4PZ0A

The crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
b'DKKKADDVKFAFIPKLTGVGFFTSGGEGAKEMGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDALMVSSTSVDGLSQSLQRAKKKGMTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAKEIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENLKMDKKVVVTGFSTPNVMRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar ABC transporter, sugar-binding protein
publication title The crystal structure of a solute binding protein from Bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (AI-2).
rcsb
source organism Bacillus anthracis
molecule tags Sugar binding protein
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pz0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pz0A01
5IUKC 1JDNA 3A3KA 3FMVA 3BRSA 3SAJA 3QLUC 2MYPA 3MYYA 4D6XA 4F3TA 2IYNA 1WETA 1ZH4A 5IUJC 1E2BA 1K68A 3EODA 3MF4A 3RVJA 3QK7A 3DGEC 3RVQA 4Q6BA 4QICA 1Z17A 2PE5A 1L5YA 1Z26A 4P98A 3IP5A 4KPYA 4WWHA 5KC8A 4Z4IA 3QLTA 1LBHA 5TPWA 2F8TA 2LPMA 2NZUG 3NHZA 4Z4GA 3GWGA 3LUCA 3N0RA 1Z16A 2FMKA 3Q41A 4IMIB 4LE0A 3QLVA 1TMYA 1EWVA 4RK7A 1YTUA 1GUBA 4OLBA 1JL3A 2A9PA 4XASA 2FQYA 5TPWB 5KQMA 4N41A 2YHBA 1D4ZA 4RY0A 4YV7A 3Q15C 4Q7EA 2WY2D 4KNYA 3RVSA 6ABPA 2FLKA 2P4UA 3QEMA 3TD9A 1BVHA 4EYQA 5CHYA 3A0UA 5IEBA 2FTKE 1JFSA 1P8AA 5F64A 1RXEA 2R47A 3EQ2A 3ROTA 5FWXB 3H5TA 4RXTA 3QEMB 3JY6A 1CHNA 4KRFA 2JK1A 3KYIB 3NNDA 3L49A 2E4YA 1QO0A 3K9CA 1DBQA 2HPHA 3GBPA 5JNWA 2AYZA 3GA5A 3IP6A 1EWKA 2NT3A 1MAVA 3GBVA 1XHEA 3LUFA 4HNSA 1NXOA 1JF8A 3FFXA 2R48A 3DLBA 4WZZA 3HVRA 4NQRA 3F73A 1NTRA 3GYBA 4P1ZA 1RXIA 3W9SA 1Y1LA 4FB4A 2PAFA 5JNUA 4KFCA 1GLGA 2L17A 4OTZA 1FFGA 3VNAA 4OLAA 4S05A 2OENG 1ZESA 3H1GA 4MGEA 1APBA 1D2AA 2FEKA 4G0QA 4YP9A 1MIHA 4ZJPA 5TE9A 2E4WA 4HNQA 1AB5A 5TQJA 2FEPA 3IDOA 2PL9A 3O1JC 2VUHB 3UKJA 4PYRA 4RK4A 1JFVA 3E3MA 5EWJA 1JH9A 4FE7A 4RSMA 4XFKA 1FFSA 4NCAA 1I3CA 3NHMA 3HJFA 4KMRA 2OQRA 4JB2A 1DCMA 4LX8A 5EWJB 4RKQA 4KQ9A 2M98A 5DGCA 3BBLA 4ETNA 2A9OA 2J48A 2LBPA 2IKSA 1PEYA 4E7OA 3I09A 2E4VA 3OLWA 4GPAA 5GQSA 1YS7A 1L5ZA 2X7XA 9ABPA 3N8IA 4KV7A 2QW1A 3CFYA 5JS1A 2HSGA 4PEVA 4PZ0A 3L6UA 2QSJA 3M9WA 1DZ3A 1LJUA 2B1JA 2LP4Y 3CS3A 3LUAA 1DP4A 4LZLA 3D8UA 3C6QA 3O74A 4KK3A 1RZRA 3URMA 2FKAA 1QKKA 3KHTA 4H60A 1BA2A 4JOQA 1U8TA 2PKXA 1SD5A 4LE2A 3RVLA 3QX8A 4H3HB 4MS4A 2L2QA 4YS6A 1YMUA 3OLYA 5IBQA 3DLHA 1XHFA 5B3JA 1JDPA 3EJWA 5C5EA 1BDIA 3CKMA 4YRZA 3H1EA 4XAQA 3MMNA 5IX8A 5BRJA 8ABPA 3RVRA 1JHZA 4MAAA 2M1ZA 2QXYA 4MS4B 4RV5A 3T95A 5IULC 2RGYA 1C0EA 1K66A 4MS1A 1QP4A 