4PYLA

Humanized rat comt in complex with sinefungin, mg2+, and tolcapone
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
b'TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
molecule keywords Catechol O-methyltransferase
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pylA00
2P40A 3BWBA 3T0IA 5DSXA 2GLUA 5KQRA 3HCAA 1EJ0A 3LKDA 1L9KA 3OE5A 4ISCA 3EVZA 2WA2A 4EVIA 3BZBA 5CCXA 1ZG3A 3TLJA 4GOOD 5EZSA 2AZTA 4PYMA 3GO4A 4CKBA 3A25A 1EAMA 1KPGA 4IV0A 4C04A 5BW5A 2VZ9A 2IFTA 3X0DA 3A4TA 3S68A 4JXJA 5K0LA 4IKPA 1VP9A 5B1SA 3M6UA 3TOSA 4FT4A 1RJGA 4DF3A 2OO3A 2WA1A 2HTEA 4HH4A 3M70A 4OA5A 5C9ZA 3ELWA 2O57A 1MHTA 2AOVA 5GWXA 3AY0A 2HWKA 1INLA 3EVGA 1XCLA 1L1EA 3G5LA 1RI2A 2ZBPA 3G88A 3MAGA 5EMLA 3DXZA 2UZ4A 1G8AA 2CWWA 4X63A 4V0RA 3EVDA 1UFKA 5DM2A 5FTWA 2OYRA 2NXCA 1N7JA 3EGIA 4RVHA 4UOEA 5GIPE 5FA5A 5DX8A 5GM2A 3LECA 1XDSA 3JWGA 2C7QA 2JG3A 1QYRA 3KPWA 1NE2A 2FCAA 5U4XA 2ONZA 4RVGA 3PB3A 1XVAA 1WZNA 5BW4A 1XDUA 3HCFA 5C0OE 2OPBA 4PYIA 2Y1WA 1TPYA 3KQMA 3AXSA 3V97A 4AZVA 3HA3A 3OZRA 4ER7A 5LQKA 1F3LA 1SQFA 5EEHA 4A6EA 1UWVA 4YUYA 3THSA 4RVFA 3MHTA 3BWCA 3NDIA 1EJ6A 2XYQA 2PXAA 3NWEA 1B42A 3LDFA 1SUSA 3HP7A 5GP1A 5K0NA 1ZKDA 2ERCA 2PXCA 5G02A 4EK9A 1NT2A 4QQNA 4FR0A 4PYKA 4BY9E 2PY6A 2ZIEA 3FTEA 3FUWA 2OZVA 2YVLA 5E1DA 1BHJA 3EVAA 4YMGA 4POOA 3EVBA 2ZFUA 1JR4A 4KVZA 1R00A 2BR5A 2JHPA 3KQVA 1NW5A 2FHPA 5HIJA 3ER9A 4FSDA 2H00A 4MIKA 5EQJB 4DKJA 2NP6A 1L3BA 3C3PA 2XBMA 1IY9A 5K0FA 2G72A 5DTQA 1ZQ9A 2V74B 4QPPA 4QQKA 4DCMA 2XVAA 2YX1A 3UJ8A 2Q41A 3H2BA 4E2WA 5K03A 2P3OA 4FGZA 5KS2A 3OCJA 1YF3A 2Y1XA 3V8VA 3TPZA 4OX9Y 3IYLW 4HSGA 4QVGA 5HFJA 3FRIA 3QOXA 3LX6A 3EVCA 3MQ2A 4LWPA 1U2ZA 3LCCA 2C7RA 1QANA 3CCFA 5HIKA 3C0KA 4DCGA 5ICCA 2ONYA 1NW8A 1JQEA 3GXOA 1XJ5A 2BM8A 1P1CA 4X41A 1X19A 3LBFA 1Q0TA 5HZMA 3NW9A 5JR3A 2G1PA 2P8JA 2VDUE 4FS8A 4RTQA 3TM4A 3VC2A 5LQRA 2ZZNA 5LSAA 2B25A 3A26A 3DLIA 3SGLA 1KYZA 3HVHA 1P39A 4DZRA 3KR9A 4HC4A 3NDJA 3OU7A 1QAQA 1I1NA 3FUVA 4ZTBA 5HILA 5ICFA 2PGXA 3P71T 2UYCA 3NVMB 4K6MA 5EIWA 1FP1D 2XYRA 2F8LA 1M6EX 2NXJA 4AZTA 1NW7A 3KQTA 4ATNA 3FYDA 3DP7A 4QDKA 3B7PA 4LECA 3LL7A 2PV0A 2GPYA 3FPFA 4YV2A 3LBYA 1AV6A 2AOXA 1RI5A 3M6XA 3GRYA 3OU2A 3OU6A 3UJCA 3UJ7A 5DXJA 3MB5A 3GRRA 3PVCA 4MQ4A 4F86A 1ORHA 2EJTA 1JG2A 3KQYA 3DULA 4RYLA 5DM1A 2OY0A 3P9CA 4YV0A 5CM2Z 3FTCA 1RJFA 1JG3A 5E8JA 1ZGAA 4DM3A 4PCAA 2BR3A 2O0LA 3HVJA 5FHQA 3KPVA 2G8NA 3R3HA 5K05A 3P8ZA 5GINE 4RTSA 2QRVA 1JSZA 2GH1A 2IIPA 1I4WA 2GA9A 1KPHA 2OKCA 3KKZA 4GEKA 4M38A 4PWYA 5C1IA 4HTFB 1FJXA 3PLAE 1BOOA 4E2YA 2FYTA 2AOTA 3OPNA 2AN5A 3AWIA 4KDCA 1QAMA 2QY6A 1N7IA 2QE6A 4AZWA 5CD1A 4B17A 4O29A 1VL5A 4CKEA 1SQGA 2AOUA 3UBTA 1FPQA 3KHKA 5EIFA 3DMFA 3ANXA 2CKDA 4PONA 1O54A 1YZ3A 4R8RA 3NMUF 5EHIA 3ELYA 5D1NA 1DUSA 3DLCA 3SMQA 3GCZA 3SSOA 2ZIGA 2AS0A 4XUDA 3LDUA 4FT2A 3CJRA 2P3LA 2PKWA 3IEIA 3G2MA 4RTNA 4KW7A 3EPPA 4EQZA 1SVUA 1XDZA 4RTMA 3TKYA 4BP3A 2C7PA 3UJ6A 4MWZA 2ZCJA 4QTTB 2Z6AA 3BGDA 1TW3A 2UYOA 2IGTA 2P7HA 3PTAA 3ERCA 2FRXA 3RODA 3DTNA 1OR8A 3OZTA 1RJEA 5F2OA 3UJBA 3FZGA 3I58A 3BGVA 4YV1A 1T43A 2VS1A 3HCDA 4C08A 5FWAA 4PYJA 5LQJA 10MHA 4YMHA 2ZW9A 3NTVA 3GJYA 1DL5A 4YUVA 3BWYA 4PGGA 5KQSA 2JHAA 3G5TA 1F38A 4RVDA 3TFWA 1M0EA 5EKXA 3UWPA 5DX1A 4RTOA 3LSTA 3CC8A 5DXAA 1O9HA 1TW2A 2YXEA 3R9XB 3ELDA 3EVEA 2NNWB 3EMBA 4X61A 5K0CA 4FZVA 5E2AA 3HVIA 5E9WA 3CVOA 1RI3A 4MHTA 8MHTA 3UJ9A 5DM0A 1Y8CA 2PLWA 1KHHA 3I53A 5FCDA 2ZULA 3AXTA 4X60A 1AQJA 2NP7A 5DSTA 5DX0A 1EIZA 3A7EA 1I9GA 1RI4A 2O06A 4IWNA 2B3TA 3M6WA 5ERGB 4BP1A 1G8SA 2HNKA 4CTKA 3BGIA 5E9QA 1WY7A 2JHCA 4RTKA 2P35A 3OFJA 1JQ3A 3E23A 4R6WA 1PRYA 3SSMA 3HEMA 3G2OA 3E8SA 3I9FA 1BKYA 2OBFA 4PIMA 5CCBA 2JJQA 3GWZA 4HG2A 5EMKA 3JWIA 4OQDA 4DMGA 3THRA 4GC9A 3KQWA 5FWDA 4HGYA 4PYQA 4WXHA 4PYOA 4QTUB 2R6ZA 4XUCA 4YUXA 3HA5A 1QZZA 1X1BA 2IDJA 3TM5A 5CVJA 5EMJA 1ZGJA 5CVEA 4GF5A 2PWPA 3LCVB 4RTRA 4PGHA 5K09A 4QPNA 2ZZKA 3K0BA 4U7PB 5EZQA 3A27A 3VC1A 3NJRA 3G8BA 3R6TA 4RSRA 5E1MA 3C6KA 5E2BA 3CKKA 4A6DA 1L3IA 5LR6A 1X1CA 3P97A 4L7VA 4CXMA 1QAOA 5HIIA 4XCXA 1D2CA 2ZIFA 4KIFA 4RV9A 3SXJA 2PX2A 3SVZA 2LD4A 3BWMA 5DTRA 3AJDA 1HMYA 3KR1A 2G71A 3L8DA 1NV8A 5DRYA 1JTFA 3TQSA 1HNNA 4EMSA 2IPXA 4P7KA 3CBGA 3FPEA 3UJDA 4C03A 3UA3A 3HTXA 2B78A 2PT6A 3EGEA 3D2LA 3ORHA 3KQQA 5BP7A 4XUEA 2VP3A 2ZBQA 1AF7A 3OFKA 5LQNA 5GOZA 1SG9A 5K8VA 3LKZA 2HMYB 2I62A 2O05A 3CJTA 2G70A 2ZBRA 5ICEA 4DA4A 2IBTA 3DXXA 5FUBA 4E2ZA 3EEYA 5EPEA 1FP2A 2GB4A 5K0JA 2B9EA 4RTJA 3IV6A 3FYCA 3PX3A 5DT2A 2PSSA 5CUQA 3QV2A 5DLYA 1WXWA 1D2GA 1AQIA 4AX8A 4M37A 5JUWA 3LPMA 3DUWA 3T7TA 5T67A 3FPGA 2YR0A 2YTZA 3EMDA 3Q7EA 1KYWA 3BKXA 3HCEA 4KRGA 4PINA 5FULA 3SM3A 4KWCA 5E8RA 5HEKA 2A14A 5KYGA 4WVLA 3PX2A 4RTPA 3K6RA 4OQEA 3KR0A 4MTLA 2I9KA 3G2PA 4ER0A 1R6AA 2FK8A 1YB2A 3DMGA 4FP9A 5E1BA 4AUKA 1R18A 2XYVA 1KR5A 1R74A 2OXTA 2BM9A 3NWBA 3R24A 3ELUA 4BLWA 5CVVA 2UYQA 3O7WA 2PBFA 2B2CA 3PS9A 1NKVA 4GOLD 1M6YA 3KQPA 3RW9A 4RTLA 5P8WA 3BUSA 4PIPA 4CWAA 4PCLA 5M5BA 3SR4A 5CVUA 3WSTA 1KPIA 1PJZA 1VIDA 3MTIA 2JH8A 4ER3A 7MHTA 