 4ZVUA 5CW2A 1A9OA 2FP3A 4LWZA 4V3CA 5FPPA 4PLYA 4C3UA 1A9SA 2WFMA 3V32A 5C8XA 4EFNA 4OX9B 2JA2A 3A6DA 3F98A 1QORA 1J1UA 1BWSA 5FYDA 4WOBA 5IG2A 3EZGA 5B55A 2FN3A 5EQFA 4ED9A 2IH5A 1YRAA 4CR8A 3GFTA 2O4CA 2XGOA 3FDZB 2BCEA 2ZYUX 3Q7SA 1OWNA 3BUSA 3H87A 4D9BA 4I0WB 2P6PA 4FGLA 3RT1A 1E89A 3JD0A 1JKFA 2J7KA 1CS4C 2JJMA 3AOEA 4OEHA 1M33A 4FD2A 1Z83A 1CJSA 3KE9A 4AKEA 4EH1A 4WBNA 5C7OO 1P60A 4R98A 4PYIA 2HW8A 1ZIOA 2BHTA 1EA7A 2PX4A 3K16A 5AHRA 1CHNA 2YNMD 2HNBA 4C0HA 3TM4A 3VU3A 1MC8A 5FQNA 4OAQA 3KZMA 4LCEA 1K5GA 5LZ2A 4Q4JA 2NO4A 4TV9F 5E7MA 2P2GA 4ARBA 5INTA 4OB8A 2AEMA 2M6RA 3JZFA 4C0BA 3C3MA 1E62A 2OCGA 4MV6A 4Z53A 1EEHA 2AOVA 2B0JA 2H4YA 3PUYA 3Q8LA 3GLHB 1QU2A 2OD7A 3OH8A 2W6IA 1DQRA 3OFJA 1PFVA 4PRZA 1CUJA 3AI3A 2I8AA 4KV7A 2YH2A 4TV8F 2EFEB 2VF7A 1NVBA 1XEFA 1ZS9A 2ZWIA 1QLHA 1M2KA 5BV0A 1VKNA 4TS1A 3KYBA 1YV9A 4QAQA 5DK6A 5DN9A 1MB2A 1I1NA 4ALMA 1ONPA 5DGTA 4FFPA 3ZWPA 2DQYA 3OWXA 1XDWA 2DFTA 4OSEA 1B4DA 2A1TS 1NATA 3FLAA 5BR7A 1YVRA 9MHTA 5F33A 4MCJA 3QVJA 1WE2A 2NV2B 3WFJA 3D6AA 3HJCA 5CEFA 5KOHA 1DU4A 2J3EA 1H69A 1C3OB 4ZVSA 3OBIA 4FE7A 5ITSA 5JISA 5J3JA 4BQOA 2BSQA 1FYEA 1PBNA 1JXMA 1N5OX 5HOEA 3JQAD 3H5VA 2F9LA 4JHLA 1Z0IA 3IAXA 5BYJA 2JLRA 1AT1A 1TZKA 3OU2A 4FN5A 2EL9A 2FPRA 3IQDB 4L8VA 1V5EA 1NNI1 2J6CA 2Q4EA 3IA2A 2X42A 5JDCC 2WINI 1ZCAA 2RB4A 1WXGA 3KQUA 3SIRA 2GCNA 5B3KA 1E3LA 1LRKA 1MG5A 1P1JA 1UK9A 3NNNA 2JFUA 3ETHA 2J30A 4N6OA 4Z0NA 4D82A 4H31A 1ZHOA 1Z0FA 4O5AA 5BSGA 3Q85A 3LPDA 1K63A 1Z0KA 2Q9BA 2REOA 3N76A 4RD1A 2M6LA 2QJRA 5ED0A 5EXXA 1IXSB 2H4JA 1RPAA 1I4WA 1V41E 1GKLA 2GCOB 1X80A 1A9QA 1FQOA 3HWX1 1V96A 3NTVA 4ZQHA 5KVSA 3ROMA 5I7HA 3I64A 1AXGA 2QX4A 2VJOA 3V1MA 1NFRA 3ZU3A 4NCBA 1P61B 1XK7A 4CTKA 1U5AA 1CS0B 1J8VA 2C3UA 1G20E 4YACA 4I55B 1VMEA 2DWCA 1JE1A 3ZZUA 3MWKA 2BH2A 3I52A 1ZEJA 2J9XB 1B41A 2B92A 2O3JA 3BCUA 5CG1A 2W2XA 5E7JA 4FN4A 2K2QB 3PFGA 1TQHA 3NNDA 4MMZB 1QO0A 3ICPA 3VR6H 3AKZA 1QYIA 3MERA 3QX9A 3AIOA 1LPSA 1RM5A 1XT6A 2ZP1A 4WFJA 3RYIA 1HO3A 1RHKA 1SC1A 4B8YA 2Y99A 1NR1A 2B94A 2IX9A 4FU0A 4EENA 4RTQA 1VJRA 2ZBGA 4FFVA 2B99A 1JIQA 1GV1A 3KU4A 3P9RA 3ABQB 1WD5A 4YT5A 4BBJA 3I9NA 1RP1A 1L7AA 2CN1A 4MGEA 1TAGA 4F4IA 4P4NA 1EBBA 1G4HA 3MGBA 1TM5E 3DXYA 3T7IA 2H7CA 2ISSD 4DR7B 4FHDA 3TLAA 3B6JA 4X94A 4X24A 3G9UA 4OK5A 4DTCA 5NULA 4XIFA 4EG0A 3FBWA 