4PYZA

Crystal structure of the first two ubl domains of deubiquitylase usp7
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
LVPRGSPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the first two Ubl domains of Deubiquitylase USP7
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
total genus 70
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyzA02
5FR6A 1UELA 4HVBA 5DCNA 4K81A 1V81A 2BF8B 2C7NB 3A33B 2C9WB 2K6DB 2MBQA 3PGEA 3PSEB 3KYCD 4GU2A 4WJNA 2JY6A 3VUXA 2AL6A 4GDKA 2GBRA 3NOBA 2XK5B 3HM6X 1TZ1A 1Q0WB 1V80A 1VD2A 1C3TA 2M1MA 4GB9A 1H8CA 4EZJA 2KXJA 3IFWB 2M4NA 3K9OB 1YD8U 3H7PB 3MHSD 3JYUA 2C7HA 2K25A 4DHZB 2JT4B 2L7RA 2M0XA 2WWZA 3CMMB 3TCAA 4E3CA 3ZNID 4HPLB 2CKHB 2Z59B 4PS3A 1YX6B 3VDZA 2KX3A 2NBUA 3VH3B 4MJSA 2L05A 3ZDMC 1J19A 2XEWA 1WE7A 2DZIA 1UH6A 2V1YA 3PRMB 4DK5A 2A5UA 3TL5A 1E7VA 1WGGA 2BWFA 3ONSA 4JL9A 2UWQA 1IPGA 2L76A 1KM7A 3DBRI 2YVCA 4MH0E 4MEMA 5HKHA 2BYFA 4TQ1A 4KZ0A 1JRUA 4HPMB 4M8NA 4RMAA 1R4NI 2LXCA 2MW5A 3LJ3A 4G3XB 3ZNHB 4WAAA 3OJ4B 4DXAB 3UF8A 4MGKE 4ZRKA 3A1QB 4B95A 1J8CA 4NQLB 3HM3A 2XK5A 3M3JA 2HD5B 4NAWA 3N3KB 1I42A 4K1RB 3PHWB 4F1SA 4ICVA 2EMSA 2D10A 3DPDA 1D3ZA 2RGFA 4BKGA 4ANXA 5JZEB 2KDEB 2KO3A 1YJ1A 3NZUA 4WWOA 3OLMD 1MG8A 3VXWA 3TJPA 2KFJA 1V5OA 5E6PA 4GMVA 4HLEA 5L95C 2FNJB 3U8ZA 1WJNA 2C5LC 1EUVB 3QWZB 4BKSD 5KHOA 1P1AA 1YIWA 3CSFA 3ZUNA 2HE7A 3B1LX 3K9PB 2PJHA 3PREA 1TBEA 4HCPB 1RAXA 4I6LB 4BVUC 3NS8A 3QCAA 3DVNU 2LZ6A 1NBFC 4KDLB 3RUIB 2DYOA 5CTRC 1J0GA 2LRUA 4BKSA 1LQBA 2NBVB 1Z5SB 1E8WA 4A3OA 5D94A 4B6WA 1P98A 2O6VD 4NNJB 2ZCCA 5JH5C 2D3GA 2NCNA 2EKEC 3PLUA 4JGHB 1S3SG 3V60A 3QA8A 3VVWB 2JRIB 1WE6A 3DVGY 2LGDA 4HCNB 3WA0A 3APFA 4BFRA 2J0JA 2YLMA 1L2NA 2ZPYA 2KHWB 3L17A 3SD5A 3A9KA 3X0WA 1RLFA 2J0MA 2KJRA 3ZTCA 1KLVA 2FCQA 4KVGB 5LXHA 4OVUA 2GMIC 3QAQA 2JZ3B 3PRZA 4A20A 3A9JA 3C0RB 4NPNA 3OAWA 1WM2A 3Q3JA 2IZVB 2ZZPB 3A4RA 3QQ8B 2NPTB 4II2B 3PZDA 2BWES 2IO3B 4IG7B 1WY8A 4NY0A 3UINB 3CF6E 3QX1A 2KC1A 4G50A 1V6EA 2KC2A 1E8YA 4ANUA 2WX1A 4K7SA 4WJPA 5GMVA 3X23A 3R7QA 4AJWA 1KOTA 1GJZA 3V61A 1RFAA 2KVRA 2IO2B 3L08A 1GNUA 2IY0B 2NBWB 3PV1A 2K6QA 1XD3B 3B0AA 1ZKHA 2ASQA 4G11A 1V49A 4CHKA 3QIJA 4KIKB 3RT3B 2EMTA 4FA6A 5EDSA 1QZEA 1Q5WB 1WJUA 2N9PC 2CHXA 3NZSA 4GSWA 5LLIA 3TMPB 5J17A 2ZEQA 2LGXA 4IM0A 4MGZE 5G2NA 2JVCA 3WAPA 1E5WA 2K39A 4HK2A 3A9JB 4W9GA 1GC6A 3U30A 1IP9A 2DENB 1WR6E 2K1FA 3ZKJC 3BY4B 3EC8A 2NPTA 1Y8RC 4W9FA 1WJ6A 4KIKA 2B3AA 2QHOA 4W9EA 2KQ7A 3JW0X 2FCNA 1WI0A 3KYDD 1I35A 2C7MB 2KQSA 2L0FA 3JVZX 3V6EB 3ZNGC 1XT9B 4DWFA 2JRHA 1U4AA 3IBEA 4P7IA 2RD0A 2I1JA 5CHFA 3W1SA 4AJYB 4HDQA 3DDCB 3UGBB 1WXAA 2RR9A 4ZRIA 2ZNVC 2J7QB 1X1MA 2CU1A 2ZVOA 4MGYE 3PTFC 4BBNC 1WIAA 2JF5A 4W9DA 2KK8A 1S1QB 2VRRB 3HK0A 3PRPB 4EFOA 2OOBB 5J2RA 2LVOA 2C60A 1UGMA 2R2QA 3H7PA 4XZ4A 4MDKE 4NJ7A 4YL8A 5BO4B 2MBEA 3ZTDA 4ANVA 1G6JA 4TV3A 2BYEA 2KDFB 3AXCA 1K8RB 2Z0EB 3ML8A 4FJYA 4MSQB 4ICUA 2N1VA 4KSKC 4MJSB 1OGWA 4WWNA 2FCMA 3W1YA 1WM3A 4PYZA 2MRPA 1Q1OA 1E90A 1YX5B 1BT0A 2PE9A 4W9KA 4GGQA 2CHWA 2NVUI 5CHVC 1V5TA 3DOWA 2BGFA 2GBMA 2MP2A 4F7ZA 1WJ4A 4LDTB 1A5RA 2CR5A 2AYOB 2KTRA 3KUDB 3R7RA 1V2YA 2RPQA 3ZRCA 2HJ8A 1CMXB 4E74A 2IY1B 2NR2A 1WXMA 3L13A 4FHKA 3V6CB 2IO1B 2I1KA 2KX0A 2GBNA 2KTFA 5DPSA 3RULA 2KDIA 1OQYA 1WMHA 2N9XA 4EOYA 1OEYJ 3A4SC 3MJWA 4JLCA 4IUMB 2MBBB 2N9EB 1XQQA 3DQVA 1M94A 1SE9A 2O6VB 2WYQA 4AWJA 2REXA 2J0KA 4IW0A 4I6NB 3HHMA 4DHJB 2L00B 3U7DA 3TIXA 3KH0A 2JUOA 2GBJA 1WGRA 1AARA 1P3QU 2RSUA 3H9DA 1HE8A 2MSED 2OJRA 3PT2B 1GG3A 3PPAA 3EECA 1V86A 2R2OA 2ZNVB 3B08A 5D6JB 3WALA 3P2BA 4FN2A 3RZWC 3VTVA 3AI5A 1TTNA 3H6NA 2IYDB 1L7YA 2Y5BB 4WWPA 4E71A 4EUTA 2LWPA 3I3TB 3SHQA 1WZ3A 2N4FA 4GXBA 2L8JA 1UD7A 4WJOA 3PVLA 3S2AA 1R4MI 2MA9B 4ZDVA 2MP2B 5TR5A 1SIFA 3KW5B 5L83A 4AP4C 2DAFA 2FAZA 3DBLI 1WYWB 3M95A 4MSMB 2DZKA 2LASA 5JHAA 4MM3A 3RZFA 3QHTA 3ZNZB 2CS4A 4JIOU 2KWCA 1ZGUB 2AEHA 1YQBA 2Z0DB 1WMHB 2V4LA 3TBLD 2N1WA 1LFDA 4EZLA 1TGZB 2BKFA 2KN5A 4K7WA 3VQIA 3VUWA 5D7GA 1WGYA 4DBGA 2KZRA 3DBSA 2BKRB 1RRBA 2G3QB 1ZW7A 2V3SA 4J6IA 4IM2A 4MELA 2PE6B 1NI2A 4WJQA 3N32A 4OVVA 4XC2A 3UIPB 2LJ5A 5AEKB 2MLBA 2K8BA 1OEYA 3AU4A 4G0NB 5E6NA 4W9HA 4MGIE 4W9JA 5AZGA 3VAWA 2LGYA 4GOCA 3A1QA 1WX9A 2LI5A 5AZHA 1WX7A 1GC7A 2KMAA 3ZRFA 2AWTA 2KLCA 4M0WB 2G4SA 4TKNA 5D2MB 1WXSA 3DVNV 3L0WB 2DAJA 4PS8A 2LVQA 4B9KA 2MWSB 4I6PA 5CX3A 4WQOB 2KLGA 4KZCA 1IYFA 4TQ0A 2N7DA 2O2VB 3LDZE 1GUAB 2G45B 2LUEA 2IO0B 1LM8B 4DHZE 3NHEB 2KJHB 1KJTA 3DCGA 3R66C 4HDOA 1WGDA 1NDDA 5JHBA 2KOXA 3MTNB 4IM3A 1EF1A 4HWIB 4NAWB 4NQKE 1V9JA 1VCBA 2DYMA 4LCDE 1LXDA 4DDID 5KHQA 3UQAA 2NS5A 3QARA 5DPWA 3NY5A 3GOEA 2WX0A 4FULA 4ZYNA 1PQSA 3JSVA 2DZMA 5C23A 3UQBA 4KDIC 3VH4B 3H1UA 2KWVB 4II3B 1WZ0A 2UYZB 5DPRA 2DHZA 4M8MA 3ML9A 5J18A 2K8HA 3GZNI 2ZPNA 4DHJD 4F8CB 2XBBC 4PYUA 3ZO5B 2LD9A 3R3MA 2KKCA 3QC8B 2HTHA 1P9DU 2K8CA 3ZDTA 3KVFB 5G55A 5C1ZA 2ZVNA 5CHWA 3Q3FA 1E8ZA 1H4RA 2LXAA 3KUZA 3SU8X 3L54A 4K7UA 3L10B 3A9KB 3H7SA 2D2QA 2ZCBA 3O65B 4EEWA 3L16A 4FLHA 2O2VA 3JSVB 2KD0A 4HXDA 2D11A 4JQWC 4LJOB 4IWOA 3KUCB 4GN1A 3BINA 3D32A 3IG3A 2MX2A 3VFKA 2CHZA 2MBOA 4IWPA 4N9F4 2JPHA 2A4ZA 2KMCA 3WAMA 4ZRJA 3V62A 2N7EA 3OJ3A 4EZKA 4FADA 4GIVA 4BOZB 2L0TA 3WIMA 3IVFA 3T9LA 3AU5A 4XX5A 1EO6A 1EF5A 2BPSA 2JZZA 5IA7A 4BKTA 4LDTD 1P0RA 2FIFA 3WANA 3SDLC 3UIOB 1WF9A 4A3PA 1E8XA 4ANWA 3APDA 2DZJA 3HIZA 2GBKA 2KWUB 3ENEA 3PHXB 5E6OA 2DX5B 2KDBA 4KSLC 1WH3A 3VTUA 4HJKA 4AOFA 2PEAA 3N30A 4W9CA 3APCA 2FIDA 4FJZA 4GDLA 1WX8A 4DDGD 2AL3A 3RYTA 3VUYA 2ZJDA 4W9IA 3ZIMA 2KNBA 2MQJA 4IC7B 3EFUA 3M62B 2WDTB 2DYBA 3RD2A 2LRWA 2LVPA 1WR1A 1FXTB 3QJZA 1Z2MA 3VTWA 1T0YA 4KV2A 4AUQC 3ALBA 2KJ6A 3WAOA 4PS7A 2KANA 4CYEA 2FUHB 3DBHI 1WXVA 3VHTC 3PLVA 3PS6A 2G4DB 1SGHA 2JXXA 2GOWA 1E7UA 1WFYA 2O6VA 5IAAC 3T8MA 4BOSC 2D07B 1UZXB 2BYVE 2FCSA 5LXIB 2KFKA 1WRDB 4NJ6A 2KTRB 4FHJA 4X57B 4FJVB 1F9JA 5AZFA 4ASWC 1C1YB 1OTRB 3AULA 3QK0A 3W1SC 1UBIA 3ZVVA 3ZLZA 4W9LA 4IWQA 4BBNF 4GDKB 2MCNB 2MBHA 2JWZA 1WGHA 4TUUA 4RM9A 2L3ZA 3RCZA 4CO7A 4LJPB 4EKUA 4FBJB 3M63B 4URKA 5DPTA 2M17A 1UBQA 2W9NA 2PPHA 1ISNA 3DVGX 3ZW3A 2IBIB 4RM8A 4GDLB 3EHVA 3IHPC 3CSTA 2M8SA 3ECIA 2KFKB
chains in the Genus database with same CATH superfamily