2PX4A 3BXOA 3KPUA 4PYNA 2CL5A 5HOQA 2XVMA 3OE4A 1EG2A 5K01A 5K0BA 4P7GA 3BT7A 2ORED 3MCZA 1G38A 4E2XA 1NV9A 4M36A 2P41A 2NXNA 4R8SA 4E32A 1IM8A 3DH0A 3FUTA 3GNLA 4DQ0A 1YFLA 3UA4A 2IDKA 3I5UA 4LWOA 1KIAA 5IH3A 5H02A 2HV9A 1YZHA 1WS6A 2HR1A 3REOA 5DPMA 3E05A 2ZSUA 1DCTA 2AN3A 1VP3A 1VE3A 2IH2A 3B5IA 2E5WA 5EKUA 5MHTA 2Z6UA 3LCUA 1X1DA 4KIGA 4EKIA 2QRVB 4OBWA 1RI1A 3HA7A 4GBED 1RJDA 4P7FA 5F2NA 2ZVJA 3ER8A 2ESRA 1KP9A 2AOTB 4HGZA 3DR5A 1XCJA 2OB2A 4G56A 2ADMA 2NYUA 3KQOA 4QDJA 2PWYA 4P58A 9MHTA 2AOUB 4AZSA 1NW3A 1UIRA 3EVFA 5FQNA 5IKMA 2AN4A 3JWJA 4ER6A 3KQSA 4BLVA 3MTEA 3MCTA 2K4MA 3PT9A 4F85A 2YUIA 2ZWVA 5LQCA 2ZLBA 4EKGA 2PX5A 3SSNA 1X1AA 2H11A 2N47A 2YXDA 2AR0A 2WK1A 3KU1A 2R3SA 2OB1A 4RX1A 3C3YA 5FHRA 1JQDA 5FQOA 5DTMA 4YUZA 3FTFA 2Z6QA 3KPYA 1SUIA 1XTPA 2YXLA 2IH5A 5E9JA 1JG4A 3M4XA 5GM1A 3CGGA 3G2QA 1IXKA 3B3JA 2PT9A 4LG1A 2AOWA 2YQZA 3FTDA 1BC5A 3HM2A 2FPOA 1VLMA 3TR6A 1VPTA 5EHGA 3EEOA 1JG1A 1EQAA 2CMGA 3FUXA 2I7CA 3CJQA 3GDHA 3ID6C 2P3QA 2O07A 4IV8A 5D1HA 5EC8A 3O31A 5FADA 1YUBA 3GRUA 4Y2HA 3GRVA 3Q87B 5E1OA 2JH9A 5KVAA 3R0QA 2AVDA 3P9KA 4E31A 2KW5A 4NECA 3DXYA 4Z2YA 1FBNA 2IP2A 1JTEA 5FA8A 3O4FA 3F4KA 3G89A 3GIWA 4E70A 1ORIA 2BH2A 3KPJA 2UYHA 1D2HA 1WG8A 2DPMA 3HNRA 5CIYA 3P2IA 1YFJA 2FK7A 4GUAA 3FRHA 5EOVA 1NW6A 1R8XA 4OA8A 3SX0A 1NBHA 3LGAA 3UJAA 2C7OA 3FPJA 3P2KA 2EG5A 3A7DA 1Q0SA 5BXYA 4X1OA 4CKCA 3NVKI 1P91A 4E33A 2IH4A 4C06A 3IHTA 2I6GA 3GU3A 3VYWA 2QYOA 4GOND 4RWZA 5T6BA 5T64A 3VSEA 5LQUA 2H1RA 3DMHA 4YUWA 3ME5A 4BLUA 4R6XA 3OZSA 2VDVE 3PFGA 3KR2A 3B3GA 3HCBA 5EG5A 2IBSA 5LQAA 4Y30A 4KDRA 3M6VA 4HTFA 3DOUA 2GS9A 4GOMD 2PX8A 1L3CA 3UZUA 5K0GA 1XXLA 1ZHFA 2ZZMA 3E7PA 3I64A 3LHDA 2VDWA 4HRAA 3FPHA 2QM3A 1SKMA 2PJDA 1Z3CA 3HVKA 2BR4A 5EVJA 4ER5A 3QOWA 3MERA 5GIOE 3U81A 4CTJA 4M7RA 3HCCA 5DM4A 1JSXA 1NBIA 4F84A 3GRZA 3T7RA 5DWQA 3TRKA 5K0EA 3UFBA 4V0QA 4C07A 1VQ1A 4H0NA 3RIEA 3T7SA 5F2KA 3TKAA 4U7TB 1R8YA 3C6MA 4OBXA 4C4AA 1G60A 5CVDA 2GAFA 5EEGA 4PNEA 3P9NA 4P7JA 1KXZA 3BKWA 3TMAA 1P1BA 2P7IA 2PVCA 2NXEA 1O9GA 2CMHA 5DRTA 3LDGA 1H1DA 3P2EA 2V7EA 2ZTHA 4FSXA 2AVNA 5HIMA 3B3FA 5ICGA 2P1DA 2ZWAA 4GQBA 1WXXA 2PXXA 4QVKA 4E30A 2EJUA 3PFHA 1G55A 3P9IA 2BZGA 2DULA 3MGGA 1VBFA 1V39A 5EMMA 3JWHA 4GC5A 4R05A 4C05A 3FUUA 1N2XA 3B89A 2EFJA 3G8AA 1G6Q1 3M33A 4PYLA 3G7UA 1MJFA 3GGDA 3EGVA 5EGSA 2EX4A
chains in the Genus database with same CATH superfamily
1DMRA 3R9XA 3AUUA 1T1JA 2O3JA 5DSXA 3H9JA 5I9SA 4B87A 3IKVA 1M0WA 2FWBA 1GZSA 1LLDA 1MJGA 1Y33E 2GZDA 3GZTB 4NBUA 4XM1A 5TRTA 3WMEA 1SOAA 4JKOA 1Q84A 1AKUA 1A9YA 1KJJA 4CODB 4Z1OA 2ZP1A 5CLFA 1X1RA 3D4LA 4K6FA 2KBFA 3PQFA 1U94A 2UYGA 1IJKA 2ADFA 3IDSA 3OD1A 1P7ZA 2WAXA 4BNWA 3MC1A 4MO2A 2K5UA 1FZQA 1UDRA 2XKJE 2IFTA 4U9HS 4Y9TA 2PUWA 2Z5FA 2HRBA 2MJLA 2BW0A 3MRXA 4WGGA 5KYYB 1WTCA 4PFQA 1CJTC 1HYBA 3WGKA 4O2AB 2DLNA 3IP3A 2R7NA 3W4KA 1TAQA 4UU8A 2FAXA 3Q72A 3H5NA 4YFYA 2WAAA 3KSAC 2QHXA 3L5OA 1HA3A 1QV9A 1RVDA 4GPEA 4XCVA 5FF9A 1ZCFA 2DR2A 4EG4A 1XTRA 3H2IA 4WXEA 2H1OA 4GICA 5HGJA 3AQ4A 2VPZA 5JQWA 5CW1A 1HH4A 1IDN1 2Y76A 4TKUB 3UV7A 1E3QA 4XWKA 4P0PB 4RFSA 3RBAA 4AIIA 4QAQA 1C1XA 1AO3A 1K6IA 1RRKA 1E9CA 2L18A 4G89A 5TGTA 1SXJA 3ZV6A 2R1TA 4AF7A 1IAQA 1YOVB 3R41A 4Q5IA 2Y1FA 5A9TA 4AZVA 3HYSA 4HWRA 4LQDA 3ZVLA 2PZFA 3C2QA 3K0FB 1QH1A 4MRSA 5KINB 4DEYA 1FLNA 1MC5A 2OGZA 2HJSA 3QPWA 1N4DA 3X43A 5CDUA 4MJ7A 3H17A 1NLMA 3EC2A 4LZLA 2UXDB 3UUGA 4FR0A 4BLPA 4D57A 2A9KA 4B0OA 4TV9F 4JUAA 1P1KA 1R0WA 1DT3A 4XJVA 4RHTA 3EVBA 4BKRA 1NF9A 2ATXA 2IOQA 2JHPA 2PJUA 2RIPA 3GZ4A 3Q7PA 4KODA 5AICA 3UMMA 3OF2A 1EGVB 1FX0A 4JYZA 4R1OA 4R7ZA 4R1MA 2QQ5A 3S3TA 3THYA 1KI6B 1YDFA 4NZYA 4W5TA 1IMOA 1S3IA 3VDQA 4ECEA 3ZE9A 4G8JA 4HLUC 1LSOA 4S1VA 4G0UA 1EP3B 4YR7A 4Z49A 1VJRA 2XGGA 5J4VA 2FW6A 3T7DA 2GBCA 3LUGA 5D7BA 1EK1A 3H18A 4AXBA 1C9JA 2VJAA 1XRSB 1FP7A 4BCBA 5HX7A 4NPAA 4OHOA 5HXAA 1OAKA 3OCCA 3LX6A 5IZ4A 2YIJA 4OI4A 1NPYA 2CZQA 4ZZ3A 1N1MA 4BHTA 2L69A 2FPGB 2QN2A 1NAIA 1BNCA 2P4EA 1XJ5A 2GNAA 2CLKB 5JFGA 3SQWA 1VHDA 4FS8A 1Z0DA 5JNTA 2ZJ2A 4HZUB 2JKYA 1I3KA 5F1KA 4QUIA 2FWMX 1GY8A 1ZNYA 3P9ZA 2DAPA 2HIGA 4K9RA 3E4CA 1FVHA 3D54D 4I1SA 2FQXA 4LGVA 4ZAWA 1GRNA 2FW7A 4RMNA 4BJ6A 5LP6B 3I92A 3GJ4A 4PSVA 3NNSA 4K6OA 4K9OA 4Y6GB 1LEHA 5ELLA 1LBQA 1B8OA 3Q3CA 4Q82A 4CV1A 2I4LA 2B83A 1N2SA 5CJPA 1K3FA 3AUAA 3FX2A 3LBYA 1T6XA 3UJNA 4TVBA 4G3XA 2IYVA 3ZGNA 3W90A 1X9HA 2A5GA 4G0PA 1ORHA 4B31A 3B9QA 3L07A 1JHVA 1L7MA 3AO0B 1PUJA 3H19A 3PRKE 4L3WA 4EX6A 2WDZA 5CM2Z 1NF8A 3OZFA 1T5TA 3PFBA 2WVGA 3HDTA 1E1DA 4Z0NA 4HFRA 3HJFA 2YH2A 4PO1A 2R84A 4XGQA 2JD0A 1ZEJA 1POWA 1TK2A 4X65B 1QBGA 1ZD8A 1D3AA 1D0VA 1YB4A 2GCGA 3L8CA 5JNRA 1KH3A 2XR1A 1UZUA 2H0QA 4L0MA 5IMSA 1XD8A 5F9FA 5JS8A 3MMPA 1RYHA 4TN1A 2GYUA 3DOHA 1X8XA 1W5EA 3KHKA 3UT5A 3MD9A 3DMFA 5JZMA 4I19A 4IHAA 1O54A 1QOZA 2X0RA 4CRWB 3DGFC 5C5EA 5JJIA 4FYPA 2I8CA 2NU8A 2IP4A 5KYXB 4BQFA 1TCBA 2WYUA 3FYHA 2O7VA 3K9WA 4RHEA 1XZPA 1PL0A 3QG1A 1GQOA 4HF7A 2GA8A 2OO7A 1CW2B 1ZEMA 3RS9A 5CD1A 1HLPA 4ENQA 4QGGA 2NU6A 3H1AA 3ESQA 1ZJ6A 1P3JA 