5DI9A 3E1KA 1B0ZA 1PTJA 3GRKA 4PQEA 4TRRA 5TQJA 3ROPA 3EVAA 4P0QB 3RU7A 2DEUA 4B3FX 2I2BA 4R6WA 2FU5C 3LVFO 5K0NA 1N57A 2CNWD 4NS1A 3V2HA 3U17A 1CVLA 5TEVA 1M1YB 3CU5A 2V74B 3P9ZA 3SC3A 4PTZA 3W5BA 1H94A 1RD4A 1P19A 1UFOA 5JSKA 3ZQJA 5LU8A 2YXPX 2Z0MA 3NJ4A 3V8PA 3IP3A 4TMVA 3PQ4A 3DV9A 4YJHB 5DH9A 1EI9A 2FN8A 3HUDA 3BVPA 3SQNA 2Z6QA 5SYMA 4P98A 5B1DA 3DCJA 4B3JA 4TKVB 1N3LA 2XMBA 3SJ7A 2YDYA 2V6GA 4MAAA 1T24A 2AK2A 3ZJUA 2NZUG 1MOSA 3D02A 1GQ2A 2ZVPX 4KOAA 4TOIA 2R86A 3WMRA 1HFJA 4BXOB 2VATA 2QNRA 3AT1A 1GUAA 2WD9A 2X76A 3C6YA 5IUJC 3WHLA 1P9OA 2HGZA 1T5BA 1K9VF 1XRJA 2OHHA 4QGAA 5LN1A 2NP6A 2LDXA 1R0CA 1NBEA 4GZMA 3REGA 1K97A 3D4OA 4OB6A 1DLIA 2IYRA 1Z88A 3CT4A 3HG7A 1SVOA 2A8YA 1SZDA 3LDUA 4CLHA 5A06A 4DCMA 4DLAA 5HXAA 3IV7A 2W6OA 1ML4A 3E03A 2PZKA 5KNBD 3IMKA 5KAPA 1PDWA 2OCAA 3FOWA 1FVOA 5BMVB 5FDFA 3TX2A 4DUGD 1G21B 2XYRA 3PQ2A 4TVBA 3HYRA 5DX8A 1J7JA 5HCIA 2HSWA 3RBAA 3ZBUA 1Q21A 2AMYA 4R51A 5JECA 3GUVA 3J7AC 2ONCA 3ZHVA 1GFSA 2CDAA 2B83A 2F1OA 1ZGCA 2IEYA 3JWHA 5SYNA 3E6AA 3EYAA 4FZJA 4IX9A 4EUEA 1I2BA 3CO5A 3L4KA 4LC9A 2OXIA 4BMZA 3R5XA 1KQ3A 1YBMA 2P65A 1OFUA 1E18A 4TSFD 5AI8A 5GM2A 4ENRA 1G59A 1AV6A 4TN5A 1IQPA 3OTGA 1KR2A 5KOJB 1M72A 1RI4A 2DSNA 4AKHA 1OA1A 4DWVA 2VF4X 5LD2C 4H59A 1GL9B 1GA4A 4LKRA 1PLLA 4FYVA 3QVUA 1BXGA 4R8KA 5BW6B 4CIYA 2G4VA 4FYYA 5DX1A 5IZ4A 1UDRA 5ALEA 5F2KA 4OQMA 5BQPA 4RYLA 1ZEMA 4EW6A 4XX0A 4JR1A 4TLDA 4KTVE 1N0UA 4WZBE 3AIMA 3E18A 3R4CA 1NXTA 3DEYX 4GH5A 4Q9IA 3GDGA 3R7LA 1DCMA 2PFGA 1BYIA 5L53A 4Z99A 2PZBA 1Y3IA 3D0OA 4RF5A 5FBZA 3ZGLA 4CMCA 5F9FA 4ARZB 1P39A 1NYQA 1G9SA 2G04A 2G5CA 3AY6A 3DXZA 5GZ1A 4ZV7A 4Y2PA 1MB0A 4YAKA 1RXEA 2QPAA 1Z4KA 2PANA 3PXEA 4GLOA 4B83A 1KAMA 2AK3A 4HH3C 4P83A 1TD1A 2EJTA 1U7OA 3JV7A 3PQEA 3WGZA 4ZMBA 1C0KA 1LK5A 4Z4FA 1DIGA 2OFWA 2GYUA 4PAWA 5LYJB 3IOCA 1R6VA 4X60A 1Z0UA 1PF7E 4G23A 4PBTA 4DQXA 1M83A 4J7AA 5J4KA 2YQZA 3PX2A 1HA3A 1SIOA 3NEAA 3U60B 3CVYA 2V58A 3L5KA 5DV9A 2IHZA 4D79A 3QXXA 3FCAA 4OL9A 3E2PA 2PRYA 4ZGWA 1Z5NA 1FDTA 1E6UA 1DELA 2A5YB 2R84A 4RZHA 3ZDEA 3CSSA 2HXYA 3VC2A 5IT0A 3KHKA 3EF3A 4FQ5A 4HZUA 4MJ7A 1TNDA 3DMDA 3BFXA 4B3CA 4TS3A 2IYFA 4AUKA 1S5PA 1AZLA 2OZPA 2UXDB 1B7GO 1Z12A 3VZQA 2GI4A 3PNLA 5G0SA 1NUSA 1EFHA 1NV9A 2GZ3A 2BGUA 1AZTA 2CFSA 5L3SB 1DC5A 4B3IA 4PAOA 4B43A 3NS7A 4PAQA 6YASA 3Q7RA 