4PYLA

Humanized rat comt in complex with sinefungin, mg2+, and tolcapone
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pylA00
1JTEA 5E8JA 4FGZA 1M6YA 1KPIA 4UOEA 3ELUA 2UZ4A 3PVCA 5DXJA 1PJZA 2G71A 3BZBA 2OYRA 1O54A 2P7IA 3EGVA 1R00A 5EIFA 3FUVA 4AUKA 3M33A 2IH4A 4X1OA 1NW8A 3KPWA 4A6EA 2PX5A 3M70A 4EKGA 3K0BA 1JQDA 2YXLA 4HTFA 5K0GA 3P9NA 1ORHA 1RI4A 5EHGA 4AZTA 2OO3A 1VBFA 3RODA 3G5TA 1UWVA 3GIWA 4ER7A 4BLWA 2YXEA 4QPNA 5K0FA 2AZTA 4NECA 1RI2A 4QTTB 3C6MA 4FT2A 5CVUA 3FTDA 2CKDA 4OQDA 2IDJA 4CXMA 5CUQA 9MHTA 3KQMA 3OU7A 1H1DA 1KHHA 1JSXA 5DTMA 2GAFA 4U7PB 1NW6A 3FPJA 3HEMA 2LD4A 4MHTA 5E2BA 3KPJA 1INLA 1BHJA 5DTRA 2WK1A 4EKIA 3LCUA 3GGDA 1RI3A 5GIPE 2O05A 2KW5A 3ELDA 4LWPA 5LSAA 2A14A 1XTPA 1FP1D 4EQZA 3C3PA 1X1AA 3PFHA 5U4XA 1EQAA 4HSGA 5ICFA 1R74A 1D2HA 5E9WA 2JJQA 4RYLA 2PX8A 3BGDA 3G89A 3S68A 1P1BA 5F2NA 1F38A 2AN3A 2YXDA 2IPXA 3HVKA 1XDSA 1YFJA 2VZ9A 4GOLD 1HNNA 4RVFA 2AN4A 4QQKA 4C05A 1XDZA 2I9KA 2OBFA 4HG2A 3FYDA 2ERCA 2YX1A 1L3CA 3TM5A 3BT7A 2PSSA 3UJBA 1YZ3A 3HP7A 4YV0A 3G2QA 4RX1A 2OB2A 3VC2A 3GO4A 1XXLA 3KQQA 2P40A 2OZVA 4HRAA 3THRA 1P91A 4RTLA 2NNWB 5C9ZA 5ICGA 3LCVB 4PCLA 3NVKI 2FK8A 2OB1A 4O29A 4RV9A 2ZIEA 2ZLBA 2NP6A 3FRHA 4ER0A 3PLAE 1JG3A 1VP9A 5FADA 5DPMA 3LDUA 2B2CA 2GPYA 3MHTA 2PT6A 3KHKA 2BR3A 5HIMA 1TW2A 3DH0A 1SUIA 3HVIA 3TQSA 3OZRA 4P7KA 5F2OA 4AZWA 3LDGA 3TLJA 3E8SA 3C3YA 3CC8A 4X41A 5HEKA 4E2WA 3A7DA 5D1NA 5P8WA 7MHTA 4E70A 3EVZA 1G38A 5T67A 3HCCA 4ISCA 4GC9A 4CKEA 2ZW9A 4QQNA 1NKVA 4YMGA 4PYNA 3CJTA 2UYCA 2BH2A 3ER8A 4QTUB 4PIMA 2P3LA 2AOUB 2GLUA 1YUBA 3TOSA 4CTKA 3ORHA 5EHIA 3HM2A 3OZTA 1JTFA 2HWKA 3I5UA 4A6DA 2YR0A 3GRYA 5HFJA 2XVAA 3B3GA 5DSXA 4F85A 1KIAA 2JHAA 1I9GA 3KQTA 5HIKA 5K0CA 1X19A 4KRGA 4P7JA 5EKXA 1EIZA 1RJDA 4RTRA 4Z2YA 4DZRA 3B7PA 2O0LA 5GWXA 2GB4A 4PIPA 5DM2A 3SSOA 3T0IA 3CGGA 3V97A 1VIDA 1EJ0A 4YV1A 3BUSA 2B3TA 3EPPA 5M5BA 1ZKDA 3BWCA 1WG8A 1WZNA 2FPOA 3A26A 3BGVA 3I58A 3LX6A 5DLYA 1T43A 2ZWVA 3KQYA 3TR6A 2PY6A 3RW9A 2JHPA 5FQOA 2GS9A 4C03A 3KR0A 4RTNA 3OZSA 3FZGA 5ICEA 2ZBQA 3CKKA 5K01A 3DMFA 4HTFB 5DXAA 5FA8A 2K4MA 4E2YA 4GC5A 2ZSUA 2IBTA 3TFWA 4QDKA 2B78A 5FWAA 3IYLW 4GUAA 5E1BA 3ID6C 5DRTA 1EG2A 1JQEA 4DM3A 2ZVJA 2BR5A 4PNEA 1YB2A 2C7OA 1B42A 3PX3A 3P2IA 4JXJA 2UYOA 3G7UA 2XYRA 2ZULA 3QOWA 1MHTA 1TPYA 3FTEA 1NW3A 2EJTA 3B5IA 4QDJA 5HIJA 4RTSA 4E30A 2AVNA 1YFLA 5FCDA 2FRXA 2YQZA 3HCDA 5E9JA 3TMAA 1R6AA 4HGZA 1SG9A 1ZHFA 1R18A 1XCLA 2NXCA 4MWZA 4PYLA 5C1IA 2O57A 5LQNA 2C7QA 2YUIA 5IH3A 1I4WA 5JUWA 1Q0TA 4RVGA 5FQNA 1RJFA 3EEYA 1WXWA 4YUWA 3M6XA 3LECA 4PCAA 5E1OA 5CIYA 4F84A 3BWYA 4RWZA 3QV2A 5EZSA 4CKCA 1R8XA 5CVEA 3UJ7A 3SXJA 5FWDA 5KYGA 3G2OA 3E23A 5DM1A 1IY9A 3GRUA 3BKXA 4GEKA 3NW9A 2PXXA 4V0RA 1BKYA 2DPMA 2DULA 1HMYA 3C6KA 4M36A 3HA7A 4OA5A 5CM2Z 2XBMA 4C4AA 4IV8A 4QPPA 3IV6A 3LPMA 4YUVA 3SGLA 1YZHA 3SMQA 5ERGB 2B9EA 3G8AA 3H2BA 3GRRA 3LBFA 3OCJA 4R05A 1KPHA 3A25A 1IM8A 4FZVA 5KS2A 4PYKA 2I7CA 1QZZA 3KU1A 1XCJA 1KYWA 1MJFA 5DM4A 3FPGA 4OX9Y 2AVDA 4X61A 3UA4A 1BC5A 3DUWA 1VL5A 4AZVA 1G55A 2IBSA 2QE6A 3AXSA 2O06A 3DXYA 4KW7A 4PYQA 5DWQA 3G2PA 2BM8A 3CBGA 4LECA 3M6VA 4MQ4A 4M38A 3UWPA 3TKYA 3MCTA 3KPUA 5EVJA 4PYIA 4PINA 2R6ZA 5JR3A 3PB3A 3NJRA 4GQBA 3X0DA 1Z3CA 5EMJA 3P2KA 3P97A 3WSTA 1NW5A 3DP7A 2F8LA 3MERA 3OFJA 1L9KA 2PGXA 1EAMA 1QAQA 3EVGA 4FP9A 4YV2A 4DA4A 3EVAA 2ZBRA 1G60A 5LQRA 5CCXA 2WA2A 4P7GA 1AF7A 5EIWA 5BXYA 4E2XA 1DCTA 3HVHA 3KPYA 1KP9A 3CCFA 5LR6A 2Z6QA 2HNKA 3A4TA 2BR4A 3B3JA 2H11A 3KKZA 5CVJA 2ADMA 5T64A 3OU6A 3CJRA 3NVMB 4BLUA 5MHTA 3KQWA 4KDRA 3HA3A 3TPZA 2NP7A 1NV9A 3LKDA 4IKPA 2AOWA 5EMKA 3SSNA 2NXNA 3UJCA 2IH5A 1FP2A 5EMMA 5KQRA 1X1CA 1NW7A 2HV9A 3PT9A 2JG3A 2OKCA 4PYJA 5DTQA 3LDFA 2AS0A 1QAMA 3UBTA 2IFTA 3BGIA 2ZIGA 2EG5A 1VLMA 3EVBA 5DX8A 2JH9A 3UFBA 3P71T 3EGIA 4PYOA 4CKBA 3GDHA 2ZZKA 3K6RA 3DTNA 4RTQA 5HILA 1QAOA 2I6GA 2PT9A 2PXAA 3EVFA 3UJAA 4F86A 3GCZA 3RIEA 2PXCA 3MTEA 2ZWAA 4YMHA 4GOND 5FUBA 4YUXA 2R3SA 5GM2A 2OXTA 5DM0A 4OA8A 1I1NA 1V39A 3EVEA 3KR2A 3UJ8A 5LQAA 2PX2A 2Y1WA 3I53A 4CTJA 1Q0SA 3DLCA 2OY0A 3OE5A 4RTMA 1WS6A 1EJ6A 4PGGA 2EX4A 4KWCA 5GIOE 5BP7A 4M37A 2EJUA 3FUWA 1N7JA 2ONZA 2ZTHA 3KR9A 3LL7A 4FR0A 4G56A 4M7RA 1SUSA 5H02A 1ZG3A 2PVCA 3P8ZA 2WA1A 2ZZNA 4V0QA 2IIPA 3TM4A 2ZCJA 1PRYA 5C0OE 2V74B 3SM3A 1R8YA 3G5LA 1O9HA 3AWIA 3UZUA 4XUCA 2Z6UA 2IDKA 2H1RA 2YVLA 4WXHA 1FJXA 5BW5A 5EEHA 3FYCA 4OQEA 2QM3A 3O4FA 3BWMA 1X1BA 3GNLA 2GA9A 1DL5A 4P7FA 2HTEA 3THSA 1YF3A 3NWBA 4KIGA 1NBIA 3ANXA 1NE2A 4RVDA 4C06A 3FTFA 3PFGA 5K0EA 3IHTA 3LGAA 3LSTA 5EMLA 5EZQA 4DF3A 2P35A 3MCZA 2UYHA 1U2ZA 2PX4A 3R0QA 3DXZA 4LWOA 1N2XA 3KQOA 1XDUA 3GRVA 4KVZA 1JG2A 3FTCA 4EMSA 3KQVA 2VDWA 4C07A 1ZQ9A 3O7WA 3GJYA 3BKWA 8MHTA 2G70A 5ICCA 3F4KA 4U7TB 5HIIA 3OE4A 4GBED 4H0NA 3VSEA 5K0LA 1IXKA 4DCMA 4MTLA 2AOXA 2QRVA 4FSDA 2QRVB 2Y1XA 5DT2A 2ZZMA 3FUUA 3ELWA 2AOTB 3JWJA 3QOXA 5G02A 3I9FA 1KYZA 5K05A 5E2AA 3JWIA 3P9IA 3REOA 5D1HA 5GP1A 3MB5A 4DKJA 5K03A 3AY0A 3IEIA 1WXXA 4C04A 4EK9A 4MIKA 3NMUF 4LG1A 3A27A 3O31A 3PS9A 