2BCJQ 3OZIA 3IKMB 1N2EA 5EE0A 4BP3A 1B76A 2QG4A 3PDIA 4PHFA 4Y98A 3U5ZB 1UK8A 4NWIA 2FRXA 1PCXA 2FPLA 2XTJA 2Q6KA 1M2VA 3HLTA 2QSZA 3LUCA 3JYQA 2R6CA 3FNBA 3R5TA 4GAEA 3ROFA 4BV9A 4CMEA 4NNPA 2YJGA 1SUEA 3BS4A 3D1JA 1QMPA 3LQRA 2X4DA 2K7FA 3GVPA 2DWUA 1FRQA 3GVIA 3WLMA 4B7UA 2B2NA 3EQ2A 1Z5VA 5EIOA 3ZW9A 5D87A 2ZAGA 2XNSA 2AT1A 2R7KA 3E6AA 3EXEA 3KO8A 1V11A 2ID4A 3OP1A 1X38A 3GJ3A 3ZLUA 4EY8A 4J7AA 3SXUB 3ZXIA 5MDHA 1HDIA 3EIQA 3HJTA 2JRLA 4FZVA 2DH5A 4YJKA 5DEIA 1XD2A 3I37X 4AZ0A 3WGIA 1Y3CE 4QBGB 5AKEA 4HNGA 3CT6A 2ZJ3A 3N5CA 4LJLA 3IUEA 3EH2A 2HSDA 4JWKA 2K87A 4PRLA 4CMIA 4ND1A 5B3AA 3K6SB 1NZJA 2Y1OA 4RTKA 4CTKA 3I8SA 2Q7OE 5BUSA 2Z43A 3CW8X 3DBRB 3OIUA 3CRVA 1PU2A 2W6NA 4FD3A 2LBPA 4JEIA 5J1TB 3AVTA 1GUZA 1JTVA 2EC5A 3G2OA 1IY0A 4BMOB 3VSDA 3K2IA 2VDQB 3RB8A 1JBEA 3T4UA 5CFRA 5A2GA 2ZRNA 4L08A 1FRFS 1Z6TA 2HU7A 3ZDQA 5C7OO 1QGZA 2HPVA 4W82A 1IUKA 4FYJA 1VPDA 3WMRA 1R0ZA 3QVUA 1HDGO 1RC0A 2BUAA 2OE2A 3BGSA 3KQWA 2OHXA 3LUHA 3LY8A 3TUJC 4R2IA 4X20B 3R9IA 5BWBA 1KMHB 2OUKA 4PYOA 2O5CA 2RHWA 2VF7A 4L1KA 1ZZEA 4PPFA 5AW9A 1PW7A 4D3ZA 3QKSA 4PLCA 1YR8A 3FFBA 2ZZKA 1RBZA 2ZK7A 4GPAA 1U28A 1EFPA 1MEEA 4OLHA 3C6KA 3N1UA 5HNKA 5CURA 4I4TB 2B6NA 4AN4A 1N2IA 3F6YA 2I03A 4AYWA 1U31A 4CXMA 2XZDA 4LV6A 4B3TB 2QRNA 1XIVA 3L05A 4ZO7A 1OJ7A 3M49A 3ZW7A 4DWJA 4MHSA 4RV9A 2ZM6B 2P78A 3K35A 1ZUNB 2GN4A 1HMYA 2GEBA 2LCIA 3QTTA 5EKDA 2X58A 5DGIA 3JVDA 3D8UA 4BO9A 4A8TA 2O3SA 1PJQA 4INOA 4IICA 5HZGA 3LKBA 2B34A 3N3AC 3I6IA 3ISJA 4PC3A 1CS0B 3HG7A 2B30A 3TL3A 1B2RA 1SG9A 2Q2NA 1XRMA 1WSDA 3QE4A 4O4LB 3NTUA 4UD2A 5DH9A 4D8UA 3W5SA 2JGRA 1BQEA 4QOJA 2XNCA 2BONA 2Q27A 2AMFA 4V0LA 4OHZA 4B3CA 4DLRA 4ZFNA 1V7QA 1Z4OA 4NZOA 5A3JA 1E32A 5JQGB 1H85A 3QRWA 1NXPA 1ZIYA 1HBJA 2ZWIA 4W99A 1T5HX 2VK1A 5IJAA 2KX7A 2WD8A 2P77A 2R47A 2BSAA 5KAPA 3A2LA 4U6NA 4PG6A 1A1VA 4YP0A 3GJ6A 5DCUA 3V4SA 3ZK8A 1VBKA 4BVJA 3T7TA 2X15A 4WY2A 3FPGA 1T0PA 2IL1A 1RRPA 4WN9B 5L3SA 2C84A 4HSEA 1U8UA 4X5OA 5HQJA 5TPZA 5J2UA 3CB4A 2QT0A 4QFCA 1T9CA 4LZNA 2G4LA 4KV7A 3STWA 4BP9A 4L57A 3WL6A 1E6WA 4ZT6A 3R4VA 3N74A 4DJTA 4YXFA 2AUTA 2YMQA 1WWKA 4JI4B 1T9HA 1Z62A 1Z74A 2GPTA 2O2CA 3AR9A 3PCTA 3OTOB 3R24A 3OFSA 1CJMA 2X13A 3PR2B 2HT6A 2PBFA 3U13A 5CTAA 1SU8A 4IIXA 4FFSA 2RI0A 2J09A 3DQZA 1C9MA 2WTBA 5ERXA 4DLBA 4Y2TA 8GPBA 3Q8LA 5DKFA 5BN1A 1J0BA 2JGLA 1F4VA 1KAGA 1ZN8A 3AI3A 3W5DA 1Q1ZA 5IM4A 1EVZA 1T3ZA 2ZRIA 1S3GA 2WMOB 5B2FA 1LK0A 3YASA 5IEJA 4RENA 1N5JA 1I3CA 4IDOA 3WBBA 4K9PA 5AM1A 1RQNA 3IAUA 3O4HA 3NG1A 1YZHA 1RQXA 2NZXA 1UMBB 4YRNA 1DBIA 3BXGA 3TLKA 4DGQA 1H5NA 5K3FA 4DLXA 3W79A 1RMTA 1GYQA 3AM1A 4P7FA 4ZAGA 3QBVA 2XOEA 4RETA 1Y1LA 5FBHA 4URHA 3ER8A 1IJEA 2AOTB 3OOYA 2Q6LA 2X5XA 2D59A 3DR5A 4C4XA 3IMCA 4PQFA 4QDJA 4I9UA 4XD2A 3GOQA 4F4JA 4NENB 1J1ZA 1EUDB 3FNRA 3IDOA 4M55A 4QGBA 4CKEB 1E9AA 1I13A 3UOAB 2HRZA 3KKQA 4RK4A 4RIFA 3VU0A 1X39A 1Z4JA 4JBNA 1CCWA 1NBMA 2H9IA 4R7TA 2X40A 1Q16A 3FSEA 1IYZA 3RVOA 1DTWB 2IHYA 2WJGA 3NI2A 4Y2RA 4QKQA 4BO2A 3H5IA 1CQXA 1B8VA 8AT1A 4X1IA 3ONEA 2BSQA 3G6WA 1B00A 4QREA 1PP4A 1OI4A 2GN1A 5I9TA 5JSZA 1JKJB 3QMWA 4Y2QA 1GTSA 4OL9A 2NO9A 3HH8A 4JAVC 4DFDA 3ZU4A 1NASA 3L7IA 4BX0A 5FHRA 2P2SA 4WOKA 4BZPA 4LF7B 5E4FA 3E7FA 2BFAA 1N3YA 2CNDA 2V03A 1P7CA 3LIIA 1YNSA 1NL3A 5EKTA 3WWYA 5E9JA 3S28A 1HZZA 1T4BA 3ZHRA 3G2QA 4NF2A 4KMSA 4YAFA 2MMGA 2QAJA 1PW5A 3K8YA 4XVHA 3WV4A 4U0JA 1UDBA 4EAAA 4CEHA 1AN0A 4D8TA 4IV8A 1E2GA 2AD5A 1KDPA 1SULA 3QXHA 4TX1A 1PEYA 6Q21A 3O31A 5FADA 1ISPA 3IO3A 3R3WA 4ZYVA 2B37A 2PVSA 1CLEA 1UBEA 4CU2A 1KI4A 5J2TB 4MV5A 3G9UA 1K1EA 1QM5A 1SUPA 4GD3Q 4CQLB 1N25A 2BH2A 2NN3C 3KPJA 3TOZA 2L2QA 3D2BA 4MHOA 4JB2A 4MUGA 3HJGA 1NBHA 4LJKA 3W3AH 1W2HA 5AD1A 3U60B 5HVNA 3H5RA 3BIJA 3VR6H 4JLOA 4QLAA 4I1OA 2BVNA 1N1EA 1V4NA 2IH4A 3AK4A 2O2IA 1R0YA 3Q0TA 4FDLA 3H2JA 4ENSA 5LOVA 4CYMA 2VUIB 4D4KA 1P5RA 5FTLA 4QM7A 3K53A 4LYYA 5CEJA 2PT5A 3MSCA 3QFRA 2HA5A 4JT4A 5EG5A 5HW0A 3M5CA 2ZT8A 3P2OA 4N40A 2O52A 2A78A 1IWBB 4HTFA 3W5JA 4QE3A 5JYCA 4PE5B 4FI3F 3IBSA 2D7JA 3U3JA 3VUEA 2F6RA 1PTKA 3NKVA 3U49A 4TM7A 3EJ6A 5BNZA 4D0LB 4KQEA 1YRHA 2I33A 5F3WB 4X95A 4MEAA 2Z2IA 4J0FA 1JAYA 1LDNA 3HVKA 3ZZ1A 1PN3A 4R71A 1YA8A 5DCWA 1ISRA 4POAA 4CDMA 2UVPB 2GPBA 3CISA 4LRUA 2W4IA 2EARA 5DWQA 5BSUA 4ZOLF 3NGMA 4RD4A 1T24A 1E3DA 3WX0A 3I9KA 4AMZA 1T8PA 2C4UA 3ZIAA 4U7TB 3CVJA 3NUZA 3C6MA 4R9VA 1SXIA 4DYVA 1E0JA 2ERXA 3JW8A 3KOZA 3BICA 3V6MA 3ZI4A 1W94A 3S2EA 4DABA 1A8QA 1U0SY 5J63A 3B8EA 3KVRA 1FMLA 1PGOA 2ZTHA 4P80A 5DNWA 3VPDA 4DHWA 1Y63A 2H92A 2ZSAA 5LXTF 2H31A 1LTKA 1NGSA 1P17A 1WXXA 2X0JA 3EGCA 1NF2A 4JI3B 4E6EA 2JIPA 2GXQA 3D8TA 3PU6A 1RM5A 4B3XA 1T91A 3UHJA 4R05A 1KQPA 1WPRA 1JNXX 5H80A 3RTCA 1PJAA 2ZSIA 3HLYA 3G7UA 2I29A 5JJCA 1X74A 2ZXUA 1LS1A 2PPLA 4B43A 3BFPA 1EFRD 2WFMA 3OE5A 1EVJA 3EVZA 2XY4A 1UJ2A 4Y7CA 3DO8A 2XZLA 1AV7A 1QGOA 5ALMA 2A5LA 1VE6A 2RBGA 3O8DA 4Y9RA 2AZTA 2ZYHA 2BEVA 3SHFA 3U1TA 2NIPA 1KS2A 4G4JA 5IDYA 3WS7A 4QTYA 2ARKA 2C1ZA 1OH7A 3DE2X 2NZWA 1PJTA 3D4PA 3KB1A 1Y3DE 2HO5A 3BREA 3WDLA 4EYQA 2ODNA 4JU9A 1RJGA 