2XTMA 4O25A 1DOZA 2XWQA 4X3OA 2X7JA 4A8JC 2OHXA 1VJDA 1Y34E 1LWOA 1AF4A 1EWRA 3DDCA 2WG2A 2UAGA 3VDMA 4YAWA 1AHHA 2HCTA 2O2DA 1XZIA 2IK8A 2W8BB 3FWHA 4PHTA 5A2GA 2X4DA 4OYRA 1ADCA 4HGRA 1KZGB 3P27A 2C84A 3OLCX 1FRQA 1YQEA 2ZULA 3TLKA 1YK0A 2E1RA 2W5UA 4MWZA 4BVKA 3BTUA 3M6VA 3LY9A 1RAGA 3KJIA 4FXPA 1GITA 1GY8A 3WL8A 4NE9A 2Z5GA 4LSZA 5A9TA 3SYKA 3QPWA 3ZE1B 1P74A 1ODTC 3M34A 4GSYA 1Z39A 4V38A 3Q2OA 1DV1A 3SSAA 1PDOA 4BEVA 5A1JA 1EFCA 1SUBA 5BQ3A 1S1CA 2IU4A 1QH1B 4N12A 1QTIA 5F4ZA 3PTZA 1E9EA 4FGZA 1MVOA 4ZI7B 3PG5A 1C2TA 2EJCA 3GGPA 5AK0A 3IA7A 1QTRA 2H4ZA 3LUGA 3LO8A 4YMTA 5I5EA 1JI0A 2C07A 2FPMA 2KS6A 3C3BA 5JCZA 4BATA 4D9GA 1OXTA 1G7RA 1RADA 1U2DA 2D3TA 3LWZA 3QLUC 4RH3A 3SG0A 4ZAVA 1S4QA 1XMVA 3NIWA 1S3FA 3G88A 1RZ3A 4TTRA 4DLVA 1JILA 5TF4A 2YNMC 2BFEA 1W19A 1FOEB 3OBBA 4UARA 2HDHA 3B2NA 5EP3A 4UM7A 2OVBA 4FFSA 3PQ5A 2ECPA 4DILA 5K8JB 2XE6A 3ZNPA 2VWGA 2XI4A 3BMXA 3EZYA 4NY1A 1LZLA 1H05A 1TZMA 2G80A 3O1HB 1IHXA 3G2NA 1IONA 4OGLA 4DDTA 1VXOA 4KDRA 3VV2A 3CIOA 1H2RS 3ZU5A 2ZIFA 1XTJA 4F9EA 4LJ9A 2HF8A 2PH3A 3L0CA 3OETA 4I4TA 4LOLA 4X3PA 4YI5A 3TZEA 3PICA 4RH1A 5EFOA 4YRBA 4FBMA 2O8EA 3D8TA 1E3TA 4BCDA 4Z1MD 2VZEA 1SXJE 2VF5X 1N2CB 1NPYA 4ZJZA 2EFJA 1DEHA 1NVTA 3C74A 4V0ME 1E2UA 2IFTA 4M6WA 2HF7A 3FZGA 1QH8B 4Z3OA 1KMQA 4EBBA 4P5DA 1SD5A 1MRNA 2FSGA 4X90A 3R0VA 5LOVB 1YMQA 5B4UA 2FMUA 3ECSA 5EHGA 1DC4A 3GUZA 4KIUA 4O4LB 2VLIA 5F7ZA 2WIBA 4JC5A 4YDSA 4R1SA 4EA6A 5B12A 1UC9A 1II0A 4OLJA 4AJIA 5C37A 3X1WA 2FKAA 4GVPA 4Q4JB 2QUBA 1DJLA 1V9LA 2FETA 1E3IA 2GHTA 2G9NA 3RVMA 4DA9A 5LPNA 2XGJA 3PNVA 2HMTA 3U7JA 4IHAA 3UT6A 4KODA 2Q5IA 1S2NA 2W0SA 2Z3ZA 1GSIA 3FOBA 4FINA 2VHTA 3PIRA 2R1VB 3CPEA 2KLBA 1NYTA 4MKZA 1KZHA 1Y5MA 1M7BA 4R05A 1XRNA 2GAJA 3ORYA 3EEYA 1C4KA 4F2DA 2QVLA 3K9NA 5DEIA 4I8XA 5LLTA 3HRKA 3HMQA 4AIRA 5FLXA 2XCOA 2AMJA 1PK8A 3SMVA 3T9EA 4EO4A 1ZJYA 3KQWA 3T7RA 4J0EA 3KJNA 4R1PA 4FS3A 1YTUA 5FBQB 3LU1A 3UA4A 4X92A 1K6IA 3AEXA 3DJFA 3GVXA 5D00A 1TW3A 4ABTA 2M2IA 2Q5FA 4ME6A 3C8DA 2V98A 5ALUA 4YAIA 1UJCA 4AUNA 3GC6A 4WD3A 4UEOA 3RVNA 5KINB 3ZBQA 2RK6A 5FI1B 1TYCA 4S1OA 2JFWA 1QQTA 2VYNA 3V4LA 2Q1YA 4FFBB 4JP8A 5LJIA 3DMRA 1RAAA 1Z34A 4RBNA 1QK5A 4PZUA 2JGFA 2HPAA 3W3AH 1G7TA 2HRQA 2PS0A 1QO7A 4C88A 4NL4H 1OWPA 4HF7A 5HQTA 4MKGA 3AR6A 4RFSA 4OYYA 3MQ4A 3VKHA 1GPNA 3GJ0A 