3ER9A 5CCBA 3HCEA 2AOVA 5DX0A 4XUEA 1ZGJA 2JHCA 3JWGA 3LKZA 5K09A 2PKWA 2PWYA 3M4XA 2V7EA 2BZGA 3AXTA 2N47A 1P1CA 3V8VA 5KQSA 5CVVA 2IP2A 5K8VA 4C08A 5GOZA 1QYRA 2HR1A 2XVMA 2IGTA 3NTVA 4XUDA 1QANA 3PTAA 3R24A 3T7SA 4BY9E 3DR5A 1JSZA 2ZIFA 2H00A 3SR4A 5KVAA 2AR0A 3CJQA 4ER3A 4DMGA 4BLVA 3R3HA 5FHQA 3KR1A 4R8SA 2Z6AA 1NV8A 1M0EA 3DULA 2EFJA 5EPEA 1RJEA 1XVAA 1AV6A 4CWAA 5EC8A 4KDCA 3U81A 5BW4A 2CWWA 3T7RA 3R6TA 4R6WA 4E33A 4BP1A 3SSMA 1G8SA 2P41A 4IWNA 3GXOA 3PX2A 4K6MA 3KPVA 5K0BA 3FPHA 2CMHA 4E31A 1F3LA 4RSRA 1KR5A 3ME5A 1SQFA 3HCBA 3M6WA 5F2KA 3EEOA 3P2EA 4PWYA 3CVOA 5HOQA 3GWZA 2UYQA 3HNRA 2QY6A 3UJ6A 1FBNA 3EMBA 4ATNA 1G8AA 3GU3A 1G6Q1 1L1EA 2CL5A 5EKUA 3MGGA 4QVGA 5CVDA 5GM1A 4E2ZA 1AQIA 5EEGA 4RTKA 1UFKA 2B25A 3E7PA 4FS8A 4Y30A 3TKAA 4DCGA 1JG1A 2XYVA 3NDJA 4PYMA 3DMGA 2G1PA 1SVUA 1RJGA 1L3BA 1O9GA 4KIFA 5FA5A 3BWBA 2GH1A 3C0KA 3OPNA 4HGYA 4HH4A 5LQJA 3FPEA 2PLWA 3E05A 3VYWA 4XCXA 1AQJA 1SKMA 3M6UA 3I64A 2VS1A 1NBHA 4AX8A 2P3OA 3DXXA 4FSXA 1Y8CA 4HC4A 4EVIA 5LQUA 3R9XB 2G8NA 3JWHA 1RI1A 5E1MA 2FHPA 1X1DA 2P3QA 4YUYA 2C7PA 2NXEA 1ORIA 4B17A 2FYTA 4ER6A 1N7IA 1DUSA 3HA5A 2FCAA 3MQ2A 5HZMA 2AN5A 3D2LA 4BP3A 4YUZA 3G2MA 3MTIA 3KQSA 3Q7EA 3B89A 3KQPA 4R6XA 4RVHA 2ONYA 1L3IA 3UJDA 3UJ9A 1M6EX 5E1DA 1TW3A 1BOOA 3FRIA 5EGSA 2PWPA 1KXZA 1D2CA 1JR4A 1KPGA 1P39A 1VP3A 3B3FA 3EVDA 3P9KA 2Q41A 3Q87B 3BXOA 2VDUE 5DRYA 3EVCA 5K0NA 3ELYA 2FK7A 3HVJA 2P1DA 4FT4A 5DSTA 5B1SA 2P7HA 4RTPA 4IV0A 4X60A 2HMYB 3OFKA 4X63A 3LCCA 3EGEA 3NDIA 4ZTBA 4AZSA 2ESRA 2PBFA 2G72A 3T7TA 2P8JA 5GINE 5DX1A 3UA3A 3DLIA 1NT2A 1D2GA 2BM9A 2PJDA 3SVZA 5LQCA 2E5WA 5EQJB 3LHDA 2NYUA 1OR8A 1SQGA 1XJ5A 1JG4A 1WY7A 2O07A 5FTWA 3SX0A 4WVLA 5K0JA 3A7EA 4DQ0A 4QVKA 5EOVA 2IH2A 2YTZA 2ORED 1JQ3A 5E8RA 5T6BA 5LQKA 3HCAA 4RTJA 4OBWA 2VP3A 3HTXA 3DOUA 1VE3A 2VDVE 2OPBA 2NXJA 1UIRA 3HCFA 2PV0A 3MAGA 3OU2A 3P9CA 2CMGA 4GF5A 5FULA 5E9QA 4RTOA 2ZBPA 4P58A 3L8DA 3AJDA 4GOMD 2AOUA 4L7VA 3FPFA 5EG5A 3G8BA 5CD1A 10MHA 2AOTA 3DMHA 5FHRA 1RI5A 4GOOD 2XYQA 3FUTA 4ER5A 4OBXA 3LBYA 2C7RA 3VC1A 1VQ1A 3EMDA 3FUXA 4Y2HA 4POOA 3NWEA 4R8RA 2JH8A 3GRZA 4E32A 5IKMA 4PONA 3ERCA 2I62A 1ZGAA 2QYOA 3G88A 4PGHA 1FPQA 2ZFUA 3TRKA 1VPTA
chains in the Genus database with same CATH superfamily
3P0RA 2QN7A 1KPIA 1QYIA 1BMFD 3SIWA 2ZR7A 1ZCZA 3GEGA 1E0DA 3KUCA 3MUEA 5FNVB 4EARA 4DV0B 4BV8A 1N5MA 3K9HA 1H4TA 4OMFG 3B12A 3NPMA 2I1LA 3GPIA 3HRHA 3TQQA 3VU0A 1JVBA 1XXHE 1KEKA 5A9TA 1VRCA 4EI2A 9LDBA 3QEMA 3VI3B 3VPAA 2PDAA 3JQRA 1VFNA 2P2LA 4KQIA 2PYIA 1LK0A 5DYGA 5CLJA 4Q3DA 1T8YA 1NSYA 1RYZA 2BFBB 721PA 3O7MA 1UWVA 3JQBA 5CLHA 3CT6A 5IDWA 4F6RA 3IVXA 1SQ0A 4C7BA 1RI2A 2BSQA 5E3IA 2HLDD 4H17A 5IJ0A 2HU8A 4R3NA 2Y1GA 1YRBA 9MHTA 1PYOA 3QTTA 4JKOA 4QBTA 4ZOCA 4YPVA 3P9RA 4FGKA 2QGFA 3AFHA 2OMKA 1O2DA 3KD3A 2J85A 4NC9A 5D51S 3CR7A 1UAGA 4U5QA 3IDAA 1VTKA 5D3KA 5EIBC 4GMHA 1L9XA 3GY0A 5DTRA 3ZLUA 3V7YA 3QU9A 1QX3A 4EELA 4HUTA 4NV0A 2AE2A 5GIPE 2KW5A 1F4PA 2J9FB 2Q2OA 4WKNA 3WV4A 4AJIA 5IZCC 1X1SA 3AKYA 3TGPA 3U2QA 1E61A 3RRFA 4EKDA 4RF2A 5FV4A 4PG4A 3INNA 3ML1A 5FT9A 1W1UA 3HKDB 1A2KC 1E9EA 2HF7A 3NM4A 5L4LA 2B35A 1TB4A 4F2GA 2X7HA 1GO2A 3B9PA 3KVNA 4KOEC 3K09C 5C1PA 5AK0A 3TRJA 2HB6A 4EJ6A 1CY1A 2ZSBA 4J0JA 1QV7A 4X6UA 3UATA 2WJ3A 1F14A 3D6UA 2I9KA 3OMLA 1EBFA 4G1FA 1V4VA 3VPSA 4RK0A 1F3OA 2QD4A 1FYWA 3P2YA 1UZUA 4MUMA 3WYBA 1SOWA 1XMXA 4YV0A 3HP7A 3K5IA 3OKAA 1JP7A 2ZYTX 3IDSA 5IKEA 5IJWA 1WDMA 4NBWA 1U1FA 1E7RA 3HR8A 5KKAA 3U80A 5I7AA 3VC2A 4HVTA 3SJBA 5JAPA 1C4XA 2OAQ1 4K6KA 5CYGA 3GJZA 4W9RA 3X1WA 2O5EA 2XCSB 2G0NA 4JQCA 1I7DA 2PK3A 4R2WA 1F48A 2VPIA 1TM3E 3L4EA 1E5LA 3HYSA 2VAVA 3GOHA 4DMCA 3A9WA 4OL9A 4WXEA 3GH3A 4H60A 2XYPA 3TE6A 2Z57A 2IEYA 4F8YA 3VZCA 1NQAO 4X93A 3CW9A 2JD0A 3KZKA 3AEXA 3E8SA 4X41A 1K8ZB 2PMFA 4Q7JB 3UY4A 3QMWA 5TQ0A 3ASZA 1PR6A 2B99A 4Z4HA 1XK7A 5T67A 2FPWA 1GGNA 3GLQA 5DYYA 3SYLA 4CR8A 2L82A 5C7LO 2GHTA 4JXKA 4D9EA 3IJRA 5BSFA 5AW6A 1A76A 1IN4A 1TM7E 1YQGA 1C80A 4AMGA 4KVAA 2QVCA 2EF0A 4UXHA 5F23A 4W5TA 3CRRA 4DREA 1KI3A 3I5UA 4R01A 4YT4A 5FBLB 2VKQA 2QAGC 3N0VA 4LJ7A 3L0SA 1I10A 3T0GA 4D02A 3DEIA 4OUDB 3I8XA 3ZK9A 2VXYA 1KAOA 2BHNA 3UOWA 4HDMA 1YGYA 3FWZA 3N70A 1RLOA 1TT7A 2Y9PB 4MGKR 5HG0A 3RE1A 4BWVA 1R5NA 4WY2A 1KZ6A 3SS8A 2O19A 4J76A 1NQWA 3VJLA 4YTEA 2JANA 1N2CB 1XEWX 3BB4A 3P1JA 1NVTA 4TVOA 1C3VA 5SY9A 3S2FA 4FZRA 2WUGA 3RSQA 3T5GA 4ND4A 1V37A 1K75A 1YK0A 2ZWVA 5CNMA 5CP8A 3COZA 5B3AA 3LZCA 3T38A 4BVLA 1CNMA 4QD3A 2N1MA 1GTVA 1YFZA 3E1KA 4G1CA 4RS4A 1II9A 2V0CA 3PEVA 1T1JA 4J16C 2CYCA 3DB1A 4QJ4A 1SZDA 4LWQA 3AY7A 3W0LB 4Q19A 1Z63A 3WNVA 3H9EO 3L1JA 1XK6A 2ZP1A 3T3MB 1I2CA 3HKBA 3DL0A 1DZ3A 3LOQA 2A58A 2ICAA 3BA6A 1JH8A 2OBMA 1U3UA 1XXHA 2QAGB 4F3KA 5BR4A 2XE7A 2AFIE 2ZBEA 3GG2A 4M0DA 5CIWA 1T34A 1XZCA 3PG5A 1EM8A 1B42A 1MHPA 1RR6A 3T7AA 1XQWA 3OX2A 1WTCA 1K5PA 4EW1A 1TPYA 4JJ8A 1E96A 3OOJA 5JQGA 2MR6A 4JEHA 4S2UA 2PQMA 2AVNA 1OLXB 1H3NA 4OTZA 3T9EA 3VR5D 1OVGA 4PYLA 3CF4G 1OXUA 4MWZA 3U0VA 5BNFA 2OM6A 4W8OA 3FWKA 3V4RA 1Q0TA 