2PUAA 1M2EA 4YWHA 2R4QA 4QYMA 2HJ9A 3HDGA 1YMVA 1D1QA 2ID9A 3FGZA 4LE1A 1DBPA 4KQCA 1FFWA 1M5TA 4MS1B 4RK6A 2NUBA 2PUGA 2YHAA 1MB0A 4Z4FA 1F51E 1D5WA 2RJOA 4M88A 1TM2A 3O2SB 3C3MA 1USKA 3OQMA 1H9CA 4RXUA 1ZY2A 4OATA 2PUCA 2VYCA 4MR9B 2WB4A 4JB0A 4XXHA 3SNKA 3HS3A 2MSWA 1U2QA 3QELB 1ISSA 2QVCA 2PL1A 1DBWA 1A04A 5FWYB 5DCLA 3ROFA 3S99A 3FFTA 5GOTA 3H5IA 1XWWA 1ZGGA 1NXSA 4Z9AA 4YCSA 4ML3A 4MR8A 5FWXA 3H6GA 2GKGA 3EULA 1DCFA 1GUDA 4IF4A 4G97A 2QVGA 2PUDA 1GCAA 3HUUA 3G85A 4MR8B 3C3KA 4TLMB 3RVMA 4KZKA 5T3YA 3E61A 2CHEA 3KS9A 4MLCA 4UHJA 4WXMA 2JVKA 4NV3A 1SXGA 2WMYA 5BQ3A 1NXVA 2GI4A 2QZJA 3OLVA 1QQBA 1CEYA 1VRVA 4TLLB 2Q5CA 2IDMA 3MQ4A 1JBEA 2PJUA 3CHYA 1SRRA 2E4ZA 3OLXA 4N0PA 3HK2A 5DTEA 3HCWA 2WJWA 3CZCA 1PNTA 1P6QA 4Z4EA 1Z18A 3ILYA 1A0OA 1ZGZA 3KCNA 3GT7A 4ZYLA 2H0AA 2N9UA 4G86A 4TN5A 3Q7RA 4LDZA 3LMKA 3OMWA 1DG9A 2QV0A 3T8YA 3MA0A 2FN8A 5JNSA 1AB6A 5DKFA 3TB6A 1W25A 5C5CA 2VK2A 4MR7A 3IP7A 4RK0A 3CLKA 1ZVVA 5D2CA 3OM0A 5KWSA 4PICA 1JLKA 4W5TA 4O5AA 5JS2A 2QU7A 1E6LA 5HM6A 1ZN2A 4LRQA 4N0QA 1M2FA 1U2PA 2HQOA 1BDJA 3QLUA 4MLDA 4MR7B 3T6KA 3HZHA 1NY5A 5KC9A 4UHKA 2JCGA 1NXTA 5TQ2A 3P9YA 2IPMA 2LIVA 3JVIA 3O2JA 4F06A 3N53A 1B00A 3GV0A 2RDMA 5IEJA 1R8JA 2H3HA 3MIZA 3SM9A 3CG4A 4Q6WA 1YK1A 4EUKA 4WXEA 2F8SA 4EYOA 1BAPA 5TQ2B 5FBKA 4F12A 2CD7A 3D02A 4F11A 2VUIB 3LOPA 3HM9A 4JP1A 1S8NA 1PHRA 2FQWA 3LKVA 3EQZA 1EWTA 1DJMA 3HEBA 5IC5A 3IP9A 1M5UA 1U04A 4W5QA 1E6MA 4WUTA 3TO5A 4RK5A 2FW0A 1EFAA 2FMIA 2I6FA 5KI6A 3LUDA 3MM4A 3OMXA 5HQJA 1DC8A 1D1PA 3SY8A 4B09A 1CYEA 1YK0A 1J56A 3QLVC 5TPZD 1ABEA 2HQRA 2CHFA 3F6CA 2FN9A 3GRCA 4EVRA 1ZAYA 1P2FA 3CZ5A 1FSPA 2JB9A 4MRMA 4YGXB 2MYUA 3M9XA 4TMYA 4F8JA 3KKEA 4YLEA 1NXWA 2IPAB 4KVFA 2JRLA 1QP0A 3KG2A 1ZHHA 1NATA 1HEYA 2P9HA 4L85A 2RJNA 3G1WA 4MRMB 4W5NA 3KLOA 1VPWA 4MQEA 4D74A 2CWDA 5IUNC 3JVDA 3N0XA 2GX6A 3RVPA 1SXHA 1VKRA 2AYXA 1JWLA 4ZPJA 3H5LA 1OXKB 4Y9TA 4MQEB 1W9HA 4LDAA 1F4VA 3RVNA 1T34A 4IRXA 4YR7A 1QP7A 4EVQA 4DADA 3O2QB 2FXIA 5EWLB 1E6KA 3H5WA 3LUGA 1ZH2A 3H1FA 4MR9A 3TX6A 3DGFC 4N76A 6CHYA 1KGSA 3HV2A 4W5RA 3CG0A 3IPCA 3QELA 4G0OA 3UK0A 2IPLA 3OQNA 1P6UA 5FWYA 4JAVC 3ILHA 1UDRA 2E4XA 1TVMA 2PLNA 1YS6A 1ABFA 4O1HA 4QYWA 3SQNA 2NT4A 1DCKA 5ABPA 1IIBA 3LUJA 4GNRA 4RDCA 1Z2EA 2O20A 5BRAA 2PUBA 1Z2DA 2PUFA 4G0XA 2MYNA 3KSMA 3LUHA 3RH0A 1U0SY 1NXXA 2R25B 3NNNA 3H6HA 5CNIA 1KRWA 3H5OA 5JNRA 5PNTA 1NXPA 4EY3A 1Z12A 2ZAYA 4IILA 1QMPA 1FQWA 3HO1A 3F6PA 1RZRD 3KTOA 2PUEA 1Z15A 4OBBA 4RY9A 3JS5A 3CU5A 3FFWA 4JASB 4JA2A 1C4WA 3N6VA 3H75A 1RNLA 1EHCA 