1X15A 3BMXA 2JIQA 3M6MD 5UKDA 1ABEA 2H1HA 5I51A 4RA6A 3ZS9A 2BGMA 1LQUA 1H05A 1Y1SA 1FFCA 4JQZA 2VDLB 3A6KA 5A7FA 1AK2A 1TDJA 2RHRA 3ZBTA 2BSXA 3DM5A 3DXZA 2CWWA 1K27A 1YD7A 4QTXA 1VI2A 3ESXA 2H5LA 5DHTA 3VZDA 5I8WA 1RDFA 4YREA 1NZDA 4H1TA 4GR9A 3WJ1A 1CBUA 3KPWA 1KMQA 3RSHA 3TLAA 3DFKA 4EBFA 5BW4A 4XRRA 4EG1A 2OFWA 4IDBA 4JVLA 4YN3A 2J5XA 3JU3A 3IDAA 4DY6A 2EF1A 1W36B 2QYSA 3MJVA 3THSA 3B78A 4BB6A 2FJUA 5HFNA 2X14A 4A73A 4LZZA 4WK2B 4IDQA 2E18A 2C5SA 3D6VA 3LQ4A 3NHZA 1S7GA 5NULA 3WICA 4YPOA 1J9GA 3E7XA 3SR0A 2OZVA 4YMSA 1PFQA 1N0VC 3CUVA 2WG0A 4JOQA 1JR4A 2BR5A 1UFVA 4YYZA 1XNJA 4A36A 1VL2A 1P9WA 1SBNE 3AETB 3LM8A 4U7GA 3TGWA 4UVIA 3MILA 1E61A 3O4GA 2E21A 4M2LA 4P7BA 3GLHA 3S55A 3W6NA 3ZDFA 2F1HA 4BB9A 5K0FA 5BMOA 1N6NA 1RPJA 3ZNNA 4UHDA 1JAHA 4UNSA 1QGED 1X7YB 4TMFA 3U4AA 2FQYA 2R6HA 3WWOA 4HPWA 3TLBA 2G1AA 4ZWNA 2H1IA 2OCXA 3BH6A 4G8DA 4MWGA 2MCFA 3TLMA 5JPCA 2FR8C 4Z4EA 3GR6A 4P4LA 2FPXA 4JOCA 1VDMA 2ZOSA 4GOKA 2IYXA 2YW9A 3OCJA 5FTNA 1RHKA 1NWHA 1GGMA 3IYLW 1GL3A 3KUUA 4QVGA 3TW8A 5CLGA 3DTVB 2JLWA 5EJAA 3D7MA 4KQGA 4HYYA 1B7GO 2G9ZA 3MT8A 3KP1A 2HDWA 3R0VA 2LDBA 1XYVA 2WPDA 2YNMA 4FEYA 4XA8A 4PIVA 3RF7A 2JIRA 3UXMA 4YK7A 3EJWA 1NW8A 1YZTA 2QJFA 1S02A 2RIRA 4JA2A 3RG2A 4CCWA 4D9FA 2EOAA 3EPJA 3H1TA 3IAS1 4WNIA 4XZ3A 1WD7A 2IIBA 3AG6A 3B52X 3H16A 5J5CA 1AA6A 3EOBI 2EBFX 4GI7A 3EX7C 3BCUA 2JD2A 4DDVA 3QVLA 2IE8A 4LJAA 1GQYA 4RMGA 3PGXA 4FE3A 2NU9B 3HCRA 3HUDA 3S2GA 3ICPA 2O1XA 1C8LA 3ZV4A 5IKXA 3NLLA 2Z56A 5TV2A 2YWJA 2Q3HA 3NBXX 4LBYA 3RSSA 4ASUA 1DDIA 5JASA 1DS6A 4LFBB 2J4DA 2Q5CA 4ZJZA 2XDQA 2HZBA 1RIFA 2Y0DA 3WL3A 4GZMA 1FQWA 1AV6A 3SZUA 1KJQA 2HTFA 3UJCA 2XXAB 3K31A 3OU6A 1YGYA 2IYPA 2BY4A 3C3DA 1Q1QA 1SCIA 1YJ5A 2POCA 3G23A 1SOVA 3PVCA 3CUWA 3QQPA 4RIGA 5BORA 1PJLA 3I3OA 3BBLA 4HGPA 2VJDA 1M67A 2Q0QA 1KO5A 3DZDA 3ZH9B 4DV5B 1E5QA 4PCAA 2O2GA 3GNQA 3LRPA 1C7EA 3OIFA 3R3HA 1KA9H 1IG3A 3HB1A 3G2LA 3HYTA 3QFSA 3L02A 1I4WA 4RY2A 1KPHA 1R16A 1BE6A 3QVKA 4C6RA 1BHSA 4OGWA 4RELA 2C97A 4RPHA 3LAWA 4O2BF 5ECYA 1OLUB 4NMLA 5CJ2A 1XN1A 2SCUB 4AG6A 4LV5B 1S9HA 1U8FO 2FQ1A 3DE7X 4WZ6A 3ETHA 2B4RO 2FX3A 1JIUA 1XKQA 4ND2A 4XVRA 4QL3A 3TPFA 3UCEA 4F3CA 1RVV1 1D4OA 2ZIGA 3TJRA 3SMVA 1ST3A 5FD8A 5BSMA 3TPCA 1DQRA 3PR1A 1YZGA 1HETA 1KK0A 1EE9A 4X1YA 2IZ7A 2EWWA 3DLPX 1JVSA 4XPIA 2ZCJA 2UXCB 4JELA 2I1WA 3HUUA 1I0LA 3H2GA 2YY5A 3LBIA 3RC1A 1P1HA 5EZ5A 3UAYA 2IY9A 4PN3A 3OZTA 3SOPA 1XT6A 2QRHA 4MWCA 2D5LA 2XOKD 3E58A 1R12A 3I58A 1EX7A 1JEQB 3IILA 3CN7A 3K0HA 4NPHA 4OF4A 4S0XA 3ZXXA 4EARA 4YV1A 2IHVA 4DRXA 2ZUDA 4YMHA 5BWCA 3BF7A 2BEUB 1MVNA 3EEQA 3N53A 1VYTA 3NU1A 4ZREA 4F1KA 1K6JA 3L79A 3A8TA 5TX7A 4EUNA 4F56A 5KQSA 1A9QA 1XHFA 1RCTE 1RMQA 3HXPA 4M99A 3AHFA 1X94A 2BFCB 3ZU3A 2E4VA 2VYFA 1CUYA 2YOGA 2WF8A 4Y9DA 3SKVA 3V8MA 5CEEA 1S2LA 1P31A 4N0DA 4V03A 3U3RA 4X61A 3KJHA 1A8IA 1UEXC 4AKGA 2LRHA 1Q12A 3FOCA 5JC8A 4MK4A 1LRKA 2IY8A 4EMUA 4FQ5A 4LXXA 2PLWA 1KHHA 3K20A 4UTZA 5TQJA 3PXUA 3UQZA 4CPDA 4HQOA 1G41A 1SK8A 3HDHA 2PK3A 1LDGA 1RFLA 3JQ7B 2MDTA 3VDMA 1BDBA 4CCAA 1OREA 3ZLJA 1QUEA 3TZQA 4CEJA 4II3A 2E82A 2JHCA 3R3VA 3DD5A 3FM9A 3T5CA 3VOTA 1WZ2A 3A05A 4DJ5X 1CSEE 3MTBA 5CM9C 2B7CA 4I4CA 1KJZA 1XI2A 4WK6A 3HEMA 1YTUA 1QU3A 3LHFA 1NVVQ 2O5RA 4LOIA 1QTIA 2P9CA 4U2BA 5JS1A 3KYCA 1B1CA 3LPNA 3D6TB 2WYWA 3K72B 5HDQA 1W4LA 3MGCA 3PJEA 1L1FA 5AM3A 2NUPB 3QHQA 1EUQA 1P18A 1IL0A 3D6HA 1WDWB 4HRVA 4PYQA 2VQSA 2P27A 2I55A 3EXHC 1U0TA 3F1KA 3WAJA 2BUBA 1COWA 3WLIA 4P92A 3FWYA 3QQ5A 3KEOA 4JSYA 3PGA1 4EHHA 3UHOA 3TM5A 5EMJA 3RJTA 1XTJA 5EN4A 2DSNA 1Z2PX 3JQGB 2WQZA 1FDOA 4F46A 4U1RA 1LC0A 1PWXA 3TDKA 1KNQA 2YASA 1DKLA 1ONSA 2FZCA 3N7AA 4J29A 3ZDZB 4Q1BA 4HVAA 4BUJA 4RF2A 1LB1B 1QAOA 1UK7A 2QLNA 4FYHA 4IDHA 2X3UA 5ALXA 4I08A 5A5GA 1BH2A 4RAQA 4G8BA 1GFWA 1Z4MA 3OO1A 4L4ZA 5PGMA 3AJDA 2B7BA 4TVOA 5JNVA 1NV8A 4DIUA 4KUEA 4RXMA 1XCBA 4AULA 3HJNA 1U2DA 1GNVA 4M88A 4NK5A 3TTSA 1PFYA 1ZJZA 1YO6A 4FNAA 2IU0A 4NC9A 4LDJA 3AERB 2DX7A 5I48A 2ZBQA 1FTQA 4E2FA 3PNYA 2BE9A 2P9TA 4Z9BA 1T4GA 1U7WA 2VC2B 4UHHA 1L5LA 3SJUA 4DM7A 2IBTA 4YAOA 5M29A 3CY6A 1TU0A 4LXUA 3KSBC 1E3SA 2DG2A 2B9EA 1ST2A 2ZT5A 1EWKA 3CEPB 3L6BA 2I6QA 3N2IA 1XMPA 4S1NA 5LUAA 4D9BA 1W7AA 5CUQA 5LFAA 3O94A 2X9LA 3DCNA 5CBKA 4F12A 1VCOA 3QKRB 2NUTB 3RLFA 1TM2A 1YACA 5BT8A 3VDXA 3KFVA 4H7EA 4ZDKA 1QGYA 5T67A 5BN4B 5KMGA 3Q7EA 3ZGVA 5DF1A 2J5RA 2Q21A 3GNSA 4FHDA 3SM3A 3WJAA 4CLEA 2GLTA 4X1KB 3FVQA 2O6HA 3IQZA 4Q7EA 4X8OA 5BQXA 3O82A 4CQJA 3G2JA 2FVYA 2FSIA 2WJIA 2Z04A 4BGIA 2XUDA 3DL4A 3TLEA 1PZNA 2VTKA 4Q1FA 1QYCA 3SZMA 4FP9A 3TGPA 3J7TA 2PGDA 3FZQA 1KR5A 2MYNA 4IYJA 1K97A 1DJNA 1YJBA 4B3MB 1I7LA 5B7QA 1TQDA 3FPBA 2PSHA 1RXYA 1QFSA 4ZVQA 3UGQA 4PLTA 1DXYA 4FLMA 3DM9B 4UZEA 2R65A 5JNUA 5JPDA 3QITA 4KLNA 3SZ3A 5K01A 1FK8A 1KEWA 1EG2A 1PD1A 1SU6A 4FEEA 4QHTA 3V4FA 1G3RA 1Y7IA 1TEXA 3BOSA 3GY0A 4TQ9A 2FEXA 1ZGHA 3CEHA 2WFZA 2FNAA 5BYAA 2V7UA 2FP4A 2CK3D 1VLLA 4KQHA 5D6NA 5AQEA 5FJJA 1KE1A 4DT1B 3FWZA 5H02A 1Q7BA 3CUUA 1GM5A 4L5CA 4CEIA 3EFOA 1M34E 1PQPA 4JQYA 1VP3A 1K88A 