4PYZA

Crystal structure of the first two ubl domains of deubiquitylase usp7
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
LVPRGSPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the first two Ubl domains of Deubiquitylase USP7
rcsb
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
molecule tags Hydrolase
source organism Homo sapiens
total genus 70
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyzA02
2LVPA 2YVCA 1E5WA 5D2MB 4HVBA 3RYTA 1WJ6A 2KFJA 1GC7A 2MCNB 2MLBA 2Y5BB 1V5TA 1G6JA 1P0RA 3A1QB 4HLEA 3L54A 3DDCB 1LM8B 4MSMB 3A4RA 4GMVA 2JZZA 3VQIA 5E6NA 3W1YA 1ZGUB 3GOEA 2D07B 2REXA 3PHWB 4MEMA 5LXHA 4G11A 2LZ6A 2BKFA 1WGDA 1WR1A 2IZVB 4WJPA 1F9JA 1KOTA 4MSQB 4TQ1A 3T9LA 3X23A 4F1SA 3X0WA 1J19A 2UWQA 2MW5A 2K25A 1V5OA 5CHWA 1R4NI 3S2AA 3KUZA 4AJYB 1E8XA 2KJ6A 2N7DA 4LDTB 2D2QA 2KTRA 2N9XA 4BBNC 4BKSD 4EUTA 2JWZA 3QHTA 4BOZB 2KTFA 4FADA 2K39A 2M17A 2JF5A 4W9LA 4KSKC 1Q5WB 3HM3A 4G3XB 4GDLB 2CS4A 2EMTA 3RT3B 4JGHB 1P98A 3VTVA 2CHXA 2L0TA 4DHJB 4NY0A 4CO7A 4K81A 1SIFA 1WXSA 2LVOA 2N7EA 2KHWB 4ZRIA 3ZDTA 3T8MA 1WZ3A 3EC8A 3ECIA 4ASWC 3PREA 2NBWB 3M62B 3APCA 2EKEC 4URKA 1WR6E 2O6VD 2OJRA 1WE6A 3ZTCA 4AOFA 1XD3B 3DBLI 3QARA 2B3AA 2GBKA 3M63B 3MHSD 4G0NB 4GIVA 3R66C 4KDLB 1S3SG 1C1YB 2HE7A 1WI0A 3TBLD 2M0XA 5D6JB 2PJHA 3P2BA 1WM2A 2AL6A 4FJZA 4WWNA 3DVNV 4MGKE 3HHMA 3U8ZA 3R3MA 4I6PA 1OTRB 4FHJA 2KDBA 3A9KB 1SE9A 2MX2A 3JW0X 4IWOA 3ZDMC 4G50A 1GJZA 4FJYA 4IM3A 1E7UA 3L16A 1LFDA 4ANXA 3AXCA 2KC1A 2DENB 4XX5A 2LASA 4AUQC 2KVRA 2EMSA 2J0JA 4DDID 2GOWA 3L17A 1UZXB 2GBJA 4KV2A 3SU8X 4BKGA 2MBQA 4ZRKA 2AEHA 2J0MA 2XK5B 1NI2A 4NAWA 4RM8A 2LGYA 2FAZA 5FR6A 3KYCD 5CX3A 1EF5A 2GBMA 4LJOB 4TQ0A 4MGIE 1GUAB 1RFAA 2HTHA 2UYZB 3OLMD 1EO6A 3HM6X 2KQSA 4HDQA 3Q3FA 4MGYE 4PS7A 4WQOB 4OVVA 2CHZA 2G4SA 2MRPA 3NS8A 2C7HA 4MELA 5J17A 3IFWB 4DK5A 3KYDD 4K7UA 3JVZX 2BF8B 3QC8B 3SHQA 4JIOU 3ZTDA 5J2RA 2K6DB 1WX7A 2FCQA 3PGEA 3PTFC 1V6EA 3AU4A 3QIJA 4DDGD 2HJ8A 2A4ZA 4IC7B 2L0FA 5LXIB 1VCBA 2IO0B 2ZEQA 3Q3JA 4FLHA 2KWCA 2CU1A 1WIAA 2MBEA 4F7ZA 3A1QA 3WANA 2OOBB 3H7PB 3TCAA 4W9IA 3UGBB 2DZIA 2FNJB 3QQ8B 4IWQA 1VD2A 3UIPB 4IUMB 4E3CA 2MBOA 2KX0A 2LD9A 2WYQA 2CKHB 2W9NA 3NOBA 2JUOA 1A5RA 2NBVB 4X57B 2A5UA 4BBNF 1Z5SB 1QZEA 2N9PC 5BO4B 4ANVA 3ENEA 2N9EB 1IPGA 2DYMA 4BVUC 3UQBA 1PQSA 2RR9A 4DBGA 2KC2A 5AZFA 3KH0A 3V6EB 1GNUA 3PV1A 1H8CA 4P7IA 4E71A 4KIKB 1YJ1A 3ZUNA 1YQBA 1TBEA 2KZRA 2JPHA 3WAMA 3WALA 2DYOA 1YIWA 2KN5A 4FULA 2KJRA 3K9PB 1R4MI 1WGYA 3MTNB 2PEAA 4AJWA 1E7VA 2K1FA 4KVGB 2PPHA 2K8HA 3DVGX 3UIOB 5L95C 2FCSA 4ANWA 1WF9A 1HE8A 2KD0A 2KNBA 2LRWA 2DYBA 5AZHA 2NR2A 3CF6E 3UF8A 2MA9B 3ZKJC 2BPSA 3V62A 3VTUA 3ZRFA 1TZ1A 2C5LC 3ML9A 1WJ4A 2L05A 1MG8A 1V86A 2V1YA 4MDKE 3QWZB 4RM9A 2JXXA 1TTNA 3JSVB 4FJVB 5AEKB 2NPTA 2LXAA 4MJSB 4TV3A 5J18A 2JVCA 2KMCA 2BGFA 2L8JA 1E8ZA 4GB9A 4GSWA 2KDIA 3IBEA 4HCNB 4NJ6A 5D7GA 1WMHA 1SGHA 1KJTA 1V2YA 1WXVA 3A9KA 4CHKA 3L0WB 3PZDA 2O6VB 3VUWA 5JZEB 1LXDA 5IAAC 1WE7A 1NDDA 4E74A 2M1MA 2WDTB 3PS6A 4GDKA 1XQQA 3PHXB 3EECA 3ZO5B 1WYWB 3N30A 3NY5A 4KZCA 3WAOA 5LLIA 2WX0A 2DAFA 5HKHA 2XBBC 3H1UA 4M8MA 2XK5A 5JH5C 3TIXA 2DHZA 3VFKA 1IYFA 3HIZA 2IO2B 1KM7A 1UBQA 4WJOA 2KMAA 1UBIA 1UGMA 2KX3A 2L3ZA 2PE9A 2LXCA 2ZNVB 4PS8A 5DPWA 2D11A 2DAJA 2MP2B 3L10B 5DPRA 3BY4B 3B1LX 3CMMB 2NVUI 3PT2B 3QK0A 4K7WA 2K6QA 4LDTD 3VDZA 2LGDA 2ZCCA 4EZJA 2O2VB 3VUXA 2J7QB 3RZFA 4IG7B 2CR5A 1I42A 2AYOB 1E90A 4J6IA 2BYEA 2KWUB 1WFYA 1CMXB 4IM0A 1WH3A 2G45B 1JRUA 4WAAA 4XZ4A 3V60A 4A3OA 2Z59B 1WX9A 4M8NA 3CSTA 2C9WB 4W9CA 3RUIB 5JHBA 3I3TB 4NJ7A 5JHAA 4W9JA 4ZDVA 2GMIC 3QCAA 4MH0E 2KTRB 3N32A 5D94A 3W1SC 4RMAA 3A4SC 4MM3A 4NQLB 4HPLB 1S1QB 3ZNGC 4HWIB 4LJPB 5EDSA 1J8CA 1AARA 3IVFA 2VRRB 3ZIMA 2KLCA 1RRBA 5DCNA 4TUUA 3W1SA 3RULA 1YD8U 2KQ7A 2NCNA 2N4FA 3U7DA 3VAWA 2N1WA 3ZNHB 4B9KA 1L7YA 2BWFA 3UINB 2L00B 3A9JB 2ZZPB 2C7NB 4FN2A 3OAWA 1V9JA 4PYZA 1J0GA 3VXWA 2LGXA 2Z0EB 3BINA 3QX1A 2M4NA 4JL9A 3APDA 3DCGA 2FIFA 4I6LB 4KZ0A 3RCZA 4A3PA 4ANUA 4N9F4 3VVWB 1WRDB 1WX8A 2PE6B 4ICVA 3VH3B 1L2NA 4IW0A 2KO3A 2LWPA 1U4AA 3ML8A 4W9KA 3B0AA 3CSFA 4I6NB 2KLGA 4HCPB 3RZWC 4EKUA 3SDLC 2R2QA 1WY8A 4YL8A 2V4LA 1WGGA 3B08A 4BKSA 4EFOA 1WXAA 4WJQA 2MQJA 1UD7A 3DPDA 3ZLZA 4NAWB 4K7SA 3MJWA 3QA8A 2L7RA 4PS3A 2KK8A 1WM3A 1ZKHA 2IO1B 2NBUA 3IHPC 1IP9A 3TMPB 4GGQA 4KDIC 3O65B 4HK2A 2O6VA 3AU5A 2JZ3B 4GDLA 2DX5B 3VUYA 3APFA 1OGWA 1P9DU 1WJUA 2KFKB 2LJ5A 3M95A 3PLVA 1KLVA 3DBHI 3ZVVA 2RPQA 4BOSC 4JLCA 1BT0A 3SD5A 2ZJDA 1EUVB 2BYFA 4EEWA 3PRPB 1Z2MA 3KVFB 4FA6A 3L08A 4OVUA 5DPSA 3VHTC 4FBJB 2DZMA 1Q0WB 4M0WB 2C60A 3PSEB 4EZKA 2KOXA 1GC6A 4ICUA 4AWJA 1WGHA 1XT9B 3KUDB 4NPNA 3GZNI 5E6OA 1ZW7A 2DZKA 4BKTA 1OEYA 1UELA 4HPMB 2MP2A 5DPTA 3DVGY 5CHFA 2JRHA 2IYDB 2WWZA 2FCMA 2IY0B 2O2VA 4ZYNA 3DBRI 2G3QB 1E8YA 4W9FA 3ALBA 2HD5B 2DZJA 3D32A 3AI5A 2I1JA 2ZCBA 1EF1A 4PYUA 2LI5A 2FCNA 4F8CB 2RGFA 3M3JA 3JYUA 3QAQA 4HDOA 4AP4C 4B6WA 4EZLA 2BKRB 1E8WA 5AZGA 2LUEA 4MGZE 3QJZA 2KXJA 5C23A 4W9DA 2D3GA 1P3QU 4A20A 4IM2A 2JY6A 2IBIB 2BWES 3WA0A 3DVNU 4ZRJA 3EFUA 4WWOA 3R7QA 4WJNA 3TJPA 2I1KA 2XEWA 3EHVA 3PPAA 2KDFB 3R7RA 4II2B 3ZNZB 1WJNA 5CHVC 2KDEB 2AL3A 2J0KA 3NZSA 3VH4B 3DBSA 3HK0A 4FHKA 2BYVE 2GBNA 4KSLC 1I35A 1X1MA 3ZW3A 2CHWA 4GOCA 3TL5A 3UQAA 1NBFC 5GMVA 3A9JA 4IWPA 3PVLA 1OEYJ 4DHJD 1H4RA 4CYEA 1P1AA 2NPTB 1V80A 2ZVNA 2G4DB 2ZPYA 4XC2A 4B95A 4HXDA 2N1VA 4GU2A 2QHOA 1WMHB 3NHEB 3L13A 3H7PA 3H9DA 4LCDE 1T0YA 2AWTA 2KJHB 2KANA 3H6NA 3LDZE 4DXAB 5KHOA 3OJ4B 2IY1B 3H7SA 3PRZA 1RAXA 5L83A 2MBHA 4NQKE 4GDKB 3PLUA 1ISNA 2K8CA 4HJKA 2MSED 1LQBA 3K9OB 3ZNID 1D3ZA 3LJ3A 4JQWC 4KIKA 4W9EA 3V61A 3WAPA 2L76A 4BFRA 2NS5A 5E6PA 3DOWA 3A33B 1WZ0A 3DQVA 5C1ZA 2LVQA 3PRMB 1K8RB 1M94A 4TKNA 2KWVB 4GXBA 5CTRC 3U30A 1UH6A 1OQYA 1Y8RC 1V49A 2C7MB 2KFKA 4DWFA 2FUHB 3V6CB 1YX5B 5G2NA 1Q1OA 3ONSA 2IO3B 2RD0A 2Z0DB 4DHZE 3AULA 3NZUA 3KUCB 3KW5B 5G55A 2K8BA 4W9HA 4W9GA 4EOYA 3C0RB 3ZRCA 2YLMA 3JSVA 4MJSA 5KHQA 1C3TA 3N3KB 2JT4B 4GN1A 3VTWA 1WGRA 2R2OA 1TGZB 2ZVOA 2KKCA 4II3B 1WXMA 1FXTB 4NNJB 2FIDA 5TR5A 3RD2A 2MWSB 2ZPNA 2RSUA 4K1RB 2WX1A 2LRUA 1V81A 2JRIB 1RLFA 2M8SA 1GG3A 2D10A 2V3SA 3IG3A 3WIMA 4WWPA 5IA7A 2ASQA 3OJ3A 2MBBB 4DHZB 1YX6B 2ZNVC 2GBRA
chains in the Genus database with same CATH superfamily