2ACVA 2QP4A 3L0DA 4G8BA 1RJFA 1Z18A 1KF0A 4WSOA 1AHNA 2IT1A 4FNGA 5IT4A 3CKYA 5IABA 1C8KA 3NRCA 4FC6A 4PLFA 5DNAA 1A9OA 5C51B 1B74A 1KK3A 3WLTA 4ZHQA 4UUNA 5FWDA 1DLIA 2PX0A 4F5ZA 3D3WB 3RJ9A 2L19A 1TE2A 4F72A 1EFKA 4O0MA 2GRAA 2YJ5A 1L5HB 4H6PA 4TUYF 3ROTA 3QGMA 2ODEA 1ZD2P 2PM8A 1WJGA 3OWXA 3VNAA 5JNSA 1WSWA 2EU8A 3FDZA 3GFOA 4UAVA 5EUQB 1JX6A 2ZB3A 4FW9A 3G8YA 5FUMA 2R66A 4OU4A 4D9GA 3BXEA 2QG6A 5A3VA 2NUAB 1ACLA 2DOKA 1YR2A 2QPTA 2YXPX 3CTMA 4MWTA 2OYCA 1GCUA 1JJVA 2ZCUA 4PSCA 1KY2A 5GV7A 1DS6A 5A2QA 5KTTA 4FSHA 1MJFA 3FPGA 4QFDA 2JFNA 1UXKA 2JIBA 5HUJA 1V9SA 3UA4A 1E2GA 2P4SA 3S6JA 3ZVMA 1REQA 1I7NA 2Y77A 3GBSA 2XB2A 4EG0A 1YCGA 4MRRA 4ZO7A 4JBYA 1W5AA 4LXGA 3P26A 1F1JA 3EIOA 3S99A 5IPFA 2XOKD 3JATB 5HZHA 5KTRA 1FIUA 2BGMA 4O4IF 3K70C 4E22A 4TXMA 4NFSA 1NW5A 1T8WA 3CUKA 3H2YA 3HSKA 3OFJA 4FIDA 4XSHA 3SLKA 1LQ2A 3UB2A 4Z4CA 3EVGA 1O87A 3DE0X 3QTBA 4YQZA 4HWPA 5HRAA 3PX7A 1H66A 2LDXA 2JGKA 4C0AC 3RU2A 4BJHB 2JC3A 2RK6A 1ESDA 2HMWA 1NE7A 2OE2A 3KPYA 4Q4DA 1TK3A 1XIVA 4F45A 4ALLA 3H4MA 4K6GA 2IOHA 3CH4B 3HY4A 4ZYLA 4QEZA 1DC3A 4IKPA 2NVUA 3VO9A 5I4CA 2ZRBA 3FJ1A 4TV8A 5C7YA 1RXWA 4HP8A 2PMKA 2WEKA 1JR3D 1WKVA 2TMDA 4ND2A 2C84A 1LRLA 4DSZA 1E4VA 1UWLA 2X1VA 2AQKA 1Y63A 3MG9A 4F4IA 2FZ4A 1JA1A 2JHGA 3G2IA 5HILA 1LC3A 1IH8A 2FKAA 1Y7PA 3I6BA 1TF5A 3MCWA 3BDAA 3AWDA 2ISCA 4L15A 1PYGA 3ZJYA 2J67A 1YVDA 3QKIA 2IW1A 3FNIA 1WP4A 2XJ9A 3O94A 4WERA 1HT1E 4Z54A 3FZYA 5JAHA 1EZZA 1Q0SA 4FE7A 4PGGA 4PPQA 4Q9NA 1YHNA 3A4LA 1AS0A 5CLQA 2VLIA 1H05A 3IT1A 2ONZA 2ZTHA 1JS1X 3AHEA 2NTJA 3JQGB 4HDOB 3UHFA 2ZVQX 4UM5A 3QA3E 3O8BA 3ORYA 2I99A 3QA9A 1N32B 1GJRA 4O4HA 1C0IA 3ZZUA 1YIAA 3ZD8A 3CNLA 4A0QA 5K6RA 1VRVA 4GP9A 1WDWB 3SR0A 1O9HA 4JOQA 4QAQA 1NHGA 3EQ2A 3IE2A 5JSHA 3DL4A 2VPYA 4JMLA 2P11A 3NHJA 3T1HB 2A8YA 3RBZA 1LNSA 4PXAA 1WCIA 1L1QA 4TOIA 4US2R 4N7MA 1CU1A 1L4LA 4RVDA 3DAGA 5ES3A 3MT7A 1E89A 1OI4A 2P35A 5DASA 3HK2A 2O8CB 1O6FA 5FUXA 3E3LA 3E22A 1P18A 3HYLA 1D0VA 4YN3A 3KQOA 2PMWB 3R0JA 1TLLA 1NC3A 4QT0A 3FTCA 1OROA 4DSOA 3K5PA 3Q2IA 1QQTA 1QJCA 5EIBD 3IIEA 2W93A 1K08A 4I6GA 2H54A 1I3KA 2JJ8A 3GCGA 3IJ5A 4EG4A 5AHKA 3IDFA 1F6WA 3V1MA 3KYCB 4HO1X 2OV8A 1TYBE 1I2ZA 1PL6A 1RQRA 2J9RA 2PUHA 4X1KB 1H2EA 4RIIA 1N8SA 3L07A 3QOFA 2D2XA 1C2YA 4D92A 5A62A 1UKEA 3ACDA 1IL0A 1ZK4A 1SHZA 4YRDA 5HUHA 5I51A 2YRXA 3A8TA 4JJFA 2J33A 3O31A 3AR6A 1G8HA 3ZTWA 4DBZA 3L9XA 5CU7A 2EW8A 3L40A 3LBNA 2WD7B 4URYR 2NT3A 4JSYA 1I30A 2XZTA 4X6YA 4DAEA 3ZWKA 1SC6A 1DEAA 1U8EA 1T4MA 5A05A 3A6EA 3BSYA 3VZSA 4OQ4A 3R7FA 2MINB 2BTEA 1XDGA 2EWMA 1J2TA 1QGDA 221PA 2VA9A 3BL5A 5GOZA 3TZKA 1BH2A 2XADA 5G3YA 2CHUA 3RYHB 5KSZA 3OESA 5U4QA 3TLZA 3FMIA 1OA0A 2W00A 4N9QA 1DTSA 5IP5A 4DMGA 3R6WA 4EPYA 4YT2A 2GXAA 2N75A 2SCUA 3NONA 3IQIX 4JFRA 1UBGA 3IUQA 1PT8A 4Q3KA 3T6KA 3WGGA 4HX9A 2IXBA 1V11A 3R77A 5HUQA 4IOJA 4EW3A 4D74A 1N2CA 1SB8A 2G36A 2VF5X 4TVKA 1R7RA 3JZMA 5BRAA 3SSMA 8GPBA 3R5JA 1A7UA 1M54A 5DNVA 2HWXA 1QK3A 3MIIA 3BH0A 2PTHA 1F3LA 2C2WA 4WH0A 5JSFA 1T1GA 3FMFA 4MQMA 3VBEA 4B3XA 2FFAA 2UU9B 1YRHA 2P2CA 4XJVA 5BOVA 1LPMA 4WUTA 1AUPA 4LOLA 4Q4JA 3FZNA 3AM4A 3UUWA 2JJMA 2HIGA 1Z34A 1EVLA 4G97A 2P65A 2ZITA 4PC3A 2AN1A 3QXCA 2AXNA 3KDPA 1DEOA 4FS8A 4B40A 4Y30A 4EENA 4PYMA 2B3DA 1OBOA 4EL0A 1U6KA 1JLLB 4P53A 4XGQA 4UEOA 4E4RA 2HWWA 2OQRA 4HGYA 2GJ8A 2HFKA 2XCOA 1N3IA 3QEKA 3NTRA 4BUZA 3HU5A 5A0FA 3A6LA 3MBIA 3ZZ0A 4BO5A 3OZEA 4BQIA 2B4QA 3IS3A 4BEWA 4QPDA 4C6TA 3HV2A 3JQAD 2VF8A 1ZOOA 3IUBA 2AB0A 3E9ZA 1JA9A 4K87A 4AICA 3ZU3A 2KLHA 4U9HS 1YWGO 4F9TA 1W35A 3PE6A 4HADA 4A8PA 3SS7X 4FMDF 1Z5PA 5EFZA 4LC0A 4UU7A 4WI1A 2EYUA 4NOLA 1ZHHA 4MGEA 3RWMB 4WKPA 4N4AA 4X7RA 5AM5A 1JR4A 1JQLB 5HDQA 1V26A 4Y6PA 3IB3A 1TCCA 3WRYC 3I9MA 4B0PA 3EVCA 4OHXA 4F11A 3STVA 4DJAA 3NOOA 3RF6A 2OFFA 2JFGA 4X63A 4B8ZA 1E2MA 2DJIA 2VZ8A 1E5XA 3WLLA 3TEFA 3FI9A 3U7QA 3SEQA 4MINA 1TGVA 5KNLA 1DADA 1ADCA 1DIAA 1IB6A 1O96A 3DDNA 3KAPA 4LBYA 3GAZA 3DE3X 4R40A 2QRLA 4TT8A 4ENWA 1R4MA 4PAOA 4X97A 4WBNF 4RFSB 1XJ5A 4U02A 1MJHA 2O07A 4LZNA 5FTWA 1UBJS 3W3AD 3ZU2A 4CQJA 1CUBA 3QOYA 4EMUA 1E7WA 5C46F 2XZOA 5IBCA 1CR6A 3RUEA 2EWWA 3BK1A 2OMEA 1PZNA 3CIFA 1SZCA 3PHJA 3AILA 3ZHCA 1VE3A 2VDVE 2OPBA 4CM4A 5DH9A 2A35A 4ETNA 4YHHB 3Q7TA 1YDHA 4E0BA 4Q4AB 4HD8A 4CKXA 1RLIA 3IIJA 5AR1A 3F2IA 3WLEA 4BNNA 2E2WA 3KWLA 5ESWA 3A4VA 1PQUA 5H68A 4EG1A 1E2BA 4C14A 1VHLA 1WHSA 2PZBA 1GZHB 4EBBA 2VHUA 2D1QA 4YO7A 5GONA 2O3TA 2PCJA 3RUAA 3KXIA 3A06A 1VLQA 4HCJA 4ARZB 1QVAA 2VRBA 2Q62A 2JK1A 1DRUA 1LS1A 1WZUA 2J7KA 3GRZA 4Y6SA 1L5LA 3IBCA 5IKMA 2PXHA 1TPZA 2GM5A 3K1JA 1UK7A 1XSEA 3D0QA 3GW8A 4D6XA 1POWA 1XF1A 2ZREA 1YI0A 4R9VA 4N48A 4ILEA 3KB8A 2AG1A 4N12A 4WK2B 4YQEA 4H08A 1V45E 3BL6A 1SCDA 1X77A 1Z4OA 2HSWA 1QTQA 1Z07A 3PEUA 1NJ1A 1CJUC 1P29A 1YS2X 1Z2EA 5DHRA 3JAMA 1D03A 1P4GA 3AUXA 2RI0A 2GVZC 1RAAA 2XOEA 5KDLA 4HTFA 4OI1A 2G04A 4K9SA 5CT6A 4DDWA 3OQMA 4RIHA 2PSHA 4AZTA 3IKTA 1FMCA 4J90A 2AJTA 3U3KA 2BGJA 3LH5A 3U5TA 2OXEA 2OCKA 2Q1UA 3EYWA 2VK8A 3M1YA 4V3BA 5CLLA 3U3OA 3ZTTA 2XDWA 3UPUA 