4PYZA

Crystal structure of the first two ubl domains of deubiquitylase usp7
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
LVPRGSPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title Crystal structure of the first two Ubl domains of Deubiquitylase USP7
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4pyzA02
4FJVB 2ZVOA 2R2OA 1P3QU 4WAAA 4W9CA 1ISNA 2Z59B 5FR6A 3T8MA 3VVWB 4W9EA 2NR2A 1V86A 4II3B 1TZ1A 2D2QA 5JZEB 5D7GA 3VQIA 2LZ6A 4NY0A 3B1LX 3SU8X 1P98A 3KUZA 3GZNI 2MBBB 3PPAA 1WGGA 4MM3A 5AZHA 2FIFA 2JXXA 1WR6E 4PS8A 3PGEA 3H7PB 4CYEA 3VUWA 4IUMB 5CHFA 1AARA 1WGYA 3R66C 3KW5B 4F7ZA 2L8JA 2IZVB 3IG3A 3NZUA 3PRMB 3U8ZA 4AJWA 3TJPA 1Z5SB 3QJZA 3IFWB 3QARA 2OJRA 4K7WA 4MJSB 2DYOA 4K7SA 4ZDVA 3B0AA 3DPDA 1WJNA 2UWQA 3WALA 4IWOA 1TTNA 4GB9A 4HPLB 3VXWA 1R4NI 4GU2A 3R3MA 1V49A 3QCAA 1TGZB 3UINB 5LLIA 1WGRA 4LCDE 4LJPB 2REXA 4IM0A 3TMPB 3ZDMC 4E71A 4HXDA 2PE6B 4GDLB 4MGZE 3JSVA 4JGHB 4N9F4 1KLVA 1WYWB 2R2QA 3APFA 2K6DB 2KD0A 2RSUA 3H9DA 4KSKC 1WGDA 4BBNC 2I1KA 4DHZE 4FBJB 2KJ6A 3RYTA 3L10B 3ZIMA 1IYFA 2L00B 1SIFA 1H4RA 3A9KB 1JRUA 3ZVVA 1LXDA 2ZNVC 2KDEB 2DZKA 3H7PA 5C1ZA 3VH3B 2RD0A 1ZW7A 2LRWA 3X23A 3CF6E 1V5OA 1YQBA 5TR5A 4OVUA 2JT4B 4RM8A 2C7NB 1NI2A 2KANA 2M1MA 5EDSA 3N32A 4WJNA 2LD9A 1SGHA 4ANUA 2LI5A 2ZCBA 3ONSA 1YX5B 3MHSD 3ZW3A 4B9KA 3ZNZB 2FUHB 1WMHB 4I6LB 4E74A 2KJHB 5KHOA 5HKHA 2BKFA 2O6VA 2BGFA 2XBBC 4XX5A 2A5UA 3C0RB 3Q3FA 3WA0A 3AI5A 3WAMA 3PS6A 1E8YA 3KUDB 4BOZB 3UIPB 4GDLA 2BWES 5CTRC 5GMVA 1GG3A 3ZNHB 4DDID 5AZFA 2KWVB 3NZSA 1UH6A 2PPHA 3LJ3A 1V80A 1WJ4A 3W1SC 3ZDTA 3GOEA 1SE9A 2YLMA 3APDA 4JQWC 3RZWC 5JH5C 2WWZA 2KX0A 3UQBA 2ZPNA 2MX2A 3BINA 1UGMA 4DDGD 1E5WA 3DVNU 4AP4C 4AUQC 2MWSB 3VFKA 2KWCA 2CHWA 4MSQB 4W9FA 4PYZA 3DBRI 1WZ0A 2ZNVB 2MBQA 3QK0A 4BVUC 1YIWA 3KVFB 4K81A 2NCNA 4LJOB 2DZJA 4MGKE 3SDLC 3PREA 4ASWC 4NJ6A 1WFYA 3M3JA 4W9GA 4AWJA 1YD8U 2GBKA 4HPMB 2KTRA 3L0WB 3MTNB 4WQOB 2FIDA 2V4LA 4ZRJA 1Q5WB 1WE6A 1NBFC 2K39A 4AOFA 5DPTA 3A33B 3VUXA 3WANA 3TBLD 4URKA 1J8CA 4MSMB 2DZMA 2KK8A 4HLEA 4DHJD 3PZDA 5J17A 2AWTA 2ZJDA 4XZ4A 4IM3A 2RGFA 4MH0E 3ZNID 3L13A 4MELA 2K25A 3I3TB 3JSVB 4EEWA 2ZZPB 1OQYA 2M17A 2LGYA 2LVQA 1RAXA 2N4FA 3AU5A 3VAWA 4P7IA 2NBVB 3HIZA 3JW0X 4M8NA 1S1QB 3NY5A 2C9WB 1FXTB 5IA7A 3EECA 3EFUA 1WM3A 3H7SA 1OEYJ 4HJKA 3V6EB 4GGQA 3UF8A 2A4ZA 1V9JA 3QQ8B 4NAWB 3X0WA 3HHMA 3A9JB 4TKNA 2KFKB 4HK2A 3IVFA 4W9KA 3L17A 2YVCA 2FCSA 4EZLA 2FNJB 2LGXA 4HCNB 4IG7B 2FCMA 2L0FA 3L54A 1WJUA 3A1QB 2L3ZA 2B3AA 2DAJA 2KVRA 4MGYE 2KQ7A 1A5RA 4GDKA 4FA6A 1KOTA 3QC8B 4FADA 5DCNA 3WIMA 4FJZA 1UBQA 1P1AA 2LXAA 1WX7A 1WZ3A 4M0WB 4JLCA 4GSWA 2GBMA 3TIXA 2O6VB 4LDTD 1OTRB 1WIAA 1L2NA 2K6QA 4KDLB 3HM6X 2D11A 2M4NA 5LXIB 4WWNA 1Q1OA 2MBEA 2ZEQA 1VD2A 4G50A 2RPQA 3JYUA 3W1YA 1E8ZA 1WXVA 3HM3A 4PS3A 4B6WA 4TQ0A 4EZJA 1GC7A 3S2AA 3W1SA 4EOYA 1XD3B 2PE9A 2K8CA 1XQQA 4RMAA 4X57B 1GJZA 4BKGA 4WWPA 3VH4B 2N1WA 3KYCD 4GIVA 3QX1A 2WX0A 3EC8A 3NOBA 2KTFA 1RRBA 2KMAA 4HDQA 5DPWA 4NAWA 5J2RA 2KMCA 2IBIB 3DVNV 3A9JA 2L0TA 2N7EA 1WH3A 2KFKA 4NNJB 5D94A 2NBUA 2LXCA 5C23A 3WAOA 1WX9A 4W9IA 4TUUA 3PSEB 3DBHI 4G11A 3CSFA 3DVGX 4FJYA 4RM9A 2KTRB 3A1QA 3NS8A 5CX3A 2XK5A 4KVGB 1RLFA 2W9NA 3DVGY 2KKCA 3M95A 4NJ7A 2GBNA 1WF9A 2IY1B 3UGBB 4B95A 2FCQA 2G3QB 1RFAA 1UD7A 2JWZA 3D32A 4TQ1A 5E6PA 1OEYA 4HWIB 2JZZA 3DBSA 3ZRCA 2BYEA 1E7UA 1V2YA 2DYMA 5IAAC 5LXHA 3DBLI 3V60A 4I6NB 3DDCB 3R7RA 4DK5A 4W9HA 1OGWA 2KWUB 3M63B 2AL3A 4PYUA 3ZTCA 3O65B 4BFRA 2KNBA 4E3CA 2ZPYA 4KV2A 2G4SA 3RT3B 3ZKJC 3ZRFA 2KX3A 1T0YA 4BKSD 2HE7A 2D10A 2J7QB 2MP2A 5L83A 4ZRIA 3VTWA 4FLHA 2K8BA 3A4RA 2V3SA 1QZEA 2C60A 2JVCA 3VDZA 4IM2A 4NQKE 2FAZA 1K8RB 2ZCCA 1E90A 3ENEA 3PLUA 5G2NA 3UQAA 2KJRA 2LWPA 5AZGA 4FULA 2K1FA 3SD5A 1EF1A 3VUYA 2RR9A 4KSLC 2K8HA 4IC7B 4NQLB 2DX5B 1UZXB 3KYDD 1V5TA 3H6NA 4GDKB 2WX1A 3ZLZA 2CHXA 2KHWB 1WY8A 1C1YB 2GOWA 1C3TA 1BT0A 3PLVA 4FHJA 1WI0A 1WM2A 1ZKHA 2KQSA 4A20A 3QWZB 1P9DU 1F9JA 2DAFA 5E6OA 3QA8A 1WE7A 3AXCA 3QAQA 4FHKA 4KDIC 4F1SA 1E8WA 3Q3JA 1WXSA 1CMXB 2IO2B 3PV1A 3VTVA 2MBHA 2KDIA 1GNUA 1WXAA 2AL6A 2BPSA 2Y5BB 4JL9A 3T9LA 4HDOA 3UIOB 3PTFC 2NVUI 3DCGA 2N1VA 2MBOA 1GC6A 2L05A 3MJWA 1U4AA 1IP9A 2UYZB 4MDKE 5DPRA 3V61A 1WGHA 4G0NB 2G45B 2C5LC 3N3KB 1M94A 4GOCA 2KLGA 3APCA 3PHXB 4W9LA 1I42A 2BKRB 5JHAA 2CU1A 3HK0A 2JPHA 1WX8A 2XK5B 3PVLA 2KLCA 3DQVA 4IWQA 5DPSA 1I35A 4W9JA 1WRDB 3R7QA 2G4DB 4F8CB 4EZKA 2AEHA 3PT2B 3VHTC 2BF8B 5CHWA 2MW5A 4M8MA 2N7DA 4YL8A 3BY4B 2O2VA 3VTUA 2CKHB 2IY0B 1PQSA 2JF5A 2NPTB 3N30A 2C7HA 4XC2A 3AU4A 3B08A 2WYQA 1E8XA 2N9PC 2NS5A 2PJHA 3EHVA 4ANXA 2KZRA 1UELA 2GBRA 1EF5A 5AEKB 2KFJA 2EMTA 4ZYNA 2KN5A 4HCPB 3U30A 2JRHA 2KO3A 4PS7A 4DBGA 4EFOA 4KZCA 1WXMA 4CO7A 2MP2B 4CHKA 3RCZA 4K7UA 1J19A 4II2B 2KDFB 1VCBA 1Y8RC 3A4SC 4KIKA 3OJ3A 2MLBA 4GXBA 1P0RA 1ZGUB 4GMVA 2GBJA 1GUAB 2HTHA 2JRIB 2I1JA 5D2MB 1V81A 2LGDA 4WJOA 2QHOA 2HJ8A 2MQJA 2DENB 4IWPA 2MA9B 2M8SA 4EKUA 1KM7A 2BYVE 5D6JB 3ZUNA 2IO1B 2Z0EB 4EUTA 2IYDB 2KDBA 3P2BA 3ZNGC 4AJYB 3CSTA 4ICVA 2AYOB 4MGIE 4IW0A 2N9EB 4DHZB 3DOWA 1UBIA 3ZO5B 4FN2A 4K1RB 2LASA 5JHBA 2NPTA 2KC2A 3KUCB 2LUEA 2OOBB 2Z0DB 3RUIB 3TCAA 3OAWA 5L95C 3QIJA 1EUVB 2CHZA 3V62A 4DHJB 4NPNA 2DZIA 2O6VD 1Z2MA 1TBEA 4WJPA 4WJQA 4MJSA 2EMSA 2LVOA 1XT9B 2JUOA 2MCNB 1D3ZA 4KZ0A 3OLMD 3TL5A 2KOXA 5KHQA 2CR5A 3CMMB 1LM8B 2NBWB 3PHWB 1YJ1A 2FCNA 2DYBA 2L76A 4A3PA 3RZFA 1Q0WB 2J0KA 2CS4A 5E6NA 3SHQA 3ALBA 3ML8A 1IPGA 4BKSA 2JZ3B 2KXJA 1V6EA 2D3GA 3ZTDA 2EKEC 4ZRKA 4BKTA 4DXAB 3PRPB 5J18A 5CHVC 1NDDA 2KC1A 3RULA 4ANVA 2ZVNA 2IO3B 3OJ4B 2ASQA 1LQBA 4J6IA 3JVZX 1J0GA 3K9PB 1YX6B 3U7DA 1EO6A 2BWFA 2L7RA 4TV3A 2C7MB 2PEAA 4OVVA 2IO0B 3A9KA 2M0XA 3L08A 4JIOU 4DWFA 4MEMA 4A3OA 3H1UA 2O2VB 3QHTA 2XEWA 3RD2A 4HVBA 2LRUA 3IHPC 4BOSC 2LVPA 3WAPA 2GMIC 3NHEB 5G55A 1MG8A 3ECIA 3IBEA 2JY6A 3V6CB 4WWOA 2MSED 1KJTA 4ANWA 2D07B 4LDTB 4G3XB 1LFDA 3M62B 2V1YA 5BO4B 2WDTB 1E7VA 2N9XA 1X1MA 4ICUA 4I6PA 3L16A 3ML9A 4W9DA 2BYFA 1G6JA 3PRZA 1WR1A 4GN1A 4BBNF 2HD5B 2J0JA 1L7YA 1WJ6A 1WMHA 2DHZA 3AULA 1R4MI 1S3SG 2LJ5A 3K9OB 4KIKB 3KH0A 1H8CA 2J0MA 2MRPA 1HE8A 2VRRB 3LDZE
chains in the Genus database with same CATH superfamily