2LVPA 2LGIA 5D2MB 4A8XC 1HXYD 2MLBA 2Y5BB 1V5TA 1G6JA 4HLEA 1NYQA 3L54A 4GMVA 2JZZA 3LYYA 3VQIA 3W5UB 3GOEA 2D07B 3PHWB 5LXHA 2BKFA 1WGDA 3Q3NC 1ZXIA 1KOTA 4MSQB 2BQQA 3MJ5A 3S2AA 2D2QA 3PO0A 2JWZA 1STEA 1ZXHA 2K39A 4ZYSA 4W9LA 4DXFA 4G3XB 2CS4A 2EMTA 3BVGA 2WDRB 1PFDA 3RT3B 3VTVA 2CHXA 3ZDTA 1SIJA 3TUOA 3M62B 3DHGC 1L6VA 1XD3B 3DBLI 3QARA 4DXGA 4KDLB 3R66C 1C1YB 1WI0A 1WGKA 2WXMA 2RDHA 1N5XA 5HHDG 1WM2A 5HFYA 2WXPA 4I6PA 2KDBA 3A9KB 1SE9A 3U2SC 1GJZA 1ACCA 2QC8A 2ZW0A 4L23A 2DENB 3UI3A 2KVRA 1E9MA 3P42A 3SU8X 1UZXB 2GBJA 4KV2A 2AEHA 4OW0A 2L83A 2XK5B 4KKJA 4LJOB 4MGIE 1GUAB 1EO6A 3HM6X 5AUKA 1LO5D 2CHZA 2MRPA 5J17A 4DK5A 4K7UA 3QC8B 4XDCA 4HROA 3ZTDA 2E6XA 4RGNA 4EE2A 1N60A 2N9LA 2RDBC 4F7ZA 3A1QA 1VDVA 3TCAA 3P63A 3QQ8B 3UIPB 1VD2A 4C7YA 1TS4A 3ENEA 2N9EB 1PQSA 4ARIA 2UU7A 3V6EB 3R2TA 3PV1A 1L0XB 1P7EA 2KN5A 1WGYA 2KDMA 4AJWA 4FXCA 1CJEA 2W3SA 3LXFA 3UIOB 1KTKA 1SEBD 2JU6X 3RNCC 3VR9B 2MA9B 2BPSA 1TZ1A 5GXGB 1TTNA 4MJSB 2BGFA 2L8JA 4GB9A 4C4VB 4HCNB 5D7GA 1WMHA 3KWVA 4CHKA 3RNEC 1KLUD 1EWYC 1GOZA 2M1MA 2D5GA 4GDKA 2LJIA 1XQQA 1J7CA 3EECA 1L0VB 2PLPA 5LLIA 2DAFA 5HKHA 3H1UA 3TIXA 1PDXA 3HIZA 1T0QC 1QLBB 2KMAA 2ZNVB 4PS8A 2JQRB 5C2TB 1MHHE 2DAJA 3L10B 3CMMB 3QK0A 2K6QA 1V1OA 4EZJA 4IG7B 1E90A 4J6IA 1WFYA 4WAAA 3V60A 2Z59B 1WX9A 4W9CA 3RUIB 1V97A 5JHBA 3I3TB 2H89B 3NZ3A 1QILA 4W9JA 1LGRA 2GMIC 2KTRB 4RMAA 3A4SC 1TKGA 4NQLB 2H88B 1L4DB 3IVFA 5DCNA 4TUUA 3RULA 1YD8U 2N4FA 3VAWA 2L00B 3OAWA 3DWMA 3DCGA 4A3PA 3VVWB 2V3NA 4OZCA 2PE6B 3DHHC 2LWPA 2KLGA 3FILA 3RZWC 1FO4A 4EFOA 1WXAA 1UD7A 3DPDA 1ET9A 3EA6A 4NAWB 4K7SA 2XN9C 3MJWA 5BYQA 4PS3A 1WM3A 4HKQA 1ZKHA 2IO1B 4USAA 4YTMB 1WSPA 2WXQA 2CJOA 2AX5A 3B2GA 2O6VA 3AU5A 2JZ3B 3VUYA 3APFA 3PLVA 2RPQA 1BT0A 3SD5A 2ZJDA 1EUVB 2KWDA 4C56C 1M4VA 2WU2B 1N63A 3FKYA 2QCZA 4FA6A 3L08A 1Q0WB 1Y56A 2PTLA 2Z8LA 1FPYA 1DOXA 5D3DA 1XT9B 5E6OA 1DYQA 3SFDB 2WXRA 1OEYA 4HPMB 5DPTA 1ZP0B 5EE0A 2JRHA 2WWZA 2O2VA 1XLQA 1E8YA 1JWUD 5D3IB 5BYRA 4F8CB 1D5MC 4EZLA 4HDOA 2BKRB 1CZPA 2D3GA 1JALA 3EUB2 4A20A 1F2RI 4ZRJA 3R7QA 1UWMA 2NMQA 3EHVA 2PVGC 3R7RA 3HVZA 1GB1A 5CHVC 3NZSA 3HK0A 4KSLC 4JE3B 4GOCA 3TL5A 1FXIA 4YWGG 2QDFA 1HZ6A 4CYEA 4XC2A 2WXHA 2QHOA 3NHEB 3GZNB 4PT5A 2AWTA 5KHOA 3AV8A 3H7SA 5L83A 4HJKA 3AE3B 2MSED 3K9OB 4P16A 1D3ZA 4WWMA 3LJ3A 4AQ7A 1JROA 1L4ZB 1FCCC 1C4PA 3V61A 2VZKB 4RFBA 4BFRA 3NS1A 3DQVA 5C1ZA 3PRMB 1XO3A 4MACA 1E0ZA 4GXBA 3NG0A 3Q3MC 4TMAB 1F52A 3V3XA 1QOFA 2QJLA 1DGJA 1Q1OA 5IO9A 2IO3B 2RMMA 3P4QB 1FD6A 5IP4D 5G55A 1XLOA 4HJGE 4EOYA 2LHEA 1DOYA 4MJSA 3N3KB 2JT4B 4GN1A 1TGZB 1YNTE 4II3B 4YTNB 1FXTB 3ZQ4A 1SE2A 4LNIA 2JRIB 1RLFA 2D10A 1MFWA 4XDDA 5FR3A 4DHZB 1I4RA 2ICIA 2KVZA 3AE9B 1WJ6A 1GC7A 3A1QB 4OHJA 3DDCB 1LM8B 3A4RA 3AEBB 4US9A 3VRAB 3W1YA 4TSSA 4MEMA 3E56A 4G11A 4WJPA 2IZVB 2J42A 1F9JA 2YEPF 4F1SA 3X0WA 1KFYB 2K25A 3VR8B 1V5OA 4RCOA 4P1BC 3BYYB 4AJYB 4K3BA 1E8XA 1AW7A 1C4CA 2KTRA 2N9XA 3VRBB 4BKSD 3Q2AC 3QHTA 3P4PB 3GP7A 4FADA 3Q69A 4GDLB 3HM3A 4JGHB 4ZRIA 1EU3A 1YN5A 2N7EA 2KHWB 2WU5B 3AB5A 1SJHD 2JXTA 3LB8C 1I7HA 2L52A 1SSNA 3MHSD 1ET6A 2WXIA 5D6JB 1HA5A 3E9SA 2AL6A 4HKZE 3DVNV 1Q10A 1OTRB 2PW9A 4FJYA 1E7UA 3L16A 1LFDA 4ANXA 2KC1A 4AUQC 4DDID 1HTQA 4Q2JA 5H92C 3CIRB 4NAWA 1R4NB 4RM8A 2FAZA 5TSSA 1RYJA 2GBMA 4TQ0A 1BMLC 2DNFA 3AH7A 3Q3FA 4MGYE 3AEDB 3NS8A 5LNK1 4JIOU 2LHDA 2FCQA 1V6EA 2HJ8A 2A4ZA 2WDQB 4FLHA 1WIAA 2MBEA 3RPFC 4P1CC 3WANA 2IJ0A 4A90A 1JQ4A 3H7PB 3UGBB 2FNJB 4IWQA 2VZKD 2MBOA 2LD9A 1TJEA 2WYQA 2CKHB 5BO4B 1IPGA 2HTME 2KC2A 2Y5PA 2AQ2B 2SAKA 1GNUA 2GB1A 4P7IA 4E71A 4KIKB 1YJ1A 2I2YA 1TY0A 2IGGA 3WAMA 3WALA 1EM7A 2BTEA 2LUMA 3ZXVA 2K1FA 4KVGB 3B2FA 2PPHA 5L95C 2K3UA 1WF9A 1HE8A 4QAYA 1NYRA 4XE0A 5AZHA 3FILB 3ZKJC 3VTUA 3ML9A 1AN8A 1WJ4A 1MG8A 3AEGB 4MDKE 3IT6B 5FK9C 4LLGM 4H2AA 3JSVB 5AEKB 1C9FA 2WXJA 3BK1A 4YSZB 1KJTA 3OWEB 2O6VB 5JZEB 2N0SB 4HPPA 1WE7A 4JX1C 2K22A 2WDTB 3PS6A 3PHXB 1QOAA 1MJDA 2WX0A 1SXTA 3KLSX 5JH5C 2MHJA 2W82A 3RFZB 3TEXA 1L0YB 2IO2B 1KM7A 1UBQA 5BMIA 2PE9A 1UGMA 1R4MB 2KX3A 2L3ZA 2ACZB 1XXGA 5DPRA 3BY4B 3B1LX 2NVUI 1HZ5A 2BVCA 4K7WA 2BS4B 3WCQA 3CWIA 2ZCCA 2O2VB 4L2YA 3HUIA 2CR5A 3Q8BA 2BYEA 4LNNA 1GAQB 3GS2A 4XZ4A 4M8NA 1JCKB 3FC4A 4NJ7A 5JHAA 1T5XD 4MH0E 3NVVA 4C80A 1QQRA 4MM3A 4HPLB 4A9AA 1S1QB 3ZNGC 5EDSA 1HTOA 1FRDA 3I5JC 4RGTA 3ZIMA 1C76A 3AECB 3C19A 3W1SA 4YSXB 2NCNA 4B9KA 2LFIA 3RI7C 3UINB 1SE4A 3VXWA 4P6VF 3BINA 3R8BA 1VJKA 2M4NA 1NI3A 4JL9A 4N9F4 2FUG1 1PGBA 1XLPA 2R61A 1ESFA 1XLNA 4ZHPA 1U4AA 4W9KA 3B0AA 3AEEB 4EKUA 3SDLC 1WWTA 4YL8A 1WGGA 2FBWB 3ZLZA 2KQ4X 2L7RA 2KK8A 2NBUA 3IHPC 3RN9C 1FFVA 4ZOHC 3TMPB 4GGQA 1T0SC 4GDLA 2DX5B 1P9DU 2LJ5A 3ZVVA 4JLCA 3NVZA 1SE3A 3KVFB 4OVUA 1VR9A 3PZ7A 1UWXA 4FBJB 2C60A 3HRDD 4EZKA 2KOXA 1GC6A 4AWJA 3KUDB 3GZNI 4WAFA 2DZKA 2G9HD 2BS2B 4ZYNA 4W9FA 2HD5B 2DZJA 5BMHA 1EF1A 4PYUA 2J52A 3MC9A 2RGFA 3M3JA 4B6WA 2JZPA 4L1BA 5AZGA 3QJZA 2KXJA 1KF6B 2IBIB 3P4SB 1PUTA 2JWUA 4S0RA 4WWOA 1FXAA 3TJPA 1JWAD 2XEWA 2KDFB 3ZNZB 2MJ3A 1YN4A 1V8CA 3DBHB 4JWUC 1X1MA 1TKEA 1UF0A 2CHWA 3UQAA 1NBFC 3A9JA 3TEWA 4IWPA 1OEYJ 2ZVNA 2G4DB 5BMGA 3NJTA 3V05A 2N1VA 3H7PA 3H9DA 2LEKA 3AMZA 2KANA 2QEJC 1D5XC 3H6NA 3OJ4B 4HRSA 2IY1B 4LNOA 1FEHA 3PRZA 5T8IA 3DBRB 2MBHA 4NQKE 3AEAB 1ISNA 3J9CA 1LQBA 3ZNID 4KIKA 3IT4B 2L76A 3DOWA 3A33B 2QSDA 1BUIC 5IOIA 1Y8RC 1V49A 3V6CB 2JYEA 5G2NA 2RD0A 1UUPA 3KUCB 4M0WA 1FNVA 3C0RB 3ZRCA 2YLMA 1QKZA 3JSVA 1IGCA 2WXKA 3N9YC 3W5VB 2MEKA 1KLGD 2KKCA 2ZVOA 4M00A 4A55A 2MWSB 2ZPNA 2RSUA 1V81A 1E10A 2V3SA 3WIMA 1GG3A 5IA7A 3Q8AA 1YX6B 4HVBA 5E6JA 1HQRD 1P0RA 5E6NA 1ZGUB 1F77A 4NZLB 1JWMD 2LZ6A 1RM6C 1SF0A 3AM9A 4TQ1A 3X23A 1YN3A 3TEYA 2MW5A 2HDEA 2J53A 5CHWA 2PIAA 1R4NI 5I4DA 3AE5B 2N7DA 3EGRA 1FNUA 1JW9D 2KTFA 2M17A 1FMAD 1P98A 2L0TA 4DHJB 4NY0A 4JPSA 4CO7A 1K53A 4ASWC 2BYTA 4YT0B 2NBWB 2EKEC 1WR6E 2OJRA 1WE6A 2M0XA 4MH8A 2ON8A 4MGKE 5H8YE 3HHMA 3U8ZA 3R3MA 3JW0X 2KYWA 2INNE 3AXCA 2LASA 2J0JA 2GOWA 2BS3B 1J7AA 4ZRKA 5HG2A 1PGAA 2LGYA 5FR6A 5JXVA 1D6EC 2UYZB 2KQSA 2RDGA 4WQOB 3ZXRA 4OVVA 2G4SA 4MELA 2C7HA 1ZPSA 3IFWB 3SHQA 2K6DB 3PTFC 2OEDA 3QIJA 4DDGD 1VCBA 2IO0B 2ZEQA 2MJEA 2KWCA 2D3AA 2W55A 1QOGA 2CU1A 2OOBB 1BXTA 1E6EB 4MM3B 2KX0A 3SEBA 4PK1A 2JUOA 4BBNF 1Z5SB 2DYMA 4BVUC 3UQBA 4DBGA 2W3RA 3FAHA 1H8CA 1YQBA 2DYOA 1F0ZA 2KJRA 3K9PB 1R4MI 1JRPA 4WH4A 5HI1A 2B76B 2PEAA 1E7VA 2K8HA 1ENFA 2WHIA 3AN1A 1D5ZC 2FCSA 2NTSA 2IGHA 1N61A 3N20C 2LRWA 1SBBB 4OVZA 2DYBA 2NR2A 1TYGB 2WXGA 3ZJUA 1V1PA 3V62A 3ZRFA 1K52A 4ZRPA 1GB4A 2JXXA 4TV3A 1FM0D 5G5HA 2X38A 2JVCA 2KMCA 2GRIA 4GSWA 2INPE 1SGHA 3C8YA 1ZE3D 3L0WB 3PZDA 1A70A 1LXDA 1RFKA 2D3CA 4NAMA 5IAAC 1NDDA 2VH2A 1C78A 1WYWB 3WAOA 2XBBC 4M8MA 5EE9A 1T0RC 5EE3A 1IYFA 1UGJA 4WJOA 5DPWA 1UBIA 3DHIC 5C3JB 2D11A 1FNWA 4IOIE 1CQVA 2LGDA 2KAJA 2J7QB 1AYFA 3BVMA 1YOVB 3DWGC 3RNBC 1CMXB 1WH3A 2LGSA 1DOIA 3CSTA 3QCAA 1JMLA 5D94A 3EFCA 4LJPB 1VRAB 4N6EB 1AARA 4YTPB 3ZYYX 1HEZE 2KLCA 1RRBA 2Y3AA 1TY2A 4J3OD 1VZ7A 3U7DA 2N1WA 2Q5WD 3ZNHB 1L7YA 3A9JB 2ZZPB 2C7NB 1V9JA 2LGXA 2Z0EB 3SFEB 3QX1A 1ZUD2 3APDA 2FIFA 4I6LB 4ANUA 2IPKD 4HEA1 1WRDB 1CK1A 4ICVA 3VH3B 2VH1A 3N1ZC 1L2NA 4IW0A 2JX5A 2KO3A 1RWSA 3MC8A 1K50A 3CSFA 1NENB 4I6NB 4IKGA 2R2QA 5MPOA 1FIQA 4BKSA 4R3DA 2WGSA 1JWBD 1EU4A 3I57A 3QA8A 2WDVB 3KWLA 1MHXA 2QILA 4KDIC 4HK2A 2J4XA 1OGWA 3OG5A 3M95A 3DBHI 2WXNA 4BOSC 1I4XA 4EEWA 2M19A 3PRPB 1P7FA 1ROEA 3VHTC 2D3BA 4M0WB 1T6BX 3PSEB 4ICUA 1WGHA 3P4RB 4NPNA 1ZW7A 4JWSC 4BKTA 4M02A 1UELA 2MP2A 3DVGY 2IYDB 4CQNA 3DBRI 2KT7A 2G3QB 3D32A 3AI5A 4S17A 2ZCBA 1D4BA 2FCNA 3JYUA 1QOBA 1E8WA 2KMMA 4W9DA 1P3QU 2CJNA 3DVNU 3EFUA 2I1KA 4GLSC 4II2B 4O1NA 2AL3A 3P1MA 3VH4B 4FHKA 1OQQA 2GBNA 1I35A 3ZW3A 1IBXB 2KN4A 2M0AA 1NEKB 1TS5A 2NPTB 1F1HA 1V80A 2ZPYA 4D2KA 1JWSD 4B95A 5IN7A 4GU2A 1T3QA 3L13A 4LCDE 1T0YA 3LDZE 1TS2A 3PLUA 5IKCM 2V4IB 3GE8C 1ZDXA 2G1EA 4W9EA 5E6PA 3ETRA 1WZ0A 1K8RB 4WURA 4TKNA 4REZA 2KWVB 3U30A 1OQYA 3AEFB 2KFKA 4IDIA 2X8XX 3ONSA 2Z0DB 2LMCA 2WLBA 4BAXA 4DHZE 3NZUA 3KW5B 4LNFA 2EKIA 2K8BA 4W9GA 4WIPA 4AS1A 1XEEA 1MPEA 2MH7A 3Q8CA 1WGRA 2R2OA 1L5PA 