3VGPA 4DL9A 1H3EA 3MHPA 2VPWA 4H0CA 1H0HA 1X1DA 1WABA 1YZKA 4D41A 1AUPA 1SQSA 1JAXA 3BQMB 4OSEA 4EI7A 5B5SA 4ABTA 1I94B 1SOMA 2A9JA 4URXR 2W98A 1F5NA 5ALHA 2VUHB 4N76A 3H1BA 2GZAA 5IZCA 1BA2A 4PC1A 1K9VF 2JDIA 4RW0A 3MB8A 4ZQEA 2AOUB 4AZSA 1NW3A 2C96A 2O6LA 3BH7A 1JDUA 4JJKA 1C4XA 4WOJA 5AW2A 2F90A 1W96A 3M0EA 4Z3OA 3MWDA 1H5QA 3AB7A 2H1WA 2KJQA 1GZ3A 1MHPA 2FZLA 2GI4A 4D4LA 3MJCA 1GVNB 4N5IX 3WMXA 3CW2A 1NUSA 4K0RA 3GN1A 4KB5A 3FYUB 4TSKA 3DMNA 5JS7A 4MI9A 3T3EA 1I7DA 2J3KA 1BCRA 3W9BA 2XYPA 3ROTA 3LLSA 2FEPA 4EB6A 1U2RA 2FDCA 1ES9A 2IVZA 4N12A 4YRIA 1OA0A 2VI5A 4OB8A 2VSXA 3DD1A 1JT2A 2R8ZA 1YK0A 4C7BA 4D9KA 1YCGA 3R23A 4FN4A 4HOYA 4LPKA 5HIIA 3JQRA 4GYWA 3ACCA 1SQ6A 1JT9A 2I3ZA 3KB2A 2BC9A 2OM2A 1QH8A 2HCTA 3U4DA 2P4SA 1GTL1 1EQAA 4QSHA 3HY6A 2GEFA 3GGJA 3L1HA 2I2WA 4LZAA 4Y2HA 2B98A 3H0KA 1Z0FA 1SVMA 5FOVA 2DOKA 3A1VA 3B53X 3C8ZA 2W2TA 3CZRA 3R0QA 3TVTA 3DDHA 2UV8A 2VKTA 5A4MS 1EESA 2FPPB 4B4WA 4C21A 2CCGA 2X8BA 4AWXA 1A5TA 1ZFNA 4PAMA 1B8NA 4TSFD 3U4CA 4US1R 1GZ7A 5DNEA 4ZARA 4E70A 1N0UA 1SXQA 2R6AA 2YY6A 3K30A 5FLKA 1Z15A 3UJAA 4BNKA 1DKMA 1ML3A 2QAGA 4TTRA 3F5MA 5CCDA 3QY9A 1I1HA 2HK9A 1M75A 3PVZA 3VNBA 3ZCPA 1EFKA 2F1JA 2XHZA 3TINA 2WD7B 4YEDA 1QO0A 1P91A 3RF6A 4JLJA 4ZZ0A 4GPBA 3P94A 1G8HA 3M6AA 1JA9A 1JG7A 3DOOA 1YS9A 1N6OA 4QNRA 2ZWPA 3VSEA 2W6IA 3GDGA 3V00A 3N8DA 4JSTA 4DREA 4NMMA 3E5RA 2J0QA 3QVMA 4V38A 2HJHA 1KC3A 2QMHA 1DKOA 2OO5C 2Q1SA 1I80A 1N9GB 1NBWB 2GD6A 3B3GA 2H1CA 1V1MA 3CF4G 1E7YA 2H0AA 3QM1A 4LVOA 4NG5A 4QGHA 3CVUA 2JLVA 3PNBA 4V1CI 2A0KA 4F4FA 5AK3A 5H70A 1BOFA 2QD2A 4DUGD 1AUOA 3C7AA 4LXYA 3CA8A 1TO1E 1XXLA 2MSWA 3QF4B 3TSYA 5F5LA 3PXCX 3F97A 2REBA 1G6HA 1Q7GA 3MTGA 4R2WA 2W00A 2XCUA 3WWZA 1BX1A 1LD3A 1I2AA 1V3QE 5AHRA 3TZLA 3RAEC 1I2CA 4PSCA 1IEQA 1HE5A 5B2EA 4NZ9A 4DPKA 4BRZA 2HPZA 3OLZA 1U2PA 4Z2AA 1PX2A 4H15A 4H0NA 1XDGA 3RYFB 2QN3A 3V4PB 3ILXA 1LLUA 3I9V6 3OJWA 4F7DA 5IP5A 4CQMA 1E2MA 2OOKA 2AEMA 1J25A 1W5TA 4EGQA 1U2SA 1TYZA 4E7PA 4N4AA 3W1EA 3OMXA 4H3VA 4XGIA 1DGQA 4I55F 2PUTA 2UZ3A 5BWNA 2AW3A 5CT6A 4LYGA 5G3ZA 1T6ZA 3SD7A 3AWDA 4DMRA 3GJSA 3IB3A 5U1PA 1U3UA 5DSZA 1V39A 2Z9CA 4XWOA 4GPZA 3H86A 5DBGA 1RP1A 3M33A 4NYJQ 2KSQA 4Y6LA 1MJFA 1XC7A 3S5UA 1DG9A 2OFXA 3SJZA 3A6JA 1TGYA 1J7JA 2WJWA 4YJFB 2JLBA 1BDJA 2JI8A 3CURA 1T9DA 2YZ7A 1KEUA 1M72A 1FLAA 1S3SA 2EWVA 4HDQB 1JWAB 1OWOA 2A59A 2Y66A 3WP0A 4M0CA 3ZHXA 3GLIB 5FUWA 3LO5A 1E2LA 2VHTA 1GAQA 3V3KA 3VHLB 4C88A 4URVR 2POQX 3HBLA 4PYMA 5BW5A 4ESVA 5AUOB 2EG9A 4FXPA 4LVCA 2IV7A 1T5BA 2JZOA 2OZLB 3MZ0A 3A4TA 2HX1A 1GCUA 4DN6A 2ZRQA 4IKPA 3C3CA 3PXEA 2PRSA 2JKVA 5LC1A 1J1UA 5IAOA 1CEYA 3CUKA 1WVIA 4HH4A 1M10A 4CKXA 1W48A 4OA5A 2EBWA 1HFKA 1FXSA 1R0SA 1X3LA 4UHBA 3JQPA 2AF3C 1U9CA 4M0MA 4OQYA 5GJWC 2PH5A 3GHYA 3K92A 1XZBA 3IELA 4MUKA 1J1IA 3NEYA 4DJDC 2VT7A 5IVIA 4JOSA 5L53A 1HURA 5FFNA 1VE7A 3HCWA 5EP1A 3RSLA 2H63A 1CK4A 1CIPA 1E96A 2PPVA 1JKMA 2Q8PA 1V3UA 2I7XA 1EB9A 3AVOA 3CB2A 3CH5A 1ORVA 2Y1EA 3D8NA 5LWHA 1ZM3A 4X8HA 3G7SA 4EAQA 2Q4TA 1JDVA 4DQLA 2B35A 4RL4A 4BO6A 5CX1A 2UDPA 5CXQA 5JTUA 2ZT6A 1ODFA 2VRCA 3WNBA 2J4CA 2WWHA 4IDDA 2WUVA 2D2IA 4ER7A 1ADGA 2NWQA 5D3ZA 2WSIA 4JC4A 2GR9A 4DPMA 3AR8A 3KKNA 3D6MA 5HMMA 3VR2D 1XGKA 1NT2A 1W76A 3KRTA 4PYKA 3ABIA 1YKGA 3NAZA 4DHEA 4F2HA 3T54A 2VP5A 3O03A 5B30A 1UXIA 2FG6C 4G5QA 4MTCA 1T1IA 3F2VA 1BHJA 4MQMA 3ZLVA 3X1MA 4DC9A 2XA1A 3LRTA 3R5JA 3QSGA 1JMYA 4NV0A 1UXHA 1PS0A 1ELOA 4E46A 1OASA 3KALA 1IBSA 1ADFA 2BEWB 1C4KA 2V4ZA 2VHVA 4MIOA 4MUJA 4EHAA 2VHZA 2PRYA 3Q6IA 3O8QA 3ONFA 3T41A 1H0KA 3JQAD 5LYJB 1ZH6A 3N0TA 4QPPA 1GD1O 1XNHA 2QTRA 2XVAA 4HGNA 5JAQA 1M8JA 1W88B 3T9EA 1QHHA 4E3ZA 4D0SA 2PJRA 4L51A 2BH9A 2RI6A 3F7MA 3H2BA 4ZRNA 4ZEOA 3VYRB 3KETA 3PUIA 3WHKA 4OMDA 3CXUA 2FFJA 1YF3A 3E2IA 5KVVA 4QYTA 1T9KA 1P1RA 3E22B 2XT9A 3D8BA 2PMEA 5KO2A 3CONA 3TK1A 2O8BB 2R8PA 5T3YA 5TJ9A 2QQGA 3C1TA 2XAUA 3PJDA 1X9IA 5ICCA 1K5HA 1PFVA 1XELA 2XT0A 2BM8A 3PWZA 4D81A 2PS1A 1Z22A 5SICE 2G7MC 5AHOA 4NVRA 4FGLA 1JPJA 1XXHA 2PG3A 3QVJA 4DRYA 5I7HA 4D45A 2R00C 1H2BA 1E2QA 2YWBA 3AEXA 3A06A 5BR1A 4IGKA 5IANA 2FSUA 1JFLA 3TNJA 4C0XA 1TJ5A 4D80A 4JYAB 2ICAA 4JKYA 4NNJA 1IN5A 3ZBPA 1NW7A 3FI0A 3KLMX 4IO0A 3QWHA 4RDXA 5GPBA 3QYJA 4M49A 2C5AA 4FYVA 4N82A 3A6PC 1QP8A 2WY2D 1O94C 1FOEB 4FMDF 3ASVA 3HLKA 4Y2PA 5DNYB 3BZWA 2FR8A 3LU1A 4RYLA 2VDRB 1VG1A 3HXQA 1PNVA 1OE0A 4RTRA 1AIPA 2LGJA 5EIBC 3RTGA 3WLSA 3M2TA 1REQB 4ETIA 3VKFA 2CGEA 2Y6UA 1ICIA 2Z2XA 1G8FA 3MFYA 4FLEA 4E88A 2XEDA 2YINC 3BIFA 1KARA 2XSZD 3USCS 3A1DA 3WGQA 1YAJA 4A8JB 5AJVB 4B0PA 1GZ6A 2O3RA 4JUBA 3AWIA 5TC4A 3QPCA 3AT1A 3CW9A 3ZWAA 5ALNA 1KEZA 1V16A 1DO2A 1L4FA 3LX4A 3HXLA 4Q3EA 1X6VA 3NRBA 3SICE 3TMYA 1GPLA 3QUBA 5SY4A 4IIBA 3W3AD 1F9AA 2HMSA 4QLBA 5IT0A 3VR6D 3SMQA 4KFCA 1HEIA 1V7CA 1MO2A 1WBDA 1Q1AA 2FB9A 3VGJA 4X0EA 3OT4A 4FDAA 1GRCA 3FOBA 3TLYA 4BMSA 3NC0C 4MIEA 1Q3HA 1Y3HA 4E5SA 1EVYA 1K7FB 2AJDA 2FCRA 3ZWCA 4ARUA 1R5BA 2IOFK 5EWLB 1DNPA 3A3PA 3IUJA 2QR3A 3OD5A 1F8YA 4NFSA 2H4JA 3DTNA 4RK7A 3RODA 1RZRD 2PBZA 1RJEA 2C4VA 1ZVQA 1EZZA 