2JBAA 1TLFA 4G0ZA 2KYRA 4EYGA 1USGA 1ZDMA 1LBIA 2FVYA 3LFTA 5CNJA 4S04A 5T7BA 2HQBA 4RK1A 3JPYA 2JBAB 4L4UA 2WWVD 3I42A 5I4CA 3CRNA 1USIA 2MYTA 2QR3A 4MYRA 2V0NA 3KYJB 5JNTA 3I45A 4H3KB 4MS3A 3JPWA 1QQAA 2GWRA 3NBMA 1EAYA 1DRJA 5TPZA 3DBIA 4OG2A 5B3JC 3CNBA 4MQFA 4MS3B 3M6MD 3Q7SA 3VNBA 1RPJA 4NICA 3EAFA 1QPZA 4MPTA 3F7NA 3O75A 4RZSA 1KRXA 4W5OA 5KQGA 2IOYA 3CTPA 2A9RA 4Z4CA 5HSGA 3HXMA 4O1IA 3QX9A 4MQFB 2IPNA 3OM1A 2WJAA 1MVOA 1URPA 5E3JA 4IMJB 3RVKA 3SG0A 1ZITA 5TQ0A 4G0YA 5KQLA 4KREA 3BILA 4ZMSA 4RXMA 4N47A 4RY8A 2JVJA 1JFTA 3N75A 4ETIA 4Z4HA 3O1HB 2MSKA 4DN6A 2A9QA 3Q9SA 1Z25A 3O21A 5TQ0B 4ETMA 1A2OA 7ABPA 5JNVA 1DC7A 1BDHA 5CNMA 3JTEA 2JVIA 3C97A 2FMHA 5BR1A 3B2NA 2MSLA 2WRZA 2L19A 3A0RB 1MB3A 5KQPA 4EGSA 2FMFA 4RS3A 3DZDA 3GL9A 4FE4A 4Z9BA 2B4AA 4HNRA 5FBHA 2E4UA 3OO1A 3HSYA 1JYEA 3O1IC 4ZMRA 1QO0D 2GBPA 1QNLA 2XDYA 3BREA 2FQXA 1PEAA 2ZWMA 1Z13A 3EGCA 3BRQA 3A10A 3R0JA 1SXIA 3EDCA 3OO0A 5EWMA 1GCGA 4EVSA 5ED4A 1ISRA 3N0WA 3HUTA 4D6YA 3C3WA 2BGGA 3OLZA 3RQIA 3T38A 5HKOA 1PNRA 3KJXA 3I5AA 2TMYA 3K4HA 4WT7A 4RWEA 2LUOA 3LTEA 5EWMB 3KLNA 1KMIY 1LJLA 2W42A 3H5VA 3Q7TA 4RU1A 1JYFA 4Z0NA 3LUKA 5EWLA 4DQDA 4PE5B 4HYEA 4NCBA 4IGAA 3TMYA 2PMCA 4RKRA 3RVOA 4XARA 1DRKA 1OXBB 3NNSA 2DRIA 4CBVA 2FLWA 2ID7A 1JX6A 3FDFA 3QEKA 5DLEA 1YIOA 2NZVG 1TJYA 1PUXA 3OQOA 3IPAA 1YVUA 3UUGA 1LK0A 4G0MA 4Z99A 4YO7A 4QPJC 4EYKA 2FEWB 4G0PA 5CNKA 1VLZA 3LKBA 4E7PA 2L18A 3HDVA 4N03A 4XLTA 2FSPA 4KK4A
chains in the Genus database with same CATH superfamily
5IKMA 1U81A 1IHYA 4WNAB 4CV2A 1Z22A 5JYEA 2FJPA 3W05A 1Q1EA 2PCLA 4KKXB 1KOJA 3BA6A 1GKLA 3CLUC 5DI9A 4RLFA 2C98A 1LTKA 2JJ8A 1OWMA 2QAGB 4QNRA 2R7KA 4F3TA 3MN1A 4F2WA 1E2BA 3OURA 1EGVB 2AZMA 2WHQA 3M34A 3P5SA 4UZFA 5FL3A 4E6PA 3GXOA 4LHWA 1N6LA 3E3OA 5D00A 4RZIA 2XMQA 3ICCA 4C76A 4BV9A 4GI3A 4F6CA 3LSTA 4F4IA 5HQTA 2CLKB 1DFHA 2C77A 3PX2A 5CT5A 3GG9A 1U6KA 4L75A 1MH9A 1Z16A 1X87A 4JP5A 4TS3A 2AG0A 1ULTA 3G5MA 1XZIA 2PEZA 5E2IA 1H2ZA 4TXLA 1NUPA 3WMRA 1ZL0A 3W8FA 1KSJA 2AA3A 2F43A 5HK9A 2J9YB 2WY2D 1NNLA 2Z6VA 4LBZA 4GRAA 1A5BB 4QHTA 3E2IA 3KOXA 1YGPA 4BMCA 2P2CA 3HGMA 3C5VA 3A0UA 3SF0A 3V4OA 3O8CA 3A11A 4D98A 3ANXA 2QJOA 1K6JA 1XVVA 4WE3A 3WYEA 5JFTA 1P6XA 3BGVA 3LT2A 1JR3D 3ITDA 2J4CA 3CB4A 2W6QA 3AG6A 1U9YA 3K9CA 2H5EA 1Z2NX 3D1JA 3JQQA 2J5RA 4DIDA 2X9GA 1WV0A 3I6IA 4QYXA 4RZQA 4AVYA 3OFND 1SMKA 4NDNE 5IYZF 5K0LA 3UAWA 3KVYA 4AAYA 3EMBA 1F2DA 1PW7A 4ZT5A 3BEOA 4MUHA 5A3SA 3V4LA 3KAJA 4EB0A 4BNIA 2QRMA 1Y4SA 3FFXA 1JF8A 1O1YA 2Q6IA 2VP6A 3KYDA 4NZ9A 