1E10A 2R2OA 4HJGE 1ISNA 5IN7A 5H92C 4W9EA 1TZ1A 2D2QA 4NY0A 4WAFA 3SU8X 1ZPSA 5AZHA 3R2IA 5I4DA 3H7PB 1N5XA 1N6ZA 3VUWA 1AARA 3AE6B 1WGYA 3AM9A 4F7ZA 2BBCA 2L8JA 2IZVB 4B0EA 3U8ZA 3KQ4A 1D5ZC 1K52A 3AE8B 3B2FA 4P6VF 3WALA 1TTNA 2L83A 1QQRA 1E0ZA 4IM0A 2KWDA 2PE6B 5IOIA 1WYWB 2ZW1A 4DXGA 3Q6BA 1WGDA 4BBNC 4DHZE 3I9V1 3L10B 3A9KB 1VZ6A 4ARCA 4US8A 2KDEB 2DZKA 2D5GA 4JX1C 3VH3B 2D3BA 1ZW7A 2WDQB 2LRWA 4LNNA 3X23A 1YQBA 3AEGB 4IDIA 4CQNA 2KANA 1YOVB 1VRAB 3IT4B 4WJNA 1VR9A 3P1MA 3DBHB 2V3NA 1EWCA 1WMHB 3NJTA 4E74A 1BMLC 5HKHA 2BKFA 3AI5A 3KUDB 2WXFA 2BWES 5CTRC 5GMVA 4DDID 5AZFA 1UNSA 3LJ3A 2CU3A 5JH5C 4JWUC 2MX2A 1YNTE 1C4AA 2GRIA 4AUQC 2KWCA 2CHWA 4PK1A 2MBQA 4M00A 4BVUC 4LJOB 2DZJA 2R61A 1PYWD 4YSZB 3NS1A 3SDLC 3AEDB 4NJ6A 1WFYA 2HJ1A 4BZAA 1FMAD 1K53A 2KTRA 3MTNB 1XCTL 1WE6A 2K39A 4AOFA 4USAA 3WANA 4KGSA 4URKA 2KK8A 4DHJD 3PZDA 4NZLB 2ZJDA 4IM3A 4MH0E 2QILA 3I3TB 1JMLA 2BVCA 3AU5A 1V1OA 4TMAB 1GOZA 4YTPB 1S1QB 3NY5A 4RNAA 3EECA 1OEYJ 1ESFA 3UF8A 1V9JA 3HUIA 1KFYB 2KFKB 4HK2A 3VR9B 4HCNB 2L0FA 2AX5A 2E3TA 2L3ZA 4MGYE 2DAJA 1A5RA 1KOTA 2INPE 3QC8B 2WHIA 1UBQA 1L0VB 3LB8C 1ET9A 1WX7A 3NVWA 4JLCA 1VLBA 1C4PA 2D11A 3N9YC 4WWNA 2ZEQA 1N62A 3JYUA 3W1YA 2H88B 4TQ0A 1TY0A 4LNFA 1J7CA 4EOYA 2K8CA 4XWTA 4RMAA 3Q3NC 1WYGA 1HTOA 1WH3A 1DGJA 2NBUA 5BMIA 5C23A 3PSEB 3DVGX 4FJYA 4RM9A 3NS8A 2V9HA 4KVGB 3DVGY 2KKCA 3M95A 1EWYC 2IY1B 4RGTA 5G5GA 2L1AA 4HWIB 1T5XD 2BB6A 3ZRCA 1E7UA 4A90A 2KDMA 3NVZA 1GAQB 4US9A 3DBLI 2L52A 3EGRA 4I6NB 3R7RA 4W9HA 4YT0B 2KNBA 1B9RA 2LHEA 3ZKJC 2KX3A 3BWUD 2JXTA 2MP2A 2VH2A 4FLHA 1QZEA 1CZPA 3VDZA 4IM2A 4NQKE 1YN5A 1CK1A 1E90A 4LK0M 3UQAA 2D3AA 2K8HA 2WXJA 2KHWB 5JXVA 2LFIA 2LEKA 3TEZA 3WCQA 4FHJA 2W3RA 3QWZB 1P9DU 3AXCA 5HFYA 1E8WA 1CMXB 3FILA 3PV1A 3RNAC 1FIQA 3VTVA 1FNUA 4JL9A 2Y5BB 3P4SB 3T9LA 4HDOA 1QILA 3DCGA 1STEA 1HTQA 1GC6A 4R3DA 2UYZB 4DXFA 1E7PB 1WGHA 2C5LC 3VRAB 2KLGA 4HROA 2CU1A 1ZXHA 3ZYYX 1WX8A 2XK5B 2KLCA 2V4IB 1I35A 4W9JA 2G4DB 4EZKA 2BS4B 1T3QA 1N5WA 3VHTC 2BF8B 5CHWA 4M8MA 3ETRA 3AE5B 2IY0B 2JF5A 4XC2A 4JWSC 3U30A 2KO3A 4PS7A 4XGAB 4DBGA 2AQ2B 4CO7A 1C9FA 4CHKA 4OZAA 3BYYB 2KDFB 2B76B 2PW9A 3A4SC 4KIKA 2JSVX 1SJHD 2QSDA 2NMQA 4GXBA 1YN4A 2GBJA 4RGNA 2W55A 5D2MB 1FO4A 1NVID 1P7EA 3IAM1 2DENB 4EKUA 3ZXRA 1MVKA 1MHHE 1WXQA 1J7BA 4AJYB 1I4GA 2AYOB 1KRHA 4IW0A 1XEEA 3DOWA 4FN2A 4K1RB 2LASA 4OZBA 4YTMB 3OAWA 2LGSA 3QIJA 3E56A 1TY2A 2JUOA 3TL5A 1CJEA 1LM8B 3OWEB 3PHWB 4MACA 2FCNA 2KQ4X 1TS2A 2J0KA 2QC8A 1SIJA 1HQRD 2I38A 3ALBA 1IPGA 4BKSA 3Q8BA 2BQQA 2EKEC 4ZRKA 4BKTA 4DXAB 5J18A 5CHVC 3RULA 2IO3B 2KVZA 1LQBA 3BVGA 4TV3A 2Y5CA 4L2YA 1PGXA 4JIOU 2N0SB 3QHTA 2O2VB 2XEWA 2LRUA 2GMIC 2RMMA 3NHEB 3DBRB 3V6CB 1SJED 1QOFA 1ZDVA 2PVOD 4I6PA 3L16A 1I4XA 1DOYA 2PKOA 4BBNF 1L7YA 2IGDA 3AULA 1R4MI 2LJ5A 2XN9C 1HE8A 1I4QA 1B1ZA 2J42A 5E6PA 1VZ8A 3CIRB 4ACFA 4FJVB 2ZVOA 1P3QU 1FFUA 2K3UA 2IDYA 3VVWB 2NR2A 4II3B 5JZEB 2LZ6A 2MEKA 3B1LX 4ZHOA 1P98A 3GZNI 2MBBB 2WNMA 4MM3A 3SFDB 2NTSA 3AE7B 4CYEA 4IUMB 1F2RC 3KW5B 3PRMB 2BYTA 1Z5SB 3IFWB 3QARA 4MJSB 4ZDVA 2DYOA 1SE4A 3DPDA 5AUIA 2UWQA 4HKQA 4IWOA 4GB9A 4GU2A 3QCAA 3W2DA 3UINB 1KF6B 2REXA 3TMPB 1D5MC 4MGZE 3IXSA 3JSVA 3W5UB 1SSNA 5FKAC 4C7YA 2K6DB 3H9DA 4KSKC 4FBJB 4YSXB 1IBXA 2KJ6A 3Q3MC 2LJIA 2ONQA 1SIFA 2FE8A 2Y5PA 1SE3A 3P42A 3PO0A 3TEWA 4OVUA 4HRSA 1DOIA 1NI2A 5EDSA 3N32A 1L6VA 3Q69A 3SR6A 4UDUC 4ANUA 2RDBC 3MHSD 4B9KA 4RF1A 4I6LB 4M0WA 3MP9A 5KHOA 2O6VA 2BGFA 2XBBC 4XX5A 3WA0A 3WAMA 4YSYB 4EZJA 4GDLA 1GG3A 3RNEC 1OFFA 3AN1A 3W1SC 1V80A 1NENB 3ZDTA 3GOEA 4JQWC 2WWZA 4XE0A 2Y3AA 3NVYA 3DVNU 3VFKA 4PYZA 2ZNVB 3AEEB 2N9LA 1WSPA 3NVVA 1YIWA 4XDCA 2NCNA 2IGHA 1QOAA 3FKYA 3MC0B 3PREA 4ASWC 1YD8U 2GBKA 3DHIC 1ET6A 4WQOB 1E6EB 2V4LA 1Q5WB 2DBYA 4ZRPA 1J8CA 4MSMB 1TS4A 4HLEA 5J17A 3Q8FA 4XZ4A 4MELA 3MC9A 3URYA 2M17A 2LGYA 3HIZA 4M8NA 1FXTB 1V1PA 1T0SC 3QQ8B 3X0WA 3HHMA 2VH1A 4TKNA 3IVFA 2FNJB 2LGXA 2RDGA 5EE0A 4GDKA 3Q3OC 3WIMA 4FJZA 1P1AA 1WZ3A 1JCKB 4GSWA 3GZNB 5IO9A 3RI7C 2K6QA 3ZXVA 4FXCA 5LXIB 2MBEA 1IGDA 1SE2A 1VD2A 3BIID 4G50A 3VR8B 2N7JA 1E8ZA 1Q10A 1JROA 3S2AA 2PE9A 3U4EG 4BKGA 3VH4B 2G1EA 3TSSA 3NOBA 5HG2A 2KN4A 4HDQA 5DPWA 4NAWA 2OEDA 4KKJA 1FCLA 3A9JA 2L0TA 1AYFA 1XLNA 2LXCA 3WAOA 1WX9A 4XYCA 4G11A 1SEBD 3A1QA 1RLFA 2GBNA 1WF9A 3UGBB 4B95A 1RFAA 2JWZA 2M56B 2JZZA 2DYMA 5IAAC 5LXHA 1ACCA 3V60A 1WRIA 3FILB 3O65B 4E3CA 2IPKD 1MJDA 4KV2A 3RT3B 3PZ8A 4BKSD 2J7QB 5L83A 1TKEA 3VTWA 1JQ4A 2FAZA 3EFCA 3CWIA 2KJRA 2LWPA 3SD5A 2K1FA 2RR9A 1V5TA 3H6NA 3I63C 3PLVA 3MC8A 4LTUA 1F9JA 1HXYD 3QA8A 2QJLA 4F1SA 3Q3JA 2K0PA 2IO2B 2MBHA 1NI3A 1UWXA 3LXFA 2HTME 1TYGB 4DQOC 1U4AA 1IP9A 5DPRA 1FXAA 4AQ7A 4M02A 1HZ6A 3APCA 4W9LA 2BKRB 3T3OA 5JHAA 3HK0A 4ZHPA 4XWWA 3DQVA 4IWQA 2OJWA 1WRDB 4F8CB 1C79A 4OVZA 1F1HA 2MW5A 5MPOA 2VZKD 3BY4B 4A8XC 4YXDB 1D6EC 3N30A 2C7HA 3OG5A 3AU4A 2NS5A 2J4XA 2KFJA 2ON8A 4HCPB 1FRRA 4J3OD 4KZCA 4JPSA 1YJIA 4K7UA 4OZCA 1J19A 4II2B 2MLBA 1HZ5A 1ZGUB 4GMVA 2JRIB 2BS3B 2MQJA 4P1BC 1IUEA 3FAHA 1WGKA 2BYVE 3ZUNA 5H8YE 3P4QB 2EKIA 4ICVA 1YQ4B 4DHZB 3ZO5B 2NPTA 1DYQA 3ZJTA 2OOBB 3TCAA 1EUVB 2CHZA 3V62A 4DHJB 2DZIA 2O6VD 1TBEA 2KT7A 2MCNB 2WXNA 4C00A 3LYYA 4N59A 3RZFA 2WXGA 2CS4A 2BT6A 3I5JC 1D4BA 3ZTDA 1V6EA 3PRPB 2WXOA 2M0AA 1AW7A 3OJ4B 4J6IA 2LMCA 3KLSX 1YX6B 3U7DA 2EELA 1EO6A 4M01A 3I57A 2L7RA 2C7MB 4OVVA 3A9KA 1DOXA 4MEMA 3NRZA 1TT5B 2INNE 2MH7A 3BZDB 1MG8A 5G55A 2JY6A 2KMMA 3N1ZC 1LFDA 3M62B 2V1YA 5BO4B 2WDTB 2N9XA 3L4PA 1X1MA 2UU7A 4W9DA 5E6OA 4C4VA 1WMHA 2XNAC 2KAJA 1GB1A 4YWGG 3RPFC 2L32A 1I4HA 2Z59B 3T8MA 5D7GA 3KUZA 1PGAA 2CJOA 2FIFA 4PS8A 3DWMA 4ZOHC 3N20C 2JZPA 1KTKA 3R66C 2PIAA 4NJCA 4LNOA 3TJPA 3QJZA 2JWUA 2OJRA 4K7WA 3DWGC 4HPLB 2K5PA 3R3MA 1V49A 1TGZB 5LLIA 1WGRA 4LJPB 3ZDMC 4E71A 3IT6B 4HXDA 4GDLB 3Q2AC 1L0YB 2R2QA 3APFA 5C3JB 3EA6A 2WU2B 1YQ3B 1H4RA 1JRUA 3ZVVA 2ZNVC 3R2TA 1OQQA 2RD0A 5LNK1 5TR5A 4KGTA 3GB1A 4RM8A 1GPXA 3AH7A 2M1MA 4O1NA 2LD9A 3ZJUA 4IKGA 1NYRA 1YX5B 3ZNZB 2GB1A 2N9KA 2WXMA 2KJHB 1VDVA 4RFBA 2A5UA 3C0RB 3Q3FA 1D5XC 2WXQA 3PS6A 4BOZB 3E9SA 3UIPB 3ZNHB 2GLSA 2KWVB 3NZSA 2PPHA 1WJ4A 3DBLB 4TSSA 2KX0A 3UQBA 3BINA 1UGMA 1FCCC 3GS2A 1E5WA 4P16A 2X8XX 4MSQB 4W9FA 3NG0A 3KVFB 4K81A 4MGKE 3NUHB 1XLPA 2W3SA 3M3JA 4AWJA 3L0WB 1HEZE 2FIDA 4ZRJA 1NBFC 5DPTA 3VUXA 2M19A 1JW9D 3U52E 2DZMA 2WDVB 2AWTA 3ZNID 2K25A 4EEWA 1XF5L 3Q14C 2ZZPB 1OQYA 5TSSA 2N4FA 2LVQA 1RAXA 3VAWA 2JU6X 2DWQA 4MH8A 5IA7A 3KWLA 2J52A 5BYSA 1WM3A 4HJKA 2BB5A 4GGQA 5EE9A 2A4ZA 3AB5A 4NAWB 1CQVA 3A9JB 4W9KA 2YVCA 3BYTB 2FCMA 3A1QB 1OQRA 2KVRA 2QEJC 4FADA 2OHFA 1MG4A 4MT5A 1ZUD2 2LXAA 4LDTD 1WIAA 4RF0A 2FBWB 2RPQA 3HM3A 4PS3A 4B6WA 5FR3A 1XD3B 4X57B 2MJ3A 1GJZA 4WWPA 3TEYA 5GXGB 1RWSA 2N1WA 4GIVA 3QX1A 1WWTA 2WX0A 3U7ZA 2KTFA 2KMAA 5FK9C 5J2RA 2KMCA 2IBIB 1N61A 2N7EA 4NNJB 2LHDA 3ABVB 4W9IA 1I4PA 4TUUA 3DBHI 1C4CA 2KTRB 2XK5A 2W9NA 4NJ7A 2FCQA 1TS5A 1XXGA 5BYQA 4S0RA 3RNBC 1T0RC 1EU3A 1K50A 3DDCB 4DK5A 2JX5A 3RMKC 2KWUB 2IGGA 1YN3A 4RH6A 3ZTCA 4BFRA 2V3PA 1A70A 4A9AA 1L0XB 4RGOS 4ITKA 1F0ZA 2HE7A 2D10A 2W54A 5HHDG 3A4RA 2V3SA 1I4RA 2JVCA 3O13A 1XLOA 2JYTA 2X38A 2QDFA 2ZCCA 3HVZA 1Y56A 3ENEA 5AZGA 2AQ3B 4FULA 3TEXA 5BYRA 3VUYA 2PVGC 4KSLC 4D2KA 4IC7B 4NQLB 2DX5B 2MJDA 1UZXB 3KYDD 2WX1A 1TS3A 2CHXA 2G9HD 3AEFB 1C1YB 1BT0A 2BTEA 3N1XC 2KQSA 5E6JA 4A20A 1UUPA 1WE7A 3QAQA 1QKZA 1WXSA 1L6UA 2E6XA 4LNKA 1GNUA 2AL6A 3AE3B 3UIOB 2NVUI 1YJJA 4S17A 2N1VA 1MPEA 2L05A 1SB3C 1L4DB 1SBBB 1L4ZB 2WXIA 4G0NB 1R4MB 2WQYB 3PHXB 5EE3A 4P1CC 4HPPA 2JPHA 2MJEA 1RYJA 2AEHA 3FC4A 1TKGA 2N7DA 2O2VA 1V97A 2NPTB 1RM6C 3B08A 1E8XA 2N9PC 3EHVA 4ANXA 5AEKB 4ZYSA 3GP7A 2EMTA 5G5HA 3RN9C 1KLUD 4C56C 4REZA 1WXMA 2MP2B 1JWUD 2BS2B 3RCZA 4AS1A 4HKZE 3BK2A 2WXLA 1F77A 3GE3C 1P0RA 2DLBA 2MHJA 1GUAB 3AMZA 1AWDA 2QMTA 2I1JA 2HJ8A 4WURA 3ZJVA 2M8SA 1QOGA 3B2GA 1KM7A 2YEPB 4N58A 5D6JB 2IO1B 1ENFA 2KDBA 2ICIA 3V05A 3ZNGC 5JHBA 3NZ3A 5L95C 3AEAB 3R8BA 1JWSD 1F52A 4NPNA 2CJNA 1Z2MA 1QF6A 4WJPA 4WJQA 4MJSA 2EMSA 2LVOA 1XT9B 1FNWA 2PLPA 2KOXA 5KHQA 4WIPA 2CR5A 3SEBA 4C4VB 1YJ1A 1PFDA 1FEHA 1HA5A 2DYBA 1Q0WB 2DNFA 3ML8A 2JZ3B 3AEBB 2D3GA 3C19A 4YTNB 1NDDA 2ZVNA 3JVZX 1J0GA 