4PYPA

Crystal structure of the human glucose transporter glut1
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
447
structure length
447
Chain Sequence
TGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYTQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVQRAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human glucose transporter GLUT1
pubmed doi rcsb
molecule keywords Solute carrier family 2, facilitated glucose transporter mem
molecule tags Transport protein
source organism Homo sapiens
total genus 166
structure length 447
sequence length 447
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4pypA00
1PV7A 4APSA 4ZYRA 4UVMA 4OAAA 3WDOA 4TPGA 5EQIA 2XUTA 4OH3A 4YB9D 4XNIA 4J05A 2V8NA 3O7QA 5D6KA 5EQHA 4Q65A 4TPJA 5GXBA 4YBQA 4LEPA 5A2NA 4IKWA 5A2OA 5D59A 4D2DA 4LDSA 4PYPA 4ZWCA 4GBYA 4U4TA 4TPHA 5D58A 4ZW9A 4D2BA 4IU9A 2Y5YA 4JREA 5EQGA 4W6VA 4GBZA 4U4VA 4ZWBA 4IKZA 4JR9A 4U4WA 1PW4A 4GC0A 4IKYA 2CFQA 2CFPA 4IU8A 4QIQA 4D2CA 4IKXA 5C65A 4JA3A 1PV6A 3O7PA 4IKVA 4XNJA
chains in the Genus database with same CATH superfamily
4UVMA 2L3YA 1VLKA 4YB9D 4EXPA 1PW6A 3UX9A 3HOXD 1RCBA 4A3JD 4IKWA 4YUEC 4Z5RD 4ZW9A 3BPLA 4JR9A 1GNCA 5KNHI 4BY1D 5IYBD 4D2CA 3FKID 4MHLA 5IYDD 3S9DA 1INRA 3WCYI 3SE3B 1WCMD 5A2NA 1EVSA 3BPOA 3HOYD 1Y14A 1N1FA 2INTA 1QVNA 2JA5D 1V7MV 3PIVA 4A3DD 3DGCL 1RHGA 4JA3A 4LRLA 1EKUA 3PO3D 2B5IA 3DI2A 1F6FA 1Y1VD 1HIJA 4I77Z 2B8ZA 4IU9A 3L5WI 4GBZA 2C35A 1Y6KL 3QB1A 2O6IA 4A3BD 1M4CA 1PV6A 5D72A 4APSA 1D9GA 4EXNA 1M4BA 1M4RA 5IP7D 1PVHB 4A3FD 1EMRA 4GBYA 4D2BA 2D9QA 5IP9D 1AXIA 4U4WA 4GC0A 5D71A 3LB6B 2XQBA 1Z7CA 1SCFA 3L5XA 3BESL 4TPGA 5D70A 3WDOA 4NI9A 2VUMD 4O6KA 1BGDA 2Q7NB 5C4XD 1M49A 1EERA 3UF5A 4A3GD 2PSMA 4W6VA 3SE4B 3UF2A 3DI3A 4FA8E 1ETEA 2ERJD 4XNIA 4YPGC 4A3MD 4NEJA 5D6KA 3NPZA 4Q65A 3D87A 5D59A 2KZ1A 4LDSA 1F45B 1IRLA 2E9WC 3N06A 4A3LD 4DKEA 4ZYRA 2ILKA 2Q98A 2CFPA 4IU8A 2Q14A 1HWHA 3OQ3A 5C65A 3UEZE 5IYCD 5D28B 4IKVA 4DOHA 3HOWD 3QAZA 1CNT1 1IARA 2XUTA 3QWRB 5C3ED 1IJZA 3EJJA 2R92D 3G6DA 4JREA 3NCEA 3VA2A 5TS9A 