3RTBA 2XI4A 3HC7A 1QGOA 1W581 1WUIS 3RREA 4O2BA 3I9OA 1VG8A 2EZ9A 3FNQA 4D9BA 1NTOA 3BMXA 4CIDA 5CXUA 1HKUA 2EIHA 4QYIA 3CX8A 3P1JA 4UE2A 1G8SA 1HDOA 1XRNA 3R5TA 1HZJA 1S2MA 2EJTA 3RFVA 3ZBUA 4WN9A 1S0UA 1TTTA 3PJFA 4F2GA 4IEIA 1YQ9A 3E05A 3A9VA 4MGEA 1N3IA 3OQPA 4C88A 4QYIB 4P3KA 1H6DA 3HN2A 5T4EA 1XSEA 4HNTA 1V1RA 2FWNA 1Y9DA 1OFGA 2HK7A 1YDWA 1Y48E 2VBCA 3JYLA 4JLBA 3IDOA 2PL9A 4WN9B 5KYVA 1C7IA 5K4GA 2YCLA 3B1YA 2AK3A 3DC7A 2C84A 4PYRA 5IN5A 3V42A 2E1PA 3HB0A 3JW8A 4MRNA 1V1RB 2X5OA 4RQUA 2JFFA 1REQA 1ST2A 3DE2X 3WSVA 3DPIA 5B30A 1E1KA 3TTWA 1SEPA 4LOJA 4F84A 2IDJA 2C9DA 3FGNA 3BXFA 4O2RA 4BIIA 1AA9A 1QJCA 1NPTO 2Z4TA 3HBNA 3Q7PA 4OKIA 5DGTA 4D02A 1VBMA 5BQ5A 3QVSA 4OQMA 4OAPA 1KHHA 1L5MA 3LPNA 1GYRA 2E89A 3UWDA 3VSCA 5AVVA 1UODA 1T5HX 4BNXA 4O4JA 4UXJA 2BJVA 4C4ZA 5FI1B 5K0SA 3SLGA 2R7MA 3DBHB 3ODPA 3SOZA 3EGWA 5AXAA 2ONKA 2CFSA 2PV0A 4O3MA 2RARA 2D5CA 4S1TA 4FDTA 1EGMB 2R66A 4O4JB 2QW8A 3BL6A 3FTCA 5EJEA 3QYFA 5LP6A 2IYAA 4Q0MA 2PVCA 3K2BA 2AFHA 3MTBA 4EHBA 4H7EA 5D87A 4I66A 3SZLA 3UB3A 5EXXA 2WU3A 3WAKA 3CZMA 3OY7A 4LE2A 3PXGA 5IABA 1GQFA 1A71A 2B0CA 4XB2A 3JATA 5HR5A 5LP6B 3A4LA 4MS4A 1U0TA 4R6XA 4YNBA 2AFHB 2FSVC 1EX9A 4B85A 2UZ1A 1TD1A 5J2TF 4PFQA 5AM1A 3R9IA 1LQTA 5DN6A 4K9OA 2FG7C 1L5FA 3RVRA 3JATB 4MS4B 5K3CA 4Y18A 5IULC 4NG5A 3V7NA 2M6LA 2C3MA 1QP4A 3UVEA 2DKOA 1SD1A 1LW7A 3DLPX 4B6GA 4H7DA 4HQLA 4J0FA 2UUBB 3RYTC 3OJCA 5SY4A 5CEJA 1IDOA 3DBVO 2PUGA 3V8BA 1UT5A 5FKJA 1F51E 2ZXEA 4MDHA 2RJOA 1UZLA 3FHCB 1GPAA 3ILSA 4HMPA 1BOOA 2ZBDA 3TFWA 4HN4B 3AUXA 1ZY2A 5IBCA 3LVFO 2PUCA 4DR6B 2QRZA 5U1PA 2VCYA 5FLXA 1WB9A 5DW0A 3EEIA 4F92B 1EZ4A 3RTCA 3IRUA 3A2NA 3SNKA 2ACWA 4HH0A 1ZMTA 5A7FA 2CLCX 3G17A 5AQEA 2JH9A 2IYRA 3QELB 1NQVA 1C9KA 4D96A 5BNIA 1UBKS 5DCLA 4IJQA 1G1MA 3EYAA 4LQ4A 3Q10A 2ECKA 4F4DA 1HFKA 4E2XA 3N5CA 1KEZA 2BMVA 1NUAA 1PF7E 2H2IA 2OE2A 3L6CA 4WOCA 3QWHA 5FI0B 2WD9A 4B76A 5ISMA 4NWIA 3QF4B 2HK6A 2CZGA 2Y6VA 4M86A 4UBNA 5DYWA 5KPJA 3W5CA 2ZXFA 1DTWA 2P78A 3AINA 5PGMA 4AO6A 2IXEA 4XSVA 1BEZA 4NH0A 5AHWA 1HY3A 1Q7TA 4WD3A 3FNEA 4HVCA 4UHJA 5HJ7A 1DTWB 4IYRA 2QRUA 4XEUA 3GRVA 5LQMA 3F3SA 1AMUA 5HHTA 3E6AA 5ALMA 2WFZA 5IF9A 4TTAA 1X0VA 3NBQA 3HDTA 3PRHA 4U2GA 1OVGA 4AIIA 1EUDB 1PX0A 2HT6A 3MINA 3HK2A 1L8OA 1CRZA 3PXBA 3JQGA 4D3XA 1S5PA 3HB1A 2G1AA 2OV6A 3ID6C 3JX9A 1PG5A 2CEKA 3PGMA 3IAUA 5CDFE 4RVSA 1UL1X 1AGYA 3OC6A 3JQFC 3ZJ5A 2H7XA 3MINB 1NW3A 4DWVA 3AVPA 3JQGB 4GOMD 1G5PA 3LMKA 1QHEA 5AI8A 2Q0SA 2BCJQ 3UAXA 4JXXA 4EB3A 4KPFC 3B1ZA 4IHKA 3VPFA 1LV7A 1QH1A 1W25A 