1EM7A 2BWFA 2WGSA 2HDEA 2PEAA 2IO0B 3B9JA 2M0XA 2INDC 4A3OA 3RD2A 4BOSC 5D3IB 3ECIA 3IBEA 1KLGD 1ZXIA 1N63A 1LO5D 4ANWA 4G3XB 4LLGM 2PTLA 1E7VA 3MFGA 4ICUA 1KH0A 1G6JA 3PZ7A 1IGCA 2J0JA 3K9OB 1WJ6A 4KIKB 1H8CA 2J0MA 1ROEA 4WAAA 4W9CA 4ARIA 2LUMA 5FR6A 2JQRB 1V86A 2Z8LA 3MHZA 3VQIA 1UWMA 3PPAA 4ZRQA 1WGGA 2JXXA 1WR6E 3HVDA 3PGEA 1FRDA 5CHFA 1MFWA 2K22A 2K9XA 3IG3A 3NZUA 1C76A 4AJWA 4HEA1 4B0MA 1FFVA 4K7SA 3B0AA 1XLQA 1WJNA 3VXWA 1R4NI 1I7HA 4LCDE 1C78A 1JALA 1TIFA 3KWVA 4JGHB 4N9F4 1KLVA 4KGRA 2KD0A 2RSUA 4OHJA 4BAXA 2I1KA 3RYTA 3ZIMA 1IYFA 2L00B 3DHGC 5BMHA 1MHXA 1T0QC 1LXDA 2WS3B 3H7PA 5C1ZA 1J7AA 3CF6E 4KKIA 1V5OA 3AE2B 3UI3A 2JT4B 2C7NB 3BK1A 1EU4A 4RGMA 2LGIA 1SGHA 2BW2A 1PDXA 2LI5A 2ZCBA 2WXPA 1PGBA 3ONSA 3ZW3A 1V8CA 2FUHB 2D3CA 3MJ5A 1E8YA 1JWAD 1UH6A 1SE9A 2YLMA 3APDA 3RZWC 2WLBA 3HRDD 2ZPNA 2IJ0A 3SFEB 4MM3B 4DDGD 1XCQL 4AP4C 2MWSB 2YEPF 3ZQ4A 3DBRI 2RDHA 1WZ0A 3QK0A 4RCOA 5BMGA 2VZKB 2SEBD 4W9GA 1M4VA 2WDRB 4HPMB 1FD6A 2NTTA 4WH4A 3A33B 2JYEA 3TBLD 1FNVA 1NYQA 2RGFA 3L13A 3JSVB 4A55A 3N1YC 1VJKA 1QLBB 1TZOA 4WQMA 3RFZB 1T6BX 2NBVB 4P7IA 3C8YA 1E9MA 3JW0X 2ZW0A 1IBXB 2C9WB 3EFUA 3H7SA 3V6EB 1YMHE 1QOBA 1ZDXA 1R7SA 1UGJA 2I2YA 3RNCC 3L17A 4EZLA 2FCSA 1TJEA 4IG7B 3L54A 1WJUA 2W82A 2B3AA 2KQ7A 4GLSC 4FA6A 5DCNA 4M0WB 2WXRA 2GBMA 2SAKA 3TIXA 2O6VB 1OTRB 1L2NA 4KDLB 3HM6X 4EE2A 2M4NA 3RNGC 2RPVA 1Q1OA 5AUKA 3TUOA 1WXVA 3EUB2 4LNIA 1GC7A 3W1SA 1XQQA 1PUTA 1FPYA 4L1BA 3KYCD 3EC8A 5HI1A 1JWMD 1R4NB 1RRBA 3DVNV 1TKYA 2KFKA 5D94A 5T8IA 3CSFA 5CX3A 3W5VB 3P4PB 3IAS1 2QCZA 2G3QB 2AQ1B 1UD7A 3D32A 4TQ1A 3RNFC 1L5PA 1OEYA 3DBSA 2BYEA 4K3CA 1V2YA 1AN8A 2INCC 3AE9B 1OGWA 2J53A 3M63B 2AL3A 4PYUA 2ZPYA 1P7FA 2G4SA 3DHHC 3ZRFA 1T0YA 4IOIE 1NEKB 1V1PB 4ZRIA 2K8BA 2C60A 1MI0A 4N6EB 1K8RB 1ZP0B 4H2AA 1SF0A 2KACA 3PLUA 5G2NA 1EF1A 1C77A 3BVMA 2QIEB 4GDKB 4C80A 5EE1A 3ZLZA 1WY8A 2GOWA 1C3TA 1WI0A 1WM2A 1ZKHA 1SXTA 2DAFA 2WU5B 2WXHA 4FHKA 4KDIC 3AE4B 3H8HA 2FUG1 4PT5A 1LGRA 3AE1B 2KDIA 1WXAA 2BPSA 3PTFC 3AECB 3Q8CA 1N60A 2MBOA 3MJWA 4MDKE 3V61A 2G45B 4Q2JA 3N3KB 4KX6B 1M94A 4GOCA 1BUIC 1I42A 2PMVA 4OW0A 3PVLA 5DPSA 3AV8A 3P4RB 3ZGZA 3R7QA 4C7ZA 3PT2B 1ZE3D 4YL8A 1FXIA 3VTUA 5IP4D 2CKHB 1JRPA 1PQSA 2WYQA 3P63A 2PJHA 1XO3A 2KZRA 1UELA 2GBRA 1EF5A 3Q8AA 4ZYNA 2KN5A 2JRHA 4EFOA 2TSSA 4NAMA 2KYWA 1F2RI 1VCBA 1Y8RC 2ACZB 2WXKA 3OJ3A 1K51A 3V3XA 3J9CA 2HTHA 1V81A 2LGDA 4WJOA 2QHOA 3U2SC 1ZOYB 4IWPA 2MA9B 5D3DA 4JE3B 2Z0EB 4EUTA 2IYDB 3P2BA 3CSTA 2WP9B 4MGIE 1UF0A 2N9EB 4WWMA 1UBIA 2KC2A 3KUCB 2LUEA 2Z0DB 3RUIB 1GB4A 1D3ZA 2V0GA 3GE8C 4KZ0A 1JWBD 3OLMD 3CMMB 4A6QA 5IKCM 2NBWB 2L76A 4A3PA 5E6NA 3SHQA 4XDDA 5C2TB 2KXJA 3VRBB 2KC1A 4ANVA 1QT9A 2H89B 2ASQA 3BVZA 3K9PB 4QAYA 3L08A 4DWFA 3H1UA 4HVBA 2Q5WD 3IHPC 2GI9A 2LVPA 3WAPA 1VZ7A 1FM0D 4WWOA 2MSED 1KJTA 4L23A 1BXTA 2D07B 4LDTB 3W9CB 3T3NA 3Q8EA 1RFKA 3ML9A 2BYFA 3PRZA 4K3BA 1WR1A 4GN1A 2HD5B 2DHZA 1S3SG 3KH0A 2MRPA 2VRRB 3LDZE
chains in the Genus database with same CATH topology
4FJVB 2ZVOA 2R2OA 1P3QU 4WAAA 4W9CA 1ISNA 2Z59B 5FR6A 3T8MA 3VVWB 4W9EA 2NR2A 1V86A 4II3B 1TZ1A 2D2QA 5JZEB 5D7GA 3VQIA 2LZ6A 4NY0A 3B1LX 3SU8X 1P98A 3KUZA 3GZNI 2MBBB 3PPAA 1WGGA 4MM3A 5AZHA 2FIFA 2JXXA 1WR6E 4PS8A 3PGEA 3H7PB 4CYEA 3VUWA 4IUMB 5CHFA 1AARA 1WGYA 3R66C 3KW5B 4F7ZA 2L8JA 2IZVB 3IG3A 3NZUA 3PRMB 3U8ZA 4AJWA 3TJPA 1Z5SB 3QJZA 3IFWB 3QARA 2OJRA 4K7WA 4MJSB 2DYOA 4K7SA 4ZDVA 3B0AA 3DPDA 1WJNA 2UWQA 3WALA 4IWOA 1TTNA 4GB9A 4HPLB 3VXWA 1R4NI 4GU2A 3R3MA 1V49A 3QCAA 1TGZB 3UINB 5LLIA 1WGRA 4LCDE 4LJPB 2REXA 4IM0A 3TMPB 3ZDMC 4E71A 4HXDA 2PE6B 4GDLB 4MGZE 3JSVA 4JGHB 4N9F4 1KLVA 1WYWB 2R2QA 3APFA 2K6DB 2KD0A 2RSUA 3H9DA 4KSKC 1WGDA 4BBNC 2I1KA 4DHZE 4FBJB 2KJ6A 3RYTA 3L10B 3ZIMA 1IYFA 2L00B 1SIFA 1H4RA 3A9KB 1JRUA 3ZVVA 1LXDA 2ZNVC 2KDEB 2DZKA 3H7PA 5C1ZA 3VH3B 2RD0A 1ZW7A 2LRWA 3X23A 3CF6E 1V5OA 1YQBA 5TR5A 4OVUA 2JT4B 4RM8A 2C7NB 1NI2A 2KANA 2M1MA 5EDSA 3N32A 4WJNA 2LD9A 1SGHA 4ANUA 2LI5A 2ZCBA 3ONSA 1YX5B 3MHSD 3ZW3A 4B9KA 3ZNZB 2FUHB 1WMHB 4I6LB 4E74A 2KJHB 5KHOA 5HKHA 2BKFA 2O6VA 2BGFA 2XBBC 4XX5A 2A5UA 3C0RB 3Q3FA 3WA0A 3AI5A 3WAMA 3PS6A 1E8YA 3KUDB 4BOZB 3UIPB 4GDLA 2BWES 5CTRC 5GMVA 1GG3A 3ZNHB 4DDID 5AZFA 2KWVB 3NZSA 1UH6A 2PPHA 3LJ3A 1V80A 1WJ4A 3W1SC 3ZDTA 3GOEA 1SE9A 2YLMA 3APDA 4JQWC 3RZWC 5JH5C 2WWZA 2KX0A 3UQBA 2ZPNA 2MX2A 3BINA 1UGMA 4DDGD 1E5WA 3DVNU 4AP4C 4AUQC 2MWSB 3VFKA 2KWCA 2CHWA 4MSQB 4W9FA 4PYZA 3DBRI 1WZ0A 2ZNVB 2MBQA 3QK0A 4BVUC 1YIWA 3KVFB 4K81A 2NCNA 4LJOB 2DZJA 4MGKE 3SDLC 3PREA 4ASWC 4NJ6A 1WFYA 3M3JA 4W9GA 4AWJA 1YD8U 2GBKA 4HPMB 2KTRA 3L0WB 3MTNB 4WQOB 2FIDA 2V4LA 4ZRJA 1Q5WB 1WE6A 1NBFC 2K39A 4AOFA 5DPTA 3A33B 3VUXA 3WANA 3TBLD 4URKA 1J8CA 4MSMB 2DZMA 2KK8A 4HLEA 4DHJD 3PZDA 5J17A 2AWTA 2ZJDA 4XZ4A 4IM3A 2RGFA 4MH0E 3ZNID 3L13A 4MELA 2K25A 3I3TB 3JSVB 4EEWA 2ZZPB 1OQYA 2M17A 2LGYA 2LVQA 1RAXA 2N4FA 3AU5A 3VAWA 4P7IA 2NBVB 3HIZA 3JW0X 4M8NA 1S1QB 3NY5A 2C9WB 1FXTB 5IA7A 3EECA 3EFUA 1WM3A 3H7SA 1OEYJ 4HJKA 3V6EB 4GGQA 3UF8A 2A4ZA 1V9JA 3QQ8B 4NAWB 3X0WA 3HHMA 3A9JB 4TKNA 2KFKB 4HK2A 3IVFA 4W9KA 3L17A 2YVCA 2FCSA 4EZLA 2FNJB 2LGXA 4HCNB 4IG7B 2FCMA 2L0FA 3L54A 1WJUA 3A1QB 2L3ZA 2B3AA 2DAJA 2KVRA 4MGYE 2KQ7A 1A5RA 4GDKA 4FA6A 1KOTA 3QC8B 4FADA 5DCNA 3WIMA 4FJZA 1UBQA 1P1AA 2LXAA 1WX7A 1WZ3A 4M0WB 4JLCA 4GSWA 2GBMA 3TIXA 2O6VB 4LDTD 1OTRB 1WIAA 1L2NA 2K6QA 4KDLB 3HM6X 2D11A 2M4NA 5LXIB 4WWNA 1Q1OA 2MBEA 2ZEQA 1VD2A 4G50A 2RPQA 3JYUA 3W1YA 1E8ZA 1WXVA 3HM3A 4PS3A 4B6WA 4TQ0A 4EZJA 1GC7A 3S2AA 3W1SA 4EOYA 1XD3B 2PE9A 2K8CA 1XQQA 4RMAA 4X57B 1GJZA 4BKGA 4WWPA 3VH4B 2N1WA 3KYCD 4GIVA 3QX1A 2WX0A 3EC8A 3NOBA 2KTFA 1RRBA 2KMAA 4HDQA 5DPWA 4NAWA 5J2RA 2KMCA 2IBIB 3DVNV 3A9JA 2L0TA 2N7EA 1WH3A 2KFKA 4NNJB 5D94A 2NBUA 2LXCA 5C23A 3WAOA 1WX9A 4W9IA 4TUUA 3PSEB 3DBHI 4G11A 3CSFA 3DVGX 4FJYA 4RM9A 2KTRB 3A1QA 3NS8A 5CX3A 2XK5A 4KVGB 1RLFA 2W9NA 3DVGY 2KKCA 3M95A 4NJ7A 2GBNA 1WF9A 2IY1B 3UGBB 4B95A 2FCQA 2G3QB 1RFAA 1UD7A 2JWZA 3D32A 4TQ1A 5E6PA 1OEYA 4HWIB 2JZZA 3DBSA 3ZRCA 2BYEA 1E7UA 1V2YA 2DYMA 5IAAC 5LXHA 3DBLI 3V60A 4I6NB 3DDCB 3R7RA 4DK5A 4W9HA 1OGWA 2KWUB 3M63B 2AL3A 4PYUA 3ZTCA 3O65B 4BFRA 2KNBA 4E3CA 2ZPYA 4KV2A 2G4SA 3RT3B 3ZKJC 3ZRFA 2KX3A 1T0YA 4BKSD 2HE7A 2D10A 2J7QB 2MP2A 5L83A 4ZRIA 3VTWA 4FLHA 2K8BA 3A4RA 2V3SA 1QZEA 2C60A 2JVCA 3VDZA 4IM2A 4NQKE 2FAZA 1K8RB 2ZCCA 1E90A 3ENEA 3PLUA 5G2NA 3UQAA 2KJRA 2LWPA 5AZGA 4FULA 2K1FA 3SD5A 1EF1A 3VUYA 2RR9A 4KSLC 2K8HA 4IC7B 4NQLB 2DX5B 1UZXB 3KYDD 1V5TA 3H6NA 4GDKB 2WX1A 3ZLZA 2CHXA 2KHWB 1WY8A 1C1YB 2GOWA 1C3TA 1BT0A 3PLVA 4FHJA 1WI0A 1WM2A 1ZKHA 2KQSA 4A20A 3QWZB 1P9DU 1F9JA 2DAFA 5E6OA 3QA8A 1WE7A 3AXCA 3QAQA 4FHKA 4KDIC 4F1SA 1E8WA 3Q3JA 1WXSA 1CMXB 2IO2B 3PV1A 3VTVA 2MBHA 2KDIA 1GNUA 1WXAA 2AL6A 2BPSA 2Y5BB 4JL9A 3T9LA 4HDOA 3UIOB 3PTFC 2NVUI 3DCGA 2N1VA 2MBOA 1GC6A 2L05A 3MJWA 1U4AA 1IP9A 2UYZB 4MDKE 5DPRA 3V61A 1WGHA 4G0NB 2G45B 2C5LC 3N3KB 1M94A 4GOCA 2KLGA 3APCA 3PHXB 4W9LA 1I42A 2BKRB 5JHAA 2CU1A 3HK0A 2JPHA 1WX8A 2XK5B 3PVLA 2KLCA 3DQVA 4IWQA 5DPSA 1I35A 4W9JA 1WRDB 3R7QA 2G4DB 4F8CB 4EZKA 2AEHA 3PT2B 3VHTC 2BF8B 5CHWA 2MW5A 4M8MA 2N7DA 4YL8A 3BY4B 2O2VA 3VTUA 