3PNOA 2OCDA 4CXMA 3CEMA 3C1AA 4Z3DA 4IPTA 2VPZA 2WIAA 4R2HA 4JYZA 3LTEA 4CIDA 3WKCA 2B34A 1YQEA 3KEGA 1N6IA 4LRWA 1OI2A 2OC9A 3K70D 4M9CA 3RC1A 4EEXA 5E2BA 2OKGA 4MP6A 1WR8A 4UFPA 4YJGB 3CIOA 3E35A 4E7OA 2QRHA 1D8AA 1IY1A 3LUDA 3VR6D 1FFGA 1AHIA 3CN9A 3T5BA 5BV1A 1EQUA 1WPXA 4LWPA 1QP4A 4JJ4A 5TPZA 3M4YA 2R62A 2PZFA 1T3SA 3BVPA 3ED1A 3EQ9A 3WGJA 3TW0A 4TYWA 3RVNA 2IZ1A 4PPFA 4IEFB 1JIUA 3IBYA 3LYUA 4P7BA 5CGQB 1L7BA 1PR0A 2WD9A 2P2YA 3ND9A 1J56A 3O2JA 1Y82A 1PZHA 3BN3A 3GP8A 4ZDIA 4QEDA 1NX9A 3CO5A 2J1LA 3SZOA 3WGTA 3MUFA 2QN2A 4GSYA 4WINA 1Y6ZA 5IM5A 4NPHA 4JOSA 5JZSA 2WWIA 3CW8X 4IMJB 4WD3A 4MW2A 5HMMA 1N6OA 1ZK2A 2YWBA 3FYDA 4RF4A 4Y1EA 1ABBA 2O1SA 4X3CA 4ZZIA 4BQRA 3EIHA 4JP1A 4FOLA 1IG3A 3EBOA 1QYWA 1X8LA 4YP7A 4UBLA 5JOQA 5K8JB 3AHHA 4RX1A 4RJJA 4R51A 2ZU6A 3DLHA 2VEOA 5FPQA 4XR4A 4EYEA 3NVKI 1STOA 4CHTA 4EHAA 3L7CA 4DIKA 5LM3A 3ASUA 2WMYA 4X1IA 3NASA 1EVJA 4YMTA 1ZCFA 1G5IA 4YGYA 1AGRA 2A88A 1KL7A 4ER0A 1ECFA 1YOVB 4QXRA 3RS4A 5B30A 1LPPA 2Q2QA 3KHKA 2YMMA 4OJQA 4MW1A 4IQ0A 5FBZA 5THXA 3WFZA 4DZZA 4JVNA 2A0KA 3A11A 1FLNA 1WXDA 2AFIA 3L93A 1OFTA 4N49A 3WGNA 1P31A 3O3CA 1Q92A 4P86A 4CEHB 1QVZA 3AM3A 5T4FA 3TVDA 1IUOA 1IE3A 2P8SA 2WJPA 4QLBA 3CVXA 2B7LA 1FFYA 1U02A 4W8GA 4FE4A 1N5KA 1IMOA 5DKFA 3CZQA 4LRQA 4QXOA 2A30A 5EFOA 2BH2A 1QF7A 3CJTA 2CXRA 3MCUA 3UJ3X 2XT6A 4PR3A 4HB4A 3WKDA 1YUBA 4ZI7F 1UK6A 2X7XA 4WY8A 5J58A 4A6DA 1DDIA 1WV0A 1SXJD 4PLHA 3PXEA 3EA5A 1A9RA 5BWMA 3DFFA 1I9GA 3KQTA 1IVSA 4MRMB 1X19A 2IX9A 1GRNA 1RJDA 1IATA 2KHZA 3NX4A 4A03A 1EP2B 3RSLA 1LLFA 1V9CA 2QIOA 1CUCA 3O8QA 5KC8A 4QU0A 1R0LA 1MH1A 3QFHA 2RGGA 2EARA 4S05A 3O4IA 4RE5A 1WG8A 5EJFA 3THWA 3GT3A 3MS4A 1J8VA 1Z7BA 3NCHA 1VDZA 3LX4A 4G0ZA 1OC4A 4LF5B 2ZUFA 2C2ZA 5JDIA 1RRGA 3BPSA 3MM4A 2TS1A 4OEHA 2FPUA 4N39A 3SOZA 5REQB 1RQ2A 3REGA 1P9NA 4MR8B 5MDHA 3DEYX 1GSAA 1LLCA 2ZYGA 4HLNA 3KT8A 1P2VA 4K86A 4X3OA 5CMLA 5DXAA 1GTSA 2WUVA 3PQ7A 3KL4A 1W44A 1QE0A 5BV8A 1PNQA 4W1QA 3HC7A 4K8RB 4V1CA 1NN3A 4RW0A 4G2TA 1W4CA 1YE8A 1VE5A 3NNSA 2C97A 2CF6A 1ZM4A 3VZPA 1OB5A 3NT4A 3CRNA 1DINA 3OOEA 2G25A 4CG2A 1PV1A 3BIOA 4TQGA 4OB8A 3WYNA 4G5RA 4G0OA 4Y2JA 5H4GA 1XNHA 1DIRA 1K63A 1FFCA 1C0EA 1G20A 1A8UA 1V5WA 2W2XA 2WVJA 2XUDA 4BVGA 4YCSA 4UHBA 1U9IC 1WW3A 3FHTA 3PNPA 1YL6A 3ZQKA 1YS6A 2FQWA 4WLOA 1NW3A 3B5IA 3SBDA 1T10A 5ARCA 1BJKA 1VJ0A 2VP5A 1YFLA 3MSXA 1VHDA 1ZJZA 5FCDA 2WWYA 3VI4B 1QFJA 5DV9A 2ZWMA 1KI6B 4I50A 4P98A 4DV6B 5AO9A 4CMIB 1GU1A 2C82A 3MOSA 2JGEA 1I4WA 4FDTA 2Z9CA 3IR5A 4L9RA 4BN5A 4EG8A 1ZMXA 1P0MA 2OAEA 2DWPA 2P6NA 4YI3A 1BS9A 3AGPA 3KZCA 1JHZA 1OAAA 1FSZA 3ODPA 1UEXC 1GYQA 3E23A 1V0JA 4GICA 5EUMA 1F12A 4XVHA 4CRWB 3NW9A 5FBWB 1I2AA 1XHLA 4DTCA 4DDVA 1J0AA 3SIRA 2I7DA 2PUWA 2LCFA 2G9VA 3LPMA 3M4ZA 4YUVA 4M53A 1CY4A 1J9ZA 1J0BA 1FP6A 1O5OA 2H1SA 3DVAB 3ND6A 1PCXA 1PT5A 3OJWA 4HDNB 3ZGYA 2AHRA 5LCXA 4L5YA 3CVJA 4R4JA 2Y6UA 4ITVA 1XWWA 5BN3A 2A7XA 4CF6A 4F4HA 1T3LA 5DBIA 2KB0A 3ZC3A 2FJ0A 2YWEA 4LX0A 3TG8A 4U2BA 4XLZA 3T34A 4MUKA 2VF7A 1E2PA 2CNWA 2GWRA 1XMPA 1G55A 4ZAVA 1M7HA 2QE6A 4R1PA 5FF9A 3VR6A 3RC2A 2QYSA 3R20A 1QLJA 2RGNA 3S8MA 3AGQA 1DE0A 1NY5A 2V6FA 1CLEA 3N86A 3RRBA 4BO0A 1FF9A 2CCGA 4KLZA 1FRVA 3U7JA 3NHPA 1XG5A 3QPUA 4EYSA 4D41A 3EPKA 3OAAD 2O4UX 1ZFNA 3FCXA 2VNIA 2UV8A 1V1RB 3TQTA 1CS0A 2F64A 2E82A 3CV3A 1QH8B 4FP9A 3NGXA 4G2NA 4QM6A 4IUCS 1GA4A 1N25A 1OLOA 4UDNA 2V8OA 1C7ZA 1IIBA 4ID3A 3RRXA 2CNKA 4FJ1A 5BN5B 1AQNA 5BXYA 1G8FA 1CDZA 3EUWA 3LU1A 1ZUD1 2GTHA 1QG0A 1U2EA 3CCFA 4WNAA 2AJCA 1YS9A 1NRJB 2W6ID 4FYPA 5HBGA 1H42A 3W7AA 5IDXA 2ECKA 2HCJB 4QG7A 3HMQA 1J6UA 1JEAA 4ZZ0A 3WGHA 3LBHA 4WZAA 1RHMA 1FP2A 1LTQA 3AUAA 3C3DA 2JLAA 4WL0A 1G5FA 3I61A 5KTMA 5ITZB 2YBDA 1SIBE 2ZIWB 1MX1A 2QZ4A 3FGZA 1NMYA 1KEEB 1QAMA 3KXPA 1N2JA 1ZO8A 1EVQA 3AEQB 3O84A 3K9QO 2IHVA 4RXTA 4REMA 4Z0HO 1F2DA 1Z0FA 4D8TA 1RXVA 4AP6A 1QLWA 1CE8A 3K6RA 2EHDA 2RB4A 4FFVA 1CXZA 1GL9B 2BFCA 3DW1X 4N5HX 5J59A 4QDUA 3WFIA 4W5OA 4P3NA 4YMHA 5G0UA 1HLDA 3ZS8A 4LY6A 4L6IA 3SP1A 1DVRA 1SHTX 5LQAA 4P93A 3IVCA 2RAPA 3DLCA 5TB5A 4CKCB 5I3CA 2W8ZA 4RTMA 2EX4A 1JA0A 1B16A 3U7QB 3SQDA 4G86A 3FUWA 1AKVA 2OESA 2QSZA 3RF7A 3Q41A 4P4LA 1DLJA 1SUEA 2IWHA 4ZT2A 2VRCD 1M10A 1U8TA 1ZIOA 1KEEA 3CEHA 3GRCA 2V7GA 2ZR8A 4I14A 3TM4A 1PRYA 1VZ2A 2CWDA 3B1JA 1BOFA 3OZAA 4G4SP 4M1OA 3YASA 4DY6A 1OLXA 1DWPA 4WXMA 2PSEA 2I29A 1L5MA 4ZMBA 3A1FA 3H5RA 1JDSA 4L4ZA 3A1DA 1S01A 4R8LA 1FJXA 2WSIA 4DLBA 2CV1A 3VR2D 4E5MA 1PT6A 3CMMA 3BWMA 3VJKA 1L4BA 4QJ3A 5IX8A 4EGJA 1UMCA 4BO9A 2VNAA 2IUSA 4KRXA 1THGA 5EZQA 2R8RA 3C3BA 5AVJA 2FSVC 3M5PA 4B75A 1C1DB 1LW6E 3DXZA 1U11A 2DLNA 1T91A 3FYSA 2Z09A 1WSDA 3ZWOA 3PEEA 3O91A 1E77A 4HHEA 4FXPA 4KVGA 4OGWA 3EFOB 4ZQIA 1UP7A 3V7UA 1OU4A 2GEVA 5A5EA 2O2EA 1N77A 4FWIB 2UUBB 4KODA 5B5SA 1RMYA 1GPKA 3W2IA 2Q3EA 2QRVB 1O6CA 1UBLS 1BE8A 1BYIA 1KI8A 1VIMA 1YE3A 2MIIA 4RAOA 3R0ZA 2VSOA 4QWWA 5DK6A 1NGSA 1FY2A 1PR4A 2B4KA 2GDJA 2W4IA 2ZYSA 4CLDA 4DNXA 5CBKA 2CV0A 4F2PA 2QSJA 2ZR9A 2YN2A 3P94A 4FMCF 2OORC 3H9GA 3R75A 4F6LA 3GL9A 1VLJA 