3QVLA 3DEHA 4HFRA 4BFCA 1ODJA 2R9VA 2VP3A 2G5PA 3DMFA 4JYMA 5HXAA 4FUQA 3D2LA 4C2UA 5JALA 4HDRA 5JU6A 3MS4A 3D3QA 2GZAA 2H08A 1QH1B 4X24A 2YCBA 4DDUA 1E7RA 2OL4A 1NY5A 3TFQA 4UHKA 1NXTA 1QHNA 2FR8C 3HJCA 3JVIA 4FP9A 3WO0A 4ZGBA 2ZJ5A 3NKFA 5EJ7A 5I7OA 1B16A 4HDRB 2O23A 5LZ8A 2F55A 5F98A 2WV9A 1P3DA 2ORWA 1FBTA 2BGJA 3LC2O 1I6WA 1TZ2A 2GGSA 1V43A 2QTVA 3H2IA 4RZXA 5ALGA 5BSFA 1UXJA 1N7JA 2WC1A 3SS7X 4J3JA 3R2JA 3NXKA 1E6UA 1U7PA 4HBGA 2VUIB 3HA2A 4K2HA 4L3VA 4Q1VA 1QIFA 4RA9A 5CJPA 1LBTA 3RAJA 5IASA 3FCAA 4EYSA 4PGMA 5L95A 1DJMA 1S02A 5JXHA 3LK7A 4JI5B 3P9ZA 4M2LA 4RA9B 1RT9A 1YOVB 2BISA 2WAYA 5ER6A 5DHRA 4LZZA 1I94B 5IJXA 1GPBA 4J0IA 1UKCA 1LD3A 1NC3A 3QE0A 3TMKA 4CTKA 4KI0A 4D8XA 4ZAWA 2R6AA 3H18A 2JC3A 4YDSA 4O02B 5LQKA 2WF5A 2VOEA 2XF2A 2R8BA 4G1VA 1Q0ZA 1WB4A 3VAYA 2W11A 1NC1A 1OTXA 3PGVA 2QE7A 1DV1A 2WIAA 1Y8ZA 2KQUA 2PGAA 2YOGA 3THSA 4LCEA 1PI3A 2CNKA 2CVPA 1YB2A 1W44A 2D2FA 1OE0A 3RTDA 2E21A 2IHUA 1EFKA 2J7PA 3HVUA 1J8VA 2GARA 2WQZA 4LYAA 1E2PA 4D80A 1VIAA 1GFSA 4DPMA 5DHFA 1I2ZA 1PL7A 1S3GA 2FMXA 3EHEA 4C7MA 2NYRA 5C8YA 4GMGA 1L7XA 1PR2A 2QI9F 3R3SA 4L28A 1WBJB 2CFCA 2VLBA 2PSHA 1E98A 2QTRA 1P0FA 1T34A 1K3FA 1THGA 4Q15A 2W8ZA 3KPUA 5MN6A 3IIIA 3IAM6 3JYHA 1QGUA 3LXUX 4YUVA 2XMPA 1VG1A 4O25A 2P68A 5C8ZA 1I36A 4DBLC 2WJIA 2PUTA 1JTEA 3UT5A 3WI7A 1SZDA 3HY3A 4D8YA 3HV2A 3PC6A 2VPTA 1TYAE 4KN6A 2A88A 4BO4A 4C4SA 2FZEA 1ZLXA 3I5MA 2D3TA 4OQQA 4IXNA 5HF5A 4MUKA 1OAKA 5IU6A 2IUTA 2Q4EA 3PGJA 3UT5B 4TMXA 3R3HA 1DSSG 5AW9A 3TTUA 1ZL2A 2HYIC 1F9AA 3VISA 1UC8A 1VKHA 4QBFA 5ALQA 1N0IA 2XX3A 4Y2PA 4ZEOA 3ZLBA 4RPIA 1X7ZA 3D6HA 3NGXA 5C18A 4LVOA 5LPNA 2I29A 1FUKA 1CUAA 1X1QA 1Q0QA 3ES9A 1AHNA 4NZOA 4ETWA 2MYNA 1Q15A 2VBIA 4MQ4A 4AJOA 1STOA 1F2UB 1L5NA 1X7ZB 2WJVA 1AMNA 3FIJA 5KNCH 3C2QA 3ISTA 3EVCA 4YJ2F 3STXA 4BFXA 2CL6X 3ACCA 4KO1S 4MVWA 4RTJA 1RLUA 1JEYA 1Q1QA 2D5BA 1T5TA 1Z15A 4Z4QA 4D5EA 1PV4A 1W73A 4RY9A 4AB1A 3FFWA 5CTJA 5CBPA 3GFOA 2ID4A 1E92A 2KSQA 4FKBA 4MUEA 4WESB 5JSQA 1JEYB 5ALHA 2I99A 3EEOA 1Z8DA 1XQYA 2Q3BA 1XTUA 1E5LA 5ADHA 3AOEC 4EPRA 5LWQA 1B6RA 3C45A 2B9VA 2WP0A 4LEIA 2PMKA 1J2YA 2XKBA 2R62A 3DW1X 2FVYA 3LBAA 5EKSA 4UDOA 3ZK9A 4CCSA 1Z8FA 4DC0A 5CFMA 2WJGA 2D2VA 1FSGA 1FS4A 1SHUX 1G5QA 1ZJYA 2J5XA 1OOEA 3Q11A 2FRDC 2OBBA 1M76A 4KLZA 3R9WA 2UYOA 4Z7JA 3SYRA 2V0NA 3AXSA 1AKUA 1KQPA 3K5HA 2J3IA 5EJIA 2CLFB 5FUWA 1MZVA 3I45A 4YJKA 3Q7EA 2F1OA 4C0WA 1ORIA 1T36A 4JOCA 4UEWA 4PTYA 2O3TA 2QIOA 1V3UA 1BOFA 3BE8A 4UM9D 4NFSA 4CGYA 1XP5A 2VL7A 3I8XA 5AH0A 4BB0A 2PH1A 4BNDA 2Q9AA 1DO2A 