2CKHB 2IY0B 1PQSA 2JF5A 2NPTB 3N30A 2C7HA 4XC2A 3AU4A 3B08A 2WYQA 1E8XA 2N9PC 2NS5A 2PJHA 3EHVA 4ANXA 2KZRA 1UELA 2GBRA 1EF5A 5AEKB 2KFJA 2EMTA 4ZYNA 2KN5A 4HCPB 3U30A 2JRHA 2KO3A 4PS7A 4DBGA 4EFOA 4KZCA 1WXMA 4CO7A 2MP2B 4CHKA 3RCZA 4K7UA 1J19A 4II2B 2KDFB 1VCBA 1Y8RC 3A4SC 4KIKA 3OJ3A 2MLBA 4GXBA 1P0RA 1ZGUB 4GMVA 2GBJA 1GUAB 2HTHA 2JRIB 2I1JA 5D2MB 1V81A 2LGDA 4WJOA 2QHOA 2HJ8A 2MQJA 2DENB 4IWPA 2MA9B 2M8SA 4EKUA 1KM7A 2BYVE 5D6JB 3ZUNA 2IO1B 2Z0EB 4EUTA 2IYDB 2KDBA 3P2BA 3ZNGC 4AJYB 3CSTA 4ICVA 2AYOB 4MGIE 4IW0A 2N9EB 4DHZB 3DOWA 1UBIA 3ZO5B 4FN2A 4K1RB 2LASA 5JHBA 2NPTA 2KC2A 3KUCB 2LUEA 2OOBB 2Z0DB 3RUIB 3TCAA 3OAWA 5L95C 3QIJA 1EUVB 2CHZA 3V62A 4DHJB 4NPNA 2DZIA 2O6VD 1Z2MA 1TBEA 4WJPA 4WJQA 4MJSA 2EMSA 2LVOA 1XT9B 2JUOA 2MCNB 1D3ZA 4KZ0A 3OLMD 3TL5A 2KOXA 5KHQA 2CR5A 3CMMB 1LM8B 2NBWB 3PHWB 1YJ1A 2FCNA 2DYBA 2L76A 4A3PA 3RZFA 1Q0WB 2J0KA 2CS4A 5E6NA 3SHQA 3ALBA 3ML8A 1IPGA 4BKSA 2JZ3B 2KXJA 1V6EA 2D3GA 3ZTDA 2EKEC 4ZRKA 4BKTA 4DXAB 3PRPB 5J18A 5CHVC 1NDDA 2KC1A 3RULA 4ANVA 2ZVNA 2IO3B 3OJ4B 2ASQA 1LQBA 4J6IA 3JVZX 1J0GA 3K9PB 1YX6B 3U7DA 1EO6A 2BWFA 2L7RA 4TV3A 2C7MB 2PEAA 4OVVA 2IO0B 3A9KA 2M0XA 3L08A 4JIOU 4DWFA 4MEMA 4A3OA 3H1UA 2O2VB 3QHTA 2XEWA 3RD2A 4HVBA 2LRUA 3IHPC 4BOSC 2LVPA 3WAPA 2GMIC 3NHEB 5G55A 1MG8A 3ECIA 3IBEA 2JY6A 3V6CB 4WWOA 2MSED 1KJTA 4ANWA 2D07B 4LDTB 4G3XB 1LFDA 3M62B 2V1YA 5BO4B 2WDTB 1E7VA 2N9XA 1X1MA 4ICUA 4I6PA 3L16A 3ML9A 4W9DA 2BYFA 1G6JA 3PRZA 1WR1A 4GN1A 4BBNF 2HD5B 2J0JA 1L7YA 1WJ6A 1WMHA 2DHZA 3AULA 1R4MI 1S3SG 2LJ5A 3K9OB 4KIKB 3KH0A 1H8CA 2J0MA 2MRPA 1HE8A 2VRRB 3LDZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJV B;  2ZVO A;  2R2O A;  1P3Q U;  4WAA A;  4W9C A;  1ISN A;  2Z59 B;  5FR6 A;  3T8M A;  3VVW B;  4W9E A;  2NR2 A;  1V86 A;  4II3 B;  1TZ1 A;  2D2Q A;  5JZE B;  5D7G A;  3VQI A;  2LZ6 A;  4NY0 A;  3B1L X;  3SU8 X;  1P98 A;  3KUZ A;  3GZN I;  2MBB B;  3PPA A;  1WGG A;  4MM3 A;  5AZH A;  2FIF A;  2JXX A;  1WR6 E;  4PS8 A;  3PGE A;  3H7P B;  4CYE A;  3VUW A;  4IUM B;  5CHF A;  1AAR A;  1WGY A;  3R66 C;  3KW5 B;  4F7Z A;  2L8J A;  2IZV B;  3IG3 A;  3NZU A;  3PRM B;  3U8Z A;  4AJW A;  3TJP A;  1Z5S B;  3QJZ A;  3IFW B;  3QAR A;  2OJR A;  4K7W A;  4MJS B;  2DYO A;  4K7S A;  4ZDV A;  3B0A A;  3DPD A;  1WJN A;  2UWQ A;  3WAL A;  4IWO A;  1TTN A;  4GB9 A;  4HPL B;  3VXW A;  1R4N I;  4GU2 A;  3R3M A;  1V49 A;  3QCA A;  1TGZ B;  3UIN B;  5LLI A;  1WGR A;  4LCD E;  4LJP B;  2REX A;  4IM0 A;  3TMP B;  3ZDM C;  4E71 A;  4HXD A;  2PE6 B;  4GDL B;  4MGZ E;  3JSV A;  4JGH B;  4N9F 4;  1KLV A;  1WYW B;  2R2Q A;  3APF A;  2K6D B;  2KD0 A;  2RSU A;  3H9D A;  4KSK C;  1WGD A;  4BBN C;  2I1K A;  4DHZ E;  4FBJ B;  2KJ6 A;  3RYT A;  3L10 B;  3ZIM A;  1IYF A;  2L00 B;  1SIF A;  1H4R A;  3A9K B;  1JRU A;  3ZVV A;  1LXD A;  2ZNV C;  2KDE B;  2DZK A;  3H7P A;  5C1Z A;  3VH3 B;  2RD0 A;  1ZW7 A;  2LRW A;  3X23 A;  3CF6 E;  1V5O A;  1YQB A;  5TR5 A;  4OVU A;  2JT4 B;  4RM8 A;  2C7N B;  1NI2 A;  2KAN A;  2M1M A;  5EDS A;  3N32 A;  4WJN A;  2LD9 A;  1SGH A;  4ANU A;  2LI5 A;  2ZCB A;  3ONS A;  1YX5 B;  3MHS D;  3ZW3 A;  4B9K A;  3ZNZ B;  2FUH B;  1WMH B;  4I6L B;  4E74 A;  2KJH B;  5KHO A;  5HKH A;  2BKF A;  2O6V A;  2BGF A;  2XBB C;  4XX5 A;  2A5U A;  3C0R B;  3Q3F A;  3WA0 A;  3AI5 A;  3WAM A;  3PS6 A;  1E8Y A;  3KUD B;  4BOZ B;  3UIP B;  4GDL A;  2BWE S;  5CTR C;  5GMV A;  1GG3 A;  3ZNH B;  4DDI D;  5AZF A;  2KWV B;  3NZS A;  1UH6 A;  2PPH A;  3LJ3 A;  1V80 A;  1WJ4 A;  3W1S C;  3ZDT A;  3GOE A;  1SE9 A;  2YLM A;  3APD A;  4JQW C;  3RZW C;  5JH5 C;  2WWZ A;  2KX0 A;  3UQB A;  2ZPN A;  2MX2 A;  3BIN A;  1UGM A;  4DDG D;  1E5W A;  3DVN U;  4AP4 C;  4AUQ C;  2MWS B;  3VFK A;  2KWC A;  2CHW A;  4MSQ B;  4W9F A;  4PYZ A;  3DBR I;  1WZ0 A;  2ZNV B;  2MBQ A;  3QK0 A;  4BVU C;  1YIW A;  3KVF B;  4K81 A;  2NCN A;  4LJO B;  2DZJ A;  4MGK E;  3SDL C;  3PRE A;  4ASW C;  4NJ6 A;  1WFY A;  3M3J A;  4W9G A;  4AWJ A;  1YD8 U;  2GBK A;  4HPM B;  2KTR A;  3L0W B;  3MTN B;  4WQO B;  2FID A;  2V4L A;  4ZRJ A;  1Q5W B;  1WE6 A;  1NBF C;  2K39 A;  4AOF A;  5DPT A;  3A33 B;  3VUX A;  3WAN A;  3TBL D;  4URK A;  1J8C A;  4MSM B;  2DZM A;  2KK8 A;  4HLE A;  4DHJ D;  3PZD A;  5J17 A;  2AWT A;  2ZJD A;  4XZ4 A;  4IM3 A;  2RGF A;  4MH0 E;  3ZNI D;  3L13 A;  4MEL A;  2K25 A;  3I3T B;  3JSV B;  4EEW A;  2ZZP B;  1OQY A;  2M17 A;  2LGY A;  2LVQ A;  1RAX A;  2N4F A;  3AU5 A;  3VAW A;  4P7I A;  2NBV B;  3HIZ A;  3JW0 X;  4M8N A;  1S1Q B;  3NY5 A;  2C9W B;  1FXT B;  5IA7 A;  3EEC A;  3EFU A;  1WM3 A;  3H7S A;  1OEY J;  4HJK A;  3V6E B;  4GGQ A;  3UF8 A;  2A4Z A;  1V9J A;  3QQ8 B;  4NAW B;  3X0W A;  3HHM A;  3A9J B;  4TKN A;  2KFK B;  4HK2 A;  3IVF A;  4W9K A;  3L17 A;  2YVC A;  2FCS A;  4EZL A;  2FNJ B;  2LGX A;  4HCN B;  4IG7 B;  2FCM A;  2L0F A;  3L54 A;  1WJU A;  3A1Q B;  2L3Z A;  2B3A A;  2DAJ A;  2KVR A;  4MGY E;  2KQ7 A;  1A5R A;  4GDK A;  4FA6 A;  1KOT A;  3QC8 B;  4FAD A;  5DCN A;  3WIM A;  4FJZ A;  1UBQ A;  1P1A A;  2LXA A;  1WX7 A;  1WZ3 A;  4M0W B;  4JLC A;  4GSW A;  2GBM A;  3TIX A;  2O6V B;  4LDT D;  1OTR B;  1WIA A;  1L2N A;  2K6Q A;  4KDL B;  3HM6 X;  2D11 A;  2M4N A;  5LXI B;  4WWN A;  1Q1O A;  2MBE A;  2ZEQ A;  1VD2 A;  4G50 A;  2RPQ A;  3JYU A;  3W1Y A;  1E8Z A;  1WXV A;  3HM3 A;  4PS3 A;  4B6W A;  4TQ0 A;  4EZJ A;  1GC7 A;  3S2A A;  3W1S A;  4EOY A;  1XD3 B;  2PE9 A;  2K8C A;  1XQQ A;  4RMA A;  4X57 B;  1GJZ A;  4BKG A;  4WWP A;  3VH4 B;  2N1W A;  3KYC D;  4GIV A;  3QX1 A;  2WX0 A;  3EC8 A;  3NOB A;  2KTF A;  1RRB A;  2KMA A;  4HDQ A;  5DPW A;  4NAW A;  5J2R A;  2KMC A;  2IBI B;  3DVN V;  3A9J A;  2L0T A;  2N7E A;  1WH3 A;  2KFK A;  4NNJ B;  5D94 A;  2NBU A;  2LXC A;  5C23 A;  3WAO A;  1WX9 A;  4W9I A;  4TUU A;  3PSE B;  3DBH I;  4G11 A;  3CSF A;  3DVG X;  4FJY A;  4RM9 A;  2KTR B;  3A1Q A;  3NS8 A;  5CX3 A;  2XK5 A;  4KVG B;  1RLF A;  2W9N A;  3DVG Y;  2KKC A;  3M95 A;  4NJ7 A;  2GBN A;  1WF9 A;  2IY1 B;  3UGB B;  4B95 A;  2FCQ A;  2G3Q B;  1RFA A;  1UD7 A;  2JWZ A;  3D32 A;  4TQ1 A;  5E6P A;  1OEY A;  4HWI B;  2JZZ A;  3DBS A;  3ZRC A;  2BYE A;  1E7U A;  1V2Y A;  2DYM A;  5IAA C;  5LXH A;  3DBL I;  3V60 A;  4I6N B;  3DDC B;  3R7R A;  4DK5 A;  4W9H A;  1OGW A;  2KWU B;  3M63 B;  2AL3 A;  4PYU A;  3ZTC A;  3O65 B;  4BFR A;  2KNB A;  4E3C A;  2ZPY A;  4KV2 A;  2G4S A;  3RT3 B;  3ZKJ C;  3ZRF A;  2KX3 A;  1T0Y A;  4BKS D;  2HE7 A;  2D10 A;  2J7Q B;  2MP2 A;  5L83 A;  4ZRI A;  3VTW A;  4FLH A;  2K8B A;  3A4R A;  2V3S A;  1QZE A;  2C60 A;  2JVC A;  3VDZ A;  4IM2 A;  4NQK E;  2FAZ A;  1K8R B;  2ZCC A;  1E90 A;  3ENE A;  3PLU A;  5G2N A;  3UQA A;  2KJR A;  2LWP A;  5AZG A;  4FUL A;  2K1F A;  3SD5 A;  1EF1 A;  3VUY A;  2RR9 A;  4KSL C;  2K8H A;  4IC7 B;  4NQL B;  2DX5 B;  1UZX B;  3KYD D;  1V5T A;  3H6N A;  4GDK B;  2WX1 A;  3ZLZ A;  2CHX A;  2KHW B;  1WY8 A;  1C1Y B;  2GOW A;  1C3T A;  1BT0 A;  3PLV A;  4FHJ A;  1WI0 A;  1WM2 A;  1ZKH A;  2KQS A;  4A20 A;  3QWZ B;  1P9D U;  1F9J A;  2DAF A;  5E6O A;  3QA8 A;  1WE7 A;  3AXC A;  3QAQ A;  4FHK A;  4KDI