1IK0A 1CSGA 2CFQA 4A3CD 3B5KA 4IKXA 1LKIA 3I4MD 3QT2C 4DKCA 3EW3A 2B91A 2H24A 1ITIA 1KF9A 4J05A 3OG4A 1PGRA 1HGUA 5A2OA 4D2DA 3AYHA 1BUYA 5D58A 4BBRD 1ITFA 1PY2A 4A93D 1EXZA 3NCFA 2OQPA 4OH3A 1ITMA 3PO2D 1HIKA 1BGEA 5EQHA 1AX8A 3DUHC 3NCCA 3OG6A 1PW4A 2LMSA 4DKDA 4YQXA 2B8UA 2B8XA 3MZGA 4ZF7A 2D48A 1HULA 1A22A 5EQIA 3D85C 3HHRA 3IRHA 4YBQA 2Z3QA 1Y6NL 2JA6D 4YDYI 1RFBA 4A3ID 3HOVD 1Y1WD 2CYKA 2IL6A 4BBSD 4GS7A 4GRWA 1B5LA 4NN7A 1CD9A 5E4EA 1GA3A 4BY7D 1ILKA 4QIQA 4A3KD 1FG9A 1M47A 1JLIA 4NN6A 1BGCA 1LQSL 2JA8D 1BCNA 1FYHA 2V8NA 3O7QA 5GXBA 4ZS7A 4LEPA 1M48A 2O26A 4U4TA 2B90A 4ZWBA 3NCBA 3DLQI 1BP3A 3N0PA 4NEMA 2HYMB 2Z3RA 3LB6A 1V7NV 5C44D 1HZIA 3HMXB 5FUCA 4PYPA 4ZWCA 1BBNA 2O27A 1M4AA 3D48P 2Y5YA 4U4VA 4DKFA 2B8YA 5C7XA 3Q1SI 5LQBA 4XNJA 1PV7A 3PIWA 1P9MB 2R7ZD 4TPJA 1CN4C 1NBPA 5FHXA 3INKC 1I1RB 4TPHA 5EQGA 4NN5A 4IKZA 1RW5A 1A7MA 4BXXD 1CYLA 1HWGA 2GMFA 1J7VL 4O9HA 1D9CA 4J4LC 3QB7A 4OAAA 5D22A 1LK3A 1YKBA 5L6YC 3HHCA 1Z92A 4CNIC 4X51A 5FLMD 3HOUD 1HUWA 1Y6ML 2JA7D 2B63D 3H0GD 3I4ND 4IKYA 1ALUA 2L3OA 3HOZD 2LAGA 4RS1A 2R93D 4PS4A 3TGXB 4WRLB 3H3VE 3BPNA 1WU3I 4NI7A 4NKQC 1AU1A 4A3ED 1ITLA 1IL6A 3O7PA 3G9VB
chains in the Genus database with same CATH topology
1PV7A 4APSA 4ZYRA 4UVMA 4OAAA 3WDOA 4TPGA 5EQIA 2XUTA 4OH3A 4YB9D 4XNIA 4J05A 2V8NA 3O7QA 5D6KA 5EQHA 4Q65A 4TPJA 5GXBA 4YBQA 4LEPA 5A2NA 4IKWA 5A2OA 5D59A 4D2DA 4LDSA 4PYPA 4ZWCA 4GBYA 4U4TA 4TPHA 5D58A 4ZW9A 4D2BA 4IU9A 2Y5YA 4JREA 5EQGA 4W6VA 4GBZA 4U4VA 4ZWBA 4IKZA 4JR9A 4U4WA 1PW4A 4GC0A 4IKYA 2CFQA 2CFPA 4IU8A 4QIQA 4D2CA 4IKXA 5C65A 4JA3A 1PV6A 3O7PA 4IKVA 4XNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV7 A;  4APS A;  4ZYR A;  4UVM A;  4OAA A;  3WDO A;  4TPG A;  5EQI A;  2XUT A;  4OH3 A;  4YB9 D;  4XNI A;  4J05 A;  2V8N A;  3O7Q A;  5D6K A;  5EQH A;  4Q65 A;  4TPJ A;  5GXB A;  4YBQ A;  4LEP A;  5A2N A;  4IKW A;  5A2O A;  5D59 A;  4D2D A;  4LDS A;  4PYP A;  4ZWC A;  4GBY A;  4U4T A;  4TPH A;  5D58 A;  4ZW9 A;  4D2B A;  4IU9 A;  2Y5Y A;  4JRE A;  5EQG A;  4W6V A;  4GBZ A;  4U4V A;  4ZWB A;  4IKZ A;  4JR9 A;  4U4W A;  1PW4 A;  4GC0 A;  4IKY A;  2CFQ A;  2CFP A;  4IU8 A;  4QIQ A;  4D2C A;  4IKX A;  5C65 A;  4JA3 A;  1PV6 A;  3O7P A;  4IKV A;  4XNJ A; 