3W9CB 2FIDA 5TR5A 3RD2A 4K1RB 3MHZA 2WX1A 2BT6A 2K9XA 3N1XC 2PMVA 2LRUA 4US8A 5G5GA 2INCC 2M8SA 1QT9A 3IG3A 4WWPA 2ASQA 3OJ3A 2ZNVC 2YVCA 1E5WA 4YSYB 1PGXA 3U4EG 2WXLA 2KFJA 2WNMA 3RYTA 2MCNB 5EE1A 3TSSA 2PVOD 5FKAC 4MSMB 3Q3OC 2REXA 1UNSA 3T3NA 1YQ4B 1WR1A 4RNAA 1TS3A 2BW2A 4XWWA 1MI0A 3T9LA 1TIFA 1SB3C 2MJDA 4XYCA 1B9RA 1J19A 2UWQA 1C77A 1GPXA 3KUZA 2KJ6A 2BB6A 4LDTB 1FRRA 4BBNC 3MFGA 1I4PA 4EUTA 3I63C 3NVYA 4BOZB 3NVWA 4RGMA 1IUEA 2JF5A 4RH6A 4KSKC 1Q5WB 4ZRQA 4K81A 1SIFA 1WXSA 2LVOA 4ITKA 5AUIA 1J7BA 3T8MA 1WZ3A 3EC8A 3ECIA 3PREA 5BYSA 3ZGZA 2EELA 3APCA 1V1PB 4URKA 2JYTA 2O6VD 4AOFA 3ZTCA 4G0NB 2B3AA 2GBKA 3M63B 4GIVA 1S3SG 1N62A 2HE7A 3TBLD 4DQOC 1XCTL 2IDYA 3B9JA 2PJHA 3P2BA 4FJZA 4WWNA 1C79A 3RNAC 2DLBA 2E3TA 2QIEB 4FHJA 1R7SA 2MX2A 4IWOA 3ZDMC 4G50A 4XWTA 4IM3A 4KKIA 2V9HA 4XX5A 3Q6BA 2EMSA 3Q14C 1FFUA 3L17A 3O13A 4BKGA 2MBQA 2J0MA 3AE8B 1NI2A 1KH0A 1XCQL 4UDUC 3KYCD 5CX3A 1EF5A 1RFAA 2HTHA 3OLMD 4HDQA 4PS7A 4B0EA 1OFFA 3KYDD 3JVZX 2BF8B 5J2RA 1WX7A 3PGEA 3AU4A 2M56B 5LXIB 4IC7B 2L0FA 3Q3JA 3DBLB 1ZOYB 3IAM1 1C4AA 4W9IA 2DZIA 4E3CA 4IUMB 3NOBA 2W9NA 2DBYA 1A5RA 2NBVB 4X57B 2A5UA 4C00A 1QZEA 2N9PC 3BVZA 4RF0A 4ANVA 4RGOS 1I4HA 2RR9A 5AZFA 3H8HA 3IXSA 2YEPB 3KH0A 3TEZA 1YQ3B 3ZUNA 1TBEA 2JSVX 2KZRA 2JPHA 3U52E 1YIWA 4FULA 3RNFC 3MTNB 2K0PA 2AQ1B 1E7PB 1VZ8A 3DVGX 2SEBD 4ANWA 2KD0A 2KNBA 3UF8A 3CF6E 4XGAB 2W54A 1YJJA 4WQMA 2KACA 1IBXA 2C5LC 2L05A 1V86A 2V1YA 3QWZB 4LNKA 4RM9A 4FJVB 5J18A 2NPTA 2LXAA 2V3PA 1E8ZA 4LTUA 2GI9A 2KDIA 3IBEA 4NJ6A 1V2YA 1WXVA 1YJIA 3A9KA 4M01A 4MT5A 3VUWA 4K3CA 4E74A 2NTTA 2CU3A 3ZO5B 3N30A 2BB5A 1EWCA 3NY5A 4KZCA 3AE7B 3RNGC 3SR6A 2XK5A 2DHZA 3VFKA 3NRZA 3W2DA 2Y5CA 2ZW1A 2LXCA 3R2IA 2MP2B 3L4PA 3VDZA 3PT2B 4ACFA 4LDTD 3VUXA 3RZFA 2FE8A 1I42A 2AYOB 3URYA 1MG4A 1XF5L 2KWUB 3NUHB 3Q8FA 4IM0A 2G45B 1JRUA 3GE3C 2IGDA 3RMKC 4A3OA 2V0GA 2C9WB 4ZDVA 2GLSA 3N32A 2WP9B 2DWQA 3W1SC 1I4GA 2OHFA 4HWIB 1J8CA 4N59A 2VRRB 4OZBA 2KQ7A 1OQRA 2BWFA 4FN2A 4PYZA 1J0GA 3PZ8A 4ZHOA 2TSSA 3RCZA 1B1ZA 4KZ0A 3KQ4A 1IGDA 1WX8A 1WXQA 3MC0B 3ML8A 3AE6B 4KGSA 1WY8A 2V4LA 3B08A 4N58A 4WJQA 2MQJA 1L6UA 3BIID 4OZAA 1VLBA 4C4VA 1IP9A 1NVID 3O65B 3AE4B 1WRIA 1WJUA 2KFKB 2ONQA 1KLVA 2HJ1A 4RF1A 3GB1A 3T3OA 1I4QA 1SJED 2BYFA 4NJCA 1Z2MA 5DPSA 3BK2A 2DZMA 2L1AA 2XNAC 3AE1B 2AQ3B 2WXFA 3I9V1 5CHFA 2FCMA 2IY0B 1PYWD 1VZ6A 3ALBA 2I1JA 2QMTA 1QF6A 2LI5A 3QAQA 4AP4C 3IAS1 2LUEA 1AWDA 4MGZE 1F2RC 5C23A 4C7ZA 1K51A 4IM2A 2JY6A 2BWES 3WA0A 4WJNA 2OJWA 4KGTA 3PPAA 2N9KA 4B0MA 3MP9A 1WJNA 3ABVB 1TZOA 2KDEB 2J0KA 2K5PA 3DBSA 4KX6B 4BZAA 2BYVE 3N1YC 1YMHE 3HVDA 5GMVA 4DHJD 3PVLA 1H4RA 3Q8EA 1P1AA 2N7JA 4YXDB 4HXDA 1WMHB 4ARCA 2WXOA 3ZJVA 2KJHB 2RPVA 4DXAB 3BZDB 1RAXA 1ZDVA 4GDKB 2K8CA 1TKYA 2I38A 2WQYB 2INDC 4JQWC 3WAPA 2NS5A 1N6ZA 2LVQA 1M94A 1KRHA 5CTRC 1UH6A 3U7ZA 2C7MB 4DWFA 2FUHB 1YX5B 2WS3B 3AE2B 2L32A 4LK0M 3AULA 4KGRA 4W9HA 1WYGA 5KHQA 1C3TA 2BBCA 3VTWA 1FCLA 1WXMA 4NNJB 3BYTB 1TT5B 3BWUD 1MVKA 4A6QA 2PKOA 3ZJTA 2MBBB 1N5WA 4HCPB 2GBRA
chains in the Genus database with same CATH topology
2LVPA 2YVCA 1E5WA 5D2MB 4HVBA 3RYTA 1WJ6A 2KFJA 1GC7A 2MCNB 2MLBA 2Y5BB 1V5TA 1G6JA 1P0RA 3A1QB 4HLEA 3L54A 3DDCB 1LM8B 4MSMB 3A4RA 4GMVA 2JZZA 3VQIA 5E6NA 3W1YA 1ZGUB 3GOEA 2D07B 2REXA 3PHWB 4MEMA 5LXHA 4G11A 2LZ6A 2BKFA 1WGDA 1WR1A 2IZVB 4WJPA 1F9JA 1KOTA 4MSQB 4TQ1A 3T9LA 3X23A 4F1SA 3X0WA 1J19A 2UWQA 2MW5A 2K25A 1V5OA 5CHWA 1R4NI 3S2AA 3KUZA 4AJYB 1E8XA 2KJ6A 2N7DA 4LDTB 2D2QA 2KTRA 2N9XA 4BBNC 4BKSD 4EUTA 2JWZA 3QHTA 4BOZB 2KTFA 4FADA 2K39A 2M17A 2JF5A 4W9LA 4KSKC 1Q5WB 3HM3A 4G3XB 4GDLB 2CS4A 2EMTA 3RT3B 4JGHB 1P98A 3VTVA 2CHXA 2L0TA 4DHJB 4NY0A 4CO7A 4K81A 1SIFA 1WXSA 2LVOA 2N7EA 2KHWB 4ZRIA 3ZDTA 3T8MA 1WZ3A 3EC8A 3ECIA 4ASWC 3PREA 2NBWB 3M62B 3APCA 2EKEC 4URKA 1WR6E 2O6VD 2OJRA 1WE6A 3ZTCA 4AOFA 1XD3B 3DBLI 3QARA 2B3AA 2GBKA 3M63B 3MHSD 4G0NB 4GIVA 3R66C 4KDLB 1S3SG 1C1YB 2HE7A 1WI0A 3TBLD 2M0XA 5D6JB 2PJHA 3P2BA 1WM2A 2AL6A 4FJZA 4WWNA 3DVNV 4MGKE 3HHMA 3U8ZA 3R3MA 4I6PA 1OTRB 4FHJA 2KDBA 3A9KB 1SE9A 2MX2A 3JW0X 4IWOA 3ZDMC 4G50A 1GJZA 4FJYA 4IM3A 1E7UA 3L16A 1LFDA 4ANXA 3AXCA 2KC1A 2DENB 4XX5A 2LASA 4AUQC 2KVRA 2EMSA 2J0JA 4DDID 2GOWA 3L17A 1UZXB 2GBJA 4KV2A 3SU8X 4BKGA 2MBQA 4ZRKA 2AEHA 2J0MA 2XK5B 1NI2A 4NAWA 4RM8A 2LGYA 2FAZA 5FR6A 3KYCD 5CX3A 1EF5A 2GBMA 4LJOB 4TQ0A 4MGIE 1GUAB 1RFAA 2HTHA 2UYZB 3OLMD 1EO6A 3HM6X 2KQSA 4HDQA 3Q3FA 4MGYE 4PS7A 4WQOB 4OVVA 2CHZA 2G4SA 2MRPA 3NS8A 2C7HA 4MELA 5J17A 3IFWB 4DK5A 3KYDD 4K7UA 3JVZX 2BF8B 3QC8B 3SHQA 4JIOU 3ZTDA 5J2RA 2K6DB 1WX7A 2FCQA 3PGEA 3PTFC 1V6EA 3AU4A 3QIJA 4DDGD 2HJ8A 2A4ZA 4IC7B 2L0FA 5LXIB 1VCBA 2IO0B 2ZEQA 3Q3JA 4FLHA 2KWCA 2CU1A 1WIAA 2MBEA 4F7ZA 3A1QA 3WANA 2OOBB 3H7PB 3TCAA 4W9IA 3UGBB 2DZIA 2FNJB 3QQ8B 4IWQA 1VD2A 3UIPB 4IUMB 4E3CA 2MBOA 2KX0A 2LD9A 2WYQA 2CKHB 2W9NA 3NOBA 2JUOA 1A5RA 2NBVB 4X57B 2A5UA 4BBNF 1Z5SB 1QZEA 2N9PC 5BO4B 4ANVA 3ENEA 2N9EB 1IPGA 2DYMA 4BVUC 3UQBA 1PQSA 2RR9A 4DBGA 2KC2A 5AZFA 3KH0A 3V6EB 1GNUA 3PV1A 1H8CA 4P7IA 4E71A 4KIKB 1YJ1A 3ZUNA 1YQBA 1TBEA 2KZRA 2JPHA 3WAMA 3WALA 2DYOA 1YIWA 2KN5A 4FULA 2KJRA 3K9PB 1R4MI 1WGYA 3MTNB 2PEAA 4AJWA 1E7VA 2K1FA 4KVGB 2PPHA 2K8HA 3DVGX 3UIOB 5L95C 2FCSA 4ANWA 1WF9A 1HE8A 2KD0A 2KNBA 2LRWA 2DYBA 5AZHA 2NR2A 3CF6E 3UF8A 2MA9B 3ZKJC 2BPSA 3V62A 3VTUA 3ZRFA 1TZ1A 2C5LC 3ML9A 1WJ4A 2L05A 1MG8A 1V86A 2V1YA 4MDKE 3QWZB 4RM9A 2JXXA 1TTNA 3JSVB 4FJVB 5AEKB 2NPTA 2LXAA 4MJSB 4TV3A 5J18A 2JVCA 2KMCA 2BGFA 2L8JA 1E8ZA 4GB9A 4GSWA 2KDIA 3IBEA 4HCNB 4NJ6A 5D7GA 1WMHA 1SGHA 1KJTA 1V2YA 1WXVA 3A9KA 4CHKA 3L0WB 3PZDA 2O6VB 3VUWA 5JZEB 1LXDA 5IAAC 1WE7A 1NDDA 4E74A 2M1MA 2WDTB 3PS6A 4GDKA 1XQQA 3PHXB 3EECA 3ZO5B 1WYWB 3N30A 3NY5A 4KZCA 3WAOA 5LLIA 2WX0A 2DAFA 5HKHA 2XBBC 3H1UA 4M8MA 2XK5A 5JH5C 3TIXA 2DHZA 3VFKA 1IYFA 3HIZA 2IO2B 1KM7A 1UBQA 4WJOA 2KMAA 1UBIA 1UGMA 2KX3A 2L3ZA 2PE9A 2LXCA 2ZNVB 4PS8A 5DPWA 2D11A 2DAJA 2MP2B 3L10B 5DPRA 3BY4B 3B1LX 3CMMB 2NVUI 3PT2B 3QK0A 4K7WA 2K6QA 4LDTD 3VDZA 2LGDA 2ZCCA 4EZJA 2O2VB 3VUXA 2J7QB 3RZFA 4IG7B 2CR5A 1I42A 2AYOB 1E90A 4J6IA 2BYEA 2KWUB 1WFYA 1CMXB 4IM0A 1WH3A 2G45B 1JRUA 4WAAA 4XZ4A 3V60A 4A3OA 2Z59B 1WX9A 4M8NA 3CSTA 2C9WB 4W9CA 3RUIB 5JHBA 3I3TB 4NJ7A 5JHAA 4W9JA 4ZDVA 2GMIC 3QCAA 4MH0E 2KTRB 3N32A 5D94A 3W1SC 4RMAA 3A4SC 4MM3A 4NQLB 4HPLB 1S1QB 3ZNGC 4HWIB 4LJPB 5EDSA 1J8CA 1AARA 3IVFA 2VRRB 3ZIMA 2KLCA 1RRBA 5DCNA 4TUUA 3W1SA 3RULA 1YD8U 2KQ7A 2NCNA 2N4FA 3U7DA 3VAWA 2N1WA 3ZNHB 4B9KA 1L7YA 2BWFA 3UINB 2L00B 3A9JB 2ZZPB 2C7NB 4FN2A 3OAWA 1V9JA 4PYZA 1J0GA 3VXWA 2LGXA 2Z0EB 3BINA 3QX1A 2M4NA 4JL9A 3APDA 3DCGA 2FIFA 4I6LB 4KZ0A 3RCZA 4A3PA 4ANUA 4N9F4 3VVWB 1WRDB 1WX8A 2PE6B 4ICVA 3VH3B 1L2NA 4IW0A 2KO3A 2LWPA 1U4AA 3ML8A 4W9KA 3B0AA 3CSFA 4I6NB 2KLGA 4HCPB 3RZWC 4EKUA 3SDLC 2R2QA 1WY8A 4YL8A 2V4LA 1WGGA 3B08A 4BKSA 4EFOA 1WXAA 4WJQA 2MQJA 1UD7A 3DPDA 3ZLZA 4NAWB 4K7SA 3MJWA 3QA8A 2L7RA 4PS3A 2KK8A 1WM3A 1ZKHA 2IO1B 2NBUA 3IHPC 1IP9A 3TMPB 4GGQA 4KDIC 3O65B 4HK2A 2O6VA 3AU5A 2JZ3B 4GDLA 2DX5B 3VUYA 3APFA 1OGWA 1P9DU 1WJUA 2KFKB 2LJ5A 3M95A 3PLVA 1KLVA 3DBHI 3ZVVA 2RPQA 4BOSC 4JLCA 1BT0A 3SD5A 2ZJDA 1EUVB 2BYFA 4EEWA 3PRPB 1Z2MA 