2INPE 1E0ZA 1YNTE 2LFIA 4K81A 1V81A 3A33B 1FRRA 2MBQA 3PGEA 2JY6A 3VUXA 3NS1A 2BW2A 3HVZA 2QILA 2GBRA 4UDUC 3CIRB 1VD2A 1Q0WB 1V80A 1H8CA 2M4NA 3K9OB 3MHSD 2C7HA 2K25A 2JT4B 3TCAA 3ZNID 4HPLB 2CKHB 4PS3A 1ZDVA 2BS3B 4MJSA 2L05A 3ZDMC 1L6UA 3OG5A 4YSZB 1UH6A 1EU4A 2A5UA 1QT9A 2BWFA 2UWQA 1IPGA 2L76A 3BYYB 4MH0E 4HPMB 4RMAA 3SEBA 3LJ3A 3NJTA 3PZ7A 3UF8A 2VH2A 4B95A 2Y5CA 1OFFA 3M3JA 5JZEB 1YJ1A 3NZUA 1JWUD 3AE3B 1MG8A 2KFJA 3IAM1 4IOIE 4HLEA 1WJNA 2M56B 1YJIA 1WXQA 5HG2A 2PJHA 2K9XA 2LZ6A 1NBFC 4KDLB 2RDGA 2MHJA 1N61A 1J0GA 2LRUA 3EUB2 2NBVB 4BKSA 1VJKA 1P98A 1QF6A 3ETRA 1F0ZA 4C7YA 4TMAB 3V60A 3N9YC 4MT5A 4XDCA 1QLBB 3VVWB 1JROA 2YLMA 4YXDB 1E9MA 3L17A 1I4GA 2Z8LA 2Y5PA 3A9KA 3AE7B 1SJED 4USAA 3ZTCA 3AE5B 1KLVA 2FCQA 1T3QA 5LXHA 4OVUA 3PRZA 1ESFA 3C0RB 3OAWA 3W5VB 1WM2A 3T3NA 2QSDA 1SBBB 2G1EA 3AB5A 1N62A 1K53A 1XXGA 3HRDD 3AECB 3CF6E 3QX1A 2KC1A 2KC2A 2WX1A 4K7SA 3X23A 4AJWA 3ZYYX 2LGIA 1RFAA 2WQYB 1R4MB 2IY0B 2KDMA 3PV1A 2K6QA 1XD3B 3B0AA 2PTLA 3B9JA 5FK9C 1OQQA 5EDSA 2V3NA 2N9PC 2WXFA 3TMPB 1PGXA 3WAPA 1TKEA 3U30A 1IP9A 2DENB 1WGKA 1Y8RC 1I7HA 1AN8A 4WQMA 3JW0X 2WDRB 1I35A 2PVGC 3IBEA 5CHFA 2PKOA 4C00A 3ABVB 3DDCB 1MPEA 4ZOHC 1TKGA 2INDC 4ACFA 4ZRIA 3P4SB 1YOVB 2JF5A 2XNAC 3IAS1 3PRPB 4HEA1 3WCQA 3H7PA 2R2QA 1G6JA 2BYEA 3AXCA 4MSQB 3AV8A 2N1VA 4KSKC 4MJSB 2RDHA 3W1YA 1YX5B 1E90A 1BT0A 2PE9A 2CHWA 3DOWA 2JYEA 2MP2A 2KTRA 2WXNA 4XDDA 3KUDB 2RPVA 2CU3A 3ZJVA 3AN1A 4E74A 2NR2A 1WXMA 2WGSA 4FHKA 2KDIA 1OQYA 1WMHA 2N9XA 1VZ6A 2N9EB 1XQQA 2REXA 4DHJB 3TIXA 2JUOA 2L83A 3PT2B 3PPAA 5D6JB 2IGDA 2Y5BB 1L7YA 4O1NA 3I57A 4EUTA 1UWXA 1I4XA 3RMKC 1UD7A 3P4RB 4LNIA 4ZDVA 3ZGZA 3KW5B 2AQ3B 4MSMB 3BK1A 4MM3A 5E6JA 5AUKA 1PUTA 1YQBA 1C4PA 1LFDA 4R3DA 1TGZB 2MJEA 1V8CA 5D7GA 2OJWA 1WGYA 3V05A 3DBSA 2BKRB 4IM2A 4MELA 2PE6B 1NI2A 3UIPB 2LJ5A 1K51A 4OHJA 4YWGG 1OEYA 3AU4A 4G0NB 4W9JA 2LGYA 4GOCA 1I4HA 3A1QA 2KMAA 5D2MB 3GE3C 4PS8A 1T0SC 5CX3A 2PLPA 2KLGA 4TQ0A 1QOBA 1UUPA 1F2RI 4PT5A 1GOZA 1KJTA 3FILA 5JHBA 4IM3A 4HWIB 4C80A 4LCDE 2LMCA 2NS5A 1UNSA 2Y3AA 3NVWA 4WURA 4ZRPA 3Q8CA 1NYRA 1PQSA 2N0SB 3UQBA 3VH4B 1KF6B 1WZ0A 2DHZA 2PIAA 3ZDTA 3Q3FA 1H4RA 3RNAC 2K3UA 4BAXA 3HUIA 3A9KB 3H7SA 1NEKB 1RFKA 4HXDA 1VRAB 2D11A 3BINA 3MC8A 2MBOA 1HA5A 2WXOA 3OJ3A 4BOZB 2L0TA 3IVFA 3DHIC 3N1ZC 1EO6A 2FIFA 5D3DA 4L1BA 3UIOB 2UU7A 5G5HA 1ZUD2 4A3PA 1L0VB 4MH8A 1I4RA 1NYQA 3ENEA 3VTUA 2PEAA 3RFZB 4XE0A 3U7ZA 2WLBA 2AL3A 3RYTA 2QCZA 4YSYB 1XF5L 3EFUA 1JQ4A 1WR1A 1L0YB 4KV2A 3ALBA 2KJ6A 3P42A 3WAOA 2INNE 1FXAA 2G4DB 2XN9C 3ZXVA 3T8MA 2O6VA 4A8XC 2D07B 1UGJA 4NJ6A 1JMLA 2INCC 3NVVA 1XCQL 1VDVA 4P16A 3W1SC 3ZLZA 1YMHE 2QIEB 4GDKB 2MCNB 1WGHA 2OEDA 4TSSA 3M63B 5FKAC 5DPTA 1A70A 1UBQA 3DVGX 2N9LA 4GDLB 3IHPC 2TSSA 3GE8C 4HVBA 2LJIA 1MFWA 3EGRA 3SFDB 5EE9A 1CK1A 3KYCD 4GU2A 4N6EB 1ET9A 2E3TA 2JZPA 3NOBA 1TZ1A 2M1MA 3TEYA 2KXJA 3H7PB 3KQ4A 2L7RA 1YX6B 2YEPB 1J19A 2XEWA 4P1BC 1J7CA 2DZIA 2V1YA 1FIQA 3MP9A 2B76B 2LHEA 5BMIA 3BWUD 2BYFA 1FPYA 4KZ0A 2IDYA 4G3XB 4WAAA 4DXAB 4MGKE 3DHGC 4A9AA 4K3CA 1J8CA 3HM3A 2XK5A 5IP4D 1JRPA 3N3KB 4C4VA 3PHWB 4F1SA 2FE8A 4ICVA 2D10A 2QMTA 1D3ZA 4H2AA 4ANXA 5EE1A 2KO3A 3OLMD 3P4QB 1SE2A 4MM3B 3VXWA 1V5OA 2SEBD 5E6PA 3R2IA 1L5PA 5KHOA 2GRIA 1RAXA 4HPPA 3RUIB 3E9SA 1VLBA 1TS3A 1LQBA 2O6VD 4NNJB 1PFDA 3PO0A 5JH5C 2EKEC 3FKYA 4RNAA 2WXIA 3DVGY 3APFA 2JWUA 2JSVX 1T0RC 2W3RA 3VRBB 1RLFA 2KJRA 1FD6A 4L2YA 2MJ3A 4A20A 3A9JA 4LNKA 3Q3JA 3QQ8B 2NMQA 4II2B 3PZDA 4M0WA 2IO3B 4IG7B 1V1PB 1WY8A 4NY0A 3UINB 1P7EA 1WRIA 1GJZA 3V61A 2KVRA 3L08A 1GNUA 1BMLC 1JWMD 4AQ7A 2DWQA 1QZEA 5LLIA 5J17A 1IBXA 2BB6A 2JVCA 1TT5B 3IXSA 2X8XX 3Q8EA 1GB4A 1WR6E 3BY4B 3EC8A 2NPTA 1TY2A 3Q8AA 2EKIA 1LO5D 4RF0A 4KIKA 5T8IA 2B3AA 2QHOA 4KGSA 5C3JB 2KQSA 2L0FA 2MJDA 3CWIA 3MC0B 3UGBB 1WXAA 2ZNVC 4OZCA 1J7AA 1DOXA 3I63C 2NTSA 2ZVOA 4MGYE 2MH7A 3PTFC 4W9DA 3NVZA 2VRRB 3HK0A 4EFOA 2OOBB 1M4VA 1N60A 2LVOA 1UGMA 3ZTDA 2MBEA 2KDFB 4ARCA 1HXYD 1OGWA 1JALA 2MRPA 2AX5A 3RNFC 2BGFA 2GBMA 1T5XD 1WJ4A 3KWLA 5FR3A 3KWVA 3R7RA 3LB8C 1SSNA 2HJ8A 2IY1B 4RFBA 3L13A 1BUIC 1ACCA 4AOFA 2HDEA 2GBNA 2KTFA 2D3CA 2LUMA 4EOYA 2MBBB 3VRAB 1SE9A 2BBCA 2O6VB 4AWJA 2Q5WD 3HHMA 2WXGA 2L00B 3KH0A 2RSUA 5BMGA 1GG3A 3EECA 2R2OA 1VR9A 3WALA 3RZWC 3H6NA 1EM7A 4E71A 2I38A 4WWPA 1F52A 1C78A 4YTNB 1GB1A 1SIFA 4AP4C 1WYWB 1UF0A 3M95A 5JHAA 2V4IB 1PGBA 3QHTA 3ZNZB 1IGCA 4YTMB 4JIOU 2KWCA 2N1WA 2D3BA 4K7WA 4DBGA 5BMHA 1RRBA 3BVMA 1Q10A 3H8HA 2HJ1A 1ZW7A 4HRSA 4XC2A 5MPOA 2MLBA 3SR6A 2PVOD 3ZJUA 3AEFB 3VAWA 2X38A 1TIFA 1WX7A 1YJJA 3ZRFA 2IPKD 2KLCA 4M0WB 5HFYA 3L0WB 2DAJA 1E7PB 4KZCA 4XWWA 1IYFA 3LDZE 1GUAB 2G45B 2NTTA 1FRDA 2BVCA 3NHEB 2KJHB 1XLOA 2WXQA 4HDOA 1WGDA 2RMMA 2KOXA 2W54A 4NAWB 2L52A 4ITKA 3AEGB 3GOEA 4ZYNA 3H1UA 2J42A 4II3B 2UYZB 5DPRA 3GS2A 4DHJD 2XBBC 4PYUA 2KAJA 3ZO5B 1ROEA 3R3MA 2HTHA 2LHDA 1XEEA 2WXPA 5G55A 5CHWA 1E8ZA 3KUZA 3SU8X 3L10B 1DGJA 1WSPA 2ZCBA 2O2VA 3JSVB 2KD0A 4IWOA 1PGAA 3D32A 2JQRB 2WNMA 2A4ZA 2KMCA 1L0XB 4GIVA 3MHZA 1SXTA 1EF5A 2BPSA 2J52A 4RF1A 2WXLA 4ANWA 2VH1A 3APDA 2DZJA 3HIZA 4N58A 3PHXB 5E6OA 2DX5B 4KSLC 1WH3A 1T6BX 4B0MA 3MC9A 4W9CA 4GDLA 1WX8A 1FFVA 3ZIMA 2SAKA 1OQRA 3M62B 2DYBA 1JWAD 3QJZA 3VTWA 2W55A 2KANA 3Q14C 3BZDB 1SGHA 3EA6A 1SE4A 2BT6A 4HKQA 2BYVE 2FCSA 1WRDB 3N1YC 2YEPF 1LGRA 1F9JA 1VZ8A 3Q69A 4ASWC 1RM6C 3AULA 3ZVVA 4IWQA 4PK1A 1SJHD 4TUUA 2L3ZA 4IDIA 2G9HD 3L4PA 4CO7A 4FBJB 3TEWA 4XYCA 2IBIB 1D5MC 1PYWD 4RM8A 3EHVA 4MGIE 1QKZA 3JYUA 5FR6A 1UELA 2BF8B 4WJNA 2AL6A 2H89B 5BYSA 2N7JA 3HM6X 3E56A 1J7BA 4MACA 2H88B 4EZJA 1BXTA 3IFWB 1MI0A 4DHZB 3ZXRA 4E3CA 1F1HA 2Z59B 3VDZA 1HZ6A 2KX3A 2NBUA 2WXMA 3PRMB 4FXCA 4DK5A 4M02A 4JL9A 3DBRI 1I4PA 1NVID 5HKHA 2QJLA 1RWSA 1R4NI 2KN4A 1MHXA 2LXCA 2MW5A 3DBHB 2WU5B 3AE8B 3OJ4B 4XWTA 1C76A 3MJ5A 3DBRB 4NQLB 3BIID 2KMMA 2HD5B 5EE0A 4NAWA 1I42A 4K1RB 2EMSA 2RGFA 3BVGA 2KDEB 5HHDG 3EFCA 4GMVA 3ZJTA 3QWZB 2C5LC 1EUVB 1P1AA 1YIWA 3N1XC 3ZUNA 2HE7A 3PREA 1TBEA 3Q8FA 4I6LB 3UI3A 4BVUC 3QCAA 3DVNU 3RNBC 1Z5SB 1SF0A 1K50A 1E8WA 4A3OA 5D94A 5LNK1 2ZCCA 1EWCA 2NCNA 3AEBB 3PLUA 4JGHB 1S3SG 2WHIA 3U52E 1FNVA 1D4BA 2DBYA 2JRIB 1WE6A 4HCNB 4BFRA 2J0JA 1L2NA 2ZPYA 2KHWB 1V1PA 3SD5A 3X0WA 2J0MA 4KVGB 2AQ1B 4RH6A 2V3PA 3C19A 1V1OA 2CJOA 2ZZPB 3NG0A 5HI1A 5G5GA 2NPTB 3R8BA 2BWES 4WAFA 1C4CA 1YN5A 2WXKA 3SFEB 4YTPB 4S0RA 4G50A 4ANUA 4WJPA 5GMVA 3R7QA 4JPSA 2BB5A 4G11A 1TS4A 4CHKA 3QIJA 4FA6A 3RT3B 2EMTA 1E10A 4LLGM 3NZSA 3I5JC 1IUEA 4LNFA 2CHXA 2ZEQA 2LGXA 4IM0A 4MGZE 4NAMA 2ACZB 1KTKA 1KLUD 5G2NA 1E5WA 2K39A 4HK2A 4AS1A 1GC6A 2K1FA 3ZKJC 4W9FA 2GLSA 2BS2B 1WJ6A 1FCCC 3RPFC 1DYQA 4W9EA 1KFYB 2KQ7A 2FCNA 3V3XA 3KYDD 5TSSA 2C7MB 3V6EB 3ZNGC 4P7IA 2RD0A 1F2RC 2I1JA 3W1SA 4CQNA 1N5XA 2K22A 1X1MA 1SIJA 4C7ZA 2QDFA 4A55A 1WIAA 2KK8A 5J2RA 3W9CB 4NJ7A 4YL8A 1FNWA 4ANVA 4TV3A 3NVYA 1K8RB 3ML8A 3BK2A 1SE3A 4ICUA 3MFGA 2FCMA 3T3OA 3AE4B 4W9KA 4GGQA 5CHVC 4LDTB 1KLGD 1C4AA 2CR5A 3IT6B 2AYOB 2DNFA 3ZRCA 1CMXB 4RGMA 2IO1B 2I1KA 2KACA 3J9CA 3RULA 3DWGC 1OEYJ 1CZPA 3MJWA 1D5XC 3AMZA 2VZKB 1XLNA 4IW0A 4I6NB 4C56C 3U7DA 1AYFA 1WGRA 1AARA 3H9DA 2MSED 3TSSA 4RGNA 2M0AA 2ZNVB 3P2BA 3AI5A 1QQRA 2IYDB 1HTQA 2N4FA 2L8JA 3BYTB 4WJOA 2MA9B 4A90A 4US8A 2MP2B 2DZKA 1MJDA 2CS4A 2AEHA 1C77A 2Z0DB 1ZP0B 4J3OD 1FFUA 5JXVA 4EZLA 2BKFA 4KGTA 2KN5A 3VUWA 2KZRA 2LGSA 2G3QB 4ZRQA 4J6IA 4WJQA 1NI3A 2K8BA 4GLSC 3RI7C 3P63A 4W9HA 4WWMA 1XO3A 1WX9A 2LI5A 5AZHA 1GC7A 2AWTA 3VR8B 4ZHOA 1STEA 2G4SA 4ZHPA 3DVNV 2LVQA 2MWSB 4I6PA 1C9FA 2N7DA 2LUEA 1HEZE 1LM8B 4YSXB 1B9RA 1GPXA 3R66C 1ZOYB 5I4DA 4S17A 1NDDA 2AQ2B 3MTNB 1EF1A 3UQAA 1LXDA 5KHQA 5DPWA 4P6VF 2DLBA 3JSVA 1JWSD 2DZMA 4KDIC 2JYTA 1UWMA 4M8MA 3ML9A 2K8HA 2ZPNA 3AE9B 3QC8B 2K8CA 3U4EG 5C1ZA 2ZVNA 3L54A 2BS4B 2D2QA 4EEWA 3L16A 1FEHA 4JQWC 4LJOB 4RGTA 3Q2AC 4LK0M 2VZKD 3IG3A 4ZYSA 2CHZA 3FILB 2W82A 4IWPA 4N9F4 2KQ4X 4ZRJA 2N7EA 4EZKA 4FADA 3WIMA 1EWYC 3T9LA 5D3IB 4XX5A 2JZZA 4LNNA 2OHFA 4BKTA 3WANA 4LTUA 3SDLC 1E8XA 4NJCA 2KDBA 1QOFA 3APCA 2FIDA 2EELA 2ZJDA 4W9IA 2KNBA 2MQJA 5AUIA 4IC7B 1FNUA 3B2FA 3N20C 3RD2A 1FXTB 3KLSX 1MHHE 4PS7A 3VHTC 3DBHI 1WXVA 1WYGA 2JXXA 2GOWA 