#chains in the Genus database with same CATH topology
 4UVM A;  2L3Y A;  1VLK A;  4YB9 D;  4EXP A;  1PW6 A;  3UX9 A;  3HOX D;  1RCB A;  4A3J D;  4IKW A;  4YUE C;  4Z5R D;  4ZW9 A;  3BPL A;  4JR9 A;  1GNC A;  5KNH I;  4BY1 D;  5IYB D;  4D2C A;  3FKI D;  4MHL A;  5IYD D;  3S9D A;  1INR A;  3WCY I;  3SE3 B;  1WCM D;  5A2N A;  1EVS A;  3BPO A;  3HOY D;  1Y14 A;  1N1F A;  2INT A;  1QVN A;  2JA5 D;  1V7M V;  3PIV A;  4A3D D;  3DGC L;  1RHG A;  4JA3 A;  4LRL A;  1EKU A;  3PO3 D;  2B5I A;  3DI2 A;  1F6F A;  1Y1V D;  1HIJ A;  4I77 Z;  2B8Z A;  4IU9 A;  3L5W I;  4GBZ A;  2C35 A;  1Y6K L;  3QB1 A;  2O6I A;  4A3B D;  1M4C A;  1PV6 A;  5D72 A;  4APS A;  1D9G A;  4EXN A;  1M4B A;  1M4R A;  5IP7 D;  1PVH B;  4A3F D;  1EMR A;  4GBY A;  4D2B A;  2D9Q A;  5IP9 D;  1AXI A;  4U4W A;  4GC0 A;  5D71 A;  3LB6 B;  2XQB A;  1Z7C A;  1SCF A;  3L5X A;  3BES L;  4TPG A;  5D70 A;  3WDO A;  4NI9 A;  2VUM D;  4O6K A;  1BGD A;  2Q7N B;  5C4X D;  1M49 A;  1EER A;  3UF5 A;  4A3G D;  2PSM A;  4W6V A;  3SE4 B;  3UF2 A;  3DI3 A;  4FA8 E;  1ETE A;  2ERJ D;  4XNI A;  4YPG C;  4A3M D;  4NEJ A;  5D6K A;  3NPZ A;  4Q65 A;  3D87 A;  5D59 A;  2KZ1 A;  4LDS A;  1F45 B;  1IRL A;  2E9W C;  3N06 A;  4A3L D;  4DKE A;  4ZYR A;  2ILK A;  2Q98 A;  2CFP A;  4IU8 A;  2Q14 A;  1HWH A;  3OQ3 A;  5C65 A;  3UEZ E;  5IYC D;  5D28 B;  4IKV A;  4DOH A;  3HOW D;  3QAZ A;  1CNT 1;  1IAR A;  2XUT A;  3QWR B;  5C3E D;  1IJZ A;  3EJJ A;  2R92 D;  3G6D A;  4JRE A;  3NCE A;  3VA2 A;  5TS9 A;  1IK0 A;  1CSG A;  2CFQ A;  4A3C D;  3B5K A;  4IKX A;  1LKI A;  3I4M D;  3QT2 C;  4DKC A;  3EW3 A;  2B91 A;  2H24 A;  1ITI A;  1KF9 A;  4J05 A;  3OG4 A;  1PGR A;  1HGU A;  5A2O A;  4D2D A;  3AYH A;  1BUY A;  5D58 A;  4BBR D;  1ITF A;  1PY2 A;  4A93 D;  1EXZ A;  3NCF A;  2OQP A;  4OH3 A;  1ITM A;  3PO2 D;  1HIK A;  1BGE A;  5EQH A;  1AX8 A;  3DUH C;  3NCC A;  3OG6 