1E0DA 2AD5A 1T36B 3AP3A 4OHPA 3RSQA 1NQWA 3IKMB 3O1LA 2Y4OA 2JGFA 3NM4A 5KQGA 3CO0S 4BECA 1ZQ9A 4A0FA 3SQXA 5FPPA 2FE1A 1WUKS 4HGPA 5DV9A 4BNDB 1ZITA 2HF8A 2REOA 4KQ2A 4G0YA 1KI9A 2AMYA 4NYMR 4Q12A 2NADA 1VL6A 2IOHA 3SZ3A 5I4IA 1ZI8A 3ANYB 2ODWA 4Z4HA 1JFTA 3F67A 4R1UA 1GR0A 1NSTA 1VKJA 2G9VA 4LZOA 1WDMA 1QK4A 1XRPA 2OVFA 4R2MA 3TSAA 5DEOA 1MJHA 1KOFA 1R66A 2BM9A 3U7EB 5HJEA 1V9CA 1RP1A 2CDAA 4MWSA 2D5LA 3HU1A 4XB1A 3NHAA 2DFKB 1E1RA 4S05A 5T4FA 2X2PA 4H7HA 2W90A 3M6FA 2Y9PB 3OU6A 2PX6A 3F7TA 4BV3A 4JR1A 1KSFX 4HI0E 1VLQA 3LDUA 3U62A 4FNAA 2FZVA 4FM9A 5JCJA 4RBNA 1PDWA 2BCGY 4Z49A 4ABTA 3KEQA 1GQOA 1HC7A 1EFPA 4R2IA 4JLDA 5FT9A 4OYHA 3KQNA 3AKDA 3TOZA 2JFPA 2C2GA 2G76A 4EATA 1BXRA 2GNOA 1RZ3A 2BL4A 4JL6A 4RZHA 4TRJA 5KTPA 1PYGA 1WVGA 2ZVDA 3K0AA 1XEFA 2YN2A 3KEFA 2DWQA 4N3GA 4WFKA 3KJXA 5KAMA 5B4VA 1C14A 5I7HA 1PNRA 3LSYA 1DJNA 4KVAA 4JZYA 3WP1B 1CWUA 1BXRB 1HO3A 1M6NA 2POQX 2QTAA 3FVWA 4JQOA 1G98A 1R0CA 3K0AB 2HGZA 5DIZA 1Y9EA 4Z0NA 5EWLA 5LBUA 4PYOA 5B53A 1EWRA 2ZYRA 2HBZA 3JQFA 5AVTA 3FHTA 2C7BA 1GEEA 4P3PA 3SC3A 1BG6A 1ZA2A 2ID7A 3QEKA 1G64A 4RLHA 2ZT5A 3FFAA 4EUEA 1EA7A 3GEEA 3MWEA 5TMBA 1J0EA 3SX4A 2PR2A 4IIJA 1RE0A 1YVRA 1XDGA 1W0KA 4XQEA 2HPVA 4Q34A 3RAGA 1J06A 5DLQC 1YZKA 5CB4A 3UUGA 1OXMA 4QOEA 3PCRB 3EISA 1UXKA 1Z7YA 2YRFA 1MX9A 4G0PA 2PH5A 1VLZA 4E7PA 3AVWA 5EHQA 4ACBA 3ZDDA 1C9DB 4D9CA 3ZWNA 2FR8A 2R7NA 4I6GA 3GLGA 4N54A 1FNCA 2IY8A 3CGWA 1YDEA 4UUBA 5L40A 2GJ4A 1K6EA 1H0RA 1TEVA 3FLAA 3MSCA 4DJJA 4MMXB 4P5DA 2AFHE 4I4LA 3T5CA 4DCJA 1UKZA 3GGOA 3MYYA 2B6HA 2XYRA 2W2LA 1H5NA 1P4GA 1WY7A 2WIBA 2BJWA 3RVJA 4JJ4A 2VF7A 3C7KA 2P9JA 5DASA 1NJ6A 1Q6YA 1YJXA 1K97A 3JZIA 1BD4A 3K09C 3D31A 2QB5A 3IP1A 4MV1A 4AZ3A 4CIYA 1UDWA 4KIUA 4B4KA 1M75A 4GXRA 1H4TA 1AUQA 1W94A 2X77A 3GGJA 4M21A 5D7BA 3A27A 4DRXA 5HZGA 4HB2A 2FQYA 3NHBA 1ISGA 2REXB 4QGBA 2ZUVA 3WK9A 1XU4A 3NBKA 4FQ8A 4MGIR 3OJWA 4ND2A 3U81A 1R9JA 1OJ7A 1G8MA 2WTAA 2NSLA 2O2CA 2W98A 4XD7A 5IAEA 1UEXC 3Q5GA 3E9EA 2GRJA 4XJSA 4G8CA 1X86B 3WMEA 3QEAZ 2Q4DA 3HPQA 1BVHA 3IV7A 1L7MA 2WFLA 1ECPA 5FADA 1F38A 2I4NA 2VXCA 4UNQA 3VPCA 3LP5A 2R47A 1CUZA 2GHTA 3AF3A 3EQ2A 1AKNA 1JEJA 2XNDD 4QU9A 1Z5ZA 5C51B 3LT5A 2F2TA 4G5RA 1BHO1 2C42A 3CMCO 2NU9B 1A9TA 1A8QA 1ADCA 1WD7A 2AR7A 2D1YA 2VDUE 1RLJA 1PZHA 2CMHA 3LWDA 3Q3CA 2HPHA 5HIIA 2AYZA 2VF8A 2I1QA 1SXPA 3A4NA 3A4TA 1YJ5A 4FGLA 3H8SA 1T1RA 1YQTA 1QZ3A 4K46A 3KZMA 2P90A 4B83A 4X64B 2WUFA 2R48A 4GOLD 2EX0A 3N7AA 3DLBA 2VYND 2CKMA 1YL5A 5T41A 5DDIP 4ICIA 4NARA 5A2QA 3PKJA 1UAAA 4NONA 1XGKA 