3KVFB 4FA6A 3L08A 4OVUA 5DPSA 3VHTC 4FBJB 2DZMA 1Q0WB 4M0WB 2C60A 3PSEB 4EZKA 2KOXA 1GC6A 4ICUA 4AWJA 1WGHA 1XT9B 3KUDB 4NPNA 3GZNI 5E6OA 1ZW7A 2DZKA 4BKTA 1OEYA 1UELA 4HPMB 2MP2A 5DPTA 3DVGY 5CHFA 2JRHA 2IYDB 2WWZA 2FCMA 2IY0B 2O2VA 4ZYNA 3DBRI 2G3QB 1E8YA 4W9FA 3ALBA 2HD5B 2DZJA 3D32A 3AI5A 2I1JA 2ZCBA 1EF1A 4PYUA 2LI5A 2FCNA 4F8CB 2RGFA 3M3JA 3JYUA 3QAQA 4HDOA 4AP4C 4B6WA 4EZLA 2BKRB 1E8WA 5AZGA 2LUEA 4MGZE 3QJZA 2KXJA 5C23A 4W9DA 2D3GA 1P3QU 4A20A 4IM2A 2JY6A 2IBIB 2BWES 3WA0A 3DVNU 4ZRJA 3EFUA 4WWOA 3R7QA 4WJNA 3TJPA 2I1KA 2XEWA 3EHVA 3PPAA 2KDFB 3R7RA 4II2B 3ZNZB 1WJNA 5CHVC 2KDEB 2AL3A 2J0KA 3NZSA 3VH4B 3DBSA 3HK0A 4FHKA 2BYVE 2GBNA 4KSLC 1I35A 1X1MA 3ZW3A 2CHWA 4GOCA 3TL5A 3UQAA 1NBFC 5GMVA 3A9JA 4IWPA 3PVLA 1OEYJ 4DHJD 1H4RA 4CYEA 1P1AA 2NPTB 1V80A 2ZVNA 2G4DB 2ZPYA 4XC2A 4B95A 4HXDA 2N1VA 4GU2A 2QHOA 1WMHB 3NHEB 3L13A 3H7PA 3H9DA 4LCDE 1T0YA 2AWTA 2KJHB 2KANA 3H6NA 3LDZE 4DXAB 5KHOA 3OJ4B 2IY1B 3H7SA 3PRZA 1RAXA 5L83A 2MBHA 4NQKE 4GDKB 3PLUA 1ISNA 2K8CA 4HJKA 2MSED 1LQBA 3K9OB 3ZNID 1D3ZA 3LJ3A 4JQWC 4KIKA 4W9EA 3V61A 3WAPA 2L76A 4BFRA 2NS5A 5E6PA 3DOWA 3A33B 1WZ0A 3DQVA 5C1ZA 2LVQA 3PRMB 1K8RB 1M94A 4TKNA 2KWVB 4GXBA 5CTRC 3U30A 1UH6A 1OQYA 1Y8RC 1V49A 2C7MB 2KFKA 4DWFA 2FUHB 3V6CB 1YX5B 5G2NA 1Q1OA 3ONSA 2IO3B 2RD0A 2Z0DB 4DHZE 3AULA 3NZUA 3KUCB 3KW5B 5G55A 2K8BA 4W9HA 4W9GA 4EOYA 3C0RB 3ZRCA 2YLMA 3JSVA 4MJSA 5KHQA 1C3TA 3N3KB 2JT4B 4GN1A 3VTWA 1WGRA 2R2OA 1TGZB 2ZVOA 2KKCA 4II3B 1WXMA 1FXTB 4NNJB 2FIDA 5TR5A 3RD2A 2MWSB 2ZPNA 2RSUA 4K1RB 2WX1A 2LRUA 1V81A 2JRIB 1RLFA 2M8SA 1GG3A 2D10A 2V3SA 3IG3A 3WIMA 4WWPA 5IA7A 2ASQA 3OJ3A 2MBBB 4DHZB 1YX6B 2ZNVC 2GBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVP A;  2YVC A;  1E5W A;  5D2M B;  4HVB A;  3RYT A;  1WJ6 A;  2KFJ A;  1GC7 A;  2MCN B;  2MLB A;  2Y5B B;  1V5T A;  1G6J A;  1P0R A;  3A1Q B;  4HLE A;  3L54 A;  3DDC B;  1LM8 B;  4MSM B;  3A4R A;  4GMV A;  2JZZ A;  3VQI A;  5E6N A;  3W1Y A;  1ZGU B;  3GOE A;  2D07 B;  2REX A;  3PHW B;  4MEM A;  5LXH A;  4G11 A;  2LZ6 A;  2BKF A;  1WGD A;  1WR1 A;  2IZV B;  4WJP A;  1F9J A;  1KOT A;  4MSQ B;  4TQ1 A;  3T9L A;  3X23 A;  4F1S A;  3X0W A;  1J19 A;  2UWQ A;  2MW5 A;  2K25 A;  1V5O A;  5CHW A;  1R4N I;  3S2A A;  3KUZ A;  4AJY B;  1E8X A;  2KJ6 A;  2N7D A;  4LDT B;  2D2Q A;  2KTR A;  2N9X A;  4BBN C;  4BKS D;  4EUT A;  2JWZ A;  3QHT A;  4BOZ B;  2KTF A;  4FAD A;  2K39 A;  2M17 A;  2JF5 A;  4W9L A;  4KSK C;  1Q5W B;  3HM3 A;  4G3X B;  4GDL B;  2CS4 A;  2EMT A;  3RT3 B;  4JGH B;  1P98 A;  3VTV A;  2CHX A;  2L0T A;  4DHJ B;  4NY0 A;  4CO7 A;  4K81 A;  1SIF A;  1WXS A;  2LVO A;  2N7E A;  2KHW B;  4ZRI A;  3ZDT A;  3T8M A;  1WZ3 A;  3EC8 A;  3ECI A;  4ASW C;  3PRE A;  2NBW B;  3M62 B;  3APC A;  2EKE C;  4URK A;  1WR6 E;  2O6V D;  2OJR A;  1WE6 A;  3ZTC A;  4AOF A;  1XD3 B;  3DBL I;  3QAR A;  2B3A A;  2GBK A;  3M63 B;  3MHS D;  4G0N B;  4GIV A;  3R66 C;  4KDL B;  1S3S G;  1C1Y B;  2HE7 A;  1WI0 A;  3TBL D;  2M0X A;  5D6J B;  2PJH A;  3P2B A;  1WM2 A;  2AL6 A;  4FJZ A;  4WWN A;  3DVN V;  4MGK E;  3HHM A;  3U8Z A;  3R3M A;  4I6P A;  1OTR B;  4FHJ A;  2KDB A;  3A9K B;  1SE9 A;  2MX2 A;  3JW0 X;  4IWO A;  3ZDM C;  4G50 A;  1GJZ A;  4FJY A;  4IM3 A;  1E7U A;  3L16 A;  1LFD A;  4ANX A;  3AXC A;  2KC1 A;  2DEN B;  4XX5 A;  2LAS A;  4AUQ C;  2KVR A;  2EMS A;  2J0J A;  4DDI D;  2GOW A;  3L17 A;  1UZX B;  2GBJ A;  4KV2 A;  3SU8 X;  4BKG A;  2MBQ A;  4ZRK A;  2AEH A;  2J0M A;  2XK5 B;  1NI2 A;  4NAW A;  4RM8 A;  2LGY A;  2FAZ A;  5FR6 A;  3KYC D;  5CX3 A;  1EF5 A;  2GBM A;  4LJO B;  4TQ0 A;  4MGI E;  1GUA B;  1RFA A;  2HTH A;  2UYZ B;  3OLM D;  1EO6 A;  3HM6 X;  2KQS A;  4HDQ A;  3Q3F A;  4MGY E;  4PS7 A;  4WQO B;  4OVV A;  2CHZ A;  2G4S A;  2MRP A;  3NS8 A;  2C7H A;  4MEL A;  5J17 A;  3IFW B;  4DK5 A;  3KYD D;  4K7U A;  3JVZ X;  2BF8 B;  3QC8 B;  3SHQ A;  4JIO U;  3ZTD A;  5J2R A;  2K6D B;  1WX7 A;  2FCQ A;  3PGE A;  3PTF C;  1V6E A;  3AU4 A;  3QIJ A;  4DDG D;  2HJ8 A;  2A4Z A;  4IC7 B;  2L0F A;  5LXI B;  1VCB A;  2IO0 B;  2ZEQ A;  3Q3J A;  4FLH A;  2KWC A;  2CU1 A;  1WIA A;  2MBE A;  4F7Z A;  3A1Q A;  3WAN A;  2OOB B;  3H7P B;  3TCA A;  4W9I A;  3UGB B;  2DZI A;  2FNJ B;  3QQ8 B;  4IWQ A;  1VD2 A;  3UIP B;  4IUM B;  4E3C A;  2MBO A;  2KX0 A;  2LD9 A;  2WYQ A;  2CKH B;  2W9N A;  3NOB A;  2JUO A;  1A5R A;  2NBV B;  4X57 B;  2A5U A;  4BBN F;  1Z5S B;  1QZE A;  2N9P C;  5BO4 B;  4ANV A;  3ENE A;  2N9E B;  1IPG A;  2DYM A;  4BVU C;  3UQB A;  1PQS A;  2RR9 A;  4DBG A;  2KC2 A;  5AZF A;  3KH0 A;  3V6E B;  1GNU A;  3PV1 A;  1H8C A;  4P7I A;  4E71 A;  4KIK B;  1YJ1 A;  3ZUN A;  1YQB A;  1TBE A;  2KZR A;  2JPH A;  3WAM A;  3WAL A;  2DYO A;  1YIW A;  2KN5 A;  4FUL A;  2KJR A;  3K9P B;  1R4M I;  1WGY A;  3MTN B;  2PEA A;  4AJW A;  1E7V A;  2K1F A;  4KVG B;  2PPH A;  2K8H A;  3DVG X;  3UIO B;  5L95 C;  2FCS A;  4ANW A;  1WF9 A;  1HE8 A;  2KD0 A;  2KNB A;  2LRW A;  2DYB A;  5AZH A;  2NR2 A;  3CF6 E;  3UF8 A;  2MA9 B;  3ZKJ C;  2BPS A;  3V62 A;  3VTU A;  3ZRF A;  1TZ1 A;  2C5L C;  3ML9 A;  1WJ4 A;  2L05 A;  1MG8 A;  1V86 A;  2V1Y A;  4MDK E;  3QWZ B;  4RM9 A;  2JXX A;  1TTN A;  3JSV B;  4FJV B;  5AEK B;  2NPT A;  2LXA A;  4MJS B;  4TV3 A;  5J18 A;  2JVC A;  2KMC A;  2BGF A;  2L8J A;  1E8Z A;  4GB9 A;  4GSW A;  2KDI A;  3IBE A;  4HCN B;  4NJ6 A;  5D7G A;  1WMH A;  1SGH A;  1KJT A;  1V2Y A;  1WXV A;  3A9K A;  4CHK A;  3L0W B;  3PZD A;  2O6V B;  3VUW A;  5JZE B;  1LXD A;  5IAA C;  1WE7 A;  1NDD A;  4E74 A;  2M1M A;  2WDT B;  3PS6 A;  4GDK A;  1XQQ A;  3PHX B;  3EEC A;  3ZO5 B;  1WYW B;  3N30 A;  3NY5 A;  4KZC A;  3WAO A;  5LLI A;  2WX0 A;  2DAF A;  5HKH A;  2XBB C;  3H1U A;  4M8M A;  2XK5 A;  5JH5 C;  3TIX A;  2DHZ A;  3VFK A;  1IYF A;  3HIZ A;  2IO2 B;  1KM7 A;  1UBQ A;  4WJO A;  2KMA A;  1UBI A;  1UGM A;  2KX3 A;  2L3Z A;  2PE9 A;  2LXC A;  2ZNV B;  4PS8 A;  5DPW A;  2D11 A;  2DAJ A;  2MP2 B;  3L10 B;  5DPR A;  3BY4 B;  3B1L X;  3CMM B;  2NVU I;  3PT2 B;  3QK0 A;  4K7W A;  2K6Q A;  4LDT D;  3VDZ A;  2LGD A;  2ZCC A;  4EZJ A;  2O2V B;  3VUX A;  2J7Q B;  3RZF A;  4IG7 B;  2CR5 A;  1I42 A;  2AYO B;  1E90 A;  4J6I A;  2BYE A;  2KWU B;  1WFY A;  1CMX B;  4IM0 A;  1WH3 A;  2G45 B;  1JRU A;  4WAA A;  4XZ4 A;  3V60 A;  4A3O A;  2Z59 B;  1WX9 A;  4M8N A;  3CST A;  2C9W B;  4W9C A;  3RUI B;  5JHB A;  3I3T B;  4NJ7 A;  5JHA A;  4W9J A;  4ZDV A;  2GMI C;  3QCA A;  4MH0 E;  2KTR B;  3N32 A;  5D94 A;  3W1S C;  4RMA A;  3A4S C;  4MM3 A;  4NQL B;  4HPL B;  1S1Q B;  3ZNG C;  4HWI B;  4LJP B;  5EDS A;  1J8C A;  1AAR A;  3IVF A;  2VRR B;  3ZIM A;  2KLC A;  1RRB A;  5DCN A;  4TUU A;  3W1S A;  3RUL A;  1YD8 U;  2KQ7 A;  2NCN A;  2N4F A;  3U7D A;  3VAW A;  2N1W A;  3ZNH B;  4B9K A;  1L7Y A;  2BWF A;  3UIN B;  2L00 B;  3A9J B;  2ZZP B;  2C7N B;  4FN2 A;  3OAW A;  1V9J A;  4PYZ A;  1J0G A;  3VXW A;  2LGX A;  2Z0E B;  3BIN A;  3QX1 A;  2M4N A;  4JL9 A;  3APD A;  3DCG A;  2FIF A;  4I6L B;  4KZ0 A;  3RCZ A;  4A3P A;  4ANU A;  4N9F 4;  3VVW B;  1WRD B;  1WX8 A;  2PE6 B;  4ICV A;  3VH3 B;  1L2N A;  4IW0 A;  2KO3 A;  