A;  1PW4 A;  2LMS A;  4DKD A;  4YQX A;  2B8U A;  2B8X A;  3MZG A;  4ZF7 A;  2D48 A;  1HUL A;  1A22 A;  5EQI A;  3D85 C;  3HHR A;  3IRH A;  4YBQ A;  2Z3Q A;  1Y6N L;  2JA6 D;  4YDY I;  1RFB A;  4A3I D;  3HOV D;  1Y1W D;  2CYK A;  2IL6 A;  4BBS D;  4GS7 A;  4GRW A;  1B5L A;  4NN7 A;  1CD9 A;  5E4E A;  1GA3 A;  4BY7 D;  1ILK A;  4QIQ A;  4A3K D;  1FG9 A;  1M47 A;  1JLI A;  4NN6 A;  1BGC A;  1LQS L;  2JA8 D;  1BCN A;  1FYH A;  2V8N A;  3O7Q A;  5GXB A;  4ZS7 A;  4LEP A;  1M48 A;  2O26 A;  4U4T A;  2B90 A;  4ZWB A;  3NCB A;  3DLQ I;  1BP3 A;  3N0P A;  4NEM A;  2HYM B;  2Z3R A;  3LB6 A;  1V7N V;  5C44 D;  1HZI A;  3HMX B;  5FUC A;  4PYP A;  4ZWC A;  1BBN A;  2O27 A;  1M4A A;  3D48 P;  2Y5Y A;  4U4V A;  4DKF A;  2B8Y A;  5C7X A;  3Q1S I;  5LQB A;  4XNJ A;  1PV7 A;  3PIW A;  1P9M B;  2R7Z D;  4TPJ A;  1CN4 C;  1NBP A;  5FHX A;  3INK C;  1I1R B;  4TPH A;  5EQG A;  4NN5 A;  4IKZ A;  1RW5 A;  1A7M A;  4BXX D;  1CYL A;  1HWG A;  2GMF A;  1J7V L;  4O9H A;  1D9C A;  4J4L C;  3QB7 A;  4OAA A;  5D22 A;  1LK3 A;  1YKB A;  5L6Y C;  3HHC A;  1Z92 A;  4CNI C;  4X51 A;  5FLM D;  3HOU D;  1HUW A;  1Y6M L;  2JA7 D;  2B63 D;  3H0G D;  3I4N D;  4IKY A;  1ALU A;  2L3O A;  3HOZ D;  2LAG A;  4RS1 A;  2R93 D;  4PS4 A;  3TGX B;  4WRL B;  3H3V E;  3BPN A;  1WU3 I;  4NI7 A;  4NKQ C;  1AU1 A;  4A3E D;  1ITL A;  1IL6 A;  3O7P A;  3G9V B; 
#chains in the Genus database with same CATH homology
 1PV7 A;  4APS A;  4ZYR A;  4UVM A;  4OAA A;  3WDO A;  4TPG A;  5EQI A;  2XUT A;  4OH3 A;  4YB9 D;  4XNI A;  4J05 A;  2V8N A;  3O7Q A;  5D6K A;  5EQH A;  4Q65 A;  4TPJ A;  5GXB A;  4YBQ A;  4LEP A;  5A2N A;  4IKW A;  5A2O A;  5D59 A;  4D2D A;  4LDS A;  4PYP A;  4ZWC A;  4GBY A;  4U4T A;  4TPH A;  5D58 A;  4ZW9 A;  4D2B A;  4IU9 A;  2Y5Y A;  4JRE A;  5EQG A;  4W6V A;  4GBZ A;  4U4V A;  4ZWB A;  4IKZ A;  4JR9 A;  4U4W A;  1PW4 A;  4GC0 A;  4IKY A;  2CFQ A;  2CFP A;  4IU8 A;  4QIQ A;  4D2C A;  4IKX A;  5C65 A;  4JA3 A;  1PV6 A;  3O7P A;  4IKV A;  4XNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...