2HADA 3NKVA 2IYUA 3K3PA 1OC2A 1NJGA 2JIRA 2Q8QA 2WFZA 4XUEA 5AW5A 5DN6A 3ADPA 1A5SB 4QGSA 1JSLA 3AX6A 1QG6A 2PKWA 3ZCRA 1FP4B 1W19A 2P9GA 3NTOA 2HHAA 5TS2A 1UMCB 3I6MA 3U4QB 2GPWA 2WUWE 3EA0A 3PD7A 1BIFA 2IRWA 4WT7A 5ALQA 3RVMA 5HWSA 5KX5F 4WGFA 3CLUD 3KE9A 4TN5A 3JYQA 5CDFE 2Q50A 2UVDA 3AT1A 2CZQA 2VNHA 1ZL0A 3ILYA 4QYTA 5B2EA 1Z0IA 3GCWA 1BCSB 4PPNA 4DMLA 2BIFA 1JSZA 1V96A 3GLUA 3QMVA 5D5HA 1MCZA 4CCSA 5G53C 1AIPA 1E18A 2NOAA 2GA8A 3NHSA 5FPHA 4ER3A 3ECCA 5SZJA 4RACA 3QVJA 4CEIB 3KR1A 1WF6A 4O4HF 2W4MA 3PNQA 4PC6A 4RKRA 1DIHA 3E15A 4X66B 1Z35A 3KHTA 8OHMA 2PRSA 1PJCA 3FPBA 4ZPJA 1J8MF 2A1UB 4NE9A 5EC8A 3TECE 4DMKA 4CMBA 1XTBA 2DBRA 1JSRA 2IUTA 3I37X 4KZPA 4R6WA 4F1WA 1ZI8A 3I28A 5THKA 1D1PA 4K26A 3RHZA 3WBBA 3DT8A 2YS7A 3CX7A 1TIKA 4Y9UA 2X0FA 3VTAA 1D2NA 4DARA 1OB2A 4TTAA 1KR5A 3A3OA 1SQFA 2UZIR 3L7BA 4MNTA 3EEOA 4LNAA 4YXWA 4TMXA 2XUFA 3KK0A 3PP8A 4UATA 2VJMB 1AK9A 4HVCA 2QY6A 4TL7A 5NLLA 2DHQA 2FMFA 4W63A 1EWTA 2GZRA 4LFBB 3HP1A 4WFJA 2CNOA 3EFBA 4I19A 1KMQA 3I1YA 3G5MA 3L41A 4QFBA 5M7EA 3CZAA 3MFYA 3C1UA 3N2KB 4NOKA 2X0EA 5KREA 2DFNA 4D9MA 1S3SA 4B4VA 3B78A 1CVLA 3N2LA 1WW8A 2NYRA 2J3DA 1U7PA 3WGZA 2A0FA 4WACA 3B6JA 1GL7A 1CWUA 3AOEC 3EIUA 1YQXA 3NQ41 3TSWA 4CHGA 1VE1A 2NU6B 4XB6B 3JWHA 4MICA 4IDGA 4DZTA 1XGKA 2WY2D 3A0UA 1ZIPA 2FX2A 2P3QA 4UUPA 2FHSA 3KJNA 1A8IA 1T8TA 3KFVA 4N5LA 2BBOA 1ONOA 4JD5A 4EECA 1DUSA 5TMEA 2FCAA 2GF9A 4KXFB 3O47A 5DHUA 4HDRB 4OQFA 5BT8A 1HQYE 2XCLA 4MGIR 1TKAA 1W6RA 2ONYA 1ZSNA 2WKRA 4HDKB 3UJ9A 1M6EX 1VHWA 1XZHA 2BEWB 4CUZA 1DXYA 2OXRA 4KXLA 1IJFA 2XNSA 4NMMA 1UDWA 2XHEA 1PT9A 3FNQA 4NMHA 1BVYF 3M5CA 2Z30A 1GNRA 2D5AA 3C4JA 1T4CA 2JHFA 3UQYS 2P7HA 1PQYA 2DFTA 2DR0A 4MKXA 2HREA 1OVMA 2B8JA 5EI5A 3RVKA 4KR6A 2OO5A 4C1NA 1VG9B 5FKJA 4ZJPA 1AKUA 1DWOA 4B3JA 2WQ6A 4WCDA 1KZ9A 1RRPA 1CQIA 2D0PB 1ZJJA 5FNVA 7AT1A 1XZKA 1RU3A 4GX0A 2PS9A 1WPRA 4N54A 4PAMA 2OCGA 2CHGA 4U8GA 1ZM7A 1LB1B 3U31A 1UDXA 3O9MA 1I94B 1A4UA 4LF6B 3DKIA 5KJ6A 4JN6B 1PWHA 5IULC 4YT8A 3ZVNA 1LSSA 3ZV5A 3KC2A 4M8LA 2ID7A 2VH2A 1CDOA 1QIKA 2AC2A 3BJZA 2RGYA 4TMTA 1ZUWA 1O95A 4M9UA 5H8WA 4CLXA 3AF1A 1KYXA 4D2IA 3FKJA 3H1BA 4GRAA 3ZE7A 1FVHA 1NC1A 1QWOA 3IILA 4KO4S 4HXEB 1CUDA 1K5DA 1SAYA 3G8BA 3U40A 4IHQA 3THYA 2WIJA 3ZY6A 3Q8KA 4ZOLA 3U6BA 2C7RA 1RVV1 1MNAA 1OLUB 2A84A 3PQEA 4KQ6A 4E32A 5LU8A 3KOZA 4H1UA 3GD5A 1KZGB 4GIBA 5ESRA 4LJAA 3PHHA 3R5TA 4LZOA 5DNCA 4JVSB 1CIPA 5L3ZA 4CQMB 4WLNA 3S2IA 4IJMA 3TTWA 1DSSG 2G71A 3BZBA 3WMXA 4BNWA 5AQ1A 1GQ2A 3GAMA 1QU3A 3AOEA 1R00A 1EE2A 4B32A 1QHEA 3L6CA 2COUA 3IAEA 4QNMA 3PF9A 4K2AA 1UOOA 2PX5A 2QY9A 2R87A 3BB1A 3BMXA 1PEAA 2IHJA 3I01M 4OXIA 3VXKA 4JJIA 3I05A 1LUAA 1WZEA 4G0NA 1W5SA 4AO8A 1O0BA 4HWSA 3KUXA 2B20A 1CP3A 1VL6A 2XECA 4J29A 3H3JA 3LUCA 1U3GA 2YNMC 5EIOA 1M2KA 3LC2O 1E3SA 4JSTA 3TAUA 5CVUA 2IDJA 2R4TA 2YJ4A 3NXKA 1MC1A 4TVSA 4R1SA 2X2EA 2XNHA 3DE7X 5JI2E 3WVNA 1JQAA 2WM3A 3FBTA 1E3WB 1PFKA 2ZTLA 3K9CA 4ZO6A 3QKRA 4Y1RB 3TE7A 4PPYA 3GLGB 5I7VA 5CBPB 2I4MA 3Q0EA 5LXTF 3CZMA 2ORWA 3ZXUB 4JI4B 3M9WA 4KB5A 1G4AE 2PFKA 3JQ7A 3ZUPA 1V25A 1A27A 4UXJA 1EVYA 1FNNA 5AW1A 1Z6YA 3TS1A 2EKBA 4Y18A 3VR4D 3ZWBA 5LJIA 3WAGA 4ABYA 2QUHA 2WJZB 5KNDD 1NY6A 5EUBA 3IUPA 1JHOA 2G28A 2FZWA 1BHSA 2UKDA 3P0IA 2YXDA 2AN3A 2DJ5A 2JGFA 2NADA 4MS4B 1I5EA 3UKDA 1BDIA 3L0OA 4G0MA 2I2WA 3ITKA 2QX8A 2X5XA 3TW8B 1SUDA 4EY5A 1M2VA 1TEZA 1KORA 1YCFA 5FLKA 3ZDDA 2ZTMA 3GJ6A 1QRAA 2X40A 3BWEA 4TV9A 3T9BA 1T24A 5AHXA 2AX4A 4W7SA 3OT5A 4MPPA 1Q12A 2BFFB 1GVHA 2CFIA 2NSLA 1XDWA 4HZIA 4K05A 2QTVA 4UCFA 5D8DA 4Z0PA 2K6GA 1R1DA 4DDKA 1JJ7A 1XXLA 3RH0A 2OT3B 3DEAA 4KIJA 3ZIAA 2XQGA 4LRTB 2O8DA 1QV9A 3DTVA 3IQEA 2WSYB 3QY0A 3RARA 4IDNA 5HKKA 4N6NA 1QK5A 3G13A 4WCFA 4Z6KA 4W8HA 4EI7A 3F3SA 3ZDRA 1IQ0A 4C4TA 5I48A 1FZTA 1QVWA 3C8MA 2F3SA 2XZLA 2WT9A 4K2HA 3W5AA 1CF4A 2RGBA 2BR3A 2IK8A 2O2SA 4RFSA 4UVDA 2AYXA 1TCAA 4H1TA 5F64A 3MIZA 4DLYA 5K45A 1JR3E 4URZR 2VSFA 3L1KA 1OH7A 3CC8A 1T9KA 4PU0A 1UBFA 4RA6B 3ABZA 3A10A 4EMTA 3TB6A 3BHIA 1N5OX 4FYYA 3V9PA 1PFYA 1UDAA 2XMPA 1LV8A 3PC8C 2NUTA 4OHFA 1P9WA 1NKVA 3BREA 2O3JA 1LI7A 2FUNB 4MDHA 3VTZA 3WLHA 3BIJA 2OBXA 3V8EA 4DR6B 3L06A 2BGTA 1QUEA 2ZB8A 3H65A 3WTCA 3FKSD 5CW2A 3O74A 1SMKA 3W3AA 1ZXXA 5ERXA 5FO1A 4IOKA 2FA9A 2IYSA 3S1AA 4AXXA 3L4JA 1OV6A 3NAQA 4HVLA 2M32A 1SRQA 2G06A 1VXRA 4XSVA 1MO3A 4DCTA 2EERA 1IBRA 1MENA 3EG5A 4GHWA 1X7GA 3KYBA 2Z5VA 3MQFA 1EJ0A 2DY1A 3HR4A 4G1VA 1ID1A 3UGKA 1Y9EA 1O96B 3BUSA 3CG0A 4GSLA 1J06A 1Q0RA 3CRW1 4PG6A 1VBMA 3FCCA 1OKKA 1JHRA 1A72A 2PY6A 3MJVA 2X8JA 5JJCA 4KG7A 2JHPA 3LZ6A 4GP7A 2QL7A 4MVJG 5CB8A 3VAYA 2JIZD 2Q9UA 3DT6A 3UV7A 1UZAA 1T4DA 1ULZA 5DXFA 3EGXA 1M0TA 1SUWA 4NZZA 4CM3A 4IFBA 4O2RA 2NTNA 1L2TA 4HTFB 4B33A 4EL5A 2ODAA 2D5LA 3KVYA 2D5BA 4KQGA 4RXMA 3DE6X 4UDXX 1C7IA 1BKSB 3IP7A 1LBSA 1J49A 4G5GA 3SYMA 3VR5A 3WC4A 3NM6B 3DL7A 3H9CA 3BILA 3N6RA 3GHYA 1ENOA 3NEJA 4M0FA 2OHJA 4LEIA 3JZIA 3LGXA 3FNFA 1YZQA 2GN9A 3K96A 2BR5A 4MWDA 2C7OA 1CS4C 3ILSA 3KJEA 2IL1A 1G5TA 1UADA 3GN2A 3G1WA 1Y9ZA 4JZYA 