2RGBA 4O4HB 4QIHA 1CJVC 1TMGE 2JHGA 1XDDA 2I4TA 2O2ZA 1AE1A 3DC2A 3QE3A 4IVNA 2VDQB 4OGLA 1TF5A 3DT9A 2IU4A 1NJ8A 1JHMA 3ROGA 4OTZA 1OIXA 1XVUA 1YZNA 3NEJA 3OPYA 3CZ9A 4TMZA 3DXYA 4HDSA 5EJMA 3VH2A 1J25A 4JIMA 3COYA 3C8ZA 2PY6A 1G3RA 1YSCA 5ALWA 1EB8A 2TSYB 2VNAA 4ZCRA 1IIRA 2PH3A 1BMQA 4BKPA 5C32A 3E3MA 3W4KA 4PRLA 1BVRA 2IZ5A 2UV8A 4HDSB 1JH9A 4RL6A 3VAAA 2FFHA 2XDQA 4KMRA 5A5DA 5DU2A 2X9NA 3VVMA 1DCMA 4BV2A 3BXPA 3V48A 2OZPA 2X1HA 5ERYA 1NGSA 5JAMA 3ZYZA 3LRPA 2NU6B 5DGCA 2R1ZA 2XDQB 4B73A 4YI5A 3LY5A 2LBPA 1NBHA 2RHMA 2UYQA 3ZCUA 5K6AC 1LPMA 1PEYA 2XITA 2W6CX 3AOEA 1M7GA 4TVSA 4FGUA 4XUDA 4BBZA 1AZTA 2IP4A 4C89A 3ZV6A 4QPNA 1KYIA 4QGSA 1P5FA 4RHXA 3OJLA 3RHTA 4A16A 1XCGB 1AC5A 3NGMA 3I9NA 3IILA 2D1RA 3BTUA 1WP4A 3QP9A 4K6KA 2EF0A 3O74A 1E60A 1WZCA 2CFOA 2FE4A 2H8KA 4I1SA 3V4FA 4CNBA 1SQSA 2J3QA 1XUOA 3OY2A 3M4YA 1SZJG 721PA 1ZW1A 1R4NA 1TEHA 4P1ZA 1X1BA 1RI5A 5AK0A 4QRDA 3HABA 1XDUA 3H11A 3L8HA 4CIVA 2OB2A 2R8PA 3TOVA 4B5KA 3D3WB 3T7CA 3JALA 1JVBA 2ODTX 1FQOA 4O4LA 2OFPA 2QXYA 3PRKE 3NV7A 3F9CA 4W1SA 4CMEC 3HXKA 1UXIA 2Z09A 3H11B 3T3DA 4QXMA 4Q21A 4CQMA 3BKWA 1A2BA 3ER6A 4PTZA 4RW0A 3BCUA 2DR3A 4P9NA 3JALB 1YIAA 1MORA 1TKBA 4O4LB 5FOWA 4ARIA 3UKDA 4XYEA 4CQMB 3FYTA 3AL3A 2ZRGA 2C2OA 3UTCA 2LKDA 3P9XA 1D5WA 1U9IC 1K8XB 2YHIB 3NT4A 2UZAA 3THYA 4FONA 1USKA 3KSUA 1O97C 4RXUA 3BL8A 3FOBA 5DLPA 4OYRA 1MQSA 3GY0A 1Z0AA 1KVTA 4HVTA 4UNPA 1UK6A 4AYTA 2H5IA 3HS3A 3PNMA 3THYB 1B8PA 4Y2QA 3NDIA 3JRNA 5EXEA 1ECFA 4IO1A 5JANA 1Q1NA 2ARKA 4D3DA 4EQ6A 4Y6SA 2P75A 3OEEA 1L1FA 4IIBA 1H69A 2HA3A 2IWRA 3ZYCA 4E5VA 3ZVNA 4B6EA 4YDHB 2O8NA 1IN4A 5GWXA 4H6PA 5DYNA 3VZCA 3C8DA 2EEPA 4LTMA 1NBMD 3OIDA 1IM8A 1UJ2A 1G60A 1MT0A 3KJZA 4NR0A 4D81A 1CJUC 1DC4A 1DCFA 1EESA 2DUUA 5JAHA 1FUEA 2IYOA 3PYMA 4IH1A 4F4HA 1XROA 1GGFA 1K6MA 2CNOA 2QN2A 3ENQA 2WPDA 4JKIA 1OV4A 3R76A 4XIGS 3O3CA 5KUTA 4CHGA 2I1VB 1NMZA 2ZGVA 3A1SA 4KHZA 2OHJA 2CHEA 3BMCA 4QREA 4TYMA 5KVQA 2HIAA 4R71A 2WMYA 4HGYA 4A8PA 4LJ8A 4ENWA 1X7XB 1D0IA 1QK5A 4LQDA 1XFDA 3UAOA 4DCSA 4PAGA 4C21A 3BMCB 3LO5A 2MINB 2GCIA 3LBHA 3U7IA 1XNRB 4B45A 3NCHA 2O2XA 4Z4EA 1R50A 1GAWA 1V5GA 1WSWA 2B78A 2WKQA 5HIJA 1E2MA 3SEFA 3FNIA 5K8CA 4QQFA 4DLSA 3W77A 4KPGA 3KFVA 1XMPA 2EL7A 4L3OA 1IY0A 1W5SA 2YC4C 3IBGA 4FYPA 2QMEA 4LXGA 2DQYA 1QPBA 4RVHA 3WLAA 2HNAA 4R81A 4BQQA 3T35A 1UPAA 4RV4A 1QXSA 2XNSA 1DFGA 3C1OA 4LX0A 2XUJA 2DT5A 4PSUA 3DYIA 2VPXA 3LBFA 1H2WA 4DKXA 1SNYA 2WQ6A 1E1QD 5AKHA 1OLSA 1AXRA 4P4GA 4QKQA 4GOOD 3AUYA 2UUCB 4BN0A 5EYPA 2PK3A 4FWBA 3GV0A 1R5NA 