1WFYA 1ZXHA 1Y56A 1UZXB 5LXIB 2KTRB 4P1CC 4FJVB 1ZPSA 1XLQA 3GB1A 1TYGB 1OTRB 1HTOA 3RCZA 4RM9A 4Q2JA 3ZW3A 3AEDB 3CSTA 2M8SA 1KRHA 3ECIA 2KFKB 2CJNA 5DCNA 2C7NB 2C9WB 2K6DB 3PSEB 4KKIA 1CJEA 3Q3OC 1XLPA 4GDKA 3AEAB 3Q3MC 2XK5B 5H92C 1C3TA 4M01A 4GB9A 2KT7A 1YD8U 1YN4A 2D5GA 2M0XA 2WWZA 3CMMB 5IO9A 1NENB 4YT0B 3VH3B 4KX6B 1WWTA 1WE7A 3FAHA 1SEBD 4WH4A 3TL5A 1E7VA 1C79A 1WGGA 3ONSA 3RNCC 1KM7A 1N5WA 3W5UB 1FXIA 2YVCA 4MEMA 4TQ1A 1JRUA 4M8NA 1FMAD 4ZRKA 2I2YA 3A1QB 4OVZA 3Q3NC 1R7SA 1TZOA 2WDQB 1TY0A 3DPDA 4BKGA 2W3SA 2D3AA 4WWOA 4N59A 1VZ7A 3TJPA 3URYA 4KKJA 5L95C 2FNJB 3U8ZA 2JU6X 4BKSD 4BZAA 3CSFA 5EE3A 3B1LX 4DQOC 3K9PB 4HCPB 3ZQ4A 3NS8A 2V9HA 3B2GA 2DYOA 5CTRC 2GB1A 2M19A 4B6WA 1TS5A 2N9KA 4B0EA 2D3GA 3IT4B 3QA8A 1L4DB 3WA0A 2LGDA 4C4VB 4US9A 1HQRD 3C8YA 2GMIC 1SB3C 1AWDA 3QAQA 2JZ3B 4NPNA 2IZVB 1FM0D 3A4RA 4EE2A 1JWBD 1FO4A 2KVZA 1V6EA 1E8YA 3RNGC 4IKGA 1KOTA 1GAQB 1TKYA 1L4ZB 2IO2B 2NBWB 2QEJC 1ZKHA 2ASQA 1V49A 3AM9A 4KIKB 1N63A 4REZA 1Q5WB 1WJUA 4GSWA 2WXHA 1T0QC 2J53A 2WXJA 3A9JB 2IGGA 3NUHB 4W9GA 1F77A 1L6VA 1WI0A 3JVZX 4DWFA 1XT9B 1PDXA 3Q6BA 2JRHA 1U4AA 3TEZA 4AJYB 4HDQA 4JWSC 3OWEB 2RR9A 1JCKB 2J7QB 2CU1A 1MG4A 2ONQA 3RNEC 4BBNC 4M00A 4XGAB 1S1QB 5BYQA 2K0PA 4RGOS 1XCTL 2C60A 4OZAA 4MDKE 4XZ4A 5BO4B 1CQVA 4ARIA 1MVKA 2Z0EB 2RDBC 1KH0A 4FJYA 4WWNA 5GXGB 1WM3A 4PYZA 1Q1OA 2GI9A 1AW7A 2NVUI 1V5TA 4K3BA 4F7ZA 1A5RA 1ZXIA 2WXRA 1V2YA 2RPQA 1B1ZA 3P1MA 4KGRA 3V6CB 2KX0A 5DPSA 3TUOA 3TEXA 2PMVA 3A4SC 2HTME 4JLCA 2ICIA 3AH7A 4IUMB 3DQVA 5C2TB 1M94A 2WYQA 2J0KA 4WIPA 1E6EB 4A6QA 2GBJA 1P3QU 1RYJA 1HE8A 3FC4A 1ET6A 2OJRA 1V86A 3B08A 4FN2A 3VTVA 1TTNA 1JW9D 2L1AA 1N6ZA 2LWPA 3I3TB 1HZ5A 3SHQA 1WZ3A 3R2TA 4GXBA 4QAYA 3PVLA 3S2AA 1R4MI 5TR5A 5L83A 2DAFA 2FAZA 3DBLI 1QILA 3Q8BA 4NZLB 2LASA 3RN9C 2ON8A 3RZFA 5BYRA 1R4NB 1K52A 1ZGUB 2WDVB 1DOYA 1WMHB 2V4LA 3TBLD 5H8YE 2JXTA 1YQ4B 3VQIA 2ZW0A 3LXFA 1YN3A 4LNOA 2V3SA 1P7FA 4OZBA 3N32A 4OVVA 3W2DA 5AEKB 1QOGA 3U2SC 4D2KA 1V97A 3AEEB 5E6NA 5AZGA 1IGDA 2MEKA 3LYYA 1ZE3D 4TKNA 1WXSA 4B9KA 3PZ8A 4WQOB 2O2VB 2BTEA 5IOIA 2FUG1 2QC8A 2IO0B 4DHZE 2K5PA 3DCGA 2BQQA 2IJ0A 4NQKE 1V9JA 1VCBA 2DYMA 4DDID 3AE2B 3QARA 3NY5A 3DHHC 2WX0A 4FULA 1YQ3B 5C23A 2JX5A 3VR9B 3HVDA 1D5ZC 2KWVB 5J18A 3GZNI 4F8CB 3BVZA 2LD9A 3DBLB 4OW0A 2KKCA 1P9DU 3KVFB 1TS2A 2LXAA 2WU2B 1IBXB 4K7UA 4HKZE 2V0GA 3O65B 4FLHA 2KWDA 4DXGA 2IGHA 2WP9B 3KUCB 4GN1A 3O13A 2MX2A 3VFKA 2L32A 1QOAA 1ZDXA 2JPHA 2KYWA 5IKCM 2ZW1A 3WAMA 3V62A 3AU5A 5IA7A 4LDTD 1P0RA 4DXFA 1ENFA 3DWMA 1FCLA 2GBKA 2KWUB 1TJEA 3P4PB 3AE1B 4HJKA 3N30A 2R61A 2LEKA 4FJZA 4DDGD 2BYTA 3VUYA 3NZ3A 1D6EC 2WDTB 2LRWA 2LVPA 2E6XA 4L23A 1Z2MA 1T0YA 3GP7A 4AUQC 1I4QA 3NRZA 4JX1C 2FUHB 4CYEA 3PLVA 3PS6A 1E7UA 5IAAC 4BOSC 4JE3B 3AE6B 2KFKA 4FHJA 4X57B 5AZFA 4JWUC 4RCOA 1C1YB 3I9V1 3GZNB 4HROA 3QK0A 1UBIA 4BBNF 4W9LA 2FBWB 4HJGE 1EU3A 2MBHA 2JWZA 1DOIA 2PW9A 4URKA 4LJPB 4EKUA 2M17A 2W9NA 2J4XA 2PPHA 1ISNA 2WS3B 5IN7A 3ZNHB 1WF9A
chains in the Genus database with same CATH topology
5FR6A 1UELA 4HVBA 5DCNA 4K81A 1V81A 2BF8B 2C7NB 3A33B 2C9WB 2K6DB 2MBQA 3PGEA 3PSEB 3KYCD 4GU2A 4WJNA 2JY6A 3VUXA 2AL6A 4GDKA 2GBRA 3NOBA 2XK5B 3HM6X 1TZ1A 1Q0WB 1V80A 1VD2A 1C3TA 2M1MA 4GB9A 1H8CA 4EZJA 2KXJA 3IFWB 2M4NA 3K9OB 1YD8U 3H7PB 3MHSD 3JYUA 2C7HA 2K25A 4DHZB 2JT4B 2L7RA 2M0XA 2WWZA 3CMMB 3TCAA 4E3CA 3ZNID 4HPLB 2CKHB 2Z59B 4PS3A 1YX6B 3VDZA 2KX3A 2NBUA 3VH3B 4MJSA 2L05A 3ZDMC 1J19A 2XEWA 1WE7A 2DZIA 1UH6A 2V1YA 3PRMB 4DK5A 2A5UA 3TL5A 1E7VA 1WGGA 2BWFA 3ONSA 4JL9A 2UWQA 1IPGA 2L76A 1KM7A 3DBRI 2YVCA 4MH0E 4MEMA 5HKHA 2BYFA 4TQ1A 4KZ0A 1JRUA 4HPMB 4M8NA 4RMAA 1R4NI 2LXCA 2MW5A 3LJ3A 4G3XB 3ZNHB 4WAAA 3OJ4B 4DXAB 3UF8A 4MGKE 4ZRKA 3A1QB 4B95A 1J8CA 4NQLB 3HM3A 2XK5A 3M3JA 2HD5B 4NAWA 3N3KB 1I42A 4K1RB 3PHWB 4F1SA 4ICVA 2EMSA 2D10A 3DPDA 1D3ZA 2RGFA 4BKGA 4ANXA 5JZEB 2KDEB 2KO3A 1YJ1A 3NZUA 4WWOA 3OLMD 1MG8A 3VXWA 3TJPA 2KFJA 1V5OA 5E6PA 4GMVA 4HLEA 5L95C 2FNJB 3U8ZA 1WJNA 2C5LC 1EUVB 3QWZB 4BKSD 5KHOA 1P1AA 1YIWA 3CSFA 3ZUNA 2HE7A 3B1LX 3K9PB 2PJHA 3PREA 1TBEA 4HCPB 1RAXA 4I6LB 4BVUC 3NS8A 3QCAA 3DVNU 2LZ6A 1NBFC 4KDLB 3RUIB 2DYOA 5CTRC 1J0GA 2LRUA 4BKSA 1LQBA 2NBVB 1Z5SB 1E8WA 4A3OA 5D94A 4B6WA 1P98A 2O6VD 4NNJB 2ZCCA 5JH5C 2D3GA 2NCNA 2EKEC 3PLUA 4JGHB 1S3SG 3V60A 3QA8A 3VVWB 2JRIB 1WE6A 3DVGY 2LGDA 4HCNB 3WA0A 3APFA 4BFRA 2J0JA 2YLMA 1L2NA 2ZPYA 2KHWB 3L17A 3SD5A 3A9KA 3X0WA 1RLFA 2J0MA 2KJRA 3ZTCA 1KLVA 2FCQA 4KVGB 5LXHA 4OVUA 2GMIC 3QAQA 2JZ3B 3PRZA 4A20A 3A9JA 3C0RB 4NPNA 3OAWA 1WM2A 3Q3JA 2IZVB 2ZZPB 3A4RA 3QQ8B 2NPTB 4II2B 3PZDA 2BWES 2IO3B 4IG7B 1WY8A 4NY0A 3UINB 3CF6E 3QX1A 2KC1A 4G50A 1V6EA 2KC2A 1E8YA 4ANUA 2WX1A 4K7SA 4WJPA 5GMVA 3X23A 3R7QA 4AJWA 1KOTA 1GJZA 3V61A 1RFAA 2KVRA 2IO2B 3L08A 1GNUA 2IY0B 2NBWB 3PV1A 2K6QA 1XD3B 3B0AA 1ZKHA 2ASQA 4G11A 1V49A 4CHKA 3QIJA 4KIKB 3RT3B 2EMTA 4FA6A 5EDSA 1QZEA 1Q5WB 1WJUA 2N9PC 2CHXA 3NZSA 4GSWA 5LLIA 3TMPB 5J17A 2ZEQA 2LGXA 4IM0A 4MGZE 5G2NA 2JVCA 3WAPA 1E5WA 2K39A 4HK2A 3A9JB 4W9GA 1GC6A 3U30A 1IP9A 2DENB 1WR6E 2K1FA 3ZKJC 3BY4B 3EC8A 2NPTA 1Y8RC 4W9FA 1WJ6A 4KIKA 2B3AA 2QHOA 4W9EA 2KQ7A 3JW0X 2FCNA 1WI0A 3KYDD 1I35A 2C7MB 2KQSA 2L0FA 3JVZX 3V6EB 3ZNGC 1XT9B 4DWFA 2JRHA 1U4AA 3IBEA 4P7IA 2RD0A 2I1JA 5CHFA 3W1SA 4AJYB 4HDQA 3DDCB 3UGBB 1WXAA 2RR9A 4ZRIA 2ZNVC 2J7QB 1X1MA 2CU1A 2ZVOA 4MGYE 3PTFC 4BBNC 1WIAA 2JF5A 4W9DA 2KK8A 1S1QB 2VRRB 3HK0A 3PRPB 4EFOA 2OOBB 5J2RA 2LVOA 2C60A 1UGMA 2R2QA 3H7PA 4XZ4A 4MDKE 4NJ7A 4YL8A 5BO4B 2MBEA 3ZTDA 4ANVA 1G6JA 4TV3A 2BYEA 2KDFB 3AXCA 1K8RB 2Z0EB 3ML8A 4FJYA 4MSQB 4ICUA 2N1VA 4KSKC 4MJSB 1OGWA 4WWNA 2FCMA 3W1YA 1WM3A 4PYZA 2MRPA 1Q1OA 1E90A 1YX5B 1BT0A 2PE9A 4W9KA 4GGQA 2CHWA 2NVUI 5CHVC 1V5TA 3DOWA 2BGFA 2GBMA 2MP2A 4F7ZA 1WJ4A 4LDTB 1A5RA 2CR5A 2AYOB 2KTRA 3KUDB 3R7RA 1V2YA 2RPQA 3ZRCA 2HJ8A 1CMXB 4E74A 2IY1B 2NR2A 1WXMA 3L13A 4FHKA 3V6CB 2IO1B 2I1KA 2KX0A 2GBNA 2KTFA 5DPSA 3RULA 2KDIA 1OQYA 1WMHA 2N9XA 4EOYA 1OEYJ 3A4SC 3MJWA 4JLCA 4IUMB 2MBBB 2N9EB 1XQQA 3DQVA 1M94A 1SE9A 2O6VB 2WYQA 4AWJA 2REXA 2J0KA 4IW0A 4I6NB 3HHMA 4DHJB 2L00B 3U7DA 3TIXA 3KH0A 2JUOA 2GBJA 1WGRA 1AARA 1P3QU 2RSUA 3H9DA 1HE8A 2MSED 2OJRA 3PT2B 1GG3A 3PPAA 3EECA 1V86A 2R2OA 2ZNVB 3B08A 5D6JB 3WALA 3P2BA 4FN2A 3RZWC 3VTVA 3AI5A 1TTNA 3H6NA 2IYDB 1L7YA 2Y5BB 4WWPA 4E71A 4EUTA 2LWPA 3I3TB 3SHQA 1WZ3A 2N4FA 4GXBA 2L8JA 1UD7A 4WJOA 3PVLA 3S2AA 1R4MI 2MA9B 4ZDVA 2MP2B 5TR5A 1SIFA 3KW5B 5L83A 4AP4C 2DAFA 2FAZA 3DBLI 1WYWB 3M95A 4MSMB 2DZKA 2LASA 5JHAA 4MM3A 3RZFA 3QHTA 3ZNZB 2CS4A 4JIOU 2KWCA 1ZGUB 2AEHA 1YQBA 2Z0DB 1WMHB 2V4LA 3TBLD 2N1WA 1LFDA 4EZLA 1TGZB 2BKFA 2KN5A 4K7WA 3VQIA 3VUWA 5D7GA 1WGYA 4DBGA 2KZRA 3DBSA 2BKRB 1RRBA 2G3QB 1ZW7A 2V3SA 4J6IA 4IM2A 4MELA 2PE6B 1NI2A 4WJQA 3N32A 4OVVA 4XC2A 3UIPB 2LJ5A 5AEKB 2MLBA 2K8BA 1OEYA 3AU4A 4G0NB 5E6NA 4W9HA 4MGIE 4W9JA 5AZGA 3VAWA 2LGYA 4GOCA 3A1QA 1WX9A 2LI5A 5AZHA 1WX7A 1GC7A 2KMAA 3ZRFA 2AWTA 2KLCA 4M0WB 2G4SA 4TKNA 5D2MB 1WXSA 3DVNV 3L0WB 2DAJA 4PS8A 2LVQA 4B9KA 2MWSB 4I6PA 5CX3A 4WQOB 2KLGA 4KZCA 1IYFA 4TQ0A 2N7DA 2O2VB 3LDZE 1GUAB 2G45B 2LUEA 2IO0B 1LM8B 4DHZE 3NHEB 2KJHB 1KJTA 3DCGA 3R66C 4HDOA 1WGDA 1NDDA 