4D41A 5IT5A 1XNRB 2ZB2A 1NF3A 2VSYA 2D7JA 2RARA 3E3MA 2NSJA 1XD2B 3GD7A 3KKEA 4L9WA 4KITB 5JIBA 4J75A 3WGYA 2D0DA 1CT9A 1GPH1 1IG3A 1QK3A 2WTEA 3ABSB 3NVDA 1VIYA 4BKQA 3KQQA 1M10A 1BX0A 3OU6A 1R6XA 4BFVA 3N2IA 2BFPA 4KAAA 1L5HA 2FQYA 1IZ9A 2PKQP 3ADCA 3A0UA 4G0VA 1P3DA 3PC2A 3AVQA 2SKCA 4ZP1A 5BW8A 1MW9X 1CZOA 4AJ4A 1XJ0A 3PV0A 3PFFA 3THRA 3VHRA 2NTJA 4BB5A 2OHOA 4H0CA 2ODEA 1JEAA 4AXXA 5BN3A 1P2TA 2B7CA 3EVNA 1NASA 1NHGA 4Y6SA 1DDIA 2CUKA 1OTYA 1RLMA 4FOPA 4DA6A 2CNNA 5IZCA 2JFHA 3C14C 3H1AA 3KDPA 4N7BA 2E4AA 4YECA 1CY0A 1RE0A 1HG1A 2HF9A 5J2TF 4ZKEA 5LM3A 3CVXA 2HA0A 3EMKA 4LUCA 2QR3A 2H4FA 4BLPA 1Z3IX 1YCGA 2P8JA 1ZM9A 3D3QA 3QBVA 3HLKA 4LF7B 1XMPA 1PR3A 2ANCA 4M1SA 2R60A 1D0SA 3RBVA 3UMSA 2CNDA 2OEPA 3W2HA 2GTIA 4QPPA 1Q7RA 2PHZA 3CW8X 4GRAA 4WN9A 4D6YA 3UUGA 4F4HA 4YJ3A 3PGVA 4W7SA 3RUPA 1UBMS 1YD7A 4EB8A 2ERXA 1QR6A 1H2FA 3HC7A 4ZODA 1KYTA 1F8XA 2QTWB 5EJ6A 5K3CA 1ES9A 1I4DD 1TLLA 3JQ9A 3JWGA 1ZRSA 2GKOA 1LZKA 2PSDA 2VLBA 1I33A 2GBLA 3E53A 1MEJA 3HRHA 3PYLA 4Q82A 2J3JA 4C7XA 3HSSA 4KAJA 3EEOA 4IGEA 3LMKA 3JQFA 5EIBD 4M60A 4ITRC 5CFRA 5DEOA 5DTMA 3RYTC 3ZQUA 3T1YB 3N86A 2NZYA 1E2MA 2QQ0A 2QOEA 2ZRFA 3HJUA 4DZTA 3ONDA 3KAQA 1I6LA 2ZROA 4OJMX 4UAVA 1RHQA 2PMFA 1WD7A 2YRFA 5HKLA 2E18A 2Y2UA 3R7FA 3FYCA 4WXPA 5L6MB 1E1CA 4ZC1A 3TIXB 1FRVA 4B32A 5IK2D 4DYVA 4B45A 2MSLA 2PUWA 4UU8A 4LZWA 3TDNA 1J2JA 3GFRA 4NNOA 3G7UA 1BAPA 1N5LA 4YP7A 4E1AA 2PWYA 1MA0A 2WAAA 1P0MA 1X42A 1XQXA 2FFJA 3UWDA 2XX3A 4E5YA 5EJ5A 4IMRA 4LHYA 1NULA 1P5RA 2W11A 5GGYA 3FOZA 3HABA 4JC4A 5JJKA 1R0KA 2XQIA 6CHYA 3T0IA 4ZIRA 1EWYA 1FYDA 1RLIA 2VCEA 1GDDA 4RZSA 4Q4HB 5IASA 1PL6A 2O2XA 3PITA 1YSCA 3GPDG 3O84A 2OYCA 3DE1X 2I67A 3C97A 2FP4A 3HA7A 5DNDA 5DSXA 2JGAA 2ZDHA 4CQMA 4UTRA 4J29A 3B48A 3HSKA 4ZOAA 4DM4A 5JTUA 1NFFA 3FPCA 5L6LB 2NNLD 2C4NA 5G0VA 1JEDA 4DMLA 4BNZA 1WKBA 2V45A 4MS1B 2PU7A 4CL0A 1ZVQA 2OUKA 1ZVVA 1JA9A 2BEKA 2V54A 3GCDA 3RFTA 1EUQA 3UBMA 2O3UA 2JLQA 1X15A 4FCWA 4ZAYA 4R1MA 3ZGNA 4M0EA 4ECEA 2A0XA 3G0GA 3DWIA 1XDZA 1BE6A 2R66A 4ZOLA 5B58C 2BELA 1H1DA 2BHLA 2BN4A 3E9EA 4OM7A 4ROSA 3I8SA 1ZKDA 4KFRA 1H85A 1GG2A 4JJEA 2BHSA 2R2GA 2YOGA 5KCZA 3AESB 3WL4A 1ZRHA 2PD6A 4EZBA 2C92A 1E3EA 1OC4A 1FUYB 1BWRA 1KEZA 2HK6A 2OXCA 2A9KA 2XGSA 3DAOA 1UPUA 5L7TA 2IDMA 3BA1A 3NXSA 3SLKA 4K03A 3BT7A 3VV3A 5F3WB 2I5PO 