5F2OA 1I7PA 1OWPA 4NP6A 5C37A 1Z26A 1ZVKA 3EEBA 3HCDA 3OCYA 3PNLA 2Q3JA 4M9RA 1MX3A 3AEKA 5FWAA 1C3VA 4KLRA 2VR1A 3R3JA 3L7CA 4LIPD 1S0UA 1T2AA 2O2HA 5JMOA 2V7BA 1ZVMA 3TFWA 3EWIA 4YTEA 3QFTA 3ZLTA 2ZAOA 3PPXA 2KS6A 3CC8A 1Y6FA 4OYRA 2YYSA 4AZ3B 3RS8A 1RE1A 2EHDA 1BS9A 2R4QA 3ZC3A 1F2UB 2VWGA 2W6JA 5ITWA 5DM0A 1I24A 3PHIA 2WIJA 1ADJA 3VM6A 3BXXA 4X60A 4JJ6A 3ZJUA 5T57A 5DSTA 3GQBA 3VYSB 3QLUC 3WKEA 3L0CA 3MJFA 2HF8A 1W4CA 2G80A 2IZ5A 1QZTA 3FBTA 3FJ1A 4MP3A 3HDJA 4OHFA 2BRUC 2OCIA 1MQAA 2YFYA 3FOWA 3EGWA 2C78A 3K09A 3HI4A 1V7ZA 2OHGA 5CCBA 1DAOA 2INGX 3DWIA 3OZDA 4RXUA 1UJBA 2O2XA 1J23A 2ZS7A 3HN2A 3Q10A 1RJ9B 4HPJB 1OWNA 5ES4B 3AIOA 2J9FB 3A4VA 4Q4AB 4B71A 5KNCA 4UTNA 2QGZA 2JJ2A 4H35A 2EZ9A 4LF4B 1O1YA 5PNTA 4BO3A 4C43A 1B23P 1MX1A 1Q17A 5C1OA 1ZGJA 1MNAA 3IAM1 1TFUA 4PRKA 4LHWA 4LS3A 3W2GA 1F1JA 1FRNA 1RAHA 3WLFA 5EGNA 1ZLXA 2AZXA 4KFTA 4S0ZA 3IJPA 4NJOA 4NICA 4KWHA 4TV9B 3FVRA 4HJRA 4KXMA 1XVLA 1CB0A 3BIWA 3ISVA 1Y1RA 1FYDA 3X1ZA 4RJTA 5FBKA 3VMFA 2EFGA 2AKYA 2C07A 1G9SA 1RLTA 1OLXA 2W6PA 4U7JA 4OM8A 3ZE6A 3EBPA 5JI2E 3MMXA 4DLYA 2PWAA 1NONA 4BEVA 1UXJA 2E4UA 4FU0A 1A2BA 1AZSC 1T3GA 3EC1A 4HDSB 2F4VB 4AY2A 2CHGA 2FW9A 4B44A 4N8EA 4ZOQI 2GRAA 4LJ7A 1MIHA 2GCPA 1FFXB 4TRJA 1UDWA 3FCYA 1E6MA 1WP4A 1ZIDA 3C14C 3QNUA 2NZ8A 1TM3E 4BGUA 3C6ZA 3DWFA 4ZYUA 5GZ6A 2RGNC 3ECSA 4KE6A 2BHNA 2UVDA 1ZD4A 5FL7A 1EM6A 4YIHA 5CU7A 3H8WA 1CDEA 5BW6B 5LMZA 5HQ3A 1YS1X 3C15C 1G20E 1DO8A 4W6ZA 3S70A 1DC7A 3H6HA 4YRTA 1ITZA 3GPDG 2FY8A 4EZBA 1XMOB 3N8KA 3I45A 2BGJA 5KZMB 1HYHA 2NT3A 3MT7A 1XZHA 3BKXA 2VYCA 3HCEA 3C1AA 4MGZR 4HS4A 4I5FA 1GDDA 2LW7A 3DWEX 3C5CA 4QIHA 4QDTA 5DLPA 3K6RA 5DW3A 4TWIA 4DNXA 5KYYA 4KDFA 3IBGA 2XDAA 5ITZB 4MTLA 2C4NA 4AF6A 3H04A 1JLLB 3DHVA 4JLBA 1JL3A 2BGWA 1FBTA 3MUNA 1NVTA 5AH0A 4C89A 3EZGA 1NNUA 1LPBB 1V4BA 2BP7B 4KBGA 4KWEA 3NANA 1YQXA 3TG8A 2YYYA 4N6OA 4NYIQ 3UV3A 3P5SA 5I8ZA 1KJYA 5LDHA 1YJXA 1UQUA 2QN9A 4L8YA 4NBLA 1PUXA 3F8TA 4YLGA 5FFMA 4QVIA 3D8RA 3CLUC 4ND7A 4TKUA 1MFPA 2PX4A 5ESXA 5K0BA 3OE4A 4G0ZA 3WSVA 5AI5A 2Y93A 3N76A 3L8FA 4BRWA 3A9SA 2P41A 2Y1CA 2GJAA 2WEKA 4ZQHA 4E32A 2XCTB 1GNQA 3F78A 4HDOB 1HPLA 1GAXA 2IF2A 5TF4A 2R6R1 2HV9A 3AF1A 1SO8A 3REOA 1TNDA 3K0FA 3P1JA 1FL9A 3PL5A 4BVEA 5CXUA 4G6ZA 1ZIOA 5M34A 1DRKA 3TLXA 5LMNB 4UFOA 2IV2X 5ADUS 2VPYA 1BEZA 3HA7A 2NO6A 1M2JA 3L7NA 3MWKA 4UREA 1PV2A 2GJ8A 4HGZA 3RHFA 2W0MA 4M1OA 4PSAA 4UPDA 4DZTA 1F0YA 1E1QD 2NYVA 3KAQA 4PC7A 2YV2A 4QXQA 4BMNA 1NIPA 1VG0B 1JHDA 1SC4A 1KI6A 1TLTA 4MV1A 4JITA 2FWNA 1L5VA 5LQCA 2ZRFA 2WMNB 2ZLBA 2C20A 3QI7A 3DTYA 5LPNA 2VBGA 4MV4A 5LMCA 2G82A 2OB1A 2OHOA 3S2YA 4C0AC 3OPMA 3FTFA 1YRBA 2JFWA 3O74A 4ZMBA 5I3ZA 1V48A 5DTIA 1D8TA 2NU7A 1JR3D 4Y8VA 3Q3GE 2PRJA 1XWIA 4OJQA 4L0CA 2PT9A 2FPGA 2WNHA 1CPYA 4K05A 5EHNA 5CG1A 2JFVA 4ZO8A 3ZZNA 3NHLA 1F17A 5EHGA 1Y6ZA 3WOVA 5SY6A 5IS2A 3AFIA 4JJEA 2FWIA 3UAXA 5F7XA 4QBKA 4HZUA 4A6PA 3N0WA 1Z7EA 3HRKA 3Q87B 4P38A 4TL8A 5KVAA 4B6SA 1SR8A 5ALTA 4PX3A 1LFAA 5H9VA 5CNMA 4Q3NA 4LC1A 5D2CA 1GGJA 2GGSA 1ZJWA 3AF3A 2OT3B 1TK3A 3D3WB 4D4IA 4C0LA 1WKVA 2I8AA 2PLFA 4QDUA 2CW5A 2JF0A 4OB7A 4YROA 4R31A 5JAUA 3UKOA 5AP9A 2A9PA 4NZNA 4W1PA 5CNJA 4CF3A 2D1RA 4OJMX 5ENDA 1A88A 4XIYA 3RRYA 3T5GA 4C0BA 5CB4B 2EW1A 1Z83A 4N5MA 1H2EA 1M1YB 1ENOA 2Q45A 4Q9DA 1K6MA 3WGJA 4BFSA 4GOND 1U8YA 3EW7A 1G21E 4FHEA 3T5TA 2H1RA 3DMHA 4YYEA 1P5JA 1TAUA 1GSIA 2XAAA 1Z6PA 4JSRA 3T9BA 5IULC 5MFPA 1XZFA 4YBRA 2QA5A 3CEJA 5T5QA 1LV7A 4WY5A 1P3Y1 1AHHA 2WI8A 4MH0R 3KE8A 1C9EA 2BUCA 5B3JC 4R0NA 1ZZGA 1BU8A 1Y81A 1ZHFA 2RSLA 3JR3A 2VHEA 2FMIA 3MGBA 4HRAA 4EG6A 4GZLA 3LT5A 5IHPA 1CEEA 2CXHA 1Q77A 4Y2VA 1L8LA 2FXIA 2OBBA 4ZD6A 3BDVA 3GZJA 3DFIA 1Z2NX 5HF6A 3OTWA 1S96A 2O2DA 3L6UA 4MIYA 1VKJA 3VNUA 4MUNA 4BCCA 4GWKA 5K3AA 1NMQA 1PBNA 3UAWA 3LVRE 3UMVA 3AF5A 5T4BA 2VZEA 4DA7A 2Q5OA 3L4BC 2NSDA 1VKZA 3RU3A 3N2KB 3IOBA 2QX9A 5DCLA 5EMNA 3KBOA 3TSWA 2M32A 2DMRA 2I1VB 2NV0A 3N70A 3U37A 4C78A 4Q1DA 4YAGA 1GJRA 1NP3A 1GQRA 4Z7QB 1S8NA 2SBTA 5CVCA 2A1UB 1T6YA 2GPSA 2E6UX 2Z83A 2HIHA 3OQ1A 4LHEA 3H3JA 3VVCA 1WF6A 2J0VA 3I2GA 1W85B 4YS6A 3KLBA 1YJAA 2VJCA 2AFIB 1GADO 3A4IA 4NCJA 3KUDA 2Q0SA 2WQ7A 2GPNA 2P9ZA 5DNDA 1NUQA 2D2EA 3TS1A 3RK0A 4EO4A 2D6FA 1IH8A 1OYYA 2GEDA 3NNNA 4ZJPA 1I14A 5A5DA 2OHFA 1OLSA 3O9VA 4E2ZA 2X6RA 4MUEA 4DQDA 3CCBA 1T2CA 3SXUA 2RC5A 1ONOA 2GZ3A 1PJ4A 2PA3A 2ZGVA 2QSYA 3IKLA 3K1YA 3K1ZA 3ZWKA 2OMKA 4NBNA 2E4WA 1XPJA 4EOGA 4HNVA 3VR3D 4XTRA 4EVIA 2V1UA 3E7WA 1FRZA 2X77A 3OZEA 5DT9A 4EPRA 1CUJA 4B4KA 4EH1A 5IC5A 4BAGA 3JQBC 4CG3A 1I4LD 4P3XA 3A25A 1UZNA 2JAPA 5A9SB 1C30B 4E07A 5GONF 3DVRX 9ABPA 3DBRA 3JALB 3DL7A 4ZJUA 2X23A 4F6RB 4C7OB 3U31A 5K0LA 1KGDA 2C29D 1B26A 2DUJA 1NVAA 3N6VA 4H7FA 5KTRA 1E9FA 3GEMA 5KVQA 5MN6A 1P19A 2Z3VA 1YHNA 1MT0A 5FPQA 5BOSB 4MV6A 1VYUA 3QKIA 4QOGA 4YMUA 5HF5A 1MHTA 4EKNB 5GWXA 1UPTA 3C7DB 2BOVA 4KACA 1L1EA 2JKZA 3SIXA 1FMCA 3D6FA 4FE4A 4TTTS 4P86A 4X20A 5IBQA 1LV8A 4JI5B 5L95A 2AW5A 2R97A 2C2OA 4V0ME 4WEQA 3WBKA 5A6SA 5AVSA 3TLCA 1EXDA 4ZAYA 4MUAA 2HLDD 4WJZA 1JGTA 1RAIA 