5JHBA 2KOXA 3MTNB 4IM3A 1EF1A 4HWIB 4NAWB 4NQKE 1V9JA 1VCBA 2DYMA 4LCDE 1LXDA 4DDID 5KHQA 3UQAA 2NS5A 3QARA 5DPWA 3NY5A 3GOEA 2WX0A 4FULA 4ZYNA 1PQSA 3JSVA 2DZMA 5C23A 3UQBA 4KDIC 3VH4B 3H1UA 2KWVB 4II3B 1WZ0A 2UYZB 5DPRA 2DHZA 4M8MA 3ML9A 5J18A 2K8HA 3GZNI 2ZPNA 4DHJD 4F8CB 2XBBC 4PYUA 3ZO5B 2LD9A 3R3MA 2KKCA 3QC8B 2HTHA 1P9DU 2K8CA 3ZDTA 3KVFB 5G55A 5C1ZA 2ZVNA 5CHWA 3Q3FA 1E8ZA 1H4RA 2LXAA 3KUZA 3SU8X 3L54A 4K7UA 3L10B 3A9KB 3H7SA 2D2QA 2ZCBA 3O65B 4EEWA 3L16A 4FLHA 2O2VA 3JSVB 2KD0A 4HXDA 2D11A 4JQWC 4LJOB 4IWOA 3KUCB 4GN1A 3BINA 3D32A 3IG3A 2MX2A 3VFKA 2CHZA 2MBOA 4IWPA 4N9F4 2JPHA 2A4ZA 2KMCA 3WAMA 4ZRJA 3V62A 2N7EA 3OJ3A 4EZKA 4FADA 4GIVA 4BOZB 2L0TA 3WIMA 3IVFA 3T9LA 3AU5A 4XX5A 1EO6A 1EF5A 2BPSA 2JZZA 5IA7A 4BKTA 4LDTD 1P0RA 2FIFA 3WANA 3SDLC 3UIOB 1WF9A 4A3PA 1E8XA 4ANWA 3APDA 2DZJA 3HIZA 2GBKA 2KWUB 3ENEA 3PHXB 5E6OA 2DX5B 2KDBA 4KSLC 1WH3A 3VTUA 4HJKA 4AOFA 2PEAA 3N30A 4W9CA 3APCA 2FIDA 4FJZA 4GDLA 1WX8A 4DDGD 2AL3A 3RYTA 3VUYA 2ZJDA 4W9IA 3ZIMA 2KNBA 2MQJA 4IC7B 3EFUA 3M62B 2WDTB 2DYBA 3RD2A 2LRWA 2LVPA 1WR1A 1FXTB 3QJZA 1Z2MA 3VTWA 1T0YA 4KV2A 4AUQC 3ALBA 2KJ6A 3WAOA 4PS7A 2KANA 4CYEA 2FUHB 3DBHI 1WXVA 3VHTC 3PLVA 3PS6A 2G4DB 1SGHA 2JXXA 2GOWA 1E7UA 1WFYA 2O6VA 5IAAC 3T8MA 4BOSC 2D07B 1UZXB 2BYVE 2FCSA 5LXIB 2KFKA 1WRDB 4NJ6A 2KTRB 4FHJA 4X57B 4FJVB 1F9JA 5AZFA 4ASWC 1C1YB 1OTRB 3AULA 3QK0A 3W1SC 1UBIA 3ZVVA 3ZLZA 4W9LA 4IWQA 4BBNF 4GDKB 2MCNB 2MBHA 2JWZA 1WGHA 4TUUA 4RM9A 2L3ZA 3RCZA 4CO7A 4LJPB 4EKUA 4FBJB 3M63B 4URKA 5DPTA 2M17A 1UBQA 2W9NA 2PPHA 1ISNA 3DVGX 3ZW3A 2IBIB 4RM8A 4GDLB 3EHVA 3IHPC 3CSTA 2M8SA 3ECIA 2KFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FR6 A;  1UEL A;  4HVB A;  5DCN A;  4K81 A;  1V81 A;  2BF8 B;  2C7N B;  3A33 B;  2C9W B;  2K6D B;  2MBQ A;  3PGE A;  3PSE B;  3KYC D;  4GU2 A;  4WJN A;  2JY6 A;  3VUX A;  2AL6 A;  4GDK A;  2GBR A;  3NOB A;  2XK5 B;  3HM6 X;  1TZ1 A;  1Q0W B;  1V80 A;  1VD2 A;  1C3T A;  2M1M A;  4GB9 A;  1H8C A;  4EZJ A;  2KXJ A;  3IFW B;  2M4N A;  3K9O B;  1YD8 U;  3H7P B;  3MHS D;  3JYU A;  2C7H A;  2K25 A;  4DHZ B;  2JT4 B;  2L7R A;  2M0X A;  2WWZ A;  3CMM B;  3TCA A;  4E3C A;  3ZNI D;  4HPL B;  2CKH B;  2Z59 B;  4PS3 A;  1YX6 B;  3VDZ A;  2KX3 A;  2NBU A;  3VH3 B;  4MJS A;  2L05 A;  3ZDM C;  1J19 A;  2XEW A;  1WE7 A;  2DZI A;  1UH6 A;  2V1Y A;  3PRM B;  4DK5 A;  2A5U A;  3TL5 A;  1E7V A;  1WGG A;  2BWF A;  3ONS A;  4JL9 A;  2UWQ A;  1IPG A;  2L76 A;  1KM7 A;  3DBR I;  2YVC A;  4MH0 E;  4MEM A;  5HKH A;  2BYF A;  4TQ1 A;  4KZ0 A;  1JRU A;  4HPM B;  4M8N A;  4RMA A;  1R4N I;  2LXC A;  2MW5 A;  3LJ3 A;  4G3X B;  3ZNH B;  4WAA A;  3OJ4 B;  4DXA B;  3UF8 A;  4MGK E;  4ZRK A;  3A1Q B;  4B95 A;  1J8C A;  4NQL B;  3HM3 A;  2XK5 A;  3M3J A;  2HD5 B;  4NAW A;  3N3K B;  1I42 A;  4K1R B;  3PHW B;  4F1S A;  4ICV A;  2EMS A;  2D10 A;  3DPD A;  1D3Z A;  2RGF A;  4BKG A;  4ANX A;  5JZE B;  2KDE B;  2KO3 A;  1YJ1 A;  3NZU A;  4WWO A;  3OLM D;  1MG8 A;  3VXW A;  3TJP A;  2KFJ A;  1V5O A;  5E6P A;  4GMV A;  4HLE A;  5L95 C;  2FNJ B;  3U8Z A;  1WJN A;  2C5L C;  1EUV B;  3QWZ B;  4BKS D;  5KHO A;  1P1A A;  1YIW A;  3CSF A;  3ZUN A;  2HE7 A;  3B1L X;  3K9P B;  2PJH A;  3PRE A;  1TBE A;  4HCP B;  1RAX A;  4I6L B;  4BVU C;  3NS8 A;  3QCA A;  3DVN U;  2LZ6 A;  1NBF C;  4KDL B;  3RUI B;  2DYO A;  5CTR C;  1J0G A;  2LRU A;  4BKS A;  1LQB A;  2NBV B;  1Z5S B;  1E8W A;  4A3O A;  5D94 A;  4B6W A;  1P98 A;  2O6V D;  4NNJ B;  2ZCC A;  5JH5 C;  2D3G A;  2NCN A;  2EKE C;  3PLU A;  4JGH B;  1S3S G;  3V60 A;  3QA8 A;  3VVW B;  2JRI B;  1WE6 A;  3DVG Y;  2LGD A;  4HCN B;  3WA0 A;  3APF A;  4BFR A;  2J0J A;  2YLM A;  1L2N A;  2ZPY A;  2KHW B;  3L17 A;  3SD5 A;  3A9K A;  3X0W A;  1RLF A;  2J0M A;  2KJR A;  3ZTC A;  1KLV A;  2FCQ A;  4KVG B;  5LXH A;  4OVU A;  2GMI C;  3QAQ A;  2JZ3 B;  3PRZ A;  4A20 A;  3A9J A;  3C0R B;  4NPN A;  3OAW A;  1WM2 A;  3Q3J A;  2IZV B;  2ZZP B;  3A4R A;  3QQ8 B;  2NPT B;  4II2 B;  3PZD A;  2BWE S;  2IO3 B;  4IG7 B;  1WY8 A;  4NY0 A;  3UIN B;  3CF6 E;  3QX1 A;  2KC1 A;  4G50 A;  1V6E A;  2KC2 A;  1E8Y A;  4ANU A;  2WX1 A;  4K7S A;  4WJP A;  5GMV A;  3X23 A;  3R7Q A;  4AJW A;  1KOT A;  1GJZ A;  3V61 A;  1RFA A;  2KVR A;  2IO2 B;  3L08 A;  1GNU A;  2IY0 B;  2NBW B;  3PV1 A;  2K6Q A;  1XD3 B;  3B0A A;  1ZKH A;  2ASQ A;  4G11 A;  1V49 A;  4CHK A;  3QIJ A;  4KIK B;  3RT3 B;  2EMT A;  4FA6 A;  5EDS A;  1QZE A;  1Q5W B;  1WJU A;  2N9P C;  2CHX A;  3NZS A;  4GSW A;  5LLI A;  3TMP B;  5J17 A;  2ZEQ A;  2LGX A;  4IM0 A;  4MGZ E;  5G2N A;  2JVC A;  3WAP A;  1E5W A;  2K39 A;  4HK2 A;  3A9J B;  4W9G A;  1GC6 A;  3U30 A;  1IP9 A;  2DEN B;  1WR6 E;  2K1F A;  3ZKJ C;  3BY4 B;  3EC8 A;  2NPT A;  1Y8R C;  4W9F A;  1WJ6 A;  4KIK A;  2B3A A;  2QHO A;  4W9E A;  2KQ7 A;  3JW0 X;  2FCN A;  1WI0 A;  3KYD D;  1I35 A;  2C7M B;  2KQS A;  2L0F A;  3JVZ X;  3V6E B;  3ZNG C;  1XT9 B;  4DWF A;  2JRH A;  1U4A A;  3IBE A;  4P7I A;  2RD0 A;  2I1J A;  5CHF A;  3W1S A;  4AJY B;  4HDQ A;  3DDC B;  3UGB B;  1WXA A;  2RR9 A;  4ZRI A;  2ZNV C;  2J7Q B;  1X1M A;  2CU1 A;  2ZVO A;  4MGY E;  3PTF C;  4BBN C;  1WIA A;  2JF5 A;  4W9D A;  2KK8 A;  1S1Q B;  2VRR B;  3HK0 A;  3PRP B;  4EFO A;  2OOB B;  5J2R A;  2LVO A;  2C60 A;  1UGM A;  2R2Q A;  3H7P A;  4XZ4 A;  4MDK E;  4NJ7 A;  4YL8 A;  5BO4 B;  2MBE A;  3ZTD A;  4ANV A;  1G6J A;  4TV3 A;  2BYE A;  2KDF B;  3AXC A;  1K8R B;  2Z0E B;  3ML8 A;  4FJY A;  4MSQ B;  4ICU A;  2N1V A;  4KSK C;  4MJS B;  1OGW A;  4WWN A;  2FCM A;  3W1Y A;  1WM3 A;  4PYZ A;  2MRP A;  1Q1O A;  1E90 A;  1YX5 B;  1BT0 A;  2PE9 A;  4W9K A;  4GGQ A;  2CHW A;  2NVU I;  5CHV C;  1V5T A;  3DOW A;  2BGF A;  2GBM A;  2MP2 A;  4F7Z A;  1WJ4 A;  4LDT B;  1A5R A;  2CR5 A;  2AYO B;  2KTR A;  3KUD B;  3R7R A;  1V2Y A;  2RPQ A;  3ZRC A;  2HJ8 A;  1CMX B;  4E74 A;  2IY1 B;  2NR2 A;  1WXM A;  3L13 A;  4FHK A;  3V6C B;  2IO1 B;  2I1K A;  2KX0 A;  2GBN A;  2KTF A;  5DPS A;  3RUL A;  2KDI A;  1OQY A;  1WMH A;  2N9X A;  4EOY A;  1OEY J;  3A4S C;  3MJW A;  4JLC A;  4IUM B;  2MBB B;  2N9E B;  1XQQ A;  3DQV A;  1M94 A;  1SE9 A;  2O6V B;  2WYQ A;  4AWJ A;  2REX A;  2J0K A;  4IW0 A;  4I6N B;  3HHM A;  4DHJ B;  2L00 B;  3U7D A;  3TIX A;  3KH0 A;  2JUO A;  2GBJ A;  1WGR A;  1AAR A;  1P3Q U;  2RSU A;  3H9D A;  1HE8 A;  2MSE D;  2OJR A;  3PT2 B;  1GG3 A;  3PPA A;  3EEC A;  1V86 A;  2R2O A;  2ZNV B;  3B08 A;  5D6J B;  3WAL A;  3P2B A;  4FN2 A;  3RZW C;  3VTV A;  3AI5 A;  1TTN A;  3H6N A;  2IYD B;  1L7Y A;  2Y5B B;  4WWP A;  4E71 A;  4EUT A;  2LWP A;  3I3T B;  3SHQ A;  1WZ3 A;  2N4F A;  4GXB A;  2L8J A;  1UD7 A;  4WJO A;  3PVL A;  3S2A A;  1R4M I;  2MA9 B;  4ZDV A;  2MP2 B;  5TR5 A;  1SIF A;  3KW5 B;  5L83 A;  4AP4 C;  2DAF A;  2FAZ A;  3DBL I;  1WYW B;  3M95 A;  4MSM B;  2DZK A;  2LAS A;  5JHA A;  4MM3 A;  3RZF A;  3QHT A;  3ZNZ B;  2CS4 A;  4JIO U;  2KWC A;  1ZGU B;  2AEH A;  1YQB A;  2Z0D B;  1WMH B;  2V4L A;  3TBL D;  2N1W A;  1LFD A;  4EZL A;  1TGZ B;  2BKF A;  2KN5 A;  4K7W A;  3VQI A;  3VUW A;  5D7G A;  1WGY A;  4DBG A;  2KZR A;  3DBS A;  2BKR B;  1RRB