4P36A 3R9XB 1GTZA 4FDVA 1VPTA 1EJ2A 4WY8A 1G6HA 2EWVA 1JG7A 4Q1FA 4D4IA 1EB9A 2R87A 3IB3A 2ZJ3A 1K75A 1NUTA 2J3HA 1S8AA 1BXGB 4OHUA 3HY4A 1Z07A 2B1QA 4U6SA 3RSCA 4Q03A 4GC5A 3GJ3A 1YDEA 3KVRA 2FG7C 4I6GA 4W5RA 2HBZA 1MZPA 1YZLA 1DAMA 2MIIA 5T8KA 3OI7A 2XWSA 1UF9A 3EODA 2YXBA 3PJEA 4UATA 3UANA 4CGYA 3MQFA 2H48A 4C0WA 4BTEA 3G5MA 3RLFA 1X1CA 2G6TA 1Z7WA 4D5GA 4DREA 4GZLA 4P4LA 4WSOA 3VR4H 3SF8B 3OZVA 2AB0A 4D5EA 1N7HA 1Q19A 2V4UA 1CUFA 1M5TA 2BRUC 4MR9A 5FOQA 4OLHA 2YWHA 3RIEA 3SE0A 2OLEA 3ME5A 3RVPA 2E4WA 3CISA 3CWCA 4IEFB 5L7YA 3ZZ1A 5AVXA 1XMQB 3CRVA 3UJ7A 2IZOA 3NTUA 4BFYA 1XLTC 1ZSNA 4Q3DA 1N6PA 2XB8A 1NBMD 3BE6A 3M5DA 3ORQA 4BVFA 3OHSX 5C3UA 1BN6A 4ZT6A 3EUEA 1PVDA 2VNJA 4BAZA 1OB2A 5GGXA 2GHQA 5KZMB 2H17A 2EBFX 1H6BA 5FUVA 1EEXB 1RWQA 2AN4A 4I55F 5MGBA 3H8WA 1MNQA 5ALZA 3FWNA 2JIZD 3M83A 4F04A 3NHWA 5CH3A 4RZUA 4QG3A 3L0PA 2H16A 5HF5A 1YRWA 2AJTA 2FQXA 2Z9DA 4IS2A 3FVWA 4KPEC 1EMDA 4L4XA 3QSGA 1T8SA 2N42A 1UC5B 1Z8HA 3RYHB 2X13A 3GT7A 2GFIA 4IFIA 3LX4A 4X63A 4CFSA 1OAAA 3HM9A 1E1KA 1JT9A 1H1TA 1E1RD 3RS3A 3CF4G 1B0AA 2X14A 2BT4A 2GESA 2HXGA 2RK3A 2WHPB 4O4LA 1ZXBA 4KQ9A 3QGMA 2VXYA 4DGQA 1FXWF 2P9ZA 5EI5A 4M46A 5T57A 4TXJA 4YONB 1JVSA 1JEOA 3FWPA 2CK3D 3KYCB 1TGYA 3EEQA 3KVOA 4K3UA 1V95A 2O3RA 2XUDA 4QBFA 4A82A 4RTNA 1PK9A 4H3KB 2CC2A 3RFUA 1T1SA 2ZJ4A 3VM6A 2WA1A 4RZ3A 4PHGA 3F2VA 4JLSA 4EJSA 1NWCA 3LY5A 4R3UC 1ZL0A 3HYNA 4BLVA 2AUMA 1EM8A 2WP0A 4JBYA 5TMBA 3I0MA 3NU1A 3WWYA 1DVRA 4OTZA 2D1TA 3C1OA 3PVSA 4FNGA 4C6TA 4CIWA 1TA9A 5IFLA 3CZQA 2G09A 4IGAA 2BGIA 4R2HA 3IP8A 2ECOA 3IT1A 3O7MA 1EP2B 2ZXEA 2WIGA 3F9IA 4CCYA 1KFBB 3I5UA 1CF9A 4BY9E 1UMDB 4FBLA 4IUDS 3U37A 3JQBC 2DHRA 3H1TA 1A8PA 1Y3CE 1YJ5A 3PXDA 3PB3A 2ONJA 4GKKB 2WT8A 1VA4A 5B2EA 2OT3B 4WDQA 5GOTA 3MS7A 4JUBA 4R71A 4CKBB 1VJ5A 2ZE5A 5G53C 3PUVA 4RA9B 2CLKB 2IPLA 3LC0A 4MVJI 5IEJA 2FUCA 1HI9A 4DCVA 1PWYE 1V48A 3BMQB 4NV3A 2QW8A 4WOCA 3TQFA 1AUXA 3UCEA 4YRDA 2R1UA 4IXTA 3Q6NA 4Q7KA 3STYA 1P4AA 4ZOCA 2QXYA 1JH9A 3L77A 1MZVA 2Q2WA 5EIXA 4LMAA 5K1ZA 1GGEA 1M1NB 1OOEA 1U0SY 1AKTA 3HN6A 4AFNA 2FZWA 4ESVA 3UTDA 4AY6A 4PCVA 1KJYA 4OP3A 1U7TA 4NMMA 4KMSA 2ZT6A 1OWMA 3H0KA 1QP7A 1RWNA 1A2BA 3QYAA 3FN4A 1SXHA 3AFIA 2BEVA 3FMFA 2R2AA 3KEGA 1R5NA 2XW6A 5EP2A 1IN7A 4HN2A 1HE5A 4HDQB 4IDBA 4PGHA 4Q9KA 2VP6A 2WYHA 4N03A 3RVRA 4B3BA 