3X1YA 1R4MB 2NZUG 4GI1A 1P4AA 1ZIYA 4QDJA 4DDHA 4Q82A 1VYTA 1GQRA 2O2HA 2XNCA 1U63A 1E92A 5C4MA 1HF3A 2ERXA 1U04A 1C0KA 5AM0A 3TFQA 3F8TA 4LV8B 2WV9A 3N39C 5IJXA 5ADHA 1ZHFA 3TZ6A 3OCCA 4K6OA 3H0KA 2ZROA 2WJWA 2X2PA 4DLUA 4OK3A 4EY3A 4X62B 2YH2A 4RPHA 4ENRA 1IOLA 4MKHA 3BFKA 5AYVA 1MAUA 5IG2A 1IBKB 1XALA 1BNCA 5ALRA 2P6MA 3DBVO 1K92A 2MYPA 3SXJA 4B4DA 3DMYA 4PEVA 1IY9A 5DI3A 3U7IA 3AVPA 3UB3A 3HUDA 2YV5A 4W5RA 3M9LA 1I7QB 4IV8A 2A9KA 2A92A 3WL6A 2GARA 2RJ3A 4BKMA 5IN4A 1W581 3TN7A 4H0FA 2Y76A 3EWNA 3OCJA 3C74A 4C6TB 5A03A 3N9IA 3CGWA 1U0LA 1UZMA 3TGWA 3IR7A 4D5EA 1WVIA 2B1IA 3RVQA 5HQ3B 2R7NA 4Q9HA 5JCXA 2VAWA 2CMDA 1DI0A 1ZUNB 3C3EA 1EDZA 1G20E 4X0EA 3SWWA 3AHGA 3BCSA 1GRRA 4BKPA 4EFNA 3AF4A 3GVHA 3OPYA 5I47A 4IGFA 4BZPA 4LECA 4MQ4A 4XWYA 3QPCA 2Q1XA 3TKYA 2AEMA 2CC2A 1VKNA 1ZMRA 2Y2VA 3GYGA 5JR3A 4R0MA 3EFOA 1N6NA 1SVIA 2EWVA 4GPEA 2W2KB 2YZKA 2Z98A 3GFSA 4A27A 4MR7A 3DP9A 1AURA 1H2RS 3ZYZA 2GZ1A 4CM9D 2VL7A 3LBAA 2JEOA 4NBUA 2DLCX 4UTNA 3IOEA 4HB3A 4E4YA 4K1XA 3SC4A 5I7FA 3MMSA 3V6MA 5C4IA 3M49A 3WP0A 1VYVA 4BVEA 3OF3A 4I4TA 4KMMA 3GMSA 4E2XA 5J4YA 2WF6A 3A37A 1DCTA 2DQZA 3CEAA 1U8AA 3L7NA 3FTQA 1QE5A 3C39A 1Y9DA 2PH5A 3NFYA 4DMFA 4Y2UA 3QVLA 2QX4A 3WZ2A 1HC7A 5KAPA 4AJJA 4CR6A 4EIWA 2VH5R 3IULA 4KDRA 5EXPA 3TPZA 4DL9A 3W34A 3N0TA 5ELXA 1JLLA 3HCOA 4G8JA 1G2OA 4M7WA 3BRQA 2X58A 2W11A 5JMWA 2YNMD 4MPTA 3PUXA 1L6RA 3NNDA 3PPWA 4MWBA 5C7IO 3DWIA 2VQ3A 3LDFA 3K0EA 4MA4A 3FOEC 4JUAA 4UHJA 5HS6A 3RASA 2ZIVB 1R0YA 3ENNA 1M2HA 4MPDA 3FSGA 3D8SA 4S12A 4ECAA 3EXIB 3BB3A 4TRMA 3QQPA 1EESA 2XMSA 2VJNA 1YO6A 5FJIA 4BNXA 1NXXA 4S0XA 4TMZA 4MI9A 4Z4QA 4TXHA 3Q12A 1A77A 2J0UB 1BCRB 2ZK7A 3D3QA 2D1SA 2IYNA 3J80A 1VC2A 3GRAA 2OY0A 3AJEA 3QUSA 4UXIA 3ND7A 3U56A 1F2VA 3FWPA 1CUXA 4PS1A 1E0KA 1ZAKA 2DR3A 3G9UA 4JAVC 4LSZA 4MQ5A 1CQIB 2OK8A 2J3KA 2LRHA 3LQYA 5H02A 4NBRA 2XBUA 3H11B 4GI7A 4HLCA 5HF8A 2DPLA 3JPWA 5BR7A 3UGTA 3LD9A 2I3DA 1MFPA 4J9UE 1QFZA 3CNNA 2R1TA 1AKTA 1X7ZA 2EEZA 4IDQA 3T35A 4C4YA 4DA0A 1GGJA 1O8BA 2DCUA 5ER9A 1W0CA 3IQGX 3THOA 4GKKB 3NB0A 1JZTA 4TYQA 1XVLA 1HFWA 2H1RA 3O1LA 4BMPB 2REQB 1CRLA 1VHTA 1MAAA 3NHFA 5LZ8A 5LD2B 2HCFA 3THSA 3ZCPA 2ZJ1A 1R5BA 3B2NA 3DTVD 1ZP6A 1QO7A 3FA2A 4QYMA 4YJ2A 3IHTA 4KXNA 1G6OA 3AF5A 1MX3A 2YMPA 2P27A 4NATA 5I8WA 1CBUA 3R0QA 2XBLA 4C2BA 1GKIA 4OQXA 1AGXA 2G1JA 3C6ZA 3DFZA 4TX1A 3A4MA 2XGJA 5B7PA 1BEUB 3GGCA 2VDWA 3MGCA 3KKMA 3C6QA 3OC6A 3GA7A 3RIXA 4Z4FA 1U80A 4ARUA 3P0FA 2NXWA 4GT1A 5IJZA 4QECA 1E1QD 1YZUA 2M1XA 4HGQA 3IAM1 3UB4A 2VG8A 5G1OA 2J3EA 1SK9A 2DWQA 2HPVA 3HEAA 3WXBA 2YV2A 1X7WA 5ALOA 3QKUA 1P2FA 1U9IA 5JZ9A 1RZRA 4Q7LA 2IPLA 1YI8A 2JVJA 2OBYA 5B6PA 1HKHA 3K16A 3S81A 2FPIB 2X3UA 3OHPA 5E6UB 1NXTA 1DKLA 3I1JA 3ZTYA 4CV3A 1TU3A 3DXFA 1PJSA 2DTDA 2H4XA 5ALEA 2JHCA 3SXUB 2EP7A 3WL3A 4BMVA 1C7FA 3LVRE 4CG3A 5C53B 4LOHA 3VGPA 4YCAA 3M4XA 1HDZA 1B0ZA 3OP1A 4B87A 1KVTA 4ZVTA 3H42B 4X8MA 3KTOA 4DRXA 1BW9B 1ZWLA 4LUCA 1KWGA 3V8VA 1MAHA 3D1VA 1SKQA 1Y7IA 1E1CA 2FN8A 4WK0B 4YAFA 1KQNA 2KYRA 4KDEA 4M6WA 1U9JA 2W4QA 1KZ1A 1RFGE 2IYTA 3HFGA 4M2LA 2PJRA 5JG7A 3CJQA 1IXYA 5K8TA 3PQ4A 3VSDA 3ROXA 1KXJA 2QM0A 5IM4F 3JVIA 1ZXLA 2H7VA 3QMMA 2IEZA 3SC6A 3KSZO 3IELA 2ZE7A 1G3RA 1SHLA 1FNMA 1RJEA 1ULBA 1WQ3A 2H0QA 2IXGA 2QS9A 2P9JA 1XZQA 3P19A 3ZOZA 4EG3A 1AV6A 3KE8A 4Y6OA 4HDSA 5CB0A 1VL1A 5AICA 4YXFA 5JI3E 1RXIA 1N6LA 3NRJA 4O4IA 3WDMA 3DA8A 1KQPA 2D7JA 4FBGA 4LDNA 2RHTA 4X8LA 2J6CA 1Z12A 2VJOA 2FEWB 1F0KA 1FLAA 2AUTA 2GPBA 4Z4EA 3TQRA 1K4YA 2Y66A 3L92A 1ZGGA 3EMBA 1RXEA 1EPUA 3NVAA 4KYTA 3AERA 4B8YA 3GLTA 4QVGA 1QOPB 4AT1A 5LNK1 1SBHA 2GLTA 3NORA 3PR1A 3M81A 3IQHX 2WU8A 2XH8A 2FR1A 1KDZA 2WFAA 1PG2A 2V6IA 4B2PA 2I6UA 2B82A 2D2EA 3EF1A 3AO0B 1JJBA 1TX4B 1V1MB 4H6WA 1JB1A 2G40A 3OLXA 4XWWA 3G8CA 4N82A 4J0QA 4AI6A 2XTZA 3R8XA 4YUYA 1MIOA 4LOAA 4H4EA 1XEWY 3ZU6A 1GV1A 1ZMTA 3AY6A 4OXYA 4FHDA 2W6OA 3REQB 5JRJA 3A2MA 5LXTB 3Q7EA 4RCZA 3CEJA 3TTXA 2ZRPA 4Z7NB 1NOKA 2B1QA 3IRUA 1O6GA 4RV4A 1WX1A 5KQMA 4Z4GA 1AQLA 3HSSA 1ZH2A 1PU2A 4UVIA 1WSBA 3B3FA 1KXZA 5JZVA 4KQ9A 3AEUB 1W76A 1QIHA 1XYYA 5TRTA 3Q87B 3BXOA 2JARA 4UM9B 5DRYA 4KWIA 4JJ6A 4NCHA 3V34A 4BTVA 3ELYA 4FGWA 5B1SA 1J42A 1Y81A 1KAGA 2G4VA 3W8FA 4A0GA 4LTMA 3F5FA 3DLAA 1JIKA 2WVGA 3EGEA 3NDIA 4JT4A 3BORA 4OLHA 4URVR 4BB9A 2PBFA 5AM1A 5MF6A 4A73A 2O3QA 2PZJA 1WOYA 4AYTA 2H7XA 3JD0A 2NTEA 2O6LA 2B69A 1X7XA 3F6PA 1YOVA 2QZ9A 4ZANA 4PC1A 2HRCA 2NYUA 3Q8LA 2WAYA 3H5WA 2OM2A 4RE6A 4ZT7A 3BSWA 1IC6A 1A04A 1PL0A 2V96A 1YHYA 3QH4A 4NNOA 1CEQA 3EY4A 4OBWA 2NZVG 3ZDYB 1YTUA 4ZCTA 3EEQA 3FOFC 2PV0A 2BD0A 4YB8A 1D1TA 1G21B 4C3VA 1ESNA 2CNBA 4ROTA 2Q21A 4ZQCB 3LK7A 3E9YA 4TS1A 3VPCA 5DMHA 2FSVA 4XDGA 3HMKA 3AFIA 2I9PA 3LT0A 4HAVA 1EK1A 4UVEA 2RJOA 2Q4BA 2Y9MB 5CD1A 1E6CA 2VZ0A 1F17A 3ZJ4A 1Y4AE 3OLYA 4LA4A 3KVVA 3D54D 4KUHA 1T35A 1ECJA 3M6AA 4ZQEA 3ABIA 2B2NA 4B47A 1F0NA 1AK2A 5CURA 5ADVA 3MMZA 1QJ4A 2ZFUA 3IMFA 4EF4A 3M83A 2Z2YA 4HX2A 1V8PA 4HSEA 1W4RA 4KMOA 5ECDA 1T4BA 3M3PA 5DLQC 5HF5A 1TU4A 5L8VA 2BYTA 1WKBA 2ZT6A 2PH7A 