A;  2G3Q B;  1ZW7 A;  2V3S A;  4J6I A;  4IM2 A;  4MEL A;  2PE6 B;  1NI2 A;  4WJQ A;  3N32 A;  4OVV A;  4XC2 A;  3UIP B;  2LJ5 A;  5AEK B;  2MLB A;  2K8B A;  1OEY A;  3AU4 A;  4G0N B;  5E6N A;  4W9H A;  4MGI E;  4W9J A;  5AZG A;  3VAW A;  2LGY A;  4GOC A;  3A1Q A;  1WX9 A;  2LI5 A;  5AZH A;  1WX7 A;  1GC7 A;  2KMA A;  3ZRF A;  2AWT A;  2KLC A;  4M0W B;  2G4S A;  4TKN A;  5D2M B;  1WXS A;  3DVN V;  3L0W B;  2DAJ A;  4PS8 A;  2LVQ A;  4B9K A;  2MWS B;  4I6P A;  5CX3 A;  4WQO B;  2KLG A;  4KZC A;  1IYF A;  4TQ0 A;  2N7D A;  2O2V B;  3LDZ E;  1GUA B;  2G45 B;  2LUE A;  2IO0 B;  1LM8 B;  4DHZ E;  3NHE B;  2KJH B;  1KJT A;  3DCG A;  3R66 C;  4HDO A;  1WGD A;  1NDD A;  5JHB A;  2KOX A;  3MTN B;  4IM3 A;  1EF1 A;  4HWI B;  4NAW B;  4NQK E;  1V9J A;  1VCB A;  2DYM A;  4LCD E;  1LXD A;  4DDI D;  5KHQ A;  3UQA A;  2NS5 A;  3QAR A;  5DPW A;  3NY5 A;  3GOE A;  2WX0 A;  4FUL A;  4ZYN A;  1PQS A;  3JSV A;  2DZM A;  5C23 A;  3UQB A;  4KDI C;  3VH4 B;  3H1U A;  2KWV B;  4II3 B;  1WZ0 A;  2UYZ B;  5DPR A;  2DHZ A;  4M8M A;  3ML9 A;  5J18 A;  2K8H A;  3GZN I;  2ZPN A;  4DHJ D;  4F8C B;  2XBB C;  4PYU A;  3ZO5 B;  2LD9 A;  3R3M A;  2KKC A;  3QC8 B;  2HTH A;  1P9D U;  2K8C A;  3ZDT A;  3KVF B;  5G55 A;  5C1Z A;  2ZVN A;  5CHW A;  3Q3F A;  1E8Z A;  1H4R A;  2LXA A;  3KUZ A;  3SU8 X;  3L54 A;  4K7U A;  3L10 B;  3A9K B;  3H7S A;  2D2Q A;  2ZCB A;  3O65 B;  4EEW A;  3L16 A;  4FLH A;  2O2V A;  3JSV B;  2KD0 A;  4HXD A;  2D11 A;  4JQW C;  4LJO B;  4IWO A;  3KUC B;  4GN1 A;  3BIN A;  3D32 A;  3IG3 A;  2MX2 A;  3VFK A;  2CHZ A;  2MBO A;  4IWP A;  4N9F 4;  2JPH A;  2A4Z A;  2KMC A;  3WAM A;  4ZRJ A;  3V62 A;  2N7E A;  3OJ3 A;  4EZK A;  4FAD A;  4GIV A;  4BOZ B;  2L0T A;  3WIM A;  3IVF A;  3T9L A;  3AU5 A;  4XX5 A;  1EO6 A;  1EF5 A;  2BPS A;  2JZZ A;  5IA7 A;  4BKT A;  4LDT D;  1P0R A;  2FIF A;  3WAN A;  3SDL C;  3UIO B;  1WF9 A;  4A3P A;  1E8X A;  4ANW A;  3APD A;  2DZJ A;  3HIZ A;  2GBK A;  2KWU B;  3ENE A;  3PHX B;  5E6O A;  2DX5 B;  2KDB A;  4KSL C;  1WH3 A;  3VTU A;  4HJK A;  4AOF A;  2PEA A;  3N30 A;  4W9C A;  3APC A;  2FID A;  4FJZ A;  4GDL A;  1WX8 A;  4DDG D;  2AL3 A;  3RYT A;  3VUY A;  2ZJD A;  4W9I A;  3ZIM A;  2KNB A;  2MQJ A;  4IC7 B;  3EFU A;  3M62 B;  2WDT B;  2DYB A;  3RD2 A;  2LRW A;  2LVP A;  1WR1 A;  1FXT B;  3QJZ A;  1Z2M A;  3VTW A;  1T0Y A;  4KV2 A;  4AUQ C;  3ALB A;  2KJ6 A;  3WAO A;  4PS7 A;  2KAN A;  4CYE A;  2FUH B;  3DBH I;  1WXV A;  3VHT C;  3PLV A;  3PS6 A;  2G4D B;  1SGH A;  2JXX A;  2GOW A;  1E7U A;  1WFY A;  2O6V A;  5IAA C;  3T8M A;  4BOS C;  2D07 B;  1UZX B;  2BYV E;  2FCS A;  5LXI B;  2KFK A;  1WRD B;  4NJ6 A;  2KTR B;  4FHJ A;  4X57 B;  4FJV B;  1F9J A;  5AZF A;  4ASW C;  1C1Y B;  1OTR B;  3AUL A;  3QK0 A;  3W1S C;  1UBI A;  3ZVV A;  3ZLZ A;  4W9L A;  4IWQ A;  4BBN F;  4GDK B;  2MCN B;  2MBH A;  2JWZ A;  1WGH A;  4TUU A;  4RM9 A;  2L3Z A;  3RCZ A;  4CO7 A;  4LJP B;  4EKU A;  4FBJ B;  3M63 B;  4URK A;  5DPT A;  2M17 A;  1UBQ A;  2W9N A;  2PPH A;  1ISN A;  3DVG X;  3ZW3 A;  2IBI B;  4RM8 A;  4GDL B;  3EHV A;  3IHP C;  3CST A;  2M8S A;  3ECI A;  2KFK B; 
#chains in the Genus database with same CATH topology
 2INP E;  1E0Z A;  1YNT E;  2LFI A;  4K81 A;  1V81 A;  3A33 B;  1FRR A;  2MBQ A;  3PGE A;  2JY6 A;  3VUX A;  3NS1 A;  2BW2 A;  3HVZ A;  2QIL A;  2GBR A;  4UDU C;  3CIR B;  1VD2 A;  1Q0W B;  1V80 A;  1H8C A;  2M4N A;  3K9O B;  3MHS D;  2C7H A;  2K25 A;  2JT4 B;  3TCA A;  3ZNI D;  4HPL B;  2CKH B;  4PS3 A;  1ZDV A;  2BS3 B;  4MJS A;  2L05 A;  3ZDM C;  1L6U A;  3OG5 A;  4YSZ B;  1UH6 A;  1EU4 A;  2A5U A;  1QT9 A;  2BWF A;  2UWQ A;  1IPG A;  2L76 A;  3BYY B;  4MH0 E;  4HPM B;  4RMA A;  3SEB A;  3LJ3 A;  3NJT A;  3PZ7 A;  3UF8 A;  2VH2 A;  4B95 A;  2Y5C A;  1OFF A;  3M3J A;  5JZE B;  1YJ1 A;  3NZU A;  1JWU D;  3AE3 B;  1MG8 A;  2KFJ A;  3IAM 1;  4IOI E;  4HLE A;  1WJN A;  2M56 B;  1YJI A;  1WXQ A;  5HG2 A;  2PJH A;  2K9X A;  2LZ6 A;  1NBF C;  4KDL B;  2RDG A;  2MHJ A;  1N61 A;  1J0G A;  2LRU A;  3EUB 2;  2NBV B;  4BKS A;  1VJK A;  1P98 A;  1QF6 A;  3ETR A;  1F0Z A;  4C7Y A;  4TMA B;  3V60 A;  3N9Y C;  4MT5 A;  4XDC A;  1QLB B;  3VVW B;  1JRO A;  2YLM A;  4YXD B;  1E9M A;  3L17 A;  1I4G A;  2Z8L A;  2Y5P A;  3A9K A;  3AE7 B;  1SJE D;  4USA A;  3ZTC A;  3AE5 B;  1KLV A;  2FCQ A;  1T3Q A;  5LXH A;  4OVU A;  3PRZ A;  1ESF A;  3C0R B;  3OAW A;  3W5V B;  1WM2 A;  3T3N A;  2QSD A;  1SBB B;  2G1E A;  3AB5 A;  1N62 A;  1K53 A;  1XXG A;  3HRD D;  3AEC B;  3CF6 E;  3QX1 A;  2KC1 A;  2KC2 A;  2WX1 A;  4K7S A;  3X23 A;  4AJW A;  3ZYY X;  2LGI A;  1RFA A;  2WQY B;  1R4M B;  2IY0 B;  2KDM A;  3PV1 A;  2K6Q A;  1XD3 B;  3B0A A;  2PTL A;  3B9J A;  5FK9 C;  1OQQ A;  5EDS A;  2V3N A;  2N9P C;  2WXF A;  3TMP B;  1PGX A;  3WAP A;  1TKE A;  3U30 A;  1IP9 A;  2DEN B;  1WGK A;  1Y8R C;  1I7H A;  1AN8 A;  4WQM A;  3JW0 X;  2WDR B;  1I35 A;  2PVG C;  3IBE A;  5CHF A;  2PKO A;  4C00 A;  3ABV B;  3DDC B;  1MPE A;  4ZOH C;  1TKG A;  2IND C;  4ACF A;  4ZRI A;  3P4S B;  1YOV B;  2JF5 A;  2XNA C;  3IAS 1;  3PRP B;  4HEA 1;  3WCQ A;  3H7P A;  2R2Q A;  1G6J A;  2BYE A;  3AXC A;  4MSQ B;  3AV8 A;  2N1V A;  4KSK C;  4MJS B;  2RDH A;  3W1Y A;  1YX5 B;  1E90 A;  1BT0 A;  2PE9 A;  2CHW A;  3DOW A;  2JYE A;  2MP2 A;  2KTR A;  2WXN A;  4XDD A;  3KUD B;  2RPV A;  2CU3 A;  3ZJV A;  3AN1 A;  4E74 A;  2NR2 A;  1WXM A;  2WGS A;  4FHK A;  2KDI A;  1OQY A;  1WMH A;  2N9X A;  1VZ6 A;  2N9E B;  1XQQ A;  2REX A;  4DHJ B;  3TIX A;  2JUO A;  2L83 A;  3PT2 B;  3PPA A;  5D6J B;  2IGD A;  2Y5B B;  1L7Y A;  4O1N A;  3I57 A;  4EUT A;  1UWX A;  1I4X A;  3RMK C;  1UD7 A;  3P4R B;  4LNI A;  4ZDV A;  3ZGZ A;  3KW5 B;  2AQ3 B;  4MSM B;  3BK1 A;  4MM3 A;  5E6J A;  5AUK A;  1PUT A;  1YQB A;  1C4P A;  1LFD A;  4R3D A;  1TGZ B;  2MJE A;  1V8C A;  5D7G A;  2OJW A;  1WGY A;  3V05 A;  3DBS A;  2BKR B;  4IM2 A;  4MEL A;  2PE6 B;  1NI2 A;  3UIP B;  2LJ5 A;  1K51 A;  4OHJ A;  4YWG G;  1OEY A;  3AU4 A;  4G0N B;  4W9J A;  2LGY A;  4GOC A;  1I4H A;  3A1Q A;  2KMA A;  5D2M B;  3GE3 C;  4PS8 A;  1T0S C;  5CX3 A;  2PLP A;  2KLG A;  4TQ0 A;  1QOB A;  1UUP A;  1F2R I;  4PT5 A;  1GOZ A;  1KJT A;  3FIL A;  5JHB A;  4IM3 A;  4HWI B;  4C80 A;  4LCD E;  2LMC A;  2NS5 A;  1UNS A;  2Y3A A;  3NVW A;  4WUR A;  4ZRP A;  3Q8C A;  1NYR A;  1PQS A;  2N0S B;  3UQB A;  3VH4 B;  1KF6 B;  1WZ0 A;  2DHZ A;  2PIA A;  3ZDT A;  3Q3F A;  1H4R A;  3RNA C;  2K3U A;  4BAX A;  3HUI A;  3A9K B;  3H7S A;  1NEK B;  1RFK A;  4HXD A;  1VRA B;  2D11 A;  3BIN A;  3MC8 A;  2MBO A;  1HA5 A;  2WXO A;  3OJ3 A;  4BOZ B;  2L0T A;  3IVF A;  3DHI C;  3N1Z C;  1EO6 A;  2FIF A;  5D3D A;  4L1B A;  3UIO B;  2UU7 A;  5G5H A;  1ZUD 2;  4A3P A;  1L0V B;  4MH8 A;  1I4R A;  1NYQ A;  3ENE A;  3VTU A;  2PEA A;  3RFZ B;  4XE0 A;  3U7Z A;  2WLB A;  2AL3 A;  3RYT A;  2QCZ A;  4YSY B;  1XF5 L;  3EFU A;  1JQ4 A;  1WR1 A;  1L0Y B;  4KV2 A;  3ALB A;  2KJ6 A;  3P42 A;  3WAO A;  2INN E;  1FXA A;  2G4D B;  2XN9 C;  3ZXV A;  3T8M A;  2O6V A;  4A8X C;  2D07 B;  1UGJ A;  4NJ6 A;  1JML A;  2INC C;  3NVV