C;  4F1S A;  1E8W A;  3Q3J A;  1WXS A;  1CMX B;  2IO2 B;  3PV1 A;  3VTV A;  2MBH A;  2KDI A;  1GNU A;  1WXA A;  2AL6 A;  2BPS A;  2Y5B B;  4JL9 A;  3T9L A;  4HDO A;  3UIO B;  3PTF C;  2NVU I;  3DCG A;  2N1V A;  2MBO A;  1GC6 A;  2L05 A;  3MJW A;  1U4A A;  1IP9 A;  2UYZ B;  4MDK E;  5DPR A;  3V61 A;  1WGH A;  4G0N B;  2G45 B;  2C5L C;  3N3K B;  1M94 A;  4GOC A;  2KLG A;  3APC A;  3PHX B;  4W9L A;  1I42 A;  2BKR B;  5JHA A;  2CU1 A;  3HK0 A;  2JPH A;  1WX8 A;  2XK5 B;  3PVL A;  2KLC A;  3DQV A;  4IWQ A;  5DPS A;  1I35 A;  4W9J A;  1WRD B;  3R7Q A;  2G4D B;  4F8C B;  4EZK A;  2AEH A;  3PT2 B;  3VHT C;  2BF8 B;  5CHW A;  2MW5 A;  4M8M A;  2N7D A;  4YL8 A;  3BY4 B;  2O2V A;  3VTU A;  2CKH B;  2IY0 B;  1PQS A;  2JF5 A;  2NPT B;  3N30 A;  2C7H A;  4XC2 A;  3AU4 A;  3B08 A;  2WYQ A;  1E8X A;  2N9P C;  2NS5 A;  2PJH A;  3EHV A;  4ANX A;  2KZR A;  1UEL A;  2GBR A;  1EF5 A;  5AEK B;  2KFJ A;  2EMT A;  4ZYN A;  2KN5 A;  4HCP B;  3U30 A;  2JRH A;  2KO3 A;  4PS7 A;  4DBG A;  4EFO A;  4KZC A;  1WXM A;  4CO7 A;  2MP2 B;  4CHK A;  3RCZ A;  4K7U A;  1J19 A;  4II2 B;  2KDF B;  1VCB A;  1Y8R C;  3A4S C;  4KIK A;  3OJ3 A;  2MLB A;  4GXB A;  1P0R A;  1ZGU B;  4GMV A;  2GBJ A;  1GUA B;  2HTH A;  2JRI B;  2I1J A;  5D2M B;  1V81 A;  2LGD A;  4WJO A;  2QHO A;  2HJ8 A;  2MQJ A;  2DEN B;  4IWP A;  2MA9 B;  2M8S A;  4EKU A;  1KM7 A;  2BYV E;  5D6J B;  3ZUN A;  2IO1 B;  2Z0E B;  4EUT A;  2IYD B;  2KDB A;  3P2B A;  3ZNG C;  4AJY B;  3CST A;  4ICV A;  2AYO B;  4MGI E;  4IW0 A;  2N9E B;  4DHZ B;  3DOW A;  1UBI A;  3ZO5 B;  4FN2 A;  4K1R B;  2LAS A;  5JHB A;  2NPT A;  2KC2 A;  3KUC B;  2LUE A;  2OOB B;  2Z0D B;  3RUI B;  3TCA A;  3OAW A;  5L95 C;  3QIJ A;  1EUV B;  2CHZ A;  3V62 A;  4DHJ B;  4NPN A;  2DZI A;  2O6V D;  1Z2M A;  1TBE A;  4WJP A;  4WJQ A;  4MJS A;  2EMS A;  2LVO A;  1XT9 B;  2JUO A;  2MCN B;  1D3Z A;  4KZ0 A;  3OLM D;  3TL5 A;  2KOX A;  5KHQ A;  2CR5 A;  3CMM B;  1LM8 B;  2NBW B;  3PHW B;  1YJ1 A;  2FCN A;  2DYB A;  2L76 A;  4A3P A;  3RZF A;  1Q0W B;  2J0K A;  2CS4 A;  5E6N A;  3SHQ A;  3ALB A;  3ML8 A;  1IPG A;  4BKS A;  2JZ3 B;  2KXJ A;  1V6E A;  2D3G A;  3ZTD A;  2EKE C;  4ZRK A;  4BKT A;  4DXA B;  3PRP B;  5J18 A;  5CHV C;  1NDD A;  2KC1 A;  3RUL A;  4ANV A;  2ZVN A;  2IO3 B;  3OJ4 B;  2ASQ A;  1LQB A;  4J6I A;  3JVZ X;  1J0G A;  3K9P B;  1YX6 B;  3U7D A;  1EO6 A;  2BWF A;  2L7R A;  4TV3 A;  2C7M B;  2PEA A;  4OVV A;  2IO0 B;  3A9K A;  2M0X A;  3L08 A;  4JIO U;  4DWF A;  4MEM A;  4A3O A;  3H1U A;  2O2V B;  3QHT A;  2XEW A;  3RD2 A;  4HVB A;  2LRU A;  3IHP C;  4BOS C;  2LVP A;  3WAP A;  2GMI C;  3NHE B;  5G55 A;  1MG8 A;  3ECI A;  3IBE A;  2JY6 A;  3V6C B;  4WWO A;  2MSE D;  1KJT A;  4ANW A;  2D07 B;  4LDT B;  4G3X B;  1LFD A;  3M62 B;  2V1Y A;  5BO4 B;  2WDT B;  1E7V A;  2N9X A;  1X1M A;  4ICU A;  4I6P A;  3L16 A;  3ML9 A;  4W9D A;  2BYF A;  1G6J A;  3PRZ A;  1WR1 A;  4GN1 A;  4BBN F;  2HD5 B;  2J0J A;  1L7Y A;  1WJ6 A;  1WMH A;  2DHZ A;  3AUL A;  1R4M I;  1S3S G;  2LJ5 A;  3K9O B;  4KIK B;  3KH0 A;  1H8C A;  2J0M A;  2MRP A;  1HE8 A;  2VRR B;  3LDZ E; 
#chains in the Genus database with same CATH topology
 1E10 A;  2R2O A;  4HJG E;  1ISN A;  5IN7 A;  5H92 C;  4W9E A;  1TZ1 A;  2D2Q A;  4NY0 A;  4WAF A;  3SU8 X;  1ZPS A;  5AZH A;  3R2I A;  5I4D A;  3H7P B;  1N5X A;  1N6Z A;  3VUW A;  1AAR A;  3AE6 B;  1WGY A;  3AM9 A;  4F7Z A;  2BBC A;  2L8J A;  2IZV B;  4B0E A;  3U8Z A;  3KQ4 A;  1D5Z C;  1K52 A;  3AE8 B;  3B2F A;  4P6V F;  3WAL A;  1TTN A;  2L83 A;  1QQR A;  1E0Z A;  4IM0 A;  2KWD A;  2PE6 B;  5IOI A;  1WYW B;  2ZW1 A;  4DXG A;  3Q6B A;  1WGD A;  4BBN C;  4DHZ E;  3I9V 1;  3L10 B;  3A9K B;  1VZ6 A;  4ARC A;  4US8 A;  2KDE B;  2DZK A;  2D5G A;  4JX1 C;  3VH3 B;  2D3B A;  1ZW7 A;  2WDQ B;  2LRW A;  4LNN A;  3X23 A;  1YQB A;  3AEG B;  4IDI A;  4CQN A;  2KAN A;  1YOV B;  1VRA B;  3IT4 B;  4WJN A;  1VR9 A;  3P1M A;  3DBH B;  2V3N A;  1EWC A;  1WMH B;  3NJT A;  4E74 A;  1BML C;  5HKH A;  2BKF A;  3AI5 A;  3KUD B;  2WXF A;  2BWE S;  5CTR C;  5GMV A;  4DDI D;  5AZF A;  1UNS A;  3LJ3 A;  2CU3 A;  5JH5 C;  4JWU C;  2MX2 A;  1YNT E;  1C4A A;  2GRI A;  4AUQ C;  2KWC A;  2CHW A;  4PK1 A;  2MBQ A;  4M00 A;  4BVU C;  4LJO B;  2DZJ A;  2R61 A;  1PYW D;  4YSZ B;  3NS1 A;  3SDL C;  3AED B;  4NJ6 A;  1WFY A;  2HJ1 A;  4BZA A;  1FMA D;  1K53 A;  2KTR A;  3MTN B;  1XCT L;  1WE6 A;  2K39 A;  4AOF A;  4USA A;  3WAN A;  4KGS A;  4URK A;  2KK8 A;  4DHJ D;  3PZD A;  4NZL B;  2ZJD A;  4IM3 A;  4MH0 E;  2QIL A;  3I3T B;  1JML A;  2BVC A;  3AU5 A;  1V1O A;  4TMA B;  1GOZ A;  4YTP B;  1S1Q B;  3NY5 A;  4RNA A;  3EEC A;  1OEY J;  1ESF A;  3UF8 A;  1V9J A;  3HUI A;  1KFY B;  2KFK B;  4HK2 A;  3VR9 B;  4HCN B;  2L0F A;  2AX5 A;  2E3T A;  2L3Z A;  4MGY E;  2DAJ A;  1A5R A;  1KOT A;  2INP E;  3QC8 B;  2WHI A;  1UBQ A;  1L0V B;  3LB8 C;  1ET9 A;  1WX7 A;  3NVW A;  4JLC A;  1VLB A;  1C4P A;  2D11 A;  3N9Y C;  4WWN A;  2ZEQ A;  1N62 A;  3JYU A;  3W1Y A;  2H88 B;  4TQ0 A;  1TY0 A;  4LNF A;  1J7C A;  4EOY A;  2K8C A;  4XWT A;  4RMA A;  3Q3N C;  1WYG A;  1HTO A;  1WH3 A;  1DGJ A;  2NBU A;  5BMI A;  5C23 A;  3PSE B;  3DVG X;  4FJY A;  4RM9 A;  3NS8 A;  2V9H A;  4KVG B;  3DVG Y;  2KKC A;  3M95 A;  1EWY C;  2IY1 B;  4RGT A;  5G5G A;  2L1A A;  4HWI B;  1T5X D;  2BB6 A;  3ZRC A;  1E7U A;  4A90 A;  2KDM A;  3NVZ A;  1GAQ B;  4US9 A;  3DBL I;  2L52 A;  3EGR A;  4I6N B;  3R7R A;  4W9H A;  4YT0 B;  2KNB A;  1B9R A;  2LHE A;  3ZKJ C;  2KX3 A;  3BWU D;  2JXT A;  2MP2 A;  2VH2 A;  4FLH A;  1QZE A;  1CZP A;  3VDZ A;  4IM2 A;  4NQK E;  1YN5 A;  1CK1 A;  1E90 A;  4LK0 M;  3UQA A;  2D3A A;  2K8H A;  2WXJ A;  2KHW B;  5JXV A;  2LFI A;  2LEK A;  3TEZ A;  3WCQ A;  4FHJ A;  2W3R A;  3QWZ B;  1P9D U;  3AXC A;  5HFY A;  1E8W A;  1CMX B;  3FIL A;  3PV1 A;  3RNA C;  1FIQ A;  3VTV A;  1FNU A;  4JL9 A;  2Y5B B;  3P4S B;  3T9L A;  4HDO A;  1QIL A;  3DCG A;  1STE A;  1HTQ A;  1GC6 A;  4R3D A;  2UYZ B;  4DXF A;  1E7P B;  1WGH A;  2C5L C;  3VRA B;  2KLG A;  4HRO A;  2CU1 A;  1ZXH A;  3ZYY X;  1WX8 A;  2XK5 B;  2KLC A;  2V4I B;  1I35 A;  4W9J A;  2G4D B;  4EZK A;  2BS4 B;  1T3Q A;  1N5W A;  3VHT C;  2BF8 B;  5CHW A;  4M8M A;  3ETR A;  3AE5 B;  2IY0 B;  2JF5 A;  4XC2 A;  4JWS C;  3U30 A;  2KO3 A;  4PS7 A;  4XGA B;  4DBG A;  2AQ2 B;  4CO7 A;  1C9F A;  4CHK A;  4OZA A;  3BYY B;  2KDF B;  2B76 B;  2PW9 A;  3A4S C;  4KIK A;  2JSV X;  1SJH D;  2QSD A;  2NMQ A;  4GXB A;  1YN4 A;  2GBJ A;  4RGN A;  2W55 A;  5D2M B;  1FO4 A;  1NVI D;  1P7E A;  3IAM 1;  2DEN B;  4EKU A;  3ZXR A;  1MVK A;  1MHH E;  1WXQ A;  1J7B A;  4AJY B;  1I4G A;  2AYO B;  1KRH A;  4IW0 A;  1XEE A;  3DOW A;  4FN2 A;  4K1R B;  2LAS A;  4OZB A;  4YTM B;  3OAW A;  2LGS A;  3QIJ A;  3E56 A;  1TY2 A;  2JUO A;  3TL5 A;  1CJE A;  1LM8 B;  3OWE B;  3PHW B;  4MAC A;  2FCN A;  2KQ4 X;  1TS2 A;  2J0K A;  2QC8 A;  1SIJ A;  1HQR D;  2I38 A;  3ALB A;  1IPG A;  4BKS A;  3Q8B A;  2BQQ A;  2EKE C;  4ZRK A;  4BKT A;  4DXA B;  5J18 A;  5CHV C;  3RUL A;  2IO3 B;  2KVZ A;  1LQB A;  3BVG A;  4TV3 A;  