2LWP A;  1U4A A;  3ML8 A;  4W9K A;  3B0A A;  3CSF A;  4I6N B;  2KLG A;  4HCP B;  3RZW C;  4EKU A;  3SDL C;  2R2Q A;  1WY8 A;  4YL8 A;  2V4L A;  1WGG A;  3B08 A;  4BKS A;  4EFO A;  1WXA A;  4WJQ A;  2MQJ A;  1UD7 A;  3DPD A;  3ZLZ A;  4NAW B;  4K7S A;  3MJW A;  3QA8 A;  2L7R A;  4PS3 A;  2KK8 A;  1WM3 A;  1ZKH A;  2IO1 B;  2NBU A;  3IHP C;  1IP9 A;  3TMP B;  4GGQ A;  4KDI C;  3O65 B;  4HK2 A;  2O6V A;  3AU5 A;  2JZ3 B;  4GDL A;  2DX5 B;  3VUY A;  3APF A;  1OGW A;  1P9D U;  1WJU A;  2KFK B;  2LJ5 A;  3M95 A;  3PLV A;  1KLV A;  3DBH I;  3ZVV A;  2RPQ A;  4BOS C;  4JLC A;  1BT0 A;  3SD5 A;  2ZJD A;  1EUV B;  2BYF A;  4EEW A;  3PRP B;  1Z2M A;  3KVF B;  4FA6 A;  3L08 A;  4OVU A;  5DPS A;  3VHT C;  4FBJ B;  2DZM A;  1Q0W B;  4M0W B;  2C60 A;  3PSE B;  4EZK A;  2KOX A;  1GC6 A;  4ICU A;  4AWJ A;  1WGH A;  1XT9 B;  3KUD B;  4NPN A;  3GZN I;  5E6O A;  1ZW7 A;  2DZK A;  4BKT A;  1OEY A;  1UEL A;  4HPM B;  2MP2 A;  5DPT A;  3DVG Y;  5CHF A;  2JRH A;  2IYD B;  2WWZ A;  2FCM A;  2IY0 B;  2O2V A;  4ZYN A;  3DBR I;  2G3Q B;  1E8Y A;  4W9F A;  3ALB A;  2HD5 B;  2DZJ A;  3D32 A;  3AI5 A;  2I1J A;  2ZCB A;  1EF1 A;  4PYU A;  2LI5 A;  2FCN A;  4F8C B;  2RGF A;  3M3J A;  3JYU A;  3QAQ A;  4HDO A;  4AP4 C;  4B6W A;  4EZL A;  2BKR B;  1E8W A;  5AZG A;  2LUE A;  4MGZ E;  3QJZ A;  2KXJ A;  5C23 A;  4W9D A;  2D3G A;  1P3Q U;  4A20 A;  4IM2 A;  2JY6 A;  2IBI B;  2BWE S;  3WA0 A;  3DVN U;  4ZRJ A;  3EFU A;  4WWO A;  3R7Q A;  4WJN A;  3TJP A;  2I1K A;  2XEW A;  3EHV A;  3PPA A;  2KDF B;  3R7R A;  4II2 B;  3ZNZ B;  1WJN A;  5CHV C;  2KDE B;  2AL3 A;  2J0K A;  3NZS A;  3VH4 B;  3DBS A;  3HK0 A;  4FHK A;  2BYV E;  2GBN A;  4KSL C;  1I35 A;  1X1M A;  3ZW3 A;  2CHW A;  4GOC A;  3TL5 A;  3UQA A;  1NBF C;  5GMV A;  3A9J A;  4IWP A;  3PVL A;  1OEY J;  4DHJ D;  1H4R A;  4CYE A;  1P1A A;  2NPT B;  1V80 A;  2ZVN A;  2G4D B;  2ZPY A;  4XC2 A;  4B95 A;  4HXD A;  2N1V A;  4GU2 A;  2QHO A;  1WMH B;  3NHE B;  3L13 A;  3H7P A;  3H9D A;  4LCD E;  1T0Y A;  2AWT A;  2KJH B;  2KAN A;  3H6N A;  3LDZ E;  4DXA B;  5KHO A;  3OJ4 B;  2IY1 B;  3H7S A;  3PRZ A;  1RAX A;  5L83 A;  2MBH A;  4NQK E;  4GDK B;  3PLU A;  1ISN A;  2K8C A;  4HJK A;  2MSE D;  1LQB A;  3K9O B;  3ZNI D;  1D3Z A;  3LJ3 A;  4JQW C;  4KIK A;  4W9E A;  3V61 A;  3WAP A;  2L76 A;  4BFR A;  2NS5 A;  5E6P A;  3DOW A;  3A33 B;  1WZ0 A;  3DQV A;  5C1Z A;  2LVQ A;  3PRM B;  1K8R B;  1M94 A;  4TKN A;  2KWV B;  4GXB A;  5CTR C;  3U30 A;  1UH6 A;  1OQY A;  1Y8R C;  1V49 A;  2C7M B;  2KFK A;  4DWF A;  2FUH B;  3V6C B;  1YX5 B;  5G2N A;  1Q1O A;  3ONS A;  2IO3 B;  2RD0 A;  2Z0D B;  4DHZ E;  3AUL A;  3NZU A;  3KUC B;  3KW5 B;  5G55 A;  2K8B A;  4W9H A;  4W9G A;  4EOY A;  3C0R B;  3ZRC A;  2YLM A;  3JSV A;  4MJS A;  5KHQ A;  1C3T A;  3N3K B;  2JT4 B;  4GN1 A;  3VTW A;  1WGR A;  2R2O A;  1TGZ B;  2ZVO A;  2KKC A;  4II3 B;  1WXM A;  1FXT B;  4NNJ B;  2FID A;  5TR5 A;  3RD2 A;  2MWS B;  2ZPN A;  2RSU A;  4K1R B;  2WX1 A;  2LRU A;  1V81 A;  2JRI B;  1RLF A;  2M8S A;  1GG3 A;  2D10 A;  2V3S A;  3IG3 A;  3WIM A;  4WWP A;  5IA7 A;  2ASQ A;  3OJ3 A;  2MBB B;  4DHZ B;  1YX6 B;  2ZNV C;  2GBR A; 
#chains in the Genus database with same CATH topology
 2LVP A;  2LGI A;  5D2M B;  4A8X C;  1HXY D;  2MLB A;  2Y5B B;  1V5T A;  1G6J A;  4HLE A;  1NYQ A;  3L54 A;  4GMV A;  2JZZ A;  3LYY A;  3VQI A;  3W5U B;  3GOE A;  2D07 B;  3PHW B;  5LXH A;  2BKF A;  1WGD A;  3Q3N C;  1ZXI A;  1KOT A;  4MSQ B;  2BQQ A;  3MJ5 A;  3S2A A;  2D2Q A;  3PO0 A;  2JWZ A;  1STE A;  1ZXH A;  2K39 A;  4ZYS A;  4W9L A;  4DXF A;  4G3X B;  2CS4 A;  2EMT A;  3BVG A;  2WDR B;  1PFD A;  3RT3 B;  3VTV A;  2CHX A;  3ZDT A;  1SIJ A;  3TUO A;  3M62 B;  3DHG C;  1L6V A;  1XD3 B;  3DBL I;  3QAR A;  4DXG A;  4KDL B;  3R66 C;  1C1Y B;  1WI0 A;  1WGK A;  2WXM A;  2RDH A;  1N5X A;  5HHD G;  1WM2 A;  5HFY A;  2WXP A;  4I6P A;  2KDB A;  3A9K B;  1SE9 A;  3U2S C;  1GJZ A;  1ACC A;  2QC8 A;  2ZW0 A;  4L23 A;  2DEN B;  3UI3 A;  2KVR A;  1E9M A;  3P42 A;  3SU8 X;  1UZX B;  2GBJ A;  4KV2 A;  2AEH A;  4OW0 A;  2L83 A;  2XK5 B;  4KKJ A;  4LJO B;  4MGI E;  1GUA B;  1EO6 A;  3HM6 X;  5AUK A;  1LO5 D;  2CHZ A;  2MRP A;  5J17 A;  4DK5 A;  4K7U A;  3QC8 B;  4XDC A;  4HRO A;  3ZTD A;  2E6X A;  4RGN A;  4EE2 A;  1N60 A;  2N9L A;  2RDB C;  4F7Z A;  3A1Q A;  1VDV A;  3TCA A;  3P63 A;  3QQ8 B;  3UIP B;  1VD2 A;  4C7Y A;  1TS4 A;  3ENE A;  2N9E B;  1PQS A;  4ARI A;  2UU7 A;  3V6E B;  3R2T A;  3PV1 A;  1L0X B;  1P7E A;  2KN5 A;  1WGY A;  2KDM A;  4AJW A;  4FXC A;  1CJE A;  2W3S A;  3LXF A;  3UIO B;  1KTK A;  1SEB D;  2JU6 X;  3RNC C;  3VR9 B;  2MA9 B;  2BPS A;  1TZ1 A;  5GXG B;  1TTN A;  4MJS B;  2BGF A;  2L8J A;  4GB9 A;  4C4V B;  4HCN B;  5D7G A;  1WMH A;  3KWV A;  4CHK A;  3RNE C;  1KLU D;  1EWY C;  1GOZ A;  2M1M A;  2D5G A;  4GDK A;  2LJI A;  1XQQ A;  1J7C A;  3EEC A;  1L0V B;  2PLP A;  5LLI A;  2DAF A;  5HKH A;  3H1U A;  3TIX A;  1PDX A;  3HIZ A;  1T0Q C;  1QLB B;  2KMA A;  2ZNV B;  4PS8 A;  2JQR B;  5C2T B;  1MHH E;  2DAJ A;  3L10 B;  3CMM B;  3QK0 A;  2K6Q A;  1V1O A;  4EZJ A;  4IG7 B;  1E90 A;  4J6I A;  1WFY A;  4WAA A;  3V60 A;  2Z59 B;  1WX9 A;  4W9C A;  3RUI B;  1V97 A;  5JHB A;  3I3T B;  2H89 B;  3NZ3 A;  1QIL A;  4W9J A;  1LGR A;  2GMI C;  2KTR B;  4RMA A;  3A4S C;  1TKG A;  4NQL B;  2H88 B;  1L4D B;  3IVF A;  5DCN A;  4TUU A;  3RUL A;  1YD8 U;  2N4F A;  3VAW A;  2L00 B;  3OAW A;  3DWM A;  3DCG A;  4A3P A;  3VVW B;  2V3N A;  4OZC A;  2PE6 B;  3DHH C;  2LWP A;  2KLG A;  3FIL A;  3RZW C;  1FO4 A;  4EFO A;  1WXA A;  1UD7 A;  3DPD A;  1ET9 A;  3EA6 A;  4NAW B;  4K7S A;  2XN9 C;  3MJW A;  5BYQ A;  4PS3 A;  1WM3 A;  4HKQ A;  1ZKH A;  2IO1 B;  4USA A;  4YTM B;  1WSP A;  2WXQ A;  2CJO A;  2AX5 A;  3B2G A;  2O6V A;  3AU5 A;  2JZ3 B;  3VUY A;  3APF A;  3PLV A;  2RPQ A;  1BT0 A;  3SD5 A;  2ZJD A;  1EUV B;  2KWD A;  4C56 C;  1M4V A;  2WU2 B;  1N63 A;  3FKY A;  2QCZ A;  4FA6 A;  3L08 A;  1Q0W B;  1Y56 A;  2PTL A;  2Z8L A;  1FPY A;  1DOX A;  5D3D A;  1XT9 B;  5E6O A;  1DYQ A;  3SFD B;  2WXR A;  1OEY A;  4HPM B;  5DPT A;  1ZP0 B;  5EE0 A;  2JRH A;  2WWZ A;  2O2V A;  1XLQ A;  1E8Y A;  1JWU D;  5D3I B;  5BYR A;  4F8C B;  1D5M C;  4EZL A;  4HDO A;  2BKR B;  1CZP A;  2D3G A;  1JAL A;  3EUB 2;  4A20 A;  1F2R I;  4ZRJ A;  3R7Q A;  1UWM A;  2NMQ A;  3EHV A;  2PVG C;  3R7R A;  3HVZ A;  1GB1 A;  5CHV C;  3NZS A;  3HK0 A;  4KSL C;  4JE3 B;  4GOC A;  3TL5 A;  1FXI A;  4YWG G;  2QDF A;  1HZ6 A;  4CYE A;  4XC2 A;  2WXH A;  2QHO A;  3NHE B;  3GZN B;  4PT5 A;  2AWT A;  5KHO A;  3AV8 A;  3H7S A;  5L83 A;  4HJK A;  3AE3 B;  2MSE D;  3K9O B;  4P16 A;  1D3Z A;  4WWM A;  3LJ3 A;  4AQ7 A;  1JRO A;  1L4Z B;  1FCC C;  1C4P A;  3V61 A;  2VZK B;  4RFB A;  4BFR A;  3NS1 A;  3DQV A;  5C1Z A;  3PRM B;  1XO3 A;  4MAC A;  1E0Z A;  4GXB A;  3NG0 A;  3Q3M C;  4TMA B;  1F52 A;  3V3X A;  1QOF A;  2QJL A;  1DGJ A;  1Q1O A;  5IO9 A;  2IO3 B;  2RMM A;  3P4Q B;  1FD6 A;  5IP4 D;  5G55 A;  1XLO A;  4HJG E;  4EOY A;  2LHE A;  1DOY A;  4MJS A;  3N3K B;  2JT4 B;  4GN1 A;  1TGZ B;  1YNT E;  4II3 B;  4YTN B;  1FXT B;  3ZQ4 A;  1SE2 A;  4LNI A;  2JRI B;  1RLF A;  2D10 A;  1MFW A;  4XDD A;  5FR3 A;  4DHZ B;  1I4R A;  2ICI A;  2KVZ A;  3AE9 B;  1WJ6 A;  1GC7 A;  3A1Q B;  4OHJ A;  3DDC B;  1LM8 B;  3A4R A;  3AEB B;  4US9 A;  3VRA B;  3W1Y A;  4TSS A;  4MEM A;  3E56 A;  4G11 A;  4WJP A;  2IZV B;  2J42 A;  1F9J A;  2YEP F;  4F1S A;  3X0W A;  1KFY B;  2K25 A;  3VR8 B;  1V5O A;  4RCO A;  4P1B C;  3BYY B;  4AJY B;  4K3B A;  1E8X A;  1AW7 A;  1C4C A;  2KTR A;  2N9X A;  3VRB B;  4BKS D;  3Q2A C;  3QHT A;  3P4P B;  3GP7 A;  4FAD A;  3Q69 A;  4GDL B;  3HM3 A;  4JGH B;  4ZRI A;  1EU3 A;  1YN5 A;  2N7E A;  2KHW B;  2WU5 B;  3AB5 A;  1SJH D;  2JXT A;  3LB8 C;  1I7H A;  2L52 A;  1SSN A;  3MHS D;  1ET6 A;  2WXI A;  5D6J B;  1HA5 A;  3E9S A;  2AL6 A;  4HKZ E;  3DVN V;  1Q10 A;  1OTR B;  2PW9 A;  4FJY A;  1E7U A;  3L16 A;  1LFD A;  4ANX A;  2KC1 A;  4AUQ C;  4DDI D;  1HTQ A;  4Q2J A;  5H92 C;  3CIR B;  4NAW A;  1R4N B;  4RM8 A;  2FAZ A;  5TSS A;  1RYJ A;  2GBM A;  4TQ0 A;  1BML C;  2DNF A;  3AH7 A;  3Q3F A;  4MGY E;  3AED B;  3NS8 A;  5LNK 1;  4JIO U;  2LHD A;  2FCQ A;  1V6E A;  2HJ8 A;  2A4Z A;  2WDQ B;  4FLH A;  1WIA A;  2MBE A;  3RPF C;  4P1C C;  3WAN A;  2IJ0 A;  4A90 A;  1JQ4 A;  3H7P B;  3UGB B;  2FNJ B;  4IWQ A;  2VZK D;  2MBO A;  2LD9 A;  1TJE A;  2WYQ A;  2CKH B;  5BO4 B;  1IPG A;  2HTM E;  2KC2 A;  2Y5P A;  2AQ2 B;  2SAK A;  1GNU A;  2GB1 A;  4P7I A;  4E71 A;  4KIK B;  1YJ1 A;  2I2Y A;  1TY0 A;  2IGG A;  3WAM A;  3WAL A;  1EM7 A;  2BTE A;  2LUM A;  3ZXV A;  2K1F A;  4KVG B;  3B2F A;  2PPH A;  5L95 C;  2K3U A;  1WF9 A;  1HE8 A;  4QAY A;  1NYR A;  4XE0 A;  5AZH A;  3FIL B;  3ZKJ C;  3VTU A;  3ML9 A;  1AN8 A;  1WJ4 A;  1MG8 A;  3AEG B;  4MDK E;  3IT6 B;  5FK9 C;  4LLG M;  4H2A A;  3JSV B;  5AEK B;  1C9F A;  2WXJ A;  3BK1 A;  4YSZ B;  1KJT A;  3OWE B;  2O6V B;  5JZE B;  2N0S B;  4HPP A;  1WE7 A;  4JX1 C;  2K22 A;  2WDT B;  3PS6 A;  3PHX B;  1QOA A;  1MJD A;  2WX0 A;  1SXT A;  3KLS X;  5JH5 C;  2MHJ A;  2W82 A;  3RFZ B;  3TEX A;  1L0Y B;  2IO2 B;  1KM7 A;  1UBQ A;  5BMI A;  2PE9 A;  1UGM A;  1R4M B;  2KX3 A;  2L3Z A;  2ACZ B;  1XXG A;  5DPR A;  3BY4 B;  3B1L X;  2NVU I;  1HZ5 A;  2BVC A;  4K7W A;  2BS4 B;  3WCQ A;  3CWI A;  2ZCC A;  2O2V B;  4L2Y A;  3HUI A;  2CR5 A;  3Q8B A;  2BYE A;  4LNN A;  1GAQ B;  3GS2 A;  4XZ4 A;  4M8N A;  1JCK B;  3FC4 A;  4NJ7 A;  5JHA A;  1T5X D;  4MH0 E;  3NVV A;  4C80 A;  1QQR A;  4MM3 A;  4HPL B;  4A9A A;  1S1Q B;  3ZNG C;  5EDS A;  1HTO A;  1FRD A;  3I5J C;  4RGT A;  3ZIM A;  1C76 A;  3AEC B;  3C19 A;  3W1S A;  4YSX B;  2NCN A;  4B9K A;  2LFI A;  3RI7 C;  3UIN B;  1SE4 A;  3VXW A;  4P6V F;  3BIN A;  3R8B A;  1VJK A;  2M4N A;  1NI3 A;  4JL9 A;  4N9F 4;  2FUG 1;  1PGB A;  1XLP A;  2R61 A;  1ESF A;  1XLN A;  4ZHP A;  1U4A A;  4W9K A;  3B0A A;  3AEE B;  4EKU A;  3SDL C;  1WWT A;  4YL8 A;  1WGG A;  2FBW B;  3ZLZ A;  2KQ4 X;  2L7R A;  2KK8 A;  2NBU A;  3IHP C;  3RN9 C;  1FFV A;  4ZOH C;  3TMP B;  4GGQ A;  1T0S C;  4GDL A;  2DX5 B;  1P9D U;  2LJ5 A;  3ZVV A;  4JLC A;  3NVZ A;  1SE3 A;  3KVF B;  4OVU A;  1VR9 A;  3PZ7 A;  1UWX A;  4FBJ B;  2C60 A;  3HRD D;  4EZK A;  2KOX A;  1GC6 A;  4AWJ A;  3KUD B;  3GZN I;  4WAF A;  2DZK A;  2G9H D;  2BS2 B;  4ZYN A;  4W9F A;  2HD5 B;  2DZJ A;  5BMH A;  1EF1 A;  4PYU A;  2J52 A;  3MC9 A;  2RGF A;  3M3J A;  4B6W A;  2JZP A;  4L1B A;  5AZG A;  3QJZ A;  2KXJ A;  1KF6 B;  2IBI B;  3P4S B;  1PUT A;  2JWU A;  4S0R A;  4WWO A;  1FXA A;  3TJP A;  1JWA D;  2XEW A;  2KDF B;  3ZNZ B;  2MJ3 A;  1YN4 A;  1V8C A;  3DBH B;  4JWU C;  1X1M A;  1TKE A;  1UF0 A;  2CHW A;  3UQA A;  1NBF C;  3A9J A;  3TEW A;  4IWP A;  1OEY J;  2ZVN A;  2G4D B;  5BMG A;  3NJT A;  3V05 A;  2N1V A;  3H7P A;  3H9D A;  2LEK A;  3AMZ A;  2KAN A;  2QEJ C;  1D5X C;  3H6N A;  3OJ4 B;  4HRS A;  2IY1 B;  4LNO A;  1FEH A;  3PRZ A;  5T8I A;  3DBR B;  2MBH A;  4NQK E;  3AEA B;  1ISN A;  3J9C A;  1LQB A;  3ZNI D;  4KIK A;  3IT4 B;  2L76 A;  3DOW A;  3A33 B;  2QSD A;  1BUI C;  5IOI A;  1Y8R C;  1V49 A;  3V6C B;  2JYE A;  5G2N A;  2RD0 A;  1UUP A;  3KUC B;  4M0W A;  1FNV A;  3C0R B;  3ZRC A;  2YLM A;  1QKZ A;  3JSV A;  1IGC A;  2WXK A;  3N9Y C;  3W5V B;  2MEK A;  1KLG D;  2KKC A;  2ZVO A;  4M00 A;  4A55 A;  2MWS B;  2ZPN A;  2RSU A;  1V81 A;  1E10 A;  2V3S A;  3WIM A;  1GG3 A;  5IA7 A;  3Q8A A;  1YX6 B;  4HVB A;  5E6J A;  1HQR D;  1P0R A;  5E6N A;  1ZGU B;  1F77 A;  4NZL B;  1JWM D;  2LZ6 A;  1RM6 C;  1SF0 A;  3AM9 A;  4TQ1 A;  3X23 A;  1YN3 A;  3TEY A;  2MW5 A;  2HDE A;  2J53 A;  5CHW A;  2PIA A;  1R4N I;  5I4D A;  3AE5 B;  2N7D A;  3EGR A;  1FNU A;  1JW9 D;  2KTF A;  2M17 A;  1FMA D;  1P98 A;  2L0T A;  4DHJ B;  4NY0 A;  4JPS A;  4CO7 A;  1K53 A;  4ASW C;  2BYT A;  4YT0 B;  2NBW B;  2EKE C;  1WR6 E;  2OJR A;  1WE6 A;  2M0X A;  4MH8 A;  2ON8 A;  4MGK E;  5H8Y E;  3HHM A;  3U8Z A;  3R3M A;  3JW0 X;  2KYW A;  2INN E;  3AXC A;  2LAS A;  2J0J A;  2GOW A;  2BS3 B;  1J7A A;  4ZRK A;  5HG2 A;  1PGA A;  2LGY A;  5FR6 A;  5JXV A;  1D6E C;  2UYZ B;  2KQS A;  2RDG A;  4WQO B;  3ZXR A;  4OVV A;  2G4S A;  4MEL A;  2C7H A;  1ZPS A;  3IFW B;  3SHQ A;  2K6D B;  3PTF C;  2OED A;  3QIJ A;  4DDG D;  1VCB A;  2IO0 B;  2ZEQ A;  2MJE A;  2KWC A;  2D3A A;  2W55 A;  1QOG A;  2CU1 A;  2OOB B;  1BXT A;  1E6E B;  4MM3 B;  2KX0 A;  3SEB A;  4PK1 A;  2JUO A;  4BBN F;  1Z5S B;  2DYM A;  4BVU C;  3UQB A;  4DBG A;  2W3R A;  3FAH A;  1H8C A;  1YQB A;  2DYO A;  1F0Z A;  2KJR A;  3K9P B;  1R4M I;  1JRP A;  4WH4 A;  5HI1 A;  2B76 B;  2PEA A;  1E7V A;  2K8H A;  1ENF A;  2WHI A;  3AN1 A;  1D5Z C;  2FCS A;  2NTS A;  2IGH A;  1N61 A;  3N20 C;  2LRW A;  1SBB B;  4OVZ A;  2DYB A;  2NR2 A;  1TYG B;  2WXG A;  3ZJU A;  1V1P A;  3V62 A;  3ZRF A;  1K52 A;  4ZRP A;  1GB4 A;  2JXX A;  4TV3 A;  1FM0 D;  5G5H A;  2X38 A;  2JVC A;  2KMC A;  2GRI A;  4GSW A;  2INP E;  1SGH A;  3C8Y A;  1ZE3 D;  3L0W B;  3PZD A;  1A70 A;  1LXD A;  1RFK A;  2D3C A;  4NAM A;  5IAA C;  1NDD A;  2VH2 A;  1C78 A;  1WYW B;  3WAO A;  2XBB C;  4M8M A;  5EE9 A;  1T0R C;  5EE3 A;  1IYF A;  1UGJ A;  4WJO A;  5DPW A;  1UBI A;  3DHI C;  5C3J B;  2D11 A;  1FNW A;  4IOI E;  1CQV A;  2LGD A;  2KAJ A;  2J7Q B;  1AYF A;  3BVM A;  1YOV B;  3DWG C;  3RNB C;  1CMX B;  1WH3 A;  2LGS A;  1DOI A;  3CST A;  3QCA A;  1JML A;  5D94 A;  3EFC A;  4LJP B;  1VRA B;  4N6E B;  1AAR A;  4YTP B;  3ZYY X;  1HEZ E;  2KLC A;  1RRB A;  2Y3A A;  1TY2 A;  4J3O D;  1VZ7 A;  3U7D A;  2N1W A;  2Q5W D;  3ZNH B;  1L7Y A;  3A9J B;  2ZZP B;  2C7N B;  1V9J A;  2LGX A;  2Z0E B;  3SFE B;  3QX1 A;  1ZUD 2;  3APD A;  2FIF A;  4I6L B;  4ANU A;  2IPK D;  4HEA 1;  1WRD B;  1CK1 A;  4ICV A;  3VH3 B;  2VH1 A;  3N1Z C;  1L2N A;  4IW0 A;  2JX5 A;  2KO3 A;  1RWS A;  3MC8 A;  1K50 A;  3CSF A;  1NEN B;  4I6N B;  4IKG A;  2R2Q A;  5MPO A;  1FIQ A;  4BKS A;  4R3D A;  2WGS A;  1JWB D;  1EU4 A;  3I57 A;  3QA8 A;  2WDV B;  3KWL A;  1MHX A;  2QIL A;  4KDI C;  4HK2 A;  2J4X A;  1OGW A;  3OG5 A;  3M95 A;  3DBH I;  2WXN A;  4BOS C;  1I4X A;  4EEW A;  2M19 A;  3PRP B;  1P7F A;  1ROE A;  3VHT C;  2D3B A;  