4HAVA 2CNWA 4ZVRA 3PHJA 4UNRA 5FORA 4FEAA 4M1MA 1FFDA 4GL2A 1GLGA 1Y48E 3TE6A 2YZMA 1WKBA 4OFBA 2BZ0A 2Y1WA 4Q7JB 5D00A 1JE1A 1UKAA 4I4TA 3SEFA 3TO5A 3KOXA 3QW4B 1RLJA 4WLNA 4HRXA 4WX2B 4XX0A 5EEHA 2ZYSA 2HHAA 3PA8A 5AK6A 1QR2A 3DE6X 3I6ZA 1FTYA 4GX0A 1RYDA 4Z4IA 1H0SA 1QZXA 2PCLA 5C8XA 4C20A 5EP3A 2OEPA 4JLUA 3EMKA 4WK4B 1USIA 5B7GA 2WTUA 2QK4A 2IYZA 4HEHA 4Y2XA 4WMLA 2ZFUA 2FFQA 1IEXA 1CS0A 1XU4A 1QK5A 4OK5A 2QXTA 3L1IA 3S8MA 5DXFA 4XGNA 5JSHA 4LF6B 1TTHA 3FF4A 1XALA 3QEOA 4O4LA 5IN5A 3WMWA 5EQJB 3L8GA 3RCBA 1F0PA 3K9FC 1U3VA 4I3FA 4OAQA 1QDUA 2X2PA 1FU7A 3HEAA 4QQKA 2HIAA 1W8DA 1HE8B 1C7ZA 3TJZA 1N5IA 5JQGA 3EASA 5BUQA 4TWRA 5CBPB 5GVSA 4FCWA 3ZG6A 1VXOA 2P3OA 4FGZA 4IJMA 4AG5A 4OHBA 5KNBD 1US8A 4B3IA 3OCZA 1E6UA 1OBVA 1OILA 1YT5A 2GK3A 1OAOC 2OXFA 2QRKA 2V5UA 3BMOB 3EDCA 3EK2A 2GBFA 3EVCA 4MVWA 3LCCA 4ALKA 3SYTA 1KI1A 3BD8A 2AEFA 4FOLA 1XZMA 4TSRA 3CCFA 1N8SA 3H1FA 5I45A 3QE3A 1TJ4A 2IA5A 5F1YA 3TH5A 2Q62A 4PG8A 4JWTA 4DTIA 4XOIA 2GNPA 2V7WA 1QG0A 2VDUE 3AKYA 4RSMA 2OM6A 2ZSEA 3ONVA 4Y18A 2PZGA 5B1DA 3MPOA 1EDOA 3N2GB 3OIDA 3R4CA 1P39A 1RZ3A 2VYQA 2O8DA 2E48A 2HIMA 2IP1A 3KL2A 4LE2A 3UNXA 3Q0IA 4B3FX 3A04A 4DWVA 3DXFA 4LHYA 5BT9A 1G42A 5F1OA 1BU5A 4UBNA 5EFZA 4EL0A 2W83A 2DP4E 4EUHA 3B7PA 1J4AA 3C3KA 1ZY2A 1Z4KA 2MWMA 3R0ZA 1QNFA 4I8XA 2GN9A 5BVHB 1U0FA 1E69A 1T9GR 1B8PA 1WCXA 3VKHA 1JJAA 1JFFB 2HGZA 3AI7A 3IBTA 4KSCA 1NJ6A 3GRRA 1Y4DE 4MW9A 4DDUA 2RHMA 4FWTA 3C8MA 4MQFA 1V37A 2PMWB 3JQAB 1WXGA 1LTHR 3H2ZA 1V35A 2CDAA 2FW8A 4MR8B 1AHIA 2PUVA 3T38A 2JZCA 2I4RA 1A9TA 1CXZA 4DA8A 4YJDA 1NRWA 1PJ2A 1MXFA 1VTKA 3KOOA 2OKCA 5FWNA 3AIKA 3O26A 5KX5F 3PC7A 4RFVA 1ENYA 1M5TA 2V9CA 3DKKA 5FAXA 1R0LA 2AOTA 4N8DA 2AN5A 4H7JA 3VI3B 5AW1A 2J9ZB 2O54A 4NENA 1JAIA 1EUDA 2RAFA 4ZOLB 1ZL0A 2C59A 4CKEA 2GPWA 2VDWB 1Q7TA 3DZFA 3AI1A 3I3SR 3I9MA 5I01A 2C4HA 1XL0A 1KI8A 1K7YA 1DAEA 1D2RA 1FU8A 2CLMB 1WMEA 2P1ZA 1DTWA 2PGAA 2EAUA 1WUYA 2R00A 2IEZA 1I1QB 2ZRCA 3EYAA 3M89A 3ML1A 5FOQA 2JIBA 4J3JA 5JBIA 5JROA 1NHGA 1HNWB 2WP0A 3I32A 1B3BA 3DEIA 3GG2A 4D4HA 3SVLA 1JKJA 2Z08A 4OXQA 2J4FA 2XCOA 3EPPA 3TTVA 4YUAA 3OBIA 2XXBA 1ZN2A 4JBGA 4Y6QA 5LXTB 4W5NA 1ZESA 5KSYA 3JVUA 2Y0EA 4JXXA 2H0RA 1LQTA 2IGTA 4PW0A 4FYWA 4IV5A 1AXGA 1O87A 5AJHA 5IEBA 3J81A 4WA7A 5A4DA 1W4RA 3AFMA 1T43A 4G5SA 4QRDA 2MINA 4GLOA 10MHA 4UFNA 3L9XA 5JCXA 1N0WA 1DWUA 2A0UA 3BM5A 2I6TA 4LVNA 4CVNA 2JFQA 1JEAA 1ZSVA 4PHCA 3VR5D 4E5DA 3WTBA 4G5FA 1GL9B 3WQBA 2HM7A 2R7MA 5J2TA 3LSTA 3Q41A 4ZV7A 1VL1A 1ZSYA 2CVPA 2PQMA 2YXEA 3MOGA 2VO1A 4XE5A 4GYYA 5KC8A 4OGGA 4CQLA 3LT2A 2J3MA 3PI7A 3ASYA 2Z3WA 1HE3A 3HVIA 5YASA 4KBFA 1QTNA 1G16A 2V96A 4PCVA 4J3FA 4L8LA 5A1JA 2QUIA 2I67A 4IIYA 5B2ZA 1TZCA 5A6VA 4EELA 5BWMA 3H9QA 3WB0A 1X7ZB 1W9MA 2HNKA 1RS0A 2FX2A 1E3EA 1RKXA 4WOCA 3NM4A 4I4IA 4QU8A 4PXYA 2BIFA 4KXFB 2CEAA 3DVQX 1SA0A 2SKEA 1EG7A 1PRYA 3JZDA 2YYAA 2PX0A 1VMAA 2LWIA 4HG2A 4C0JA 4LDPA 2CHQA 4BUZA 4PNPA 1D04A 3OFND 5HG0A 3OFVA 4QJ5A 4B45A 1E0KA 1WUIS 3FDZB 4AECA 5D3QA 1IHXA 2VBFA 2PUAA 3ZD7A 4JL5A 3IIKA 2C3YA 4CL8A 3CINA 3IAHA 3V2HA 3VZPA 5KNDH 2DHQA 4RY8A 1KJWA 4E5VA 1G66A 4UBOA 3MWLA 4GF5A 3LBAA 3MCVA 5JCZA 4QYMA 1B8UA 2CLOB 3OEHD 1UBLS 2UZ0A 2OZEA 1WPXA 2YZNA 2ZSDA 1JDZA 3K9CA 1ESCA 1DT5A 2YXPX 3NONA 4AURA 2UVPA 4BFWA 2NZYA 5DCYA 3NBKA 3W2FA 1GQSA 1CUWA 3V8PA 5F23A 3C7CB 1YZQA 2V7XA 4H1WA 3H05A 1OT5A 5JSQA 3IALA 1G4HA 4M1ZA 2EIXA 4FZ5A 4ESHA 1N6PA 2Z2JA 4TXHA 4MYDA 4DADA 3LT4A 4OUDA 4RMHA 4DMUB 1HNNA 1Z9BA 2JBHA 2P67A 2QEQA 3HTXA 2BDUA 1A5BB 1ATIA 1RXEA 1S4MA 2H1SA 1TCAA 1U0OC 1SOWA 3B5EA 3FAZA 5CP8A 1T0UA 3GG9A 4CM9A 2VYVD 3OOHA 4INAA 1HT1E 1STOA 4NE7A 2I62A 2BMVA 3H97A 1VHWA 1HY3A 1R0RE 3UWKA 3DXXA 3RQSA 2WMDA 2X8AA 3IMFA 4ESOA 3L8ZA 5IXSA 3M6IA 3WK7A 2HDNB 1NUHA 4RTJA 2C54A 5J23A 1DOAA 2JGJA 4G1EB 1DAGA 5DT2A 4GMHA 4PTZA 4CQNA 2BHRA 3A6DA 3AEYA 2GHQA 3IPLA 4KMRA 2WHPB 5HM8A 5I7WA 4DV0B 5JARA 4M37A 2ZIUB 1BWSA 1E7QA 3HA2A 5B57C 2JFBA 5FPTA 5A62A 5I4IA 1EUZA 4AKSA 4JZYA 2G0TA 3PX2A 2C3OA 1D8AA 1JJVA 1ZK1A 3TB6A 4PZYA 4LYDA 3L1KA 2XLBA 4P0TA 1FNSA 1Z6YA 4I5IA 3P20A 1E1YA 4INPA 5ALVA 1JR2A 2RONA 3O0DA 2H4ZA 3MXTA 4ZOCA 2WUEA 1EBUA 4KXLA 3ESBA 2NTNA 4DG8A 1K7SN 4DLTA 5KQMA 3BHIA 4EUKA 1Q74A 1RWOA 1ESNA 5P8WA 1YZYA 3PV0A 4F9TA 3F7OA 3JX9A 1NFFA 4R2KA 4KNYA 5F5XA 3RIGA 1GKYA 3SLRA 1IJBA 3DZGA 4IIEA 1CY1A 2AHRA 1EE2A 3WK4A 1H42A 2CLFB 3FMGA 3PQ8A 5CAEB 4B8YA 4JODA 2C2WA 3NIDB 3P0FA 5JD4A 1EIWA 1UZMA 5CXXA 3AB3A 4AY5A 2W2OA 2NXNA 2ZYRA 1NY5A 3D0RA 3QBTA 1X7HA 4FCCA 4PGAA 4RXTA 3EA5A 4XX1A 1P80A 2E4ZA 4G0YA 6LDHA 4O2BB 1F2TB 4D0NA 2VTDA 3BE4A 5MHTA 1PT6A 2IDMA 3VNRA 1UK9A 1LNSA 2V45A 3LS2A 5C7YA 3N0RA 3R3YA 3FPLA 2OOSA 4LXTA 3RVPA 4MW5A 3E4DA 4NBKA 3JQ6A 4ZI7F 2AJ8A 3HKEB 1J2YA 1SXGA 3L04A 1PBTA 4NX2A 1JIVA 4RIEA 4FSHA 4FHCA 1ZM9A 2V6IA 4BVGA 1WE2A 4YGYA 1I0IA 1DV1A 4DCSA 3E9EA 3AETA 2PGOA 2PFGA 2OAGA 2Q1YA 2WU4A 3I12A 1MORA 3NZEA 3VPSA 1M34A 5F21A 1KERA 1V0JA 3NV7A 3UK0A 4Y2YA 1VL8A 4DLWA 4YDHB 2YUIA 1N5DA 2FFAA 1XZAA 1X7YA 3WGTA 3EEIA 4CCYA 3BAFA 2J1LA 2OG1A 1HKHA 