2WG0A 3MCAA 4AS2A 2YWXA 4HEJA 3GJTA 4MR7B 4NOJA 3W6UA 1QBKC 2ODNA 4HNQA 4OG2A 4NENB 5JXJA 4ENUA 1Z6XA 4CKBB 1FRZA 1VPLA 2ZTSA 3MRXA 1WXEA 2XTJA 3NJ8A 2VHWA 4KTTE 3UV3A 3UAWA 5DBEX 3EJ6A 3T5CA 1QC5A 1SCUA 1TO1E 3R5KA 4L2IA 5BVHB 1PL7A 2FSSA 2HO5A 1PG0A 3MGAA 1GZVA 4NU5A 4EZBA 4FT2A 5JPDA 1EXDA 1T3ZA 3ZDAA 4BO7A 2WC1A 4XWGA 1Q3TA 4O4JB 8ABPA 1BYUA 2QZJA 1SJ9A 3MCVA 5CVCA 5AVTA 3U5ZB 2A0WA 3G0BA 4E5UA 4JVOA 1RRMA 5KJFA 3QSYA 3RK0A 2GSWA 3NBUA 4HDMB 3PGJA 3D8RA 1R8QA 4GKBA 3IT3A 4XPZA 3V46A 3VNSA 1PFQA 2A4MA 3DE5X 4UMVA 3L8MA 1KOFA 5GY7A 4WZAE 4NMWA 3IAS1 4RGVA 3OEHA 2X3YA 5JECA 4PGAA 1FL9A 2GHQA 2GEJA 1U9CA 4OPMA 3NKFA 3TUJC 1Y8QB 3ET4A 3ZI0A 4AP5A 1PV4A 1IONA 2G07A 4BQNA 3VZDA 2DQ4A 1LBHA 1VPDA 4XA8A 5I7HA 2PQ0A 3R09A 3TFOA 5AJYA 1C50A 1K6EA 3K9WA 1H9AA 5ITSA 1TI7A 3HVKA 1WLYA 5LFAA 4JLUA 2ZIXB 4RZQA 2V0NA 5JNRA 5LOVA 3A6DA 3OPYB 4R71A 1KP2A 4XYEA 4HZUA 1RABA 2C5SA 4U6SA 3BFJA 4UARA 1VL0A 3VO8A 2ONJA 3HXKA 5LVAA 3SXPA 2ERCA 5KKNB 5C8XA 1SKUA 3K72B 5B58C 1Z5UA 3IVMA 5LJLA 3EVNA 1KWKA 4LTDA 1FXWA 1YZ3A 2F59A 3WR5A 3SPXA 3UUFA 1ZM2A 4MYSA 3GO4A 4KRFA 1T5HX 4N0PA 3KQQA 1P91A 2AFHA 4K1LA 3D6JA 4WLUA 5KYXB 4LVNA 4I4TF 4NPAA 3EEBA 4P1ZA 1XLVA 4WECA 4ZAWA 5AW3A 2C20A 3FR7A 4IVPA 1N6HA 4OXNA 3CLRC 2JFOA 4AZWA 2X15A 3QXXA 3F90A 3GX1A 1ZLYA 4D96A 1GG8A 5DCLA 1NXOA 2DTXA 3FPCA 1I4LD 1ZN7A 1D4FA 1ZGHA 2NUTB 1IWBB 2AMFA 2O4CA 1SUFA 2VFAA 1CZNA 1GARA 1SVKA 2X8JB 3D43A 3E58A 3ETEA 4RH3A 5B3JA 4AF7A 4O8CA 4AJEA 1E79D 2HMAA 3L6OO 4YAKA 3AONB 4S1WA 1XT6A 3JAWB 5D00A 4GBJA 5AK6A 3P0JA 4QG3A 2HWKA 1E7QA 3H1EA 2OVBA 1XL0A 3IX7A 2QRNA 1BMTA 1IAVA 3GRYA 5F1YA 5FFNA 1WA5A 3LHFA 4DXDA 4C2UA 2IYZA 3OJEA 1E3DA 4PHHA 3FIJA 4DGSA 1O9BA 1N7GA 1UKYA 1OFGA 2O14A 2UZ1B 3DV0A 1UWKA 4WX2B 5CNJA 5AXCA 4TLCA 5GWXA 3WWOA 1CLUA 1C7QA 3H13A 3U7RA 1JR2A 1Q7RA 4ZJYA 4IP0A 2FWPA 1W5FA 1J99A 3ZKAA 5FYQA 5M5BA 1Z45A 3A26A 3KAKA 3UENA 3JQCA 2PGDA 1Z8DA 1YBMA 4IIDA 2WKWA 5CCEA 4MTCA 1W5TA 3O1JC 3FZGA 3NG1A 3C1OA 5ALLA 4CIAA 3OQIB 1T5BA 2RKBA 4MP3A 5K01A 3DMFA 2QUZA 3FRJA 4HLQB 2DEUA 1UWCA 2K4MA 3AH8A 3F67A 3INTA 4XE5A 4E09A 2Q6LA 2UZ3A 1OOEA 4D1YA 5KHAA 4LF4B 1EFVB 3FTNA 2IBTA 1AZWA 3GEMA 1E60A 2EGHA 4IIVA 2WWXA 4HI0E 3S1SA 1JKMA 1UJNA 2XPCA 1JQEA 1RHKA 2QTCA 2WG1A 1JDPA 1Z4LA 2RGEA 2YIVX 3FGPA 1YB2A 4JGBA 2VPXA 5F21A 1AQ6A 5A02A 4BX2A 1KMMA 2EQBA 4H18A 2QN1A 2UYOA 4NBLA 4Y7CA 4R1MA 1DXOA 1GQOA 4MQ6A 4Q9KA 4ADSG 4QSHA 3ZXIA 1KZ4A 1PR3A 4Q1VA 4JQYA 4ZRDA 3E7XA 3AESA 1W48A 4YRFA 3R6LA 4DWWA 4N41A 5L3SB 2NV0A 4ZO8A 4WNCA 5FDFA 4KQKA 3Q3VA 1ND5A 2W2TA 1YQDA 4LXYA 3RDPA 4HGZA 3WK7A 5ISMA 3RSOA 3BCRA 3RNOA 1YCHA 1WZ2A 3FB4A 2MYTA 1EUZA 3UPDA 2YMLA 1DUVG 1LTHR 4GSKA 3LECA 4KQEA 2IPOA 3R3SA 4M21A 2GRJA 5CLIA 3AMVA 4MYDA 4KX3A 4ZC8A 4AK9A 1PJAA 4ND7A 4IGEA 2IOQA 4V03A 2H52A 2ZETA 2PWZA 2O7RA 3BKXA 4KQCA 4N7RA 4BFCA 5K0SA 5ARBA 3UXYA 3OOSA 2GN2A 4A10A 3HU2A 1PFGA 3EZ6A 5BSGA 1Z7YA 3H04A 3HB7A 4J1TC 2LW7A 5G4KB 2FUG6 2RAFA 1B26A 1NAHA 2XXJA 2YJZA 1FOEB 3I8SA 4WOPA 1E9BA 3R7LA 2VSYA 4YRKA 1YRYE 4O25A 1G9TA 1RHRA 3OX1A 3PNBA 4JI6B 4DOMA 2P2GA 1EDOA 3B51X 3G0CA 4YJKA 1X7DA 3D7LA 3PSAA 3TIXB 1G9XA 5ALWA 1ZR2A 1SHJA 2ZUUA 4EJSA 5JIBA 3UXMA 3DOFA 4X61A 3FD8A 1VL5A 2I3GA 2Z4TA 1BDBA 3D59A 1P5ZB 3E9DA 3EAGA 3EWSA 3OC0A 4PYQA 3VV2A 3A36A 5LBUA 2ENWA 3OEEA 5T5QA 2V03A 2V8BA 1YB1A 1Q11A 2AQHA 3A1CA 1CEEA 4RNDB 4FCCA 1L8LA 1Y8QA 2ASEA 2OCBA 4XSGA 5EVJA 3W05A 2ATEA 1MC5A 2GAIA 1J0DA 1KFBB 3QWHA 4MUNA 2J31A 4IX9A 4RF5A 3UPTA 2NW6A 3VR2A 5TLSA 1WETA 5CH8A 1RM0A 2EXXA 3TQFA 5D3MB 4XYBA 4DSTA 4YV2A 4R68A 4J7XA 1FS5A 3OMXA 3FVTA 3QBVA 3AR5A 2FDRA 4RZ3A 4LZAA 1L4KA 4II3A 3OZXA 1P80A 4A2PA 2V55B 4GVXA 4QGAA 4CT4B 5HJ7A 1QQAA 1MFZA 2B0JA 2KQUA 4DLAA 4OQNA 4AKHA 3FSJX 4LVOA 1ML3A 3KKZA 3R3WA 2SCUB 1KDTA 2WP8J 4ACAA 1RYMA 3QLEA 1JDZA 2BN4A 3DCIA 4P6VF 1NUSA 4RJTA 2XB6A 2O2GA 3D3EA 2QTNA 5LZ5A 4C0HA 1Z26A 4XIYA 4ZO4A 5AT1A 1FS6A 3DTTA 5KQRA 3PT9A 2C5AA 3EARA 1IVYA 3RSHA 1HEUA 3CHYA 2FFRA 4S3MA 2ZIGA 4HWRA 4JYPA 4O4LF 4R9UC 1P9RA 3A9SA 2C4WA 5C8YA 1QAOA 3W6NA 4CGZA 2FR0A 3AHJA 3OTGA 3PENA 1IPEA 2AA3A 2B83A 2I2CA 1RKXA 4BBAA 4YUXA 1R3DA 1GR0A 4DPKA 1USGA 2Y99A 4EVSA 3I53A 5BSMA 1FVOA 1R9NA 4D99A 4CKWA 4PSAA 5EJGA 2GHIA 3ABQB 5CLFA 2LV8A 4XARA 1I0LA 3BE4A 3EZ9A 4PINA 4DCCA 2BTOA 1ODCA 5BUCA 1PL8A 4FMPA 3RREA 1F20A 1AKQA 3I6ZA 2Q8NA 2R48A 3DO5A 4K3VA 4AZ3A 1PYDA 4HMQA 3G2HA 4OBEA 1TD1A 5B4VA 2CVOA 2GAOA 3PR2B 3SM3A 4ZMSA 3G5LA 5I5EA 2AMJA 3UZUA 1NQXA 3S28A 4QZVA 1TNDA 1YT5A 1ODTC 4KE9A 1X1BA 2C5BA 2R86A 3QIVA 4BX8A 3ABRB 6ABPA 3QLJA 1BWSA 4XQGA 3PV0A 2X5OA 1G5QA 5A7GA 3TIFA 2P9ZA 4I1IA 4G5HA 1OFHA 2TYSB 1DQPA 4RYDA 5L40A 4JEUA 1A3CA 1ADGA 3FSRA 3T1NA 2XQVA 1GGMA 5B7QA 4NDNE 2VDMB 4KSYA 2F1KA 4QDXA 4JLWA 3IIMA 3NP7A 1Z15A 3P32A 2GNPA 3R3VA 3V9AA 1IXKA 1HPLA 2R6CA 2W6QA 4LXQA 4MTLA 1NULA 3ZZMA 4BNLA 1H5QA 1GEGA 3TDMA 4H77A 1E1NA 1O77A 1WF3A 1U0SY 1XZLA 1YR3A 2WABA 3M2PA 1B3BA 4JLKA 5KO2A 2PNFA 3C15C 1FVXA 2GZ2A 3ZKWA 1A71A 1N5IA 1PEKE 1EWKA 3GFQA 4YIKA 5FOWA 5BUQA 