A;  1XCQ L;  1VDV A;  4P16 A;  3W1S C;  3ZLZ A;  1YMH E;  2QIE B;  4GDK B;  2MCN B;  1WGH A;  2OED A;  4TSS A;  3M63 B;  5FKA C;  5DPT A;  1A70 A;  1UBQ A;  3DVG X;  2N9L A;  4GDL B;  3IHP C;  2TSS A;  3GE8 C;  4HVB A;  2LJI A;  1MFW A;  3EGR A;  3SFD B;  5EE9 A;  1CK1 A;  3KYC D;  4GU2 A;  4N6E B;  1ET9 A;  2E3T A;  2JZP A;  3NOB A;  1TZ1 A;  2M1M A;  3TEY A;  2KXJ A;  3H7P B;  3KQ4 A;  2L7R A;  1YX6 B;  2YEP B;  1J19 A;  2XEW A;  4P1B C;  1J7C A;  2DZI A;  2V1Y A;  1FIQ A;  3MP9 A;  2B76 B;  2LHE A;  5BMI A;  3BWU D;  2BYF A;  1FPY A;  4KZ0 A;  2IDY A;  4G3X B;  4WAA A;  4DXA B;  4MGK E;  3DHG C;  4A9A A;  4K3C A;  1J8C A;  3HM3 A;  2XK5 A;  5IP4 D;  1JRP A;  3N3K B;  4C4V A;  3PHW B;  4F1S A;  2FE8 A;  4ICV A;  2D10 A;  2QMT A;  1D3Z A;  4H2A A;  4ANX A;  5EE1 A;  2KO3 A;  3OLM D;  3P4Q B;  1SE2 A;  4MM3 B;  3VXW A;  1V5O A;  2SEB D;  5E6P A;  3R2I A;  1L5P A;  5KHO A;  2GRI A;  1RAX A;  4HPP A;  3RUI B;  3E9S A;  1VLB A;  1TS3 A;  1LQB A;  2O6V D;  4NNJ B;  1PFD A;  3PO0 A;  5JH5 C;  2EKE C;  3FKY A;  4RNA A;  2WXI A;  3DVG Y;  3APF A;  2JWU A;  2JSV X;  1T0R C;  2W3R A;  3VRB B;  1RLF A;  2KJR A;  1FD6 A;  4L2Y A;  2MJ3 A;  4A20 A;  3A9J A;  4LNK A;  3Q3J A;  3QQ8 B;  2NMQ A;  4II2 B;  3PZD A;  4M0W A;  2IO3 B;  4IG7 B;  1V1P B;  1WY8 A;  4NY0 A;  3UIN B;  1P7E A;  1WRI A;  1GJZ A;  3V61 A;  2KVR A;  3L08 A;  1GNU A;  1BML C;  1JWM D;  4AQ7 A;  2DWQ A;  1QZE A;  5LLI A;  5J17 A;  1IBX A;  2BB6 A;  2JVC A;  1TT5 B;  3IXS A;  2X8X X;  3Q8E A;  1GB4 A;  1WR6 E;  3BY4 B;  3EC8 A;  2NPT A;  1TY2 A;  3Q8A A;  2EKI A;  1LO5 D;  4RF0 A;  4KIK A;  5T8I A;  2B3A A;  2QHO A;  4KGS A;  5C3J B;  2KQS A;  2L0F A;  2MJD A;  3CWI A;  3MC0 B;  3UGB B;  1WXA A;  2ZNV C;  4OZC A;  1J7A A;  1DOX A;  3I63 C;  2NTS A;  2ZVO A;  4MGY E;  2MH7 A;  3PTF C;  4W9D A;  3NVZ A;  2VRR B;  3HK0 A;  4EFO A;  2OOB B;  1M4V A;  1N60 A;  2LVO A;  1UGM A;  3ZTD A;  2MBE A;  2KDF B;  4ARC A;  1HXY D;  1OGW A;  1JAL A;  2MRP A;  2AX5 A;  3RNF C;  2BGF A;  2GBM A;  1T5X D;  1WJ4 A;  3KWL A;  5FR3 A;  3KWV A;  3R7R A;  3LB8 C;  1SSN A;  2HJ8 A;  2IY1 B;  4RFB A;  3L13 A;  1BUI C;  1ACC A;  4AOF A;  2HDE A;  2GBN A;  2KTF A;  2D3C A;  2LUM A;  4EOY A;  2MBB B;  3VRA B;  1SE9 A;  2BBC A;  2O6V B;  4AWJ A;  2Q5W D;  3HHM A;  2WXG A;  2L00 B;  3KH0 A;  2RSU A;  5BMG A;  1GG3 A;  3EEC A;  2R2O A;  1VR9 A;  3WAL A;  3RZW C;  3H6N A;  1EM7 A;  4E71 A;  2I38 A;  4WWP A;  1F52 A;  1C78 A;  4YTN B;  1GB1 A;  1SIF A;  4AP4 C;  1WYW B;  1UF0 A;  3M95 A;  5JHA A;  2V4I B;  1PGB A;  3QHT A;  3ZNZ B;  1IGC A;  4YTM B;  4JIO U;  2KWC A;  2N1W A;  2D3B A;  4K7W A;  4DBG A;  5BMH A;  1RRB A;  3BVM A;  1Q10 A;  3H8H A;  2HJ1 A;  1ZW7 A;  4HRS A;  4XC2 A;  5MPO A;  2MLB A;  3SR6 A;  2PVO D;  3ZJU A;  3AEF B;  3VAW A;  2X38 A;  1TIF A;  1WX7 A;  1YJJ A;  3ZRF A;  2IPK D;  2KLC A;  4M0W B;  5HFY A;  3L0W B;  2DAJ A;  1E7P B;  4KZC A;  4XWW A;  1IYF A;  3LDZ E;  1GUA B;  2G45 B;  2NTT A;  1FRD A;  2BVC A;  3NHE B;  2KJH B;  1XLO A;  2WXQ A;  4HDO A;  1WGD A;  2RMM A;  2KOX A;  2W54 A;  4NAW B;  2L52 A;  4ITK A;  3AEG B;  3GOE A;  4ZYN A;  3H1U A;  2J42 A;  4II3 B;  2UYZ B;  5DPR A;  3GS2 A;  4DHJ D;  2XBB C;  4PYU A;  2KAJ A;  3ZO5 B;  1ROE A;  3R3M A;  2HTH A;  2LHD A;  1XEE A;  2WXP A;  5G55 A;  5CHW A;  1E8Z A;  3KUZ A;  3SU8 X;  3L10 B;  1DGJ A;  1WSP A;  2ZCB A;  2O2V A;  3JSV B;  2KD0 A;  4IWO A;  1PGA A;  3D32 A;  2JQR B;  2WNM A;  2A4Z A;  2KMC A;  1L0X B;  4GIV A;  3MHZ A;  1SXT A;  1EF5 A;  2BPS A;  2J52 A;  4RF1 A;  2WXL A;  4ANW A;  2VH1 A;  3APD A;  2DZJ A;  3HIZ A;  4N58 A;  3PHX B;  5E6O A;  2DX5 B;  4KSL C;  1WH3 A;  1T6B X;  4B0M A;  3MC9 A;  4W9C A;  4GDL A;  1WX8 A;  1FFV A;  3ZIM A;  2SAK A;  1OQR A;  3M62 B;  2DYB A;  1JWA D;  3QJZ A;  3VTW A;  2W55 A;  2KAN A;  3Q14 C;  3BZD B;  1SGH A;  3EA6 A;  1SE4 A;  2BT6 A;  4HKQ A;  2BYV E;  2FCS A;  1WRD B;  3N1Y C;  2YEP F;  1LGR A;  1F9J A;  1VZ8 A;  3Q69 A;  4ASW C;  1RM6 C;  3AUL A;  3ZVV A;  4IWQ A;  4PK1 A;  1SJH D;  4TUU A;  2L3Z A;  4IDI A;  2G9H D;  3L4P A;  4CO7 A;  4FBJ B;  3TEW A;  4XYC A;  2IBI B;  1D5M C;  1PYW D;  4RM8 A;  3EHV A;  4MGI E;  1QKZ A;  3JYU A;  5FR6 A;  1UEL A;  2BF8 B;  4WJN A;  2AL6 A;  2H89 B;  5BYS A;  2N7J A;  3HM6 X;  3E56 A;  1J7B A;  4MAC A;  2H88 B;  4EZJ A;  1BXT A;  3IFW B;  1MI0 A;  4DHZ B;  3ZXR A;  4E3C A;  1F1H A;  2Z59 B;  3VDZ A;  1HZ6 A;  2KX3 A;  2NBU A;  2WXM A;  3PRM B;  4FXC A;  4DK5 A;  4M02 A;  4JL9 A;  3DBR I;  1I4P A;  1NVI D;  5HKH A;  2QJL A;  1RWS A;  1R4N I;  2KN4 A;  1MHX A;  2LXC A;  2MW5 A;  3DBH B;  2WU5 B;  3AE8 B;  3OJ4 B;  4XWT A;  1C76 A;  3MJ5 A;  3DBR B;  4NQL B;  3BII D;  2KMM A;  2HD5 B;  5EE0 A;  4NAW A;  1I42 A;  4K1R B;  2EMS A;  2RGF A;  3BVG A;  2KDE B;  5HHD G;  3EFC A;  4GMV A;  3ZJT A;  3QWZ B;  2C5L C;  1EUV B;  1P1A A;  1YIW A;  3N1X C;  3ZUN A;  2HE7 A;  3PRE A;  1TBE A;  3Q8F A;  4I6L B;  3UI3 A;  4BVU C;  3QCA A;  3DVN U;  3RNB C;  1Z5S B;  1SF0 A;  1K50 A;  1E8W A;  4A3O A;  5D94 A;  5LNK 1;  2ZCC A;  1EWC A;  2NCN A;  3AEB B;  3PLU A;  4JGH B;  1S3S G;  2WHI A;  3U52 E;  1FNV A;  1D4B A;  2DBY A;  2JRI B;  1WE6 A;  4HCN B;  4BFR A;  2J0J A;  1L2N A;  2ZPY A;  2KHW B;  1V1P A;  3SD5 A;  3X0W A;  2J0M A;  4KVG B;  2AQ1 B;  4RH6 A;  2V3P A;  3C19 A;  1V1O A;  2CJO A;  2ZZP B;  3NG0 A;  5HI1 A;  5G5G A;  2NPT B;  3R8B A;  2BWE S;  4WAF A;  1C4C A;  1YN5 A;  2WXK A;  3SFE B;  4YTP B;  4S0R A;  4G50 A;  4ANU A;  4WJP A;  5GMV A;  3R7Q A;  4JPS A;  2BB5 A;  4G11 A;  1TS4 A;  4CHK A;  3QIJ A;  4FA6 A;  3RT3 B;  2EMT A;  1E10 A;  4LLG M;  3NZS A;  3I5J C;  1IUE A;  4LNF A;  2CHX A;  2ZEQ A;  2LGX A;  4IM0 A;  4MGZ E;  4NAM A;  2ACZ B;  1KTK A;  1KLU D;  5G2N A;  1E5W A;  2K39 A;  4HK2 A;  4AS1 A;  1GC6 A;  2K1F A;  3ZKJ C;  4W9F A;  2GLS A;  2BS2 B;  1WJ6 A;  1FCC C;  3RPF C;  1DYQ A;  4W9E A;  1KFY B;  2KQ7 A;  2FCN A;  3V3X A;  3KYD D;  5TSS A;  2C7M B;  3V6E B;  3ZNG C;  4P7I A;  2RD0 A;  1F2R C;  2I1J A;  3W1S A;  4CQN A;  1N5X A;  2K22 A;  1X1M A;  1SIJ A;  4C7Z A;  2QDF A;  4A55 A;  1WIA A;  2KK8 A;  5J2R A;  3W9C B;  4NJ7 A;  4YL8 A;  1FNW A;  4ANV A;  4TV3 A;  3NVY A;  1K8R B;  3ML8 A;  3BK2 A;  1SE3 A;  4ICU A;  3MFG A;  2FCM A;  3T3O A;  3AE4 B;  4W9K A;  4GGQ A;  5CHV C;  4LDT B;  1KLG D;  1C4A A;  2CR5 A;  3IT6 B;  2AYO B;  2DNF A;  3ZRC A;  1CMX B;  4RGM A;  2IO1 B;  2I1K A;  2KAC A;  3J9C A;  3RUL A;  3DWG C;  1OEY J;  1CZP A;  3MJW A;  1D5X C;  3AMZ A;  2VZK B;  1XLN A;  4IW0 A;  4I6N B;  4C56 C;  3U7D A;  1AYF A;  1WGR A;  1AAR A;  3H9D A;  2MSE D;  3TSS A;  4RGN A;  2M0A A;  2ZNV B;  3P2B A;  3AI5 A;  1QQR A;  2IYD B;  1HTQ A;  2N4F A;  2L8J A;  3BYT B;  4WJO A;  2MA9 B;  4A90 A;  4US8 A;  2MP2 B;  2DZK A;  1MJD A;  2CS4 A;  2AEH A;  1C77 A;  2Z0D B;  1ZP0 B;  4J3O D;  1FFU A;  5JXV A;  4EZL A;  2BKF A;  4KGT A;  2KN5 A;  3VUW A;  2KZR A;  2LGS A;  2G3Q B;  4ZRQ A;  4J6I A;  4WJQ A;  1NI3 A;  2K8B A;  4GLS C;  3RI7 C;  3P63 A;  4W9H A;  4WWM A;  1XO3 A;  1WX9 