5HZHA 5A05A 2OV6A 4E4YA 1DFHA 3AEYA 1EGMB 1FU4A 3TL3A 3WS7A 1V35A 4H1VA 1P3JA 3QMWA 4PG4A 3RB8A 4DMUB 3C7DB 4P84A 2Q62A 1SRQA 2E89A 1NUHA 1J2YA 3IMCA 1F4LA 1T4MA 5CLJA 1T26A 2CV1A 1F9EA 1THZA 2LPMA 3BTSA 5BMVF 3E22A 4LNUB 3HRIA 1W0JD 3D0QA 5AKYA 4RLHA 1JHPA 2NQ2C 3SIWA 2PGOA 4LJAA 4DSOA 3FOFC 4FYIA 3EVFA 3JWIA 2DOKA 3LUHA 1WOYA 3THXA 5JANA 4ZEOA 1WSAA 1XD9A 3HLYA 2EGGA 2MMCA 4F5WA 1J9EA 1I9CA 1XB2A 3UJBA 1QGDA 4ESHA 2YJNA 4PLWA 2QYHA 2JLWA 1DKRA 3AUFA 3QMPA 2VYVD 2PX5A 2OA0A 4PPGA 2I91A 1R1DA 3JQRA 4YIHA 3TCKA 1FFCA 5E1MA 2OXTA 2VSNA 1U1EA 1LPBB 5EXPA 1X8JA 3KSDO 3O4GA 3OE5A 2VDJA 1ZGHA 1VA5A 1V25A 4FHGA 2GYVA 4H17A 4BNYA 3VJMA 2WB2A 3R7DA 1VE3A 3RS0A 1DBRA 2D00A 5MGNA 3S0JA 1HUQA 1WCWA 2H4HA 4M8NE 1W4CA 2O1XA 4U1RA 4GGMX 3UW3A 5D87A 3E8MA 2VEDA 1KZ4A 3M4JA 2ZEJA 3JSXA 5AVQA 1S2MA 1WCV1 2AUTA 3LBYA 2VRWA 5AMXA 3VKVA 1U2SA 3L7KA 2QVGA 1FDUA 2JI9A 4K26A 4KIWA 5I8PA 5K4HA 1QFYA 2FJ0A 4GOLD 4L9SA 3ND9A 1GRCA 2ZIXB 5AKZA 4B6PA 4HDRA 8ADHA 4GBGA 2YZMA 3BZUA 1JQAA 1ACJA 2OXRA 3LZ6A 5E6SA 3ECCA 3ZEAA 3V1LA 3ZVMA 1PJRA 4KLCA 1PK7A 1O94A 1PYDA 3E0QA 2PKRA 3D1VA 2H92A 1CWUA 3WLJA 1B8OA 3T3GA 3TLMA 4ZYTA 2OYSA 2XSZD 2AI2A 4HXFB 4BS9A 5LYJF 1UFVA 2HK8A 5TVGA 1U6KA 1HE8B 5DVZA 1AB6A 4MMXB 4Q6WA 5JAIA 1F3LA 2IUTA 2R65A 3L6OO 5CLFA 2LKCA 3KO8A 4ISBA 4ZXPA 4A6EA 2HH9A 3OZDA 1D2AA 2AJBA 4HAXA 2D4HA 2OO5C 3BD8A 3HVHA 4BJHB 1XJQA 1SPXA 3I1FA 3L0SA 5DCUA 1RM4A 3EGEA 1SQSA 5G3ZA 1U3GA 2XB9A 3DBRA 5DW0A 4ZYWA 2BGKA 5HILA 1P1FA 1XHEA 4M21A 3ERCA 3JARB 2OL4A 3QLVC 2MSNA 2YY6A 1Y1KE 1OA0A 2YJGA 4PR0A 5K8LA 2J6HA 3IB6A 4B84A 1WV1A 3NH6A 1U2TA 2B35A 1F8YA 4YGYA 1GJRA 4YMHA 3VHXB 2WMNB 2F9MA 3RAFC 2KJQA 2C88A 2V0CA 2PM8A 3P2YA 4DKXA 2X1VA 4I4LA 2VH5R 4EMUA 3C48A 4OUDA 3IC5A 4RVUA 3WE7A 1GTVA 5FFFA 2NSLA 3U3ZA 1XYVA 2DPHA 3OM8A 1AKRA 5EHZA 1E0KA 3MWYW 5IDVA 5DZSA 1RIFA 4Q3OA 2YYAA 4CTMA 4OSPA 4LF5B 3WJ7A 3RTDA 3NHAA 1O2DA 4H1WA 5GVSA 4C01A 1LRJA 4GKBA 2BPOA 1KOJA 3HR7A 4YALA 3LGAA 5EIBC 3HCPA 5ESDA 1FTWA 4UHEA 4BB0A 2ZQZA 1XOIA 4ARAA 1TEVA 4BVJA 1SG6A 3GLFB 3BDAA 4MPRA 3V7NA 1QTNA 1CUZA 4XI9A 3KG2A 4K1XA 1LPNA 2FPPA 3FVTA 4L5JA 4V03A 5G41A 2ORIA 1YMUA 5D5PA 4DY4A 1RXIA 2P5UA 5AKIA 5KNLA 3WK6A 4AQDA 4QBGB 1N7IA 2DFPA 3AVOA 5IAJA 1PX2A 4RXTA 1YRLA 1SVLA 2PNFA 3DCNA 2JKYA 1PJCA 3EFOB 2UVPB 3A4IA 1T2UA 3LW7A 4FHZA 