2Y5C A;  4L2Y A;  1PGX A;  4JIO U;  2N0S B;  3QHT A;  2O2V B;  2XEW A;  2LRU A;  2GMI C;  2RMM A;  3NHE B;  3DBR B;  3V6C B;  1SJE D;  1QOF A;  1ZDV A;  2PVO D;  4I6P A;  3L16 A;  1I4X A;  1DOY A;  2PKO A;  4BBN F;  1L7Y A;  2IGD A;  3AUL A;  1R4M I;  2LJ5 A;  2XN9 C;  1HE8 A;  1I4Q A;  1B1Z A;  2J42 A;  5E6P A;  1VZ8 A;  3CIR B;  4ACF A;  4FJV B;  2ZVO A;  1P3Q U;  1FFU A;  2K3U A;  2IDY A;  3VVW B;  2NR2 A;  4II3 B;  5JZE B;  2LZ6 A;  2MEK A;  3B1L X;  4ZHO A;  1P98 A;  3GZN I;  2MBB B;  2WNM A;  4MM3 A;  3SFD B;  2NTS A;  3AE7 B;  4CYE A;  4IUM B;  1F2R C;  3KW5 B;  3PRM B;  2BYT A;  1Z5S B;  3IFW B;  3QAR A;  4MJS B;  4ZDV A;  2DYO A;  1SE4 A;  3DPD A;  5AUI A;  2UWQ A;  4HKQ A;  4IWO A;  4GB9 A;  4GU2 A;  3QCA A;  3W2D A;  3UIN B;  1KF6 B;  2REX A;  3TMP B;  1D5M C;  4MGZ E;  3IXS A;  3JSV A;  3W5U B;  1SSN A;  5FKA C;  4C7Y A;  2K6D B;  3H9D A;  4KSK C;  4FBJ B;  4YSX B;  1IBX A;  2KJ6 A;  3Q3M C;  2LJI A;  2ONQ A;  1SIF A;  2FE8 A;  2Y5P A;  1SE3 A;  3P42 A;  3PO0 A;  3TEW A;  4OVU A;  4HRS A;  1DOI A;  1NI2 A;  5EDS A;  3N32 A;  1L6V A;  3Q69 A;  3SR6 A;  4UDU C;  4ANU A;  2RDB C;  3MHS D;  4B9K A;  4RF1 A;  4I6L B;  4M0W A;  3MP9 A;  5KHO A;  2O6V A;  2BGF A;  2XBB C;  4XX5 A;  3WA0 A;  3WAM A;  4YSY B;  4EZJ A;  4GDL A;  1GG3 A;  3RNE C;  1OFF A;  3AN1 A;  3W1S C;  1V80 A;  1NEN B;  3ZDT A;  3GOE A;  4JQW C;  2WWZ A;  4XE0 A;  2Y3A A;  3NVY A;  3DVN U;  3VFK A;  4PYZ A;  2ZNV B;  3AEE B;  2N9L A;  1WSP A;  3NVV A;  1YIW A;  4XDC A;  2NCN A;  2IGH A;  1QOA A;  3FKY A;  3MC0 B;  3PRE A;  4ASW C;  1YD8 U;  2GBK A;  3DHI C;  1ET6 A;  4WQO B;  1E6E B;  2V4L A;  1Q5W B;  2DBY A;  4ZRP A;  1J8C A;  4MSM B;  1TS4 A;  4HLE A;  5J17 A;  3Q8F A;  4XZ4 A;  4MEL A;  3MC9 A;  3URY A;  2M17 A;  2LGY A;  3HIZ A;  4M8N A;  1FXT B;  1V1P A;  1T0S C;  3QQ8 B;  3X0W A;  3HHM A;  2VH1 A;  4TKN A;  3IVF A;  2FNJ B;  2LGX A;  2RDG A;  5EE0 A;  4GDK A;  3Q3O C;  3WIM A;  4FJZ A;  1P1A A;  1WZ3 A;  1JCK B;  4GSW A;  3GZN B;  5IO9 A;  3RI7 C;  2K6Q A;  3ZXV A;  4FXC A;  5LXI B;  2MBE A;  1IGD A;  1SE2 A;  1VD2 A;  3BII D;  4G50 A;  3VR8 B;  2N7J A;  1E8Z A;  1Q10 A;  1JRO A;  3S2A A;  2PE9 A;  3U4E G;  4BKG A;  3VH4 B;  2G1E A;  3TSS A;  3NOB A;  5HG2 A;  2KN4 A;  4HDQ A;  5DPW A;  4NAW A;  2OED A;  4KKJ A;  1FCL A;  3A9J A;  2L0T A;  1AYF A;  1XLN A;  2LXC A;  3WAO A;  1WX9 A;  4XYC A;  4G11 A;  1SEB D;  3A1Q A;  1RLF A;  2GBN A;  1WF9 A;  3UGB B;  4B95 A;  1RFA A;  2JWZ A;  2M56 B;  2JZZ A;  2DYM A;  5IAA C;  5LXH A;  1ACC A;  3V60 A;  1WRI A;  3FIL B;  3O65 B;  4E3C A;  2IPK D;  1MJD A;  4KV2 A;  3RT3 B;  3PZ8 A;  4BKS D;  2J7Q B;  5L83 A;  1TKE A;  3VTW A;  1JQ4 A;  2FAZ A;  3EFC A;  3CWI A;  2KJR A;  2LWP A;  3SD5 A;  2K1F A;  2RR9 A;  1V5T A;  3H6N A;  3I63 C;  3PLV A;  3MC8 A;  4LTU A;  1F9J A;  1HXY D;  3QA8 A;  2QJL A;  4F1S A;  3Q3J A;  2K0P A;  2IO2 B;  2MBH A;  1NI3 A;  1UWX A;  3LXF A;  2HTM E;  1TYG B;  4DQO C;  1U4A A;  1IP9 A;  5DPR A;  1FXA A;  4AQ7 A;  4M02 A;  1HZ6 A;  3APC A;  4W9L A;  2BKR B;  3T3O A;  5JHA A;  3HK0 A;  4ZHP A;  4XWW A;  3DQV A;  4IWQ A;  2OJW A;  1WRD B;  4F8C B;  1C79 A;  4OVZ A;  1F1H A;  2MW5 A;  5MPO A;  2VZK D;  3BY4 B;  4A8X C;  4YXD B;  1D6E C;  3N30 A;  2C7H A;  3OG5 A;  3AU4 A;  2NS5 A;  2J4X A;  2KFJ A;  2ON8 A;  4HCP B;  1FRR A;  4J3O D;  4KZC A;  4JPS A;  1YJI A;  4K7U A;  4OZC A;  1J19 A;  4II2 B;  2MLB A;  1HZ5 A;  1ZGU B;  4GMV A;  2JRI B;  2BS3 B;  2MQJ A;  4P1B C;  1IUE A;  3FAH A;  1WGK A;  2BYV E;  3ZUN A;  5H8Y E;  3P4Q B;  2EKI A;  4ICV A;  1YQ4 B;  4DHZ B;  3ZO5 B;  2NPT A;  1DYQ A;  3ZJT A;  2OOB B;  3TCA A;  1EUV B;  2CHZ A;  3V62 A;  4DHJ B;  2DZI A;  2O6V D;  1TBE A;  2KT7 A;  2MCN B;  2WXN A;  4C00 A;  3LYY A;  4N59 A;  3RZF A;  2WXG A;  2CS4 A;  2BT6 A;  3I5J C;  1D4B A;  3ZTD A;  1V6E A;  3PRP B;  2WXO A;  2M0A A;  1AW7 A;  3OJ4 B;  4J6I A;  2LMC A;  3KLS X;  1YX6 B;  3U7D A;  2EEL A;  1EO6 A;  4M01 A;  3I57 A;  2L7R A;  2C7M B;  4OVV A;  3A9K A;  1DOX A;  4MEM A;  3NRZ A;  1TT5 B;  2INN E;  2MH7 A;  3BZD B;  1MG8 A;  5G55 A;  2JY6 A;  2KMM A;  3N1Z C;  1LFD A;  3M62 B;  2V1Y A;  5BO4 B;  2WDT B;  2N9X A;  3L4P A;  1X1M A;  2UU7 A;  4W9D A;  5E6O A;  4C4V A;  1WMH A;  2XNA C;  2KAJ A;  1GB1 A;  4YWG G;  3RPF C;  2L32 A;  1I4H A;  2Z59 B;  3T8M A;  5D7G A;  3KUZ A;  1PGA A;  2CJO A;  2FIF A;  4PS8 A;  3DWM A;  4ZOH C;  3N20 C;  2JZP A;  1KTK A;  3R66 C;  2PIA A;  4NJC A;  4LNO A;  3TJP A;  3QJZ A;  2JWU A;  2OJR A;  4K7W A;  3DWG C;  4HPL B;  2K5P A;  3R3M A;  1V49 A;  1TGZ B;  5LLI A;  1WGR A;  4LJP B;  3ZDM C;  4E71 A;  3IT6 B;  4HXD A;  4GDL B;  3Q2A C;  1L0Y B;  2R2Q A;  3APF A;  5C3J B;  3EA6 A;  2WU2 B;  1YQ3 B;  1H4R A;  1JRU A;  3ZVV A;  2ZNV C;  3R2T A;  1OQQ A;  2RD0 A;  5LNK 1;  5TR5 A;  4KGT A;  3GB1 A;  4RM8 A;  1GPX A;  3AH7 A;  2M1M A;  4O1N A;  2LD9 A;  3ZJU A;  4IKG A;  1NYR A;  1YX5 B;  3ZNZ B;  2GB1 A;  2N9K A;  2WXM A;  2KJH B;  1VDV A;  4RFB A;  2A5U A;  3C0R B;  3Q3F A;  1D5X C;  2WXQ A;  3PS6 A;  4BOZ B;  3E9S A;  3UIP B;  3ZNH B;  2GLS A;  2KWV B;  3NZS A;  2PPH A;  1WJ4 A;  3DBL B;  4TSS A;  2KX0 A;  3UQB A;  3BIN A;  1UGM A;  1FCC C;  3GS2 A;  1E5W A;  4P16 A;  2X8X X;  4MSQ B;  4W9F A;  3NG0 A;  3KVF B;  4K81 A;  4MGK E;  3NUH B;  1XLP A;  2W3S A;  3M3J A;  4AWJ A;  3L0W B;  1HEZ E;  2FID A;  4ZRJ A;  1NBF C;  5DPT A;  3VUX A;  2M19 A;  1JW9 D;  3U52 E;  2DZM A;  2WDV B;  2AWT A;  3ZNI D;  2K25 A;  4EEW A;  1XF5 L;  3Q14 C;  2ZZP B;  1OQY A;  5TSS A;  2N4F A;  2LVQ A;  1RAX A;  3VAW A;  2JU6 X;  2DWQ A;  4MH8 A;  5IA7 A;  3KWL A;  2J52 A;  5BYS A;  1WM3 A;  4HJK A;  2BB5 A;  4GGQ A;  5EE9 A;  2A4Z A;  3AB5 A;  4NAW B;  1CQV A;  3A9J B;  4W9K A;  2YVC A;  3BYT B;  2FCM A;  3A1Q B;  1OQR A;  2KVR A;  2QEJ C;  4FAD A;  2OHF A;  1MG4 A;  4MT5 A;  1ZUD 2;  2LXA A;  4LDT D;  1WIA A;  4RF0 A;  2FBW B;  2RPQ A;  3HM3 A;  4PS3 A;  4B6W A;  5FR3 A;  1XD3 B;  4X57 B;  2MJ3 A;  1GJZ A;  4WWP A;  3TEY A;  5GXG B;  1RWS A;  2N1W A;  4GIV A;  3QX1 A;  1WWT A;  2WX0 A;  3U7Z A;  2KTF A;  2KMA A;  5FK9 C;  5J2R A;  2KMC A;  2IBI B;  1N61 A;  2N7E A;  4NNJ B;  2LHD A;  3ABV B;  4W9I A;  1I4P A;  4TUU A;  3DBH I;  1C4C A;  2KTR B;  2XK5 A;  2W9N A;  4NJ7 A;  2FCQ A;  1TS5 A;  1XXG A;  5BYQ A;  4S0R A;  3RNB C;  1T0R C;  1EU3 A;  1K50 A;  3DDC B;  4DK5 A;  2JX5 A;  3RMK C;  2KWU B;  2IGG A;  1YN3 A;  4RH6 A;  3ZTC A;  4BFR A;  2V3P A;  1A70 A;  4A9A A;  1L0X B;  4RGO S;  4ITK A;  1F0Z A;  2HE7 A;  2D10 A;  2W54 A;  5HHD G;  3A4R A;  2V3S A;  1I4R A;  2JVC A;  3O13 A;  1XLO A;  2JYT A;  2X38 A;  2QDF A;  2ZCC A;  3HVZ A;  1Y56 A;  3ENE A;  5AZG A;  2AQ3 B;  4FUL A;  3TEX A;  5BYR A;  3VUY A;  2PVG C;  4KSL C;  4D2K A;  4IC7 B;  4NQL B;  2DX5 B;  2MJD A;  1UZX B;  3KYD D;  2WX1 A;  1TS3 A;  2CHX A;  2G9H D;  3AEF B;  1C1Y B;  1BT0 A;  2BTE A;  3N1X C;  2KQS A;  5E6J A;  4A20 A;  1UUP A;  1WE7 A;  3QAQ A;  1QKZ A;  1WXS A;  1L6U A;  2E6X A;  4LNK A;  1GNU A;  2AL6 A;  3AE3 B;  3UIO B;  2NVU I;  1YJJ A;  4S17 A;  2N1V A;  1MPE A;  2L05 A;  1SB3 C;  1L4D B;  1SBB B;  1L4Z B;  2WXI A;  4G0N B;  1R4M B;  2WQY B;  3PHX B;  5EE3 A;  4P1C C;  4HPP A;  2JPH A;  2MJE A;  1RYJ A;  2AEH A;  3FC4 A;  1TKG A;  2N7D A;  2O2V A;  1V97 A;  2NPT B;  1RM6 C;  3B08 A;  1E8X A;  2N9P C;  3EHV A;  4ANX A;  5AEK B;  4ZYS A;  3GP7 A;  2EMT A;  5G5H A;  3RN9 C;  1KLU D;  4C56 C;  4REZ A;  1WXM A;  2MP2 B;  1JWU D;  2BS2 B;  3RCZ A;  4AS1 A;  4HKZ E;  3BK2 A;  2WXL A;  1F77 A;  3GE3 C;  1P0R A;  2DLB A;  2MHJ A;  1GUA B;  3AMZ A;  1AWD A;  2QMT A;  2I1J A;  2HJ8 A;  4WUR A;  3ZJV A;  2M8S A;  1QOG A;  3B2G A;  1KM7 A;  2YEP B;  4N58 A;  5D6J B;  2IO1 B;  1ENF A;  2KDB A;  2ICI A;  3V05 A;  3ZNG C;  5JHB A;  3NZ3 A;  5L95 C;  3AEA B;  3R8B A;  1JWS D;  1F52 A;  4NPN A;  2CJN A;  1Z2M A;  1QF6 A;  4WJP A;  4WJQ A;  4MJS A;  2EMS A;  2LVO A;  1XT9 B;  1FNW A;  2PLP A;  2KOX A;  5KHQ A;  4WIP A;  2CR5 A;  3SEB A;  4C4V B;  1YJ1 A;  1PFD A;  1FEH A;  1HA5 A;  2DYB A;  1Q0W B;  2DNF A;  3ML8 A;  2JZ3 B;  3AEB B;  2D3G A;  3C19 A;  4YTN B;  1NDD A;  2ZVN A;  3JVZ X;  1J0G A;  1EM7 A;  2BWF A;  2WGS A;  2HDE A;  2PEA A;  2IO0 B;  3B9J A;  2M0X A;  2IND C;  4A3O A;  3RD2 A;  4BOS C;  5D3I B;  3ECI A;  3IBE A;  1KLG D;  1ZXI A;  1N63 A;  1LO5 D;  4ANW A;  4G3X B;  4LLG M;  2PTL A;  1E7V A;  3MFG A;  4ICU A;  1KH0 A;  1G6J A;  3PZ7 A;  1IGC A;  2J0J A;  3K9O B;  1WJ6 A;  4KIK B;  1H8C A;  2J0M A;  1ROE A;  4WAA A;  4W9C A;  4ARI A;  2LUM A;  5FR6 A;  2JQR B;  1V86 A;  2Z8L A;  3MHZ A;  3VQI A;  1UWM A;  3PPA A;  4ZRQ A;  1WGG A;  2JXX A;  1WR6 E;  3HVD A;  3PGE A;  1FRD A;  5CHF A;  1MFW A;  2K22 A;  2K9X A;  3IG3 A;  3NZU A;  1C76 A;  4AJW A;  4HEA 1;  4B0M A;  1FFV A;  4K7S A;  3B0A A;  1XLQ A;  1WJN A;  3VXW A;  1R4N I;  1I7H A;  4LCD E;  1C78 A;  1JAL A;  1TIF A;  3KWV A;  4JGH B;  4N9F 4;  1KLV A;  4KGR A;  2KD0 A;  2RSU A;  4OHJ A;  4BAX A;  2I1K A;  3RYT A;  3ZIM A;  1IYF A;  2L00 B;  3DHG C;  5BMH A;  1MHX A;  1T0Q C;  1LXD A;  2WS3 B;  3H7P A;  5C1Z A;  1J7A A;  3CF6 E;  4KKI A;  1V5O A;  3AE2 B;  3UI3 A;  2JT4 B;  2C7N B;  3BK1 A;  1EU4 A;  4RGM A;  2LGI A;  1SGH A;  2BW2 A;  1PDX A;  2LI5 A;  2ZCB A;  2WXP A;  1PGB A;  3ONS A;  3ZW3 A;  1V8C A;  2FUH B;  2D3C A;  3MJ5 A;  1E8Y A;  1JWA D;  1UH6 A;  1SE9 A;  2YLM A;  3APD A;  3RZW C;  2WLB A;  3HRD D;  2ZPN A;  2IJ0 A;  3SFE B;  4MM3 B;  4DDG D;  1XCQ L;  4AP4 C;  2MWS B;  2YEP F;  3ZQ4 A;  3DBR I;  2RDH A;  1WZ0 A;  3QK0 A;  4RCO A;  5BMG A;  2VZK B;  2SEB D;  4W9G A;  1M4V A;  2WDR B;  4HPM B;  1FD6 A;  2NTT A;  4WH4 A;  3A33 B;  2JYE A;  3TBL D;  1FNV A;  1NYQ A;  2RGF A;  3L13 A;  3JSV B;  4A55 A;  3N1Y C;  1VJK A;  1QLB B;  1TZO A;  4WQM A;  3RFZ B;  1T6B X;  2NBV B;  4P7I A;  3C8Y A;  1E9M A;  3JW0 X;  2ZW0 A;  1IBX B;  2C9W B;  3EFU A;  3H7S A;  3V6E B;  1YMH E;  1QOB A;  1ZDX A;  1R7S A;  1UGJ A;  2I2Y A;  3RNC C;  3L17 A;  4EZL A;  2FCS A;  1TJE A;  4IG7 B;  3L54 A;  1WJU A;  2W82 A;  2B3A A;  2KQ7 A;  4GLS C;  4FA6 A;  5DCN A;  4M0W B;  2WXR A;  2GBM A;  2SAK A;  3TIX A;  2O6V B;  1OTR B;  1L2N A;  4KDL B;  3HM6 X;  4EE2 A;  2M4N A;  3RNG C;  2RPV A;  1Q1O A;  5AUK A;  3TUO A;  1WXV A;  3EUB 2;  4LNI A;  1GC7 A;  3W1S A;  1XQQ A;  1PUT A;  1FPY A;  4L1B A;  3KYC D;  3EC8 A;  5HI1 A;  1JWM D;  1R4N B;  1RRB A;  3DVN V;  1TKY A;  2KFK A;  5D94 A;  5T8I A;  3CSF A;  5CX3 A;  3W5V B;  3P4P B;  3IAS 1;  2QCZ A;  2G3Q B;  2AQ1 B;  1UD7 A;  3D32 A;  4TQ1 A;  3RNF C;  1L5P A;  1OEY A;  3DBS A;  2BYE A;  4K3C A;  1V2Y A;  1AN8 A;  2INC C;  3AE9 B;  1OGW A;  2J53 A;  3M63 B;  2AL3 A;  4PYU A;  2ZPY A;  1P7F A;  2G4S A;  3DHH C;  3ZRF A;  1T0Y A;  4IOI E;  1NEK B;  1V1P B;  4ZRI A;  2K8B A;  2C60 A;  1MI0 A;  4N6E B;  1K8R B;  1ZP0 B;  4H2A A;  1SF0 A;  2KAC A;  3PLU A;  5G2N A;  1EF1 A;  1C77 A;  3BVM A;  2QIE B;  4GDK B;  4C80 A;  5EE1 A;  3ZLZ A;  1WY8 A;  2GOW A;  1C3T A;  1WI0 A;  1WM2 A;  1ZKH A;  1SXT A;  2DAF A;  2WU5 B;  2WXH A;  4FHK A;  4KDI C;  3AE4 B;  3H8H A;  2FUG 1;  4PT5 A;  1LGR A;  3AE1 B;  2KDI A;  1WXA A;  2BPS A;  3PTF C;  3AEC B;  3Q8C A;  1N60 A;  2MBO A;  3MJW A;  4MDK E;  3V61 A;  2G45 B;  4Q2J A;  3N3K B;  4KX6 B;  1M94 A;  4GOC A;  1BUI C;  1I42 A;  2PMV A;  4OW0 A;  3PVL A;  5DPS A;  3AV8 A;  3P4R B;  3ZGZ A;  3R7Q A;  4C7Z A;  3PT2 B;  1ZE3 D;  4YL8 A;  1FXI A;  3VTU A;  5IP4 D;  2CKH B;  1JRP A;  1PQS A;  2WYQ A;  3P63 A;  2PJH A;  1XO3 A;  2KZR A;  1UEL A;  2GBR A;  1EF5 A;  3Q8A A;  4ZYN A;  2KN5 A;  2JRH A;  4EFO A;  2TSS A;  4NAM A;  2KYW A;  1F2R I;  1VCB A;  1Y8R C;  2ACZ B;  2WXK A;  3OJ3 A;  1K51 A;  3V3X A;  3J9C A;  2HTH A;  1V81 A;  2LGD A;  4WJO A;  2QHO A;  3U2S C;  1ZOY B;  4IWP A;  2MA9 B;  5D3D A;  4JE3 B;  2Z0E B;  4EUT A;  2IYD B;  3P2B A;  3CST A;  2WP9 B;  4MGI E;  1UF0 A;  2N9E B;  4WWM A;  1UBI A;  2KC2 A;  3KUC B;  2LUE A;  2Z0D B;  3RUI B;  1GB4 A;  1D3Z A;  2V0G A;  3GE8 C;  4KZ0 A;  1JWB D;  3OLM D;  3CMM B;  4A6Q A;  5IKC M;  2NBW B;  2L76 A;  4A3P A;  5E6N A;  3SHQ A;  4XDD A;  5C2T B;  2KXJ A;  3VRB B;  2KC1 A;  4ANV A;  1QT9 A;  2H89 B;  2ASQ A;  3BVZ A;  3K9P B;  4QAY A;  3L08 A;  4DWF A;  3H1U A;  4HVB A;  2Q5W D;  3IHP C;  2GI9 A;  2LVP A;  3WAP A;  1VZ7 A;  1FM0 D;  4WWO A;  2MSE D;  1KJT A;  4L23 A;  1BXT A;  2D07 B;  4LDT B;  3W9C B;  3T3N A;  3Q8E A;  1RFK A;  3ML9 A;  2BYF A;  3PRZ A;  4K3B A;  1WR1 A;  4GN1 A;  2HD5 B;  2DHZ A;  1S3S G;  3KH0 A;  2MRP A;  2VRR B;  3LDZ E; 
#chains in the Genus database with same CATH homology
 4FJV B;  2ZVO A;  2R2O A;  1P3Q U;  4WAA A;  4W9C A;  1ISN A;  2Z59 B;  5FR6 A;  3T8M A;  3VVW B;  4W9E A;  2NR2 A;  1V86 A;  4II3 B;  1TZ1 A;  2D2Q A;  5JZE B;  5D7G A;  3VQI A;  2LZ6 A;  4NY0 A;  3B1L X;  3SU8 X;  1P98 A;  3KUZ A;  3GZN I;  2MBB B;  3PPA A;  1WGG A;  4MM3 A;  5AZH A;  2FIF A;  2JXX A;  1WR6 E;  4PS8 A;  3PGE A;  3H7P B;  4CYE A;  3VUW A;  4IUM B;  5CHF A;  1AAR A;  1WGY A;  3R66 C;  3KW5 B;  4F7Z A;  2L8J A;  2IZV B;  3IG3 A;  3NZU A;  3PRM B;  3U8Z A;  4AJW A;  3TJP A;  1Z5S B;  3QJZ A;  3IFW B;  3QAR A;  2OJR A;  4K7W A;  4MJS B;  2DYO A;  4K7S A;  4ZDV A;  3B0A A;  3DPD A;  1WJN A;  2UWQ A;  3WAL A;  4IWO A;  1TTN A;  4GB9 A;  4HPL B;  3VXW A;  1R4N I;  4GU2 A;  3R3M A;  1V49 A;  3QCA A;  1TGZ B;  3UIN B;  5LLI A;  1WGR A;  4LCD E;  4LJP B;  2REX A;  4IM0 A;  3TMP B;  3ZDM C;  4E71 A;  4HXD A;  2PE6 B;  4GDL B;  4MGZ E;  3JSV A;  4JGH B;  4N9F 4;  1KLV A;  1WYW B;  2R2Q A;  3APF A;  2K6D B;  2KD0 A;  2RSU A;  3H9D A;  4KSK C;  1WGD A;  4BBN C;  2I1K A;  4DHZ E;  4FBJ B;  2KJ6 A;  3RYT A;  3L10 B;  3ZIM A;  1IYF A;  2L00 B;  1SIF A;  1H4R A;  3A9K B;  1JRU A;  3ZVV A;  1LXD A;  2ZNV C;  2KDE B;  2DZK A;  3H7P A;  5C1Z A;  3VH3 B;  2RD0 A;  1ZW7 A;  2LRW A;  3X23 A;  3CF6 E;  1V5O A;  1YQB A;  5TR5 A;  4OVU A;  2JT4 B;  4RM8 A;  2C7N B;  1NI2 A;  2KAN A;  2M1M A;  5EDS A;  3N32 A;  4WJN A;  2LD9 A;  1SGH A;  4ANU A;  2LI5 A;  2ZCB A;  3ONS A;  1YX5 B;  3MHS D;  3ZW3 A;  4B9K A;  3ZNZ B;  2FUH B;  1WMH B;  4I6L B;  