A;  2LI5 A;  5AZH A;  1GC7 A;  2AWT A;  3VR8 B;  4ZHO A;  1STE A;  2G4S A;  4ZHP A;  3DVN V;  2LVQ A;  2MWS B;  4I6P A;  1C9F A;  2N7D A;  2LUE A;  1HEZ E;  1LM8 B;  4YSX B;  1B9R A;  1GPX A;  3R66 C;  1ZOY B;  5I4D A;  4S17 A;  1NDD A;  2AQ2 B;  3MTN B;  1EF1 A;  3UQA A;  1LXD A;  5KHQ A;  5DPW A;  4P6V F;  2DLB A;  3JSV A;  1JWS D;  2DZM A;  4KDI C;  2JYT A;  1UWM A;  4M8M A;  3ML9 A;  2K8H A;  2ZPN A;  3AE9 B;  3QC8 B;  2K8C A;  3U4E G;  5C1Z A;  2ZVN A;  3L54 A;  2BS4 B;  2D2Q A;  4EEW A;  3L16 A;  1FEH A;  4JQW C;  4LJO B;  4RGT A;  3Q2A C;  4LK0 M;  2VZK D;  3IG3 A;  4ZYS A;  2CHZ A;  3FIL B;  2W82 A;  4IWP A;  4N9F 4;  2KQ4 X;  4ZRJ A;  2N7E A;  4EZK A;  4FAD A;  3WIM A;  1EWY C;  3T9L A;  5D3I B;  4XX5 A;  2JZZ A;  4LNN A;  2OHF A;  4BKT A;  3WAN A;  4LTU A;  3SDL C;  1E8X A;  4NJC A;  2KDB A;  1QOF A;  3APC A;  2FID A;  2EEL A;  2ZJD A;  4W9I A;  2KNB A;  2MQJ A;  5AUI A;  4IC7 B;  1FNU A;  3B2F A;  3N20 C;  3RD2 A;  1FXT B;  3KLS X;  1MHH E;  4PS7 A;  3VHT C;  3DBH I;  1WXV A;  1WYG A;  2JXX A;  2GOW A;  1WFY A;  1ZXH A;  1Y56 A;  1UZX B;  5LXI B;  2KTR B;  4P1C C;  4FJV B;  1ZPS A;  1XLQ A;  3GB1 A;  1TYG B;  1OTR B;  1HTO A;  3RCZ A;  4RM9 A;  4Q2J A;  3ZW3 A;  3AED B;  3CST A;  2M8S A;  1KRH A;  3ECI A;  2KFK B;  2CJN A;  5DCN A;  2C7N B;  2C9W B;  2K6D B;  3PSE B;  4KKI A;  1CJE A;  3Q3O C;  1XLP A;  4GDK A;  3AEA B;  3Q3M C;  2XK5 B;  5H92 C;  1C3T A;  4M01 A;  4GB9 A;  2KT7 A;  1YD8 U;  1YN4 A;  2D5G A;  2M0X A;  2WWZ A;  3CMM B;  5IO9 A;  1NEN B;  4YT0 B;  3VH3 B;  4KX6 B;  1WWT A;  1WE7 A;  3FAH A;  1SEB D;  4WH4 A;  3TL5 A;  1E7V A;  1C79 A;  1WGG A;  3ONS A;  3RNC C;  1KM7 A;  1N5W A;  3W5U B;  1FXI A;  2YVC A;  4MEM A;  4TQ1 A;  1JRU A;  4M8N A;  1FMA D;  4ZRK A;  2I2Y A;  3A1Q B;  4OVZ A;  3Q3N C;  1R7S A;  1TZO A;  2WDQ B;  1TY0 A;  3DPD A;  4BKG A;  2W3S A;  2D3A A;  4WWO A;  4N59 A;  1VZ7 A;  3TJP A;  3URY A;  4KKJ A;  5L95 C;  2FNJ B;  3U8Z A;  2JU6 X;  4BKS D;  4BZA A;  3CSF A;  5EE3 A;  3B1L X;  4DQO C;  3K9P B;  4HCP B;  3ZQ4 A;  3NS8 A;  2V9H A;  3B2G A;  2DYO A;  5CTR C;  2GB1 A;  2M19 A;  4B6W A;  1TS5 A;  2N9K A;  4B0E A;  2D3G A;  3IT4 B;  3QA8 A;  1L4D B;  3WA0 A;  2LGD A;  4C4V B;  4US9 A;  1HQR D;  3C8Y A;  2GMI C;  1SB3 C;  1AWD A;  3QAQ A;  2JZ3 B;  4NPN A;  2IZV B;  1FM0 D;  3A4R A;  4EE2 A;  1JWB D;  1FO4 A;  2KVZ A;  1V6E A;  1E8Y A;  3RNG C;  4IKG A;  1KOT A;  1GAQ B;  1TKY A;  1L4Z B;  2IO2 B;  2NBW B;  2QEJ C;  1ZKH A;  2ASQ A;  1V49 A;  3AM9 A;  4KIK B;  1N63 A;  4REZ A;  1Q5W B;  1WJU A;  4GSW A;  2WXH A;  1T0Q C;  2J53 A;  2WXJ A;  3A9J B;  2IGG A;  3NUH B;  4W9G A;  1F77 A;  1L6V A;  1WI0 A;  3JVZ X;  4DWF A;  1XT9 B;  1PDX A;  3Q6B A;  2JRH A;  1U4A A;  3TEZ A;  4AJY B;  4HDQ A;  4JWS C;  3OWE B;  2RR9 A;  1JCK B;  2J7Q B;  2CU1 A;  1MG4 A;  2ONQ A;  3RNE C;  4BBN C;  4M00 A;  4XGA B;  1S1Q B;  5BYQ A;  2K0P A;  4RGO S;  1XCT L;  2C60 A;  4OZA A;  4MDK E;  4XZ4 A;  5BO4 B;  1CQV A;  4ARI A;  1MVK A;  2Z0E B;  2RDB C;  1KH0 A;  4FJY A;  4WWN A;  5GXG B;  1WM3 A;  4PYZ A;  1Q1O A;  2GI9 A;  1AW7 A;  2NVU I;  1V5T A;  4K3B A;  4F7Z A;  1A5R A;  1ZXI A;  2WXR A;  1V2Y A;  2RPQ A;  1B1Z A;  3P1M A;  4KGR A;  3V6C B;  2KX0 A;  5DPS A;  3TUO A;  3TEX A;  2PMV A;  3A4S C;  2HTM E;  4JLC A;  2ICI A;  3AH7 A;  4IUM B;  3DQV A;  5C2T B;  1M94 A;  2WYQ A;  2J0K A;  4WIP A;  1E6E B;  4A6Q A;  2GBJ A;  1P3Q U;  1RYJ A;  1HE8 A;  3FC4 A;  1ET6 A;  2OJR A;  1V86 A;  3B08 A;  4FN2 A;  3VTV A;  1TTN A;  1JW9 D;  2L1A A;  1N6Z A;  2LWP A;  3I3T B;  1HZ5 A;  3SHQ A;  1WZ3 A;  3R2T A;  4GXB A;  4QAY A;  3PVL A;  3S2A A;  1R4M I;  5TR5 A;  5L83 A;  2DAF A;  2FAZ A;  3DBL I;  1QIL A;  3Q8B A;  4NZL B;  2LAS A;  3RN9 C;  2ON8 A;  3RZF A;  5BYR A;  1R4N B;  1K52 A;  1ZGU B;  2WDV B;  1DOY A;  1WMH B;  2V4L A;  3TBL D;  5H8Y E;  2JXT A;  1YQ4 B;  3VQI A;  2ZW0 A;  3LXF A;  1YN3 A;  4LNO A;  2V3S A;  1P7F A;  4OZB A;  3N32 A;  4OVV A;  3W2D A;  5AEK B;  1QOG A;  3U2S C;  4D2K A;  1V97 A;  3AEE B;  5E6N A;  5AZG A;  1IGD A;  2MEK A;  3LYY A;  1ZE3 D;  4TKN A;  1WXS A;  4B9K A;  3PZ8 A;  4WQO B;  2O2V B;  2BTE A;  5IOI A;  2FUG 1;  2QC8 A;  2IO0 B;  4DHZ E;  2K5P A;  3DCG A;  2BQQ A;  2IJ0 A;  4NQK E;  1V9J A;  1VCB A;  2DYM A;  4DDI D;  3AE2 B;  3QAR A;  3NY5 A;  3DHH C;  2WX0 A;  4FUL A;  1YQ3 B;  5C23 A;  2JX5 A;  3VR9 B;  3HVD A;  1D5Z C;  2KWV B;  5J18 A;  3GZN I;  4F8C B;  3BVZ A;  2LD9 A;  3DBL B;  4OW0 A;  2KKC A;  1P9D U;  3KVF B;  1TS2 A;  2LXA A;  2WU2 B;  1IBX B;  4K7U A;  4HKZ E;  2V0G A;  3O65 B;  4FLH A;  2KWD A;  4DXG A;  2IGH A;  2WP9 B;  3KUC B;  4GN1 A;  3O13 A;  2MX2 A;  3VFK A;  2L32 A;  1QOA A;  1ZDX A;  2JPH A;  2KYW A;  5IKC M;  2ZW1 A;  3WAM A;  3V62 A;  3AU5 A;  5IA7 A;  4LDT D;  1P0R A;  4DXF A;  1ENF A;  3DWM A;  1FCL A;  2GBK A;  2KWU B;  1TJE A;  3P4P B;  3AE1 B;  4HJK A;  3N30 A;  2R61 A;  2LEK A;  4FJZ A;  4DDG D;  2BYT A;  3VUY A;  3NZ3 A;  1D6E C;  2WDT B;  2LRW A;  2LVP A;  2E6X A;  4L23 A;  1Z2M A;  1T0Y A;  3GP7 A;  4AUQ C;  1I4Q A;  3NRZ A;  4JX1 C;  2FUH B;  4CYE A;  3PLV A;  3PS6 A;  1E7U A;  5IAA C;  4BOS C;  4JE3 B;  3AE6 B;  2KFK A;  4FHJ A;  4X57 B;  5AZF A;  4JWU C;  4RCO A;  1C1Y B;  3I9V 1;  3GZN B;  4HRO A;  3QK0 A;  1UBI A;  4BBN F;  4W9L A;  2FBW B;  4HJG E;  1EU3 A;  2MBH A;  2JWZ A;  1DOI A;  2PW9 A;  4URK A;  4LJP B;  4EKU A;  2M17 A;  2W9N A;  2J4X A;  2PPH A;  1ISN A;  2WS3 B;  5IN7 A;  3ZNH B;  1WF9 A; 
#chains in the Genus database with same CATH homology
 5FR6 A;  1UEL A;  4HVB A;  5DCN A;  4K81 A;  1V81 A;  2BF8 B;  2C7N B;  3A33 B;  2C9W B;  2K6D B;  2MBQ A;  3PGE A;  3PSE B;  3KYC D;  4GU2 A;  4WJN A;  2JY6 A;  3VUX A;  2AL6 A;  4GDK A;  2GBR A;  3NOB A;  2XK5 B;  3HM6 X;  1TZ1 A;  1Q0W B;  1V80 A;  1VD2 A;  1C3T A;  2M1M A;  4GB9 A;  1H8C A;  4EZJ A;  2KXJ A;  3IFW B;  2M4N A;  3K9O B;  1YD8 U;  3H7P B;  3MHS D;  3JYU A;  2C7H A;  2K25 A;  4DHZ B;  2JT4 B;  2L7R A;  2M0X A;  2WWZ A;  3CMM B;  3TCA A;  4E3C A;  3ZNI D;  4HPL B;  2CKH B;  2Z59 B;  4PS3 A;  1YX6 B;  3VDZ A;  2KX3 A;  2NBU A;  3VH3 B;  4MJS A;  2L05 A;  3ZDM C;  1J19 A;  2XEW A;  1WE7 A;  2DZI A;  1UH6 A;  2V1Y A;  3PRM B;  4DK5 A;  2A5U A;  3TL5 A;  1E7V A;  1WGG A;  2BWF A;  3ONS A;  4JL9 A;  2UWQ A;  1IPG A;  2L76 A;  1KM7 A;  3DBR I;  2YVC A;  4MH0 E;  4MEM A;  5HKH A;  2BYF A;  4TQ1 A;  4KZ0 A;  1JRU A;  4HPM B;  4M8N A;  4RMA A;  1R4N I;  2LXC A;  2MW5 A;  3LJ3 A;  4G3X B;  3ZNH B;  4WAA A;  3OJ4 B;  4DXA B;  3UF8 A;  4MGK E;  4ZRK A;  3A1Q B;  4B95 A;  1J8C A;  4NQL B;  3HM3 A;  2XK5 A;  3M3J A;  2HD5 B;  4NAW A;  3N3K B;  1I42 A;  4K1R B;  3PHW B;  4F1S A;  4ICV A;  2EMS A;  2D10 A;  3DPD A;  1D3Z A;  2RGF A;  4BKG A;  4ANX A;  5JZE B;  2KDE B;  2KO3 A;  1YJ1 A;  3NZU A;  4WWO A;  3OLM D;  1MG8 A;  3VXW A;  3TJP A;  2KFJ A;  1V5O A;  5E6P A;  4GMV A;  4HLE A;  5L95 C;  2FNJ B;  3U8Z A;  1WJN A;  2C5L C;  1EUV B;  3QWZ B;  4BKS D;  5KHO A;  1P1A A;  1YIW A;  3CSF A;  3ZUN A;  2HE7 A;  3B1L X;  3K9P B;  2PJH