4D0GA 2CUZA 2X40A 3MMSA 1TD9A 4ND1A 1J90A 4RULA 5HF9A 2PMWB 3T41A 2V7PA 3VR1A 2W2KA 1ZVJA 1Y6QA 3V46A 3AJ9A 2B20A 1J0CA 1MEEA 2RAPA 3MBIA 4ZI7F 2GPJA 3NRJA 4ZJUA 2N1MA 2JEOA 4YH1A 4CZ2A 5HUJA 2XUKA 4XJVA 3ICWA 4CUKA 1Z6PA 4DJAA 4LZOA 1GZ5A 1D7OA 5E9WA 1I6WA 2H2AA 1MC4A 5IH7A 2GO7A 3KL4A 3KZVA 1WCIA 3SVZA 4BO2A 3L8MA 3H13A 1GXSA 3V00A 3LI2A 4AULA 5AFSA 6AT1A 1Z63A 2XLCA 1A4UA 2ZAOA 1ST3A 1CY6A 3U16A 1E0AA 4AY4A 4N9QA 1JQKA 1I3KA 2E4ZA 3LKVA 4WKGA 4DV5B 2PMKA 3A6JA 3EBPA 5JTTA 4CQLB 4PR3A 2ZYRA 2NV6A 2DH5A 2JJ1D 2X22A 3KT3A 3PDWA 1MGPA 3HUUA 5CT8A 3WIOA 2Y1DA 1YQ9A 4JEHA 1C30B 3CXRA 2COEA 3DTTA 4LF9B 5JZSA 2FDRA 3DAHA 1U0OC 1RW4A 3B78A 4HDNA 4MDHA 1NDUA 4Y2SA 3W5SA 4UQLA 5MHTA 3F96A 3N2ZB 3PYXA 1DX4A 1WWKA 1ZITA 2WUGA 2WP8J 1JDZA 4R2LA 2ZPUA 1HNWB 3N2LA 3CH7A 4BV2A 2QJFA 1IZ0A 2IYZA 4HSGA 4IIJB 1XC7A 1UJ2A 3EXEA 1I2DA 2O20A 3QJGA 2JBHA 1FYXA 4A15A 4ZVRA 4BX3A 2J5RA 1HLGA 3I2IA 1OZAA 4ZVLA 1DO0A 2SCUB 1KI4A 2CJPA 2WE7A 2FSFA 1BHSA 4BJ6A 4WNAB 1UZUA 2NVUA 1WZNA 1IZ7A 3V3KA 2OPBA 3KJGA 4P1ZA 4PZDA 3FVRA 4U2GA 4NJMA 3K31A 2HO5A 4XH9B 2BF7A 1R4MA 4MO9A 2ZR0A 2A4KA 5F1OA 1KK2A 4YWJA 5LOVF 1GGFA 3ZY2A 2FZKA 2CBXA 3GDOA 5GONA 1QFJA 1DOAA 4BO9A 4EO9A 5KWSA 2OCLA 3D81A 2Y77A 4XUGB 2RGDA 2Z04A 4HDMA 2X9VA 3ODPA 2NU7A 4QOIA 4AJJA 1H3NA 4AJLA 2QBYB 1P62B 3GZJA 1E9VA 1WO8A 1UBCA 3OIGA 4FUTA 3GNQA 3EH1A 3NHYA 2ORWA 4PG5A 4MVXA 3B6KA 4BJ5A 4KYTA 3IMEA 4H7DA 3VYTB 1DHTA 4IV5A 3AJDA 2ORYA 1R9JA 2H2DA 3VDNB 2R6AA 4XOUA 3L4JA 5HQ3A 2IS4A 1T43A 5CLLA 3ZBTA 4EQ6B 5ES3A 4B82A 4INJA 3UPDA 2LIVA 3WB0A 1RWKA 3E9YA 1WF6A 1L7DA 2F8SA 3COYA 3SAJA 2Y05A 4C0JA 4OHBA 3OJOA 5AW2A 2UYCA 4G41A 1G5FA 3DWGA 3EFHA 4PW0A 4UZEA 1DAHA 3HP1A 1WULS 3L1JA 4X1KB 4ICIA 5IAEA 1BU8A 3CKLA 1UJ5A 1N2JA 2XZDA 2CHEA 2JS7A 4RMIA 5D3ZA 4D9IA 2HA4A 2JIMA 3WBFA 2QEQA 3ETDA 1B74A 3OQBA 3SJBA 4GRIA 3OQ6A 1SA0B 1D6JA 2FR8A 2JK0A 3HYLA 2WI8A 4BRZA 4GSKA 4PE5B 2J0QA 1D2HA 2AYXA 2CXNA 4ZVPA 4CKCA 4DQ0A 5C35A 5L3QB 2W4QA 2D8AA 3P9NA 1CDOA 3NUZA 4O59O 1I10A 1ZMTA 4NXMB 2HT1A 1NR7A 2CLFB 4GMXA 3NZEA 4QT0A 2YMLA 3F6PA 2XOXA 3S1AA 3LPLA 2XZPA 1S2OA 4JU9A 3FVVA 3M6WA 1GZUA 2JHGA 3UMMA 3F5MA 1Q7CA 2QDKA 3CB4A 3H2ZA 4TSKA 5HS6A 4LRYA 2GBCA 4MR9B 3K9LA 4M89A 1JLRA 3BIWA 4CWAA 2AW5A 2UUAB 3CE6A 3QVOA 3OZRA 3R3XA 1U63A 2H3EA 4FI3C 4BYGA 4EQZA 3BA6A 4N6GA 