3U62A 3NMUF 1TXGA 1MA0A 3P4YA 1K66A 1HE3A 2G7ZA 4RIFA 1NW9B 1L1FA 5IRCD 3F7OA 5J3JA 3GRPA 2N46A 3TSOA 2IELA 2V59A 4FMCB 4KMSA 3ZY2A 4B81A 4PZPA 1YJQA 1ZW1A 3LWBA 4KNWA 2XWSA 2DWUA 5KQLA 3OIFA 3ITDA 4MV9A 4LI0A 3O21A 3U19A 1ZOPA 3LYHA 3ZBTA 4P38A 1M1YA 4JR0A 4IYJA 3OCWA 3VFDA 3QXHA 1TFUA 3S5JA 2R6FA 3HL0A 4KCGA 1IY0A 4EITA 3OZDA 1H8ED 4H27A 3DKVA 1XD2A 2XCRB 2QU7A 2F8MA 4L4UA 1GGHA 1GSHA 5JYDA 1YDEA 4XQEA 2KMLA 3P2JA 5FHQA 2OCAA 3K0CC 1AHPA 4B0OA 1US8B 2F3TA 5JJBA 2BI7A 2E6UX 3JD3A 5YASA 3ON5A 5CYOA 1FYVA 4GYYA 1VPEA 1XF9A 2FWIA 3GLGE 2XNJA 5GGXA 4V0MA 1EAYA 1TA9A 3BGWA 1EUCA 4RD0A 1WXGA 2OK7A 2CMHA 2CXSA 3AG6A 1Y5LA 3NEYA 4RSRA 5H0IA 4BQPA 2UUOA 1M34A 1WXFA 3ME5A 2N9UA 2XAAA 2FLKA 2P5TB 1B0AA 1OREA 4X65B 5FI3A 3PBKA 4I1YA 5H3HA 2QRMA 3JQQA 2PKXA 3P9QA 4JJZA 3ADBA 1KE2A 2XQIA 1C9DB 4OHCA 1CUWA 2XYVA 2C3OA 1PQWA 4QLOA 4FOSA 5L3QB 3Q72A 3DDWA 3P0EA 2PUTA 4KNYA 3JASA 2PR7A 4B3CA 3Q0TA 4KR0A 3VVBA 4MPRA 1S5PA 4N18A 3OJXA 4X1KA 2GTIA 4YNBA 1XLWA 5DM70 2VKTA 1U6JA 1T0BA 4Q18A 4D9NA 3B36A 4MZDA 1FUEA 1V9LA 3GT7A 1BE6A 4NQZA 1FU7A 4KLRA 4DDUA 3UYLA 3CNBA 1WU7A 2HLHA 3OKPA 2P6OA 4Y0AA 3WGUA 4X84A 1KDYA 4ASUD 4NCJA 1K5HA 1M75A 1Q1EA 1U7OA 1T36A 4IO1A 4B17A 4E13A 3EQZA 5BXQC 4IQ8A 3SXUA 3KXLA 3ROKA 2Q9BA 3RRYA 1I24A 2A0XA 3KQSA 3S2UA 2X4IA 3PCRB 4MQUA 1GG9A 3W5UA 1K2WA 2A5FA 1YA4A 4Y6QA 4P0PB 3VH4A 5L95A 3CNHA 2V65A 3I01A 2LXNA 1G3QA 5F5XA 4LDAA 4C0LA 1KPGA 4MVWA 3ZV6A 1BXKA 3MWEA 2Q41A 3C7TA 3HG7A 1DRVA 2W71A 4QNRA 3UHAA 1CZLA 4RPKA 1J0XO 1T6ZA 1ZNQO 3QNMA 1PLKA 3GZJA 1W7AA 2I6QA 3QKTA 5B55A 2HRDA 2TRSB 4FYMA 5F9FA 2BKLA 1GNLA 2FW6A 4GXTA 5LD2C 3RCBA 3OP4A 4I0WB 2JNWA 3HUTA 4UDOA 1S89A 3OQ6A 2OA0A 4ETIA 1D09A 3QUTA 2HT1A 3Q7IA 3ORRA 1U3FA 1M6VA 2OFPA 1MJGA 2ETXA 2AL7A 3HCWA 4KLAA 5I9SA 4DLVA 1XTRA 1E3TA 3EZLA 1U3CA 1Y1RA 3LHDA 4I81A 1CUFA 3VR4H 2Q3MA 4JL6A 3JS5A 3RYFA 5KOJA 1QPGA 1OWLA 5CAEB 1G3IA 2WHPA 4A1FA 5A5FA 4JA0A 4DKXA 2J59A 2Q49A 3ZCSA 5LQKA 1C41A 3VPDA 1EBBA 2REQA 3AKEA 1SKBA 2I4TA 3JZDA 1ECBA 2B98A 4JHLA 3IUMA 4UE2A 4ARCA 1LV7A 1HDGO 1T15A 4GF5A 2D6FA 3E27A 4BNZA 3CZ9A 3HDJA 1R8SA 3LA8A 3PQ5A 3TBFA 4NYMQ 4QXAA 4C6HA 3NPAA 3DYBA 4OSOA 2CLIB 3HKCA 3L8DA 3GOQA 1KSJA 4L7VA 1DC4A 1JQKA 3P4XA 4FI3F 3L8EA 2GF0A 1YRQA 3E2MA 5A9SB 1LDBA 1TTHA 3CXRA 3EBPA 3N5KA 1J09A 3IVRA 1FTGA 5BVGB 3NUQA 1MV8A 3EMDA 3OFVA 3W2EA 1G5PA 5BYJA 3I04A 5I7OA 2PTGA 2XXAA 4RESA 1ZGAA 4B43A 3BMOB 4HAOA 3L1VA 1OYVA 1LXCA 5EJ7A 2ECFA 1JTEA 1Q1NA 5B1DA 4ZQFA 1A96A 2HDWA 2IGBA 3RJTA 2FDCA 3VYSB 1NG9A 1QKKA 1UC8A 1Z7EA 4I08A 1GKUB 4RK5A 4UZEA 3ETLA 1VG0B 1FSFA 4ZDWA 4KEAA 3NOVA 1H2AS 3VAZA 3DPIA 2OZLB 2ZE6A 3E9CA 1MEJA 1LDEA 1M76A 3FVRA 4HOYA 1N2SA 3IAXA 3TBKA 1NW8A 5TR9A 3KPWA 1K7XB 5H5JA 3CNOA 3CWQA 2RH4A 1S2MA 1D6SA 2Z9BA 1EQ2A 4NBNA 2GMWA 2KS6A 5EHGA 3RNLA 3SZMA 4X6XA 3O83A 3LDHA 4L8YA 1CD5A 3L43A 1MVLA 1A9XA 1R6XA 2AK3A 3V3TA 5JQWA 4FCVA 2AZTA 4QTTB 3R9IA 3UTDA 3QYPA 4ZYWA 4Z9BA 3ECSA 5IHPA 1WSAA 3HB4X 1H2WA 1M1YB 1UPXA 2HSGA 2GAFA 3LUAA 1LJ8A 2FDXA 3FPJA 3OWHA 4FFLA 4G01B 4MCAA 3PL5A 1Q16A 2YHAA 2ZSHA 4ON9A 1YVEI 3D9QX 4UHKA 3HLTA 2GYYA 1RFLA 2BF7A 3OA2A 4IDDA 4BJ1A 4BMSA 5D87A 1FXSA 1NMQA 4R2IA 5FPTA 4QLAA 3TR0A 4X54A 1XTPA 2CLOB 2VK4A 3U3DA 3V7NA 3TXAA 2XDQB 4HB2A 1VJDA 2WILA 4Q37A 2D54A 1P4JA 2QNRA 2Q3DA 3HDYA 3JQFC 5LA6F 5DN9A 3EXEB 1QQ7A 1UFVA 4A23A 3IBFA 2IYFA 3LQFA 1TJNA 1XMJA 3S68A 4BLTA 5F1PA 5JC1A 1CUHA 1XJCA 2VZLA 4O0LA 5ALZA 1S2OA 3VVLA 1TQHA 3W78A 5AXDA 1FRNA 4OD0A 1JAHA 1IEQA 2QJOA 4K9LA 1MOSA 2QX9A 4MR8A 1EJBA 4HWTA 4PRZA 3E2IA 5EZ6B 3T15A 3W6ZA 4D8UA 4WJLA 5BR8B 1C9NA 5A3JA 2YX1A 1H6CA 5ICMA 3U60B 2PSSA 3C6BA 4OHRA 3M1LA 4DC9A 4HMOA 2VWQA 3PFCA 1Q84A 4X24A 3WS7A 3MILA 4KYUA 1N2BA 2JGLA 3FCEA 4HPWA 5LZ7A 4BBJA 1XNRB 1RYBA 4JOCA 2Q5FA 2I7TA 3K0KA 4LRUA 4IFIA 3A28A 2XCUA 1TCUA 2EJWA 3F5QA 2RONA 3H0EA 4R8KA 4XFJA 5KJCA 3L4SO 1RVDA 5LKRA 4NH0A 2BP7A 2I65A 3OEYA 2B8TA 4YRSA 3FDIA 2JGJA 2IU6A 1C3OA 3I52A 1KO1A 4LY0A 4YJ2B 1SUIA 4Y6LA 2ZJ8A 1E7YA 4YAUA 1JDTA 3U61B 5IT5A 5L7WA 1HZZC 1KEUA 1Q7EA 1Z36A 4BMOB 1UM8A 1KYYA 1Y4DE 2FZGA 2O5RA 4HATA 4XM0A 5DGXA 2VUHB 3DBHB 3ZZTA 4DTIA 4CLOA 2IS6A 2OFXA 2ZW9A 2DP4E 3TQHA 1NDUA 16PKA 2H9AA 3LX5A 5C3MA 1PN3A 5AHOA 2H16A 3EUAA 4J91A 3SLRA 3E81A 1FU4A 3WO0A 4YRGA 1XI2A 2YVUA 3VSCA 4C78A 1E9DA 1RWKA 1C3JA 3NBYC 4KRGA 5TMPA 1P74A 1W88A 1ZD5A 2Y1LA 3AR3A 1MABA 2J46A 4B6OA 1J7KA 4PQEA 1E2FA 3H84A 3CINA 1K4MA 2AFRA 3I34X 3CGGA 3O8DA 2R97A 4P4NA 4IXWA 4XVRA 2H2IA 4KYIB 4M46A 1MV5A 2F3QA 1KKMA 1JT9A 1U7HA 2JDIA 3RJZA 2IU4A 1FZQA 3TI9A 5C37A 4MYUA 1HTWA 1BROA 2G88A 2R6DA 4Z0NA 2GS9A 5IVDA 3HGMA 4MKZA 3T4PA 3VNVA 3OZSA 4EKNB 3IB6A 1CQWA 4D57A 4MV5A 1PVDA 3D2CA 3BL8A 3QI2A 1YUMA 1H3EA 4MKFA 4A26A 3TDNA 3WNCA 1GYRA 4GC5A 5T4HA 4EKYA 1RSZA 3IUNA 4JYCA 4CYMA 1NT4A 3V8QA 2PLNA 4WUVA 2E4XA 3KSUA 4TL6A 4LQCA 4TKUB 4G63A 2F9FA 4R7GA 3T7DA 2C8JA 3WXMA 4H1WA 4KIWA 1VSVA 2CHFA 5E1BA 4L0MA 2A0UA 2FGJA 5ICSA 1DBIA 1VG1A 4AB1A 4K8OA 4X1IB 5JAIA 4A5SA 1GGVA 1PK9A 3I0NA 4K03A 3D8BA 1ZOLA 3VHXA