A;  3PRE A;  1TBE A;  4HCP B;  1RAX A;  4I6L B;  4BVU C;  3NS8 A;  3QCA A;  3DVN U;  2LZ6 A;  1NBF C;  4KDL B;  3RUI B;  2DYO A;  5CTR C;  1J0G A;  2LRU A;  4BKS A;  1LQB A;  2NBV B;  1Z5S B;  1E8W A;  4A3O A;  5D94 A;  4B6W A;  1P98 A;  2O6V D;  4NNJ B;  2ZCC A;  5JH5 C;  2D3G A;  2NCN A;  2EKE C;  3PLU A;  4JGH B;  1S3S G;  3V60 A;  3QA8 A;  3VVW B;  2JRI B;  1WE6 A;  3DVG Y;  2LGD A;  4HCN B;  3WA0 A;  3APF A;  4BFR A;  2J0J A;  2YLM A;  1L2N A;  2ZPY A;  2KHW B;  3L17 A;  3SD5 A;  3A9K A;  3X0W A;  1RLF A;  2J0M A;  2KJR A;  3ZTC A;  1KLV A;  2FCQ A;  4KVG B;  5LXH A;  4OVU A;  2GMI C;  3QAQ A;  2JZ3 B;  3PRZ A;  4A20 A;  3A9J A;  3C0R B;  4NPN A;  3OAW A;  1WM2 A;  3Q3J A;  2IZV B;  2ZZP B;  3A4R A;  3QQ8 B;  2NPT B;  4II2 B;  3PZD A;  2BWE S;  2IO3 B;  4IG7 B;  1WY8 A;  4NY0 A;  3UIN B;  3CF6 E;  3QX1 A;  2KC1 A;  4G50 A;  1V6E A;  2KC2 A;  1E8Y A;  4ANU A;  2WX1 A;  4K7S A;  4WJP A;  5GMV A;  3X23 A;  3R7Q A;  4AJW A;  1KOT A;  1GJZ A;  3V61 A;  1RFA A;  2KVR A;  2IO2 B;  3L08 A;  1GNU A;  2IY0 B;  2NBW B;  3PV1 A;  2K6Q A;  1XD3 B;  3B0A A;  1ZKH A;  2ASQ A;  4G11 A;  1V49 A;  4CHK A;  3QIJ A;  4KIK B;  3RT3 B;  2EMT A;  4FA6 A;  5EDS A;  1QZE A;  1Q5W B;  1WJU A;  2N9P C;  2CHX A;  3NZS A;  4GSW A;  5LLI A;  3TMP B;  5J17 A;  2ZEQ A;  2LGX A;  4IM0 A;  4MGZ E;  5G2N A;  2JVC A;  3WAP A;  1E5W A;  2K39 A;  4HK2 A;  3A9J B;  4W9G A;  1GC6 A;  3U30 A;  1IP9 A;  2DEN B;  1WR6 E;  2K1F A;  3ZKJ C;  3BY4 B;  3EC8 A;  2NPT A;  1Y8R C;  4W9F A;  1WJ6 A;  4KIK A;  2B3A A;  2QHO A;  4W9E A;  2KQ7 A;  3JW0 X;  2FCN A;  1WI0 A;  3KYD D;  1I35 A;  2C7M B;  2KQS A;  2L0F A;  3JVZ X;  3V6E B;  3ZNG C;  1XT9 B;  4DWF A;  2JRH A;  1U4A A;  3IBE A;  4P7I A;  2RD0 A;  2I1J A;  5CHF A;  3W1S A;  4AJY B;  4HDQ A;  3DDC B;  3UGB B;  1WXA A;  2RR9 A;  4ZRI A;  2ZNV C;  2J7Q B;  1X1M A;  2CU1 A;  2ZVO A;  4MGY E;  3PTF C;  4BBN C;  1WIA A;  2JF5 A;  4W9D A;  2KK8 A;  1S1Q B;  2VRR B;  3HK0 A;  3PRP B;  4EFO A;  2OOB B;  5J2R A;  2LVO A;  2C60 A;  1UGM A;  2R2Q A;  3H7P A;  4XZ4 A;  4MDK E;  4NJ7 A;  4YL8 A;  5BO4 B;  2MBE A;  3ZTD A;  4ANV A;  1G6J A;  4TV3 A;  2BYE A;  2KDF B;  3AXC A;  1K8R B;  2Z0E B;  3ML8 A;  4FJY A;  4MSQ B;  4ICU A;  2N1V A;  4KSK C;  4MJS B;  1OGW A;  4WWN A;  2FCM A;  3W1Y A;  1WM3 A;  4PYZ A;  2MRP A;  1Q1O A;  1E90 A;  1YX5 B;  1BT0 A;  2PE9 A;  4W9K A;  4GGQ A;  2CHW A;  2NVU I;  5CHV C;  1V5T A;  3DOW A;  2BGF A;  2GBM A;  2MP2 A;  4F7Z A;  1WJ4 A;  4LDT B;  1A5R A;  2CR5 A;  2AYO B;  2KTR A;  3KUD B;  3R7R A;  1V2Y A;  2RPQ A;  3ZRC A;  2HJ8 A;  1CMX B;  4E74 A;  2IY1 B;  2NR2 A;  1WXM A;  3L13 A;  4FHK A;  3V6C B;  2IO1 B;  2I1K A;  2KX0 A;  2GBN A;  2KTF A;  5DPS A;  3RUL A;  2KDI A;  1OQY A;  1WMH A;  2N9X A;  4EOY A;  1OEY J;  3A4S C;  3MJW A;  4JLC A;  4IUM B;  2MBB B;  2N9E B;  1XQQ A;  3DQV A;  1M94 A;  1SE9 A;  2O6V B;  2WYQ A;  4AWJ A;  2REX A;  2J0K A;  4IW0 A;  4I6N B;  3HHM A;  4DHJ B;  2L00 B;  3U7D A;  3TIX A;  3KH0 A;  2JUO A;  2GBJ A;  1WGR A;  1AAR A;  1P3Q U;  2RSU A;  3H9D A;  1HE8 A;  2MSE D;  2OJR A;  3PT2 B;  1GG3 A;  3PPA A;  3EEC A;  1V86 A;  2R2O A;  2ZNV B;  3B08 A;  5D6J B;  3WAL A;  3P2B A;  4FN2 A;  3RZW C;  3VTV A;  3AI5 A;  1TTN A;  3H6N A;  2IYD B;  1L7Y A;  2Y5B B;  4WWP A;  4E71 A;  4EUT A;  2LWP A;  3I3T B;  3SHQ A;  1WZ3 A;  2N4F A;  4GXB A;  2L8J A;  1UD7 A;  4WJO A;  3PVL A;  3S2A A;  1R4M I;  2MA9 B;  4ZDV A;  2MP2 B;  5TR5 A;  1SIF A;  3KW5 B;  5L83 A;  4AP4 C;  2DAF A;  2FAZ A;  3DBL I;  1WYW B;  3M95 A;  4MSM B;  2DZK A;  2LAS A;  5JHA A;  4MM3 A;  3RZF A;  3QHT A;  3ZNZ B;  2CS4 A;  4JIO U;  2KWC A;  1ZGU B;  2AEH A;  1YQB A;  2Z0D B;  1WMH B;  2V4L A;  3TBL D;  2N1W A;  1LFD A;  4EZL A;  1TGZ B;  2BKF A;  2KN5 A;  4K7W A;  3VQI A;  3VUW A;  5D7G A;  1WGY A;  4DBG A;  2KZR A;  3DBS A;  2BKR B;  1RRB A;  2G3Q B;  1ZW7 A;  2V3S A;  4J6I A;  4IM2 A;  4MEL A;  2PE6 B;  1NI2 A;  4WJQ A;  3N32 A;  4OVV A;  4XC2 A;  3UIP B;  2LJ5 A;  5AEK B;  2MLB A;  2K8B A;  1OEY A;  3AU4 A;  4G0N B;  5E6N A;  4W9H A;  4MGI E;  4W9J A;  5AZG A;  3VAW A;  2LGY A;  4GOC A;  3A1Q A;  1WX9 A;  2LI5 A;  5AZH A;  1WX7 A;  1GC7 A;  2KMA A;  3ZRF A;  2AWT A;  2KLC A;  4M0W B;  2G4S A;  4TKN A;  5D2M B;  1WXS A;  3DVN V;  3L0W B;  2DAJ A;  4PS8 A;  2LVQ A;  4B9K A;  2MWS B;  4I6P A;  5CX3 A;  4WQO B;  2KLG A;  4KZC A;  1IYF A;  4TQ0 A;  2N7D A;  2O2V B;  3LDZ E;  1GUA B;  2G45 B;  2LUE A;  2IO0 B;  1LM8 B;  4DHZ E;  3NHE B;  2KJH B;  1KJT A;  3DCG A;  3R66 C;  4HDO A;  1WGD A;  1NDD A;  5JHB A;  2KOX A;  3MTN B;  4IM3 A;  1EF1 A;  4HWI B;  4NAW B;  4NQK E;  1V9J A;  1VCB A;  2DYM A;  4LCD E;  1LXD A;  4DDI D;  5KHQ A;  3UQA A;  2NS5 A;  3QAR A;  5DPW A;  3NY5 A;  3GOE A;  2WX0 A;  4FUL A;  4ZYN A;  1PQS A;  3JSV A;  2DZM A;  5C23 A;  3UQB A;  4KDI C;  3VH4 B;  3H1U A;  2KWV B;  4II3 B;  1WZ0 A;  2UYZ B;  5DPR A;  2DHZ A;  4M8M A;  3ML9 A;  5J18 A;  2K8H A;  3GZN I;  2ZPN A;  4DHJ D;  4F8C B;  2XBB C;  4PYU A;  3ZO5 B;  2LD9 A;  3R3M A;  2KKC A;  3QC8 B;  2HTH A;  1P9D U;  2K8C A;  3ZDT A;  3KVF B;  5G55 A;  5C1Z A;  2ZVN A;  5CHW A;  3Q3F A;  1E8Z A;  1H4R A;  2LXA A;  3KUZ A;  3SU8 X;  3L54 A;  4K7U A;  3L10 B;  3A9K B;  3H7S A;  2D2Q A;  2ZCB A;  3O65 B;  4EEW A;  3L16 A;  4FLH A;  2O2V A;  3JSV B;  2KD0 A;  4HXD A;  2D11 A;  4JQW C;  4LJO B;  4IWO A;  3KUC B;  4GN1 A;  3BIN A;  3D32 A;  3IG3 A;  2MX2 A;  3VFK A;  2CHZ A;  2MBO A;  4IWP A;  4N9F 4;  2JPH A;  2A4Z A;  2KMC A;  3WAM A;  4ZRJ A;  3V62 A;  2N7E A;  3OJ3 A;  4EZK A;  4FAD A;  4GIV A;  4BOZ B;  2L0T A;  3WIM A;  3IVF A;  3T9L A;  3AU5 A;  4XX5 A;  1EO6 A;  1EF5 A;  2BPS A;  2JZZ A;  5IA7 A;  4BKT A;  4LDT D;  1P0R A;  2FIF A;  3WAN A;  3SDL C;  3UIO B;  1WF9 A;  4A3P A;  1E8X A;  4ANW A;  3APD A;  2DZJ A;  3HIZ A;  2GBK A;  2KWU B;  3ENE A;  3PHX B;  5E6O A;  2DX5 B;  2KDB A;  4KSL C;  1WH3 A;  3VTU A;  4HJK A;  4AOF A;  2PEA A;  3N30 A;  4W9C A;  3APC A;  2FID A;  4FJZ A;  4GDL A;  1WX8 A;  4DDG D;  2AL3 A;  3RYT A;  3VUY A;  2ZJD A;  4W9I A;  3ZIM A;  2KNB A;  2MQJ A;  4IC7 B;  3EFU A;  3M62 B;  2WDT B;  2DYB A;  3RD2 A;  2LRW A;  2LVP A;  1WR1 A;  1FXT B;  3QJZ A;  1Z2M A;  3VTW A;  1T0Y A;  4KV2 A;  4AUQ C;  3ALB A;  2KJ6 A;  3WAO A;  4PS7 A;  2KAN A;  4CYE A;  2FUH B;  3DBH I;  1WXV A;  3VHT C;  3PLV A;  3PS6 A;  2G4D B;  1SGH A;  2JXX A;  2GOW A;  1E7U A;  1WFY A;  2O6V A;  5IAA C;  3T8M A;  4BOS C;  2D07 B;  1UZX B;  2BYV E;  2FCS A;  5LXI B;  2KFK A;  1WRD B;  4NJ6 A;  2KTR B;  4FHJ A;  4X57 B;  4FJV B;  1F9J A;  5AZF A;  4ASW C;  1C1Y B;  1OTR B;  3AUL A;  3QK0 A;  3W1S C;  1UBI A;  3ZVV A;  3ZLZ A;  4W9L A;  4IWQ A;  4BBN F;  4GDK B;  2MCN B;  2MBH A;  2JWZ A;  1WGH A;  4TUU A;  4RM9 A;  2L3Z A;  3RCZ A;  4CO7 A;  4LJP B;  4EKU A;  4FBJ B;  3M63 B;  4URK A;  5DPT A;  2M17 A;  1UBQ A;  2W9N A;  2PPH A;  1ISN A;  3DVG X;  3ZW3 A;  2IBI B;  4RM8 A;  4GDL B;  3EHV A;  3IHP C;  3CST A;  2M8S A;  3ECI A;  2KFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...