4M0W B;  1T6B X;  3PSE B;  4ICU A;  1WGH A;  3P4R B;  4NPN A;  1ZW7 A;  4JWS C;  4BKT A;  4M02 A;  1UEL A;  2MP2 A;  3DVG Y;  2IYD B;  4CQN A;  3DBR I;  2KT7 A;  2G3Q B;  3D32 A;  3AI5 A;  4S17 A;  2ZCB A;  1D4B A;  2FCN A;  3JYU A;  1QOB A;  1E8W A;  2KMM A;  4W9D A;  1P3Q U;  2CJN A;  3DVN U;  3EFU A;  2I1K A;  4GLS C;  4II2 B;  4O1N A;  2AL3 A;  3P1M A;  3VH4 B;  4FHK A;  1OQQ A;  2GBN A;  1I35 A;  3ZW3 A;  1IBX B;  2KN4 A;  2M0A A;  1NEK B;  1TS5 A;  2NPT B;  1F1H A;  1V80 A;  2ZPY A;  4D2K A;  1JWS D;  4B95 A;  5IN7 A;  4GU2 A;  1T3Q A;  3L13 A;  4LCD E;  1T0Y A;  3LDZ E;  1TS2 A;  3PLU A;  5IKC M;  2V4I B;  3GE8 C;  1ZDX A;  2G1E A;  4W9E A;  5E6P A;  3ETR A;  1WZ0 A;  1K8R B;  4WUR A;  4TKN A;  4REZ A;  2KWV B;  3U30 A;  1OQY A;  3AEF B;  2KFK A;  4IDI A;  2X8X X;  3ONS A;  2Z0D B;  2LMC A;  2WLB A;  4BAX A;  4DHZ E;  3NZU A;  3KW5 B;  4LNF A;  2EKI A;  2K8B A;  4W9G A;  4WIP A;  4AS1 A;  1XEE A;  1MPE A;  2MH7 A;  3Q8C A;  1WGR A;  2R2O A;  1L5P A;  3W9C B;  2FID A;  5TR5 A;  3RD2 A;  4K1R B;  3MHZ A;  2WX1 A;  2BT6 A;  2K9X A;  3N1X C;  2PMV A;  2LRU A;  4US8 A;  5G5G A;  2INC C;  2M8S A;  1QT9 A;  3IG3 A;  4WWP A;  2ASQ A;  3OJ3 A;  2ZNV C;  2YVC A;  1E5W A;  4YSY B;  1PGX A;  3U4E G;  2WXL A;  2KFJ A;  2WNM A;  3RYT A;  2MCN B;  5EE1 A;  3TSS A;  2PVO D;  5FKA C;  4MSM B;  3Q3O C;  2REX A;  1UNS A;  3T3N A;  1YQ4 B;  1WR1 A;  4RNA A;  1TS3 A;  2BW2 A;  4XWW A;  1MI0 A;  3T9L A;  1TIF A;  1SB3 C;  2MJD A;  4XYC A;  1B9R A;  1J19 A;  2UWQ A;  1C77 A;  1GPX A;  3KUZ A;  2KJ6 A;  2BB6 A;  4LDT B;  1FRR A;  4BBN C;  3MFG A;  1I4P A;  4EUT A;  3I63 C;  3NVY A;  4BOZ B;  3NVW A;  4RGM A;  1IUE A;  2JF5 A;  4RH6 A;  4KSK C;  1Q5W B;  4ZRQ A;  4K81 A;  1SIF A;  1WXS A;  2LVO A;  4ITK A;  5AUI A;  1J7B A;  3T8M A;  1WZ3 A;  3EC8 A;  3ECI A;  3PRE A;  5BYS A;  3ZGZ A;  2EEL A;  3APC A;  1V1P B;  4URK A;  2JYT A;  2O6V D;  4AOF A;  3ZTC A;  4G0N B;  2B3A A;  2GBK A;  3M63 B;  4GIV A;  1S3S G;  1N62 A;  2HE7 A;  3TBL D;  4DQO C;  1XCT L;  2IDY A;  3B9J A;  2PJH A;  3P2B A;  4FJZ A;  4WWN A;  1C79 A;  3RNA C;  2DLB A;  2E3T A;  2QIE B;  4FHJ A;  1R7S A;  2MX2 A;  4IWO A;  3ZDM C;  4G50 A;  4XWT A;  4IM3 A;  4KKI A;  2V9H A;  4XX5 A;  3Q6B A;  2EMS A;  3Q14 C;  1FFU A;  3L17 A;  3O13 A;  4BKG A;  2MBQ A;  2J0M A;  3AE8 B;  1NI2 A;  1KH0 A;  1XCQ L;  4UDU C;  3KYC D;  5CX3 A;  1EF5 A;  1RFA A;  2HTH A;  3OLM D;  4HDQ A;  4PS7 A;  4B0E A;  1OFF A;  3KYD D;  3JVZ X;  2BF8 B;  5J2R A;  1WX7 A;  3PGE A;  3AU4 A;  2M56 B;  5LXI B;  4IC7 B;  2L0F A;  3Q3J A;  3DBL B;  1ZOY B;  3IAM 1;  1C4A A;  4W9I A;  2DZI A;  4E3C A;  4IUM B;  3NOB A;  2W9N A;  2DBY A;  1A5R A;  2NBV B;  4X57 B;  2A5U A;  4C00 A;  1QZE A;  2N9P C;  3BVZ A;  4RF0 A;  4ANV A;  4RGO S;  1I4H A;  2RR9 A;  5AZF A;  3H8H A;  3IXS A;  2YEP B;  3KH0 A;  3TEZ A;  1YQ3 B;  3ZUN A;  1TBE A;  2JSV X;  2KZR A;  2JPH A;  3U52 E;  1YIW A;  4FUL A;  3RNF C;  3MTN B;  2K0P A;  2AQ1 B;  1E7P B;  1VZ8 A;  3DVG X;  2SEB D;  4ANW A;  2KD0 A;  2KNB A;  3UF8 A;  3CF6 E;  4XGA B;  2W54 A;  1YJJ A;  4WQM A;  2KAC A;  1IBX A;  2C5L C;  2L05 A;  1V86 A;  2V1Y A;  3QWZ B;  4LNK A;  4RM9 A;  4FJV B;  5J18 A;  2NPT A;  2LXA A;  2V3P A;  1E8Z A;  4LTU A;  2GI9 A;  2KDI A;  3IBE A;  4NJ6 A;  1V2Y A;  1WXV A;  1YJI A;  3A9K A;  4M01 A;  4MT5 A;  3VUW A;  4K3C A;  4E74 A;  2NTT A;  2CU3 A;  3ZO5 B;  3N30 A;  2BB5 A;  1EWC A;  3NY5 A;  4KZC A;  3AE7 B;  3RNG C;  3SR6 A;  2XK5 A;  2DHZ A;  3VFK A;  3NRZ A;  3W2D A;  2Y5C A;  2ZW1 A;  2LXC A;  3R2I A;  2MP2 B;  3L4P A;  3VDZ A;  3PT2 B;  4ACF A;  4LDT D;  3VUX A;  3RZF A;  2FE8 A;  1I42 A;  2AYO B;  3URY A;  1MG4 A;  1XF5 L;  2KWU B;  3NUH B;  3Q8F A;  4IM0 A;  2G45 B;  1JRU A;  3GE3 C;  2IGD A;  3RMK C;  4A3O A;  2V0G A;  2C9W B;  4ZDV A;  2GLS A;  3N32 A;  2WP9 B;  2DWQ A;  3W1S C;  1I4G A;  2OHF A;  4HWI B;  1J8C A;  4N59 A;  2VRR B;  4OZB A;  2KQ7 A;  1OQR A;  2BWF A;  4FN2 A;  4PYZ A;  1J0G A;  3PZ8 A;  4ZHO A;  2TSS A;  3RCZ A;  1B1Z A;  4KZ0 A;  3KQ4 A;  1IGD A;  1WX8 A;  1WXQ A;  3MC0 B;  3ML8 A;  3AE6 B;  4KGS A;  1WY8 A;  2V4L A;  3B08 A;  4N58 A;  4WJQ A;  2MQJ A;  1L6U A;  3BII D;  4OZA A;  1VLB A;  4C4V A;  1IP9 A;  1NVI D;  3O65 B;  3AE4 B;  1WRI A;  1WJU A;  2KFK B;  2ONQ A;  1KLV A;  2HJ1 A;  4RF1 A;  3GB1 A;  3T3O A;  1I4Q A;  1SJE D;  2BYF A;  4NJC A;  1Z2M A;  5DPS A;  3BK2 A;  2DZM A;  2L1A A;  2XNA C;  3AE1 B;  2AQ3 B;  2WXF A;  3I9V 1;  5CHF A;  2FCM A;  2IY0 B;  1PYW D;  1VZ6 A;  3ALB A;  2I1J A;  2QMT A;  1QF6 A;  2LI5 A;  3QAQ A;  4AP4 C;  3IAS 1;  2LUE A;  1AWD A;  4MGZ E;  1F2R C;  5C23 A;  4C7Z A;  1K51 A;  4IM2 A;  2JY6 A;  2BWE S;  3WA0 A;  4WJN A;  2OJW A;  4KGT A;  3PPA A;  2N9K A;  4B0M A;  3MP9 A;  1WJN A;  3ABV B;  1TZO A;  2KDE B;  2J0K A;  2K5P A;  3DBS A;  4KX6 B;  4BZA A;  2BYV E;  3N1Y C;  1YMH E;  3HVD A;  5GMV A;  4DHJ D;  3PVL A;  1H4R A;  3Q8E A;  1P1A A;  2N7J A;  4YXD B;  4HXD A;  1WMH B;  4ARC A;  2WXO A;  3ZJV A;  2KJH B;  2RPV A;  4DXA B;  3BZD B;  1RAX A;  1ZDV A;  4GDK B;  2K8C A;  1TKY A;  2I38 A;  2WQY B;  2IND C;  4JQW C;  3WAP A;  2NS5 A;  1N6Z A;  2LVQ A;  1M94 A;  1KRH A;  5CTR C;  1UH6 A;  3U7Z A;  2C7M B;  4DWF A;  2FUH B;  1YX5 B;  2WS3 B;  3AE2 B;  2L32 A;  4LK0 M;  3AUL A;  4KGR A;  4W9H A;  1WYG A;  5KHQ A;  1C3T A;  2BBC A;  3VTW A;  1FCL A;  1WXM A;  4NNJ B;  3BYT B;  1TT5 B;  3BWU D;  1MVK A;  4A6Q A;  2PKO A;  3ZJT A;  2MBB B;  1N5W A;  4HCP B;  2GBR A; 
#chains in the Genus database with same CATH homology
 2LVP A;  2YVC A;  1E5W A;  5D2M B;  4HVB A;  3RYT A;  1WJ6 A;  2KFJ A;  1GC7 A;  2MCN B;  2MLB A;  2Y5B B;  1V5T A;  1G6J A;  1P0R A;  3A1Q B;  4HLE A;  3L54 A;  3DDC B;  1LM8 B;  4MSM B;  3A4R A;  4GMV A;  2JZZ A;  3VQI A;  5E6N A;  3W1Y A;  1ZGU B;  3GOE A;  2D07 B;  2REX A;  3PHW B;  4MEM A;  5LXH A;  4G11 A;  2LZ6 A;  2BKF A;  1WGD A;  1WR1 A;  2IZV B;  4WJP A;  1F9J A;  1KOT A;  4MSQ B;  4TQ1 A;  3T9L A;  3X23 A;  4F1S A;  3X0W A;  1J19 A;  2UWQ A;  2MW5 A;  2K25 A;  1V5O A;  5CHW A;  1R4N I;  3S2A A;  3KUZ A;  4AJY B;  1E8X A;  2KJ6 A;  2N7D A;  4LDT B;  2D2Q A;  2KTR A;  2N9X A;  4BBN C;  4BKS D;  4EUT A;  2JWZ A;  3QHT A;  4BOZ B;  2KTF A;  4FAD A;  2K39 A;  2M17 A;  2JF5 A;  4W9L A;  4KSK C;  1Q5W B;  3HM3 A;  4G3X B;  4GDL B;  2CS4 A;  2EMT A;  3RT3 B;  4JGH B;  1P98 A;  3VTV A;  2CHX A;  2L0T A;  4DHJ B;  4NY0 A;  4CO7 A;  4K81 A;  1SIF A;  1WXS A;  2LVO A;  2N7E A;  2KHW B;  4ZRI A;  3ZDT A;  3T8M A;  1WZ3 A;  3EC8 A;  3ECI A;  4ASW C;  3PRE A;  2NBW B;  3M62 B;  3APC A;  2EKE C;  4URK A;  1WR6 E;  2O6V D;  2OJR A;  1WE6 A;  3ZTC A;  4AOF A;  1XD3 B;  3DBL I;  3QAR A;  2B3A A;  2GBK A;  3M63 B;  3MHS D;  4G0N B;  4GIV A;  3R66 C;  4KDL B;  1S3S G;  1C1Y B;  2HE7 A;  1WI0 A;  3TBL D;  2M0X A;  5D6J B;  2PJH A;  3P2B A;  1WM2 A;  2AL6 A;  4FJZ A;  4WWN A;  3DVN V;  4MGK E;  3HHM A;  3U8Z A;  3R3M A;  4I6P A;  1OTR B;  4FHJ A;  2KDB A;  3A9K B;  1SE9 A;  2MX2 A;  3JW0 X;  4IWO A;  3ZDM C;  4G50 A;  1GJZ A;  4FJY