4E74 A;  2KJH B;  5KHO A;  5HKH A;  2BKF A;  2O6V A;  2BGF A;  2XBB C;  4XX5 A;  2A5U A;  3C0R B;  3Q3F A;  3WA0 A;  3AI5 A;  3WAM A;  3PS6 A;  1E8Y A;  3KUD B;  4BOZ B;  3UIP B;  4GDL A;  2BWE S;  5CTR C;  5GMV A;  1GG3 A;  3ZNH B;  4DDI D;  5AZF A;  2KWV B;  3NZS A;  1UH6 A;  2PPH A;  3LJ3 A;  1V80 A;  1WJ4 A;  3W1S C;  3ZDT A;  3GOE A;  1SE9 A;  2YLM A;  3APD A;  4JQW C;  3RZW C;  5JH5 C;  2WWZ A;  2KX0 A;  3UQB A;  2ZPN A;  2MX2 A;  3BIN A;  1UGM A;  4DDG D;  1E5W A;  3DVN U;  4AP4 C;  4AUQ C;  2MWS B;  3VFK A;  2KWC A;  2CHW A;  4MSQ B;  4W9F A;  4PYZ A;  3DBR I;  1WZ0 A;  2ZNV B;  2MBQ A;  3QK0 A;  4BVU C;  1YIW A;  3KVF B;  4K81 A;  2NCN A;  4LJO B;  2DZJ A;  4MGK E;  3SDL C;  3PRE A;  4ASW C;  4NJ6 A;  1WFY A;  3M3J A;  4W9G A;  4AWJ A;  1YD8 U;  2GBK A;  4HPM B;  2KTR A;  3L0W B;  3MTN B;  4WQO B;  2FID A;  2V4L A;  4ZRJ A;  1Q5W B;  1WE6 A;  1NBF C;  2K39 A;  4AOF A;  5DPT A;  3A33 B;  3VUX A;  3WAN A;  3TBL D;  4URK A;  1J8C A;  4MSM B;  2DZM A;  2KK8 A;  4HLE A;  4DHJ D;  3PZD A;  5J17 A;  2AWT A;  2ZJD A;  4XZ4 A;  4IM3 A;  2RGF A;  4MH0 E;  3ZNI D;  3L13 A;  4MEL A;  2K25 A;  3I3T B;  3JSV B;  4EEW A;  2ZZP B;  1OQY A;  2M17 A;  2LGY A;  2LVQ A;  1RAX A;  2N4F A;  3AU5 A;  3VAW A;  4P7I A;  2NBV B;  3HIZ A;  3JW0 X;  4M8N A;  1S1Q B;  3NY5 A;  2C9W B;  1FXT B;  5IA7 A;  3EEC A;  3EFU A;  1WM3 A;  3H7S A;  1OEY J;  4HJK A;  3V6E B;  4GGQ A;  3UF8 A;  2A4Z A;  1V9J A;  3QQ8 B;  4NAW B;  3X0W A;  3HHM A;  3A9J B;  4TKN A;  2KFK B;  4HK2 A;  3IVF A;  4W9K A;  3L17 A;  2YVC A;  2FCS A;  4EZL A;  2FNJ B;  2LGX A;  4HCN B;  4IG7 B;  2FCM A;  2L0F A;  3L54 A;  1WJU A;  3A1Q B;  2L3Z A;  2B3A A;  2DAJ A;  2KVR A;  4MGY E;  2KQ7 A;  1A5R A;  4GDK A;  4FA6 A;  1KOT A;  3QC8 B;  4FAD A;  5DCN A;  3WIM A;  4FJZ A;  1UBQ A;  1P1A A;  2LXA A;  1WX7 A;  1WZ3 A;  4M0W B;  4JLC A;  4GSW A;  2GBM A;  3TIX A;  2O6V B;  4LDT D;  1OTR B;  1WIA A;  1L2N A;  2K6Q A;  4KDL B;  3HM6 X;  2D11 A;  2M4N A;  5LXI B;  4WWN A;  1Q1O A;  2MBE A;  2ZEQ A;  1VD2 A;  4G50 A;  2RPQ A;  3JYU A;  3W1Y A;  1E8Z A;  1WXV A;  3HM3 A;  4PS3 A;  4B6W A;  4TQ0 A;  4EZJ A;  1GC7 A;  3S2A A;  3W1S A;  4EOY A;  1XD3 B;  2PE9 A;  2K8C A;  1XQQ A;  4RMA A;  4X57 B;  1GJZ A;  4BKG A;  4WWP A;  3VH4 B;  2N1W A;  3KYC D;  4GIV A;  3QX1 A;  2WX0 A;  3EC8 A;  3NOB A;  2KTF A;  1RRB A;  2KMA A;  4HDQ A;  5DPW A;  4NAW A;  5J2R A;  2KMC A;  2IBI B;  3DVN V;  3A9J A;  2L0T A;  2N7E A;  1WH3 A;  2KFK A;  4NNJ B;  5D94 A;  2NBU A;  2LXC A;  5C23 A;  3WAO A;  1WX9 A;  4W9I A;  4TUU A;  3PSE B;  3DBH I;  4G11 A;  3CSF A;  3DVG X;  4FJY A;  4RM9 A;  2KTR B;  3A1Q A;  3NS8 A;  5CX3 A;  2XK5 A;  4KVG B;  1RLF A;  2W9N A;  3DVG Y;  2KKC A;  3M95 A;  4NJ7 A;  2GBN A;  1WF9 A;  2IY1 B;  3UGB B;  4B95 A;  2FCQ A;  2G3Q B;  1RFA A;  1UD7 A;  2JWZ A;  3D32 A;  4TQ1 A;  5E6P A;  1OEY A;  4HWI B;  2JZZ A;  3DBS A;  3ZRC A;  2BYE A;  1E7U A;  1V2Y A;  2DYM A;  5IAA C;  5LXH A;  3DBL I;  3V60 A;  4I6N B;  3DDC B;  3R7R A;  4DK5 A;  4W9H A;  1OGW A;  2KWU B;  3M63 B;  2AL3 A;  4PYU A;  3ZTC A;  3O65 B;  4BFR A;  2KNB A;  4E3C A;  2ZPY A;  4KV2 A;  2G4S A;  3RT3 B;  3ZKJ C;  3ZRF A;  2KX3 A;  1T0Y A;  4BKS D;  2HE7 A;  2D10 A;  2J7Q B;  2MP2 A;  5L83 A;  4ZRI A;  3VTW A;  4FLH A;  2K8B A;  3A4R A;  2V3S A;  1QZE A;  2C60 A;  2JVC A;  3VDZ A;  4IM2 A;  4NQK E;  2FAZ A;  1K8R B;  2ZCC A;  1E90 A;  3ENE A;  3PLU A;  5G2N A;  3UQA A;  2KJR A;  2LWP A;  5AZG A;  4FUL A;  2K1F A;  3SD5 A;  1EF1 A;  3VUY A;  2RR9 A;  4KSL C;  2K8H A;  4IC7 B;  4NQL B;  2DX5 B;  1UZX B;  3KYD D;  1V5T A;  3H6N A;  4GDK B;  2WX1 A;  3ZLZ A;  2CHX A;  2KHW B;  1WY8 A;  1C1Y B;  2GOW A;  1C3T A;  1BT0 A;  3PLV A;  4FHJ A;  1WI0 A;  1WM2 A;  1ZKH A;  2KQS A;  4A20 A;  3QWZ B;  1P9D U;  1F9J A;  2DAF A;  5E6O A;  3QA8 A;  1WE7 A;  3AXC A;  3QAQ A;  4FHK A;  4KDI C;  4F1S A;  1E8W A;  3Q3J A;  1WXS A;  1CMX B;  2IO2 B;  3PV1 A;  3VTV A;  2MBH A;  2KDI A;  1GNU A;  1WXA A;  2AL6 A;  2BPS A;  2Y5B B;  4JL9 A;  3T9L A;  4HDO A;  3UIO B;  3PTF C;  2NVU I;  3DCG A;  2N1V A;  2MBO A;  1GC6 A;  2L05 A;  3MJW A;  1U4A A;  1IP9 A;  2UYZ B;  4MDK E;  5DPR A;  3V61 A;  1WGH A;  4G0N B;  2G45 B;  2C5L C;  3N3K B;  1M94 A;  4GOC A;  2KLG A;  3APC A;  3PHX B;  4W9L A;  1I42 A;  2BKR B;  5JHA A;  2CU1 A;  3HK0 A;  2JPH A;  1WX8 A;  2XK5 B;  3PVL A;  2KLC A;  3DQV A;  4IWQ A;  5DPS A;  1I35 A;  4W9J A;  1WRD B;  3R7Q A;  2G4D B;  4F8C B;  4EZK A;  2AEH A;  3PT2 B;  3VHT C;  2BF8 B;  5CHW A;  2MW5 A;  4M8M A;  2N7D A;  4YL8 A;  3BY4 B;  2O2V A;  3VTU A;  2CKH B;  2IY0 B;  1PQS A;  2JF5 A;  2NPT B;  3N30 A;  2C7H A;  4XC2 A;  3AU4 A;  3B08 A;  2WYQ A;  1E8X A;  2N9P C;  2NS5 A;  2PJH A;  3EHV A;  4ANX A;  2KZR A;  1UEL A;  2GBR A;  1EF5 A;  5AEK B;  2KFJ A;  2EMT A;  4ZYN A;  2KN5 A;  4HCP B;  3U30 A;  2JRH A;  2KO3 A;  4PS7 A;  4DBG A;  4EFO A;  4KZC A;  1WXM A;  4CO7 A;  2MP2 B;  4CHK A;  3RCZ A;  4K7U A;  1J19 A;  4II2 B;  2KDF B;  1VCB A;  1Y8R C;  3A4S C;  4KIK A;  3OJ3 A;  2MLB A;  4GXB A;  1P0R A;  1ZGU B;  4GMV A;  2GBJ A;  1GUA B;  2HTH A;  2JRI B;  2I1J A;  5D2M B;  1V81 A;  2LGD A;  4WJO A;  2QHO A;  2HJ8 A;  2MQJ A;  2DEN B;  4IWP A;  2MA9 B;  2M8S A;  4EKU A;  1KM7 A;  2BYV E;  5D6J B;  3ZUN A;  2IO1 B;  2Z0E B;  4EUT A;  2IYD B;  2KDB A;  3P2B A;  3ZNG C;  4AJY B;  3CST A;  4ICV A;  2AYO B;  4MGI E;  4IW0 A;  2N9E B;  4DHZ B;  3DOW A;  1UBI A;  3ZO5 B;  4FN2 A;  4K1R B;  2LAS A;  5JHB A;  2NPT A;  2KC2 A;  3KUC B;  2LUE A;  2OOB B;  2Z0D B;  3RUI B;  3TCA A;  3OAW A;  5L95 C;  3QIJ A;  1EUV B;  2CHZ A;  3V62 A;  4DHJ B;  4NPN A;  2DZI A;  2O6V D;  1Z2M A;  1TBE A;  4WJP A;  4WJQ A;  4MJS A;  2EMS A;  2LVO A;  1XT9 B;  2JUO A;  2MCN B;  1D3Z A;  4KZ0 A;  3OLM D;  3TL5 A;  2KOX A;  5KHQ A;  2CR5 A;  3CMM B;  1LM8 B;  2NBW B;  3PHW B;  1YJ1 A;  2FCN A;  2DYB A;  2L76 A;  4A3P A;  3RZF A;  1Q0W B;  2J0K A;  2CS4 A;  5E6N A;  3SHQ A;  3ALB A;  3ML8 A;  1IPG A;  4BKS A;  2JZ3 B;  2KXJ A;  1V6E A;  2D3G A;  3ZTD A;  2EKE C;  4ZRK A;  4BKT A;  4DXA B;  3PRP B;  5J18 A;  5CHV C;  1NDD A;  2KC1 A;  3RUL A;  4ANV A;  2ZVN A;  2IO3 B;  3OJ4 B;  2ASQ A;  1LQB A;  4J6I A;  3JVZ X;  1J0G A;  3K9P B;  1YX6 B;  3U7D A;  1EO6 A;  2BWF A;  2L7R A;  4TV3 A;  2C7M B;  2PEA A;  4OVV A;  2IO0 B;  3A9K A;  2M0X A;  3L08 A;  4JIO U;  4DWF A;  4MEM A;  4A3O A;  3H1U A;  2O2V B;  3QHT A;  2XEW A;  3RD2 A;  4HVB A;  2LRU A;  3IHP C;  4BOS C;  2LVP A;  3WAP A;  2GMI C;  3NHE B;  5G55 A;  1MG8 A;  3ECI A;  3IBE A;  2JY6 A;  3V6C B;  4WWO A;  2MSE D;  1KJT A;  4ANW A;  2D07 B;  4LDT B;  4G3X B;  1LFD A;  3M62 B;  2V1Y A;  5BO4 B;  2WDT B;  1E7V A;  2N9X A;  1X1M A;  4ICU A;  4I6P A;  3L16 A;  3ML9 A;  4W9D A;  2BYF A;  1G6J A;  3PRZ A;  1WR1 A;  4GN1 A;  4BBN F;  2HD5 B;  2J0J A;  1L7Y A;  1WJ6 A;  1WMH A;  2DHZ A;  3AUL A;  1R4M I;  1S3S G;  2LJ5 A;  3K9O B;  4KIK B;  3KH0 A;  1H8C A;  2J0M A;  2MRP A;  1HE8 A;  2VRR B;  3LDZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...