3R7NA 1HE1C 2Z1DA 1EQUA 1VL8A 2QPOA 1XQ1A 5SYAA 4NZYA 1N36B 3C3DA 2CHQA 4KC0A 4MI6A 4RPGA 3OE7A 4QELA 5KYUA 3VPDA 5JXJA 4Z54A 3N2KA 3QUCA 2P3QA 2BEUB 4AWXA 2NO1A 5F23A 4BZQA 2IEGA 1TZCA 1H8HA 3OX2A 5FA5A 1BMFA 2R5WA 3AR2A 4C4OA 4KVAA 1QE5A 3JYQA 1C0IA 3R0ZA 2R4QA 1Q95A 2UDPA 3REOA 5JI2E 1LU9A 2QSYA 5DIZA 4CVNA 4E2FA 1MXHA 4FGJA 4DCNA 1PE0A 2WTXA 1NQAO 2B4RO 1WL8A 4TKUB 3NDRA 2PMEA 5H59A 4CGZA 2Y1CA 4DIEA 4BZXA 2HSJA 1FFAA 2GRJA 3GXOA 3KTFA 4HQKA 1TM4E 1OH6A 3KR9A 4CCWA 3H5AA 4YV2A 3OFND 3HB5X 3CURA 4NH0A 3VNVA 2RFLA 4MW5A 1LWNA 1YDMA 2B7BA 1PJ2A 1NY5A 2FHPA 2H1IA 3I9KA 2VSQA 1IY1A 1HT2E 1U31A 2WWTA 4BKPA 3IE2A 3DQQA 1ZL2A 5I6DA 1K88A 1Q1AA 2FKNA 2PX0A 4R68A 1P91A 1XELA 1GG8A 1O8CA 1RYBA 1V45E 2CXUA 3CW9A 3MOGA 4H7KA 4UAJA 4KXQA 4YJGB 4F12A 1M75A 2D1QA 4Y3UA 3GLGE 2R5NA 4FKMA 4EJSB 5LP1A 4JVSB 3WQSB 1LDMA 4BNWA 3FZEA 3KS9A 5AK5A 2PS1A 4WY2A 4XGKA 4BB9A 1FLAA 2IT1A 4KIGA 1VDMA 4YUVA 1AQJA 5EMMA 1M6EX 1JPUA 2W2PA 3G8DA 4C6TB 1FU7A 3EDRA 2A3RA 2JCXA 3GFQA 2QL5A 2UZAA 3TOZA 4EG7A 5HK8A 5IS2A 1YZTA 3BXOA 1CTQA 1Q1GA 1Y9AA 3PPVA 3UOWA 2Q3JA 4F1JA 1EFPA 2PJDA 1NFQA 4B75A 2Y1WA 2VFAA 4ID3A 3PJDA 2PV0A 3OZFA 4UCXA 4EABA 1R0WA 1ESDA 5CIWA 5ECDA 3W4KA 3Q9UA 2VF8A 3PFCA 3WIVA 2GFQA 4JOSA 3NHMA 4YUYA 3LKBA 4G0XA 4EUHA 4MUNA 1LK7A 1ONOA 3DM5A 2W6MA 4I9FA 1X8LA 2D2VA 3PENA 3FNBA 1FLNA 3JYOA 4BU1A 5BN4A 4RA6B 1C29B 1KVQA 1X8KA 1JEQB 2C82A 3I92A 1CZLA 4M0LA 2NO0A 3IEIA 4UBLA 4B34A 4BGDA 5I48A 5CFQA 3C7CB 1T4GA 4PGGA 3OHMA 2QAGC 1OLOA 2O05A 3JRXA 4J9VA 5DW3A 5AW6A 2FZEA 3DHNA 3EF0A 3V1NA 4FONA 4DL9A 2DGDA 2QTGA 2JH3A 2CDNA 5K3AA 2O5RA 1C4XA 1C3JA 1ZUNB 4M8LA 3IHWA 1DXOA 3F73A 2OQVA 2ZRGA 4MKXA 4CM9A 4XKJA 2DJ5A 3A25A 3W05A 1II8B 2IYLD 5JUWA 4I66A 4K86A 1EUDA 4K0KB 4YJDA 1X38A 3REQA 1VHQA 2BD0A 4HGZA 4D4JA 4LI3X 4Y6RA 2XNKA 3WNBA 3TN7A 1IY9A 4OBXA 1MIOA 3QY9A 4YMGA 2AC4A 1P31A 3LBAA 3ENZA 4KUHA 4PHCA 1I30A 3RK0A 3RO7A 4DDMA 3QEBZ 3WRXA 1PR0A 2CEAA 3GEMA 3THXB 2YUTA 3OP1A 3OCCA 4Y6GB 3KKQA 2HA5A 3TI7A 3TTVA 4HDKB 3WWCA 3OX4A 4MWCA 1RC1A 3IVGA 3FHOA 3WI7A 3ZTYA 2PT5A 3JY6A 5FOWA 4MDEA 2FOXA 1VG9B 2P6NA 4WA8A 1GNPA 3I9OA 4ZQIA 3K0AA 1SCUA 4D9NA 3KSBC 2H2GA 3RAJA 2RHWA 4CEIA 2DUJA 3O73A 4FILA 1YZUA 1UKZA 4ILKA 1GRQA 2JCSA 2RKWA 4N01A 4NDAA 5FT9A 3TLXA 2PGIA 4R16A 1SXQA 1W0CA 2PWAA 3KXLA 3NI2A 1B8PA 2R47A