A;  4IM3 A;  1E7U A;  3L16 A;  1LFD A;  4ANX A;  3AXC A;  2KC1 A;  2DEN B;  4XX5 A;  2LAS A;  4AUQ C;  2KVR A;  2EMS A;  2J0J A;  4DDI D;  2GOW A;  3L17 A;  1UZX B;  2GBJ A;  4KV2 A;  3SU8 X;  4BKG A;  2MBQ A;  4ZRK A;  2AEH A;  2J0M A;  2XK5 B;  1NI2 A;  4NAW A;  4RM8 A;  2LGY A;  2FAZ A;  5FR6 A;  3KYC D;  5CX3 A;  1EF5 A;  2GBM A;  4LJO B;  4TQ0 A;  4MGI E;  1GUA B;  1RFA A;  2HTH A;  2UYZ B;  3OLM D;  1EO6 A;  3HM6 X;  2KQS A;  4HDQ A;  3Q3F A;  4MGY E;  4PS7 A;  4WQO B;  4OVV A;  2CHZ A;  2G4S A;  2MRP A;  3NS8 A;  2C7H A;  4MEL A;  5J17 A;  3IFW B;  4DK5 A;  3KYD D;  4K7U A;  3JVZ X;  2BF8 B;  3QC8 B;  3SHQ A;  4JIO U;  3ZTD A;  5J2R A;  2K6D B;  1WX7 A;  2FCQ A;  3PGE A;  3PTF C;  1V6E A;  3AU4 A;  3QIJ A;  4DDG D;  2HJ8 A;  2A4Z A;  4IC7 B;  2L0F A;  5LXI B;  1VCB A;  2IO0 B;  2ZEQ A;  3Q3J A;  4FLH A;  2KWC A;  2CU1 A;  1WIA A;  2MBE A;  4F7Z A;  3A1Q A;  3WAN A;  2OOB B;  3H7P B;  3TCA A;  4W9I A;  3UGB B;  2DZI A;  2FNJ B;  3QQ8 B;  4IWQ A;  1VD2 A;  3UIP B;  4IUM B;  4E3C A;  2MBO A;  2KX0 A;  2LD9 A;  2WYQ A;  2CKH B;  2W9N A;  3NOB A;  2JUO A;  1A5R A;  2NBV B;  4X57 B;  2A5U A;  4BBN F;  1Z5S B;  1QZE A;  2N9P C;  5BO4 B;  4ANV A;  3ENE A;  2N9E B;  1IPG A;  2DYM A;  4BVU C;  3UQB A;  1PQS A;  2RR9 A;  4DBG A;  2KC2 A;  5AZF A;  3KH0 A;  3V6E B;  1GNU A;  3PV1 A;  1H8C A;  4P7I A;  4E71 A;  4KIK B;  1YJ1 A;  3ZUN A;  1YQB A;  1TBE A;  2KZR A;  2JPH A;  3WAM A;  3WAL A;  2DYO A;  1YIW A;  2KN5 A;  4FUL A;  2KJR A;  3K9P B;  1R4M I;  1WGY A;  3MTN B;  2PEA A;  4AJW A;  1E7V A;  2K1F A;  4KVG B;  2PPH A;  2K8H A;  3DVG X;  3UIO B;  5L95 C;  2FCS A;  4ANW A;  1WF9 A;  1HE8 A;  2KD0 A;  2KNB A;  2LRW A;  2DYB A;  5AZH A;  2NR2 A;  3CF6 E;  3UF8 A;  2MA9 B;  3ZKJ C;  2BPS A;  3V62 A;  3VTU A;  3ZRF A;  1TZ1 A;  2C5L C;  3ML9 A;  1WJ4 A;  2L05 A;  1MG8 A;  1V86 A;  2V1Y A;  4MDK E;  3QWZ B;  4RM9 A;  2JXX A;  1TTN A;  3JSV B;  4FJV B;  5AEK B;  2NPT A;  2LXA A;  4MJS B;  4TV3 A;  5J18 A;  2JVC A;  2KMC A;  2BGF A;  2L8J A;  1E8Z A;  4GB9 A;  4GSW A;  2KDI A;  3IBE A;  4HCN B;  4NJ6 A;  5D7G A;  1WMH A;  1SGH A;  1KJT A;  1V2Y A;  1WXV A;  3A9K A;  4CHK A;  3L0W B;  3PZD A;  2O6V B;  3VUW A;  5JZE B;  1LXD A;  5IAA C;  1WE7 A;  1NDD A;  4E74 A;  2M1M A;  2WDT B;  3PS6 A;  4GDK A;  1XQQ A;  3PHX B;  3EEC A;  3ZO5 B;  1WYW B;  3N30 A;  3NY5 A;  4KZC A;  3WAO A;  5LLI A;  2WX0 A;  2DAF A;  5HKH A;  2XBB C;  3H1U A;  4M8M A;  2XK5 A;  5JH5 C;  3TIX A;  2DHZ A;  3VFK A;  1IYF A;  3HIZ A;  2IO2 B;  1KM7 A;  1UBQ A;  4WJO A;  2KMA A;  1UBI A;  1UGM A;  2KX3 A;  2L3Z A;  2PE9 A;  2LXC A;  2ZNV B;  4PS8 A;  5DPW A;  2D11 A;  2DAJ A;  2MP2 B;  3L10 B;  5DPR A;  3BY4 B;  3B1L X;  3CMM B;  2NVU I;  3PT2 B;  3QK0 A;  4K7W A;  2K6Q A;  4LDT D;  3VDZ A;  2LGD A;  2ZCC A;  4EZJ A;  2O2V B;  3VUX A;  2J7Q B;  3RZF A;  4IG7 B;  2CR5 A;  1I42 A;  2AYO B;  1E90 A;  4J6I A;  2BYE A;  2KWU B;  1WFY A;  1CMX B;  4IM0 A;  1WH3 A;  2G45 B;  1JRU A;  4WAA A;  4XZ4 A;  3V60 A;  4A3O A;  2Z59 B;  1WX9 A;  4M8N A;  3CST A;  2C9W B;  4W9C A;  3RUI B;  5JHB A;  3I3T B;  4NJ7 A;  5JHA A;  4W9J A;  4ZDV A;  2GMI C;  3QCA A;  4MH0 E;  2KTR B;  3N32 A;  5D94 A;  3W1S C;  4RMA A;  3A4S C;  4MM3 A;  4NQL B;  4HPL B;  1S1Q B;  3ZNG C;  4HWI B;  4LJP B;  5EDS A;  1J8C A;  1AAR A;  3IVF A;  2VRR B;  3ZIM A;  2KLC A;  1RRB A;  5DCN A;  4TUU A;  3W1S A;  3RUL A;  1YD8 U;  2KQ7 A;  2NCN A;  2N4F A;  3U7D A;  3VAW A;  2N1W A;  3ZNH B;  4B9K A;  1L7Y A;  2BWF A;  3UIN B;  2L00 B;  3A9J B;  2ZZP B;  2C7N B;  4FN2 A;  3OAW A;  1V9J A;  4PYZ A;  1J0G A;  3VXW A;  2LGX A;  2Z0E B;  3BIN A;  3QX1 A;  2M4N A;  4JL9 A;  3APD A;  3DCG A;  2FIF A;  4I6L B;  4KZ0 A;  3RCZ A;  4A3P A;  4ANU A;  4N9F 4;  3VVW B;  1WRD B;  1WX8 A;  2PE6 B;  4ICV A;  3VH3 B;  1L2N A;  4IW0 A;  2KO3 A;  2LWP A;  1U4A A;  3ML8 A;  4W9K A;  3B0A A;  3CSF A;  4I6N B;  2KLG A;  4HCP B;  3RZW C;  4EKU A;  3SDL C;  2R2Q A;  1WY8 A;  4YL8 A;  2V4L A;  1WGG A;  3B08 A;  4BKS A;  4EFO A;  1WXA A;  4WJQ A;  2MQJ A;  1UD7 A;  3DPD A;  3ZLZ A;  4NAW B;  4K7S A;  3MJW A;  3QA8 A;  2L7R A;  4PS3 A;  2KK8 A;  1WM3 A;  1ZKH A;  2IO1 B;  2NBU A;  3IHP C;  1IP9 A;  3TMP B;  4GGQ A;  4KDI C;  3O65 B;  4HK2 A;  2O6V A;  3AU5 A;  2JZ3 B;  4GDL A;  2DX5 B;  3VUY A;  3APF A;  1OGW A;  1P9D U;  1WJU A;  2KFK B;  2LJ5 A;  3M95 A;  3PLV A;  1KLV A;  3DBH I;  3ZVV A;  2RPQ A;  4BOS C;  4JLC A;  1BT0 A;  3SD5 A;  2ZJD A;  1EUV B;  2BYF A;  4EEW A;  3PRP B;  1Z2M A;  3KVF B;  4FA6 A;  3L08 A;  4OVU A;  5DPS A;  3VHT C;  4FBJ B;  2DZM A;  1Q0W B;  4M0W B;  2C60 A;  3PSE B;  4EZK A;  2KOX A;  1GC6 A;  4ICU A;  4AWJ A;  1WGH A;  1XT9 B;  3KUD B;  4NPN A;  3GZN I;  5E6O A;  1ZW7 A;  2DZK A;  4BKT A;  1OEY A;  1UEL A;  4HPM B;  2MP2 A;  5DPT A;  3DVG Y;  5CHF A;  2JRH A;  2IYD B;  2WWZ A;  2FCM A;  2IY0 B;  2O2V A;  4ZYN A;  3DBR I;  2G3Q B;  1E8Y A;  4W9F A;  3ALB A;  2HD5 B;  2DZJ A;  3D32 A;  3AI5 A;  2I1J A;  2ZCB A;  1EF1 A;  4PYU A;  2LI5 A;  2FCN A;  4F8C B;  2RGF A;  3M3J A;  3JYU A;  3QAQ A;  4HDO A;  4AP4 C;  4B6W A;  4EZL A;  2BKR B;  1E8W A;  5AZG A;  2LUE A;  4MGZ E;  3QJZ A;  2KXJ A;  5C23 A;  4W9D A;  2D3G A;  1P3Q U;  4A20 A;  4IM2 A;  2JY6 A;  2IBI B;  2BWE S;  3WA0 A;  3DVN U;  4ZRJ A;  3EFU A;  4WWO A;  3R7Q A;  4WJN A;  3TJP A;  2I1K A;  2XEW A;  3EHV A;  3PPA A;  2KDF B;  3R7R A;  4II2 B;  3ZNZ B;  1WJN A;  5CHV C;  2KDE B;  2AL3 A;  2J0K A;  3NZS A;  3VH4 B;  3DBS A;  3HK0 A;  4FHK A;  2BYV E;  2GBN A;  4KSL C;  1I35 A;  1X1M A;  3ZW3 A;  2CHW A;  4GOC A;  3TL5 A;  3UQA A;  1NBF C;  5GMV A;  3A9J A;  4IWP A;  3PVL A;  1OEY J;  4DHJ D;  1H4R A;  4CYE A;  1P1A A;  2NPT B;  1V80 A;  2ZVN A;  2G4D B;  2ZPY A;  4XC2 A;  4B95 A;  4HXD A;  2N1V A;  4GU2 A;  2QHO A;  1WMH B;  3NHE B;  3L13 A;  3H7P A;  3H9D A;  4LCD E;  1T0Y A;  2AWT A;  2KJH B;  2KAN A;  3H6N A;  3LDZ E;  4DXA B;  5KHO A;  3OJ4 B;  2IY1 B;  3H7S A;  3PRZ A;  1RAX A;  5L83 A;  2MBH A;  4NQK E;  4GDK B;  3PLU A;  1ISN A;  2K8C A;  4HJK A;  2MSE D;  1LQB A;  3K9O B;  3ZNI D;  1D3Z A;  3LJ3 A;  4JQW C;  4KIK A;  4W9E A;  3V61 A;  3WAP A;  2L76 A;  4BFR A;  2NS5 A;  5E6P A;  3DOW A;  3A33 B;  1WZ0 A;  3DQV A;  5C1Z A;  2LVQ A;  3PRM B;  1K8R B;  1M94 A;  4TKN A;  2KWV B;  4GXB A;  5CTR C;  3U30 A;  1UH6 A;  1OQY A;  1Y8R C;  1V49 A;  2C7M B;  2KFK A;  4DWF A;  2FUH B;  3V6C B;  1YX5 B;  5G2N A;  1Q1O A;  3ONS A;  2IO3 B;  2RD0 A;  2Z0D B;  4DHZ E;  3AUL A;  3NZU A;  3KUC B;  3KW5 B;  5G55 A;  2K8B A;  4W9H A;  4W9G A;  4EOY A;  3C0R B;  3ZRC A;  2YLM A;  3JSV A;  4MJS A;  5KHQ A;  1C3T A;  3N3K B;  2JT4 B;  4GN1 A;  3VTW A;  1WGR A;  2R2O A;  1TGZ B;  2ZVO A;  2KKC A;  4II3 B;  1WXM A;  1FXT B;  4NNJ B;  2FID A;  5TR5 A;  3RD2 A;  2MWS B;  2ZPN A;  2RSU A;  4K1R B;  2WX1 A;  2LRU A;  1V81 A;  2JRI B;  1RLF A;  2M8S A;  1GG3 A;  2D10 A;  2V3S A;  3IG3 A;  3WIM A;  4WWP A;  5IA7 A;  2ASQ A;  3OJ3 A;  2MBB B;  4DHZ B;  1YX6 B;  2ZNV C;  2GBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...