3A3NA 3A9CA 4KP7A 3RIXA 4W5QA 3QUAA 2IU6A 2QQEA 4FIDA 5GV7A 2ZRDA 2ZRAA 5E7IA 4DR4B 3Q85A 5TT0A 1QGDA 1TYEB 3N0VA 1LSUA 3ZWWA 1HLGA 2RCNA 3B85A 4BGEA 4JDUA 1VHLA 3EIXA 4FFWA 5JU6A 1SUIA 2R85A 1I4OA 2XB4A 1UT5A 3EC7A 4A8HA 1DCKA 3DPIA 4QYWA 2XKBA 2FU5C 1H6AA 3G2IA 3CGGA 5H3HA 4CLRB 2R0QC 3JRXA 4U7FA 1XBTA 2REQA 4IX9A 5JCOC 1RXCA 1VPTA 4OGFA 3MWFA 4H6PA 4R0MA 2P3SA 5JEDA 1JFSA 3WBFA 1XDDA 1SVIA 3DC7A 3IVRA 2PUFA 1OIVA 2X5OA 4GP9A 4FKMA 1TM7E 3W04A 3RIMA 1NWCA 3DDSA 3W9YA 1QLJA 3SY8A 3OWXA 5FOUA 2DXIA 4DJFC 4GWLA 1G5QA 4MYHA 3TTWA 1K3TA 4Z2YA 4HAYA 1F5SA 4PC2A 4WOPA 1VPEA 3A1UA 1BJRE 1SB9A 4Y1RA 3RC3A 4UUNA 4BQNA 2JB9A 4J43A 1RQLA 3B9RA 1EYZA 1PR4A 1U0NA 5JANA 16PKA 5CLLA 2RH9B 2BISA 4QICA 3UBMA 1LPMA 3QZUA 1XAJA 1GCOA 3T1VA 4B6FA 3UXYA 4LNAA 4X64B 2XXAA 4RQAA 2Q3CA 5A4AA 3IQIX 4TKZA 2MT9A 3CX7A 2X42A 3F3YA 4R2MA 4ILKA 1IHDA 2YCBA 2R5FA 4F2PA 3DBIA 5LQUA 3B8HA 2P68A 4IDAA 4BLUA 1CZLA 1R4NB 1ESMA 1XZLA 4DLKA 1Q0UA 2YVAA 1CVIA 3UK7A 2JVIA 1BAPA 2JIMA 3UJ3X 7YASA 1J07A 1DHRA 4Y30A 5IBPA 5LQAA 1I7SB 1TTTA 1P3DA 2WUFA 4NU8X 3UW1A 1I51A 1VE5A 4JLWA 2HSWA 4GOMD 5JXIA 2A2ZA 4R9RA 3WAGA 4N3AA 5IDQA 1OLUA 2Q3LA 2VFAA 1E0SA 1T2NA 4BVHA 1KSFX 2ZJ6A 1A5SB 3BSYA 3LRXA 1UKBA 3C8DA 2BFDA 1DTEA 3LPAA 5A5FA 2YHUA 2C9MA 3ZV3A 3OQMA 3QOWA 4IKOA 3EG9B 1H65A 1VJ1A 4FUTA 3X3HA 6PFKA 4JUIA 2BFBB 2VCHA 3TRKA 1OC2A 4H7IA 1H1TA 1VSTA 4V0QA 1ZINA 5EXTA 3P9QA 3BORA 1QFMA 4X7MA 5LZ4A 2HK6A 1A4IA 5FLYA 1H2YA 3ESZA 1ODSA 2A5FA 4CIDA 5IVPA 1ZAYA 1T1EA 2PSFA 3R5XA 1TB4A 5T3UA 4J0QA 3C4QA 1NJ8A 3BKWA 4IM7A 4R01A 2QV7A 2J7PA 3JQFC 3ZNPA 4P36A 2WJYA 1NR7A 4BV3A 1JH8A 2DTEA 3K0SA 1BGXT 3RYHB 2C42A 1OPXA 2LR0A 2BEUA 2HV8A 1X14A 5BV2P 3V34A 3FMFA 5E7QA 1M6WA 3QNWA 1T5SA 2FFRA 3ORSA 3GL9A 2BFCA 3MBOA 4WDQA 5C31A 1VHJA 3CTPA 2QUJA 5DM60 1MG0A 3CMMA 4FFBA 3OIYA 1JDBC 4G65A 3TBHA 3ZVRA 1AU9A 3DE1X 4LFCB 3URMA 3CQ9A 4Q37A 1NVMB 1N2BA 4F91B 3RJ5A 2P79A 3QTBA 4KE9A 3QVGB 3TDNA 5JO0A 4KV9A 1DHTA 4CF7A 5CCXA 2QIPA 2ID9A 3OF5A 4LCJA 4DA0A 3GJ5A 3B1KA 5FNVB 3FCOA 1WD5A 3JQ7A 3LC2O 1E4VA 2XMSA 1KK3A 4ID9A 4L2IB 4C04A 4ENVA 1C9DB 1BDHA 2OQ2A 3ROQA 3WQQA 1KY3A 1L6IA 1U04A 5H1YA 2B1QA 3R3ZA 2D3TA 5B1SA 3GP3A 3R1IA 1N33B 2FPWA 3L4BA 3D7LA 1V3VA 1P45A 2OO3A 3GUHA 3PUJA 4J90A 3V5NA 4ZI3A 2OD2A 1CYEA 1D2MA 2O57A 4HADA 3SX4A 1I4EB 1BDMA 2NUPA 1IXSB 4IS3A 4WLVA 1INLA 3G88A 3UGKA 3V7WA 1RI2A 1NDQA 1M83A 1X2BA 2X7JA 4JI6B 3B48A 4BDTA 5ENZA 4ONEA 5BN5B 5K6AA 4V0SA 4CM6A 2FZGA 4RVHA 2UXBB 3WVNA 5T41A 1ODLA 3JWGA 4KNVA 3V42A 1CR2A 2ENUA 1TF7A 2WWGA 4AJKA 3JQGA 4Y2JA 1MZVA 1E6EA 2GUGA 1WZNA 4GM4A 4OOEA 3EDYA 4F04A 2OLEA 4E5NA 4EG3A 4EGJA 4MWDA 3ZHYA 3NIGB 5IN4A 2H5JA 2GT1A 1YHZA 5EUQB 4D46A 5AO9A 5KDOA 1X1TA 4Q3BA 5C7LO 3BWCA 4RGQA 3O2JA 5JYDA 3QFCA 3PC8A 2PGLA 3OJXA 5GP1A 1XJCA 2ERCA 1WQ4A 2W4QA 5JJ5A 1NAHA 2A92A 4ID3A 1E2IA 4QQFA 1QIHA 1HMPA 3GT3A 1V5EA 3CUEF 4KE7A 4UEOA 1FJ2A 4XWGA 2PV7A 3IEMA 2X5KO 3JD4A 4KRFA 2FLWA 1GSOA 2NOAA 2XWPA 2FOLA 4LCEA 4Q16A 2Y67A 4B6PA 3TDMA 1E79D 1SD5A 4OQXA 3GUYA 4MQ6A 1EEHA 4MYTA 1EE1A 3V3TA 4YHHB 2XBMA 2W6MA 4AXXA 4XKJA 1W1UA 1VFNA 5EXDA 3E18A 3ORYA 1UAYA 1YMQA 3X1XA 2Q5JA 1D5CA 1FFSA 1E9SA 3RUIA 2RGAA 2AFHB 2EBUA 1GTG1 1Q91A 2BI8A 2Y99A 2ZPTX 3IUBA 5K03A 2PE5A 3BERA 4M1KA 1HR0B 3Q11A 3PRJA 5HUHA 4UE6A 2PQ6A 2NUTA 4YPVA 9ATCA 1BRMA 221PA 1E2UA 1HSOA 3PGKA 2YIVX 4BMYA 3CZAA 1QANA 3D1VA 3C0KA 1GQQA 3E1GA 4X1KA 3WTCA 1OMOA 1DQZA 4FWBA 5IARA 2JATA 4B4VA 2O59A 4YAUA 1PGPA 1EUYA 2PT7A 2JAQA 3ZU6A 1MD9A 5JY1A 4ND6A 1Z2AA 1YUNA 1XA4A 3PHBE 5LQRA 3CKYA 1Y5LA 3QVWA 4HQ0A 4GNRA 1RRCA 1YFKA 621PA 1HT2E 2DZDA 3HWWA 4HDNB 3FUVA 5IWCA 3N8HA 5CK4A 3HC7A 1R5NA 1DV2A 1Z36A 2NXJA 5TS2A 2DQSA 2IHZA 1YE8A 1J2TA 3ZEIA 1DBQA 4TOIA 4WZBE 1DELA 1K5PA 2OVFA 4YB8A 4OOFA 1OV4A 4A0SA 4BWGA 1R4MB 2ZB2A 2XUHA 1ORWA 4L07A 4L4YA 2E49A 3M6XA 4M0PA 1KDOA 2PD4A 4LGYA 3UJ7A 4OQFA 5DXJA 3B5JA 1PKEA 1S9DA 2W8BB 3HJBA 3WYDA 4DT1A 3DVAB 4YQEA 4J76A 4X91A 4BFZA 4BKQA 5DHRA 4FMCF 1JFTA 1M7HA 3WMFA 1BROA 1X8LA 2MSEB 3N58A 5LU8A 3EB9A 5IKPA 3FHOA 4L28A 3HP4A 3ODGA 1XZEA 2D1FA 4GSKA 1QIFA 2IOFA 2NYAA 4QO8A 3V7UA 5DNAA 2FYTA 3D0QA 3WLOA 5EJGA 4AJEA 1QCDA 3GVXA 5FDFA 1O96B 4HQ6A 1NP6A 2AOUA 4K9SA 4EJMA 1U1EA 2BLLA 4Q7KA 1CV2A 4KR6A 1KO7A 4TKLA 2IDZA 2PCJA 2EDCA 1HDEA 4E09A 4MEJA 5D1NA 3VR0A 4MJXA 1IVNA 1YS7A 1P7VA 2HQBA 2G9NA 5EYPB 3JXEA 4BRSA 5HQTA 3H4TA 3FYUA 1ZCZA 3GCWA 3G2MA 4I55B 5JAIA 2XNHA 3LLMA 1YDMA 2JA2A 4O2AF 3OC6A 1XZ8A 4RTMA 1ZW1A 2EU8A 1QG2A 1G7TA 1W1IA 1ZUHA 3GMIA 3QHPA 3ZHCA 4EUEA 3H4MA 3NNDA 4BZZA 2HQOA 5LA6B 1NXOA 5JJBA 2J59A 1CS4C 4J0IA 2Z98A 2PQ2A 3MW8A 1TTPB 4LHXA 3QPAA 1Y4AE 3NBUA 5ILQA 4DV1B 3JAWB 1M2EA 3RAFC 4C08A 1U3TA 4LHVA 3Q9UA 1CRWG 1G0OA 2GEVA 4YUVA 4DWOA 5EXPA 4MVJI 3P4UA 3ILVA 4UEKA 5FI0B 2D5AA 2B4QA 2X3FA 1FP4B 4GOXA 4ZVKA 3L6EA 3H5TA 5KJ6A 1VDZA 4IF4A 3NUGA 2FMFA 3CHYA 4IMPA 2HU5A 3GARA 3JZIA 1R9NA 4GPIB 1EFUA 2V7PA 4BECA 1GNTA 2Q6VA 2WU1A 5AVRA 1JMKC 1TIBA 3M4ZA 4OXRA 4ZEWA 1CQZA 2OV4A 1GZVA 1JU9A 5HZKA 3K8QA 4JBXA 2C5BA 2G6TA 1LJLA 2I3AA 2EL9A