3KE9A 3NM5A 1RPAA 1R9GA 3SM9A 3W2GA 1XN4A 3ZU4A 4XKJA 3SCZA 2HTEA 1HV8A 2IODA 1RKQA 3DF9A 2CW5A 2YV3A 2J07A 4NBVA 4I9HA 5EYPB 4BJ3A 4DTCA 3K09A 4B3XA 3VPGA 2GPTA 4ZVMA 4Y2SA 4FS3A 5ESDA 1S8FA 1SC6A 3OT4A 4NL4H 4W6ZA 4CKCB 2HF7A 3GPBA 1NL3A 1KYWA 2VTEA 3JQAA 2JFHA 2B4QA 2WLTA 4QTTB 5EPOA 3TZHA 3EDMA 4DEVA 2HT1A 1FLNA 1PVOA 2YJ6A 1DKMA 3TD6A 3EXHC 1X13A 5A7GA 2X4GA 3LUDA 4YCNA 3VPSA 3BBPA 3JQAB 4X1KA 4XSGA 3WTCA 5ITVA 1SPBS 5AM0A 1QTIA 1N57A 2YWJA 2H0QA 3P9KA 4IHJB 4UTXA 5DNUA 3AFHA 3CUKA 1QV7A 2WF8A 4JODA 5A5FA 1ABEA 2GESA 4CI0B 1CLUA 1JJIA 1G18A 2YWDA 4C78A 3L4BA 1CUFA 1TQ4A 1EGQA 2CMDA 1X70A 3B6MA 4JUFA 3UV3A 3C39A 1QYXA 3BORA 3EX7C 1ELOA 4ZYXA 4EUHA 3RGGA 2DJ5A 2XB2A 1NR5A 3S28A 1O0CA 4PG7A 2YZNA 4DV6B 1Z75A 1R6BX 3G1WA 3HEMA 4CG0A 3RAEC 3MPUA 4KO2S 5F78A 4IQ8A 3SZGA 1XVLA 1ZO8A 2Z9DA 2NQTA 4BZZA 4DW8A 1FU8A 3U40A 1NUTA 2UKDA 5J47A 5FTMA 4O5OA 3U7FB 2PZGA 4DSNA 1GLNA 4FZ5A 1O0SA 2P3SA 1ECBA 2OLJA 3DMRA 1GPUA 1Z8NA 8GPBA 3G2JA 2HRDA 3OQVA 2XZLA 2REQB 4DR7B 2VFAA 2H2WA 5CIYA 1O9HA 1E94E 3VBCA 4CTJA 1IFXA 1BHQ1 2ZWIA 1KY2A 3BFKA 5ADVA 3T3OA 1J70A 1FMCA 2LWIA 4JI1B 4PZZA 2OKGA 4BCBA 1FXSA 4UOQA 5K45A 2H00A 3UWSA 1K0FA 3LBYA 5CJ2A 4KR0A 2XH8A 2ZIWB 2CJYA 1P2GA 1YS6A 2NZWA 2P1ZA 1EZ1A 3I37X 1DCKA 3NWOA 3N76A 1ESZA 2RCYA 4GP6A 1NRXA 2BFDB 1MC4A 5KYUA 2AG8A 1SIBE 3DFMA 5F33A 5A4IS 4MDFA 3AW8A 5KNDH 1R4MA 4G0XA 1TMOA 4MV6A 5CPBA 4DQLA 3GGPA 1TMKA 4F4JA 4BC1A 1XZFA 2GPNA 1I7LA 5P21A 2XMBA 5KYUB 3VTZA 3BHMA 1V4NA 1CSEE 2XBLA 1N6OA 2O1WA 3CUWA 3V4SA 1W2GA 1KO5A 1PTJA 1R4MB 3K8ZA 2G9QA 2ZFUA 2GCGA 3HH8A 1KFEB 1D07A 4XGNA 1MD9A 2AQ8A 2VEDA 3KQVA 4JASB 4BMZA 1V6AA 3FWPA 2OB1A 1MJGA 3FCYA 1Y6ZA 3LZCA 1Y8CA 4RAQA 3NHKA 1IM2A 4Y9DA 3VX3A 1X8XA 1LY1A 4N82A 3U3DA 3UTDA 1U02A 1Z0SA 1CT9A 3ZY6A 3KVVA 1WM1A 3BJRA 2AFVA 4OO3A 1JR2A 2OCPA 4P82A 4BFVA 3S29A 1OWNA 3VA7A 1JR3E 4YY3B 2QR3A 2SKEA 5U4QA 4DQXA 4IHAA 4JN6B 4MGYR 3F3YA 4BQSA 3DDSA 4CMEA 4F6RB 4LXHA 3AIMA 1NDQA 4FEAA 2VDLB 3MG9A 3CZAA 1D03A 3HWRA 3MWJA 2VRWA 5E9AA 3AB3A 4ARUA 3QEOA 1W5EA 4PR0A 4NE7A 3EG9B 4HNUA 4YACA 5B55A 4UJ3A 2GYWA 1ST3A 1FDUA 3OEWA 2Q9UA 3DOJA 1IULA 1BS2A 4Z4CA 1U9IA 1MHPA 2CVQA 1Z45A 2IHTA 2R6DA 2WMNB 3LNCA 1RWNA 5K3FA 1YRLA 4TZKA 5KOJB 3EGVA 3R7BA 3OX1A 1VYVA 2B21A 4YQZA 1Z6TA 3DT8A 4GT1A 4LYEA 4ZMSA 2IK8A 1TADA 3M1IA 1W85A 1XP8A 4TTSA 5EKTA 5A5GA 3KTDA 1L7VC 3W79A 4D8WA 2P6MA 2NO7A 4UE6A 5H81A 1B23P 3I2HA 3OFJA 3SR4A 1AKWA 4X94A 2AL7A 1PWHA 2DTEA 3M7IA 3OJOA 1ZIDA 4TV8F 1JJAA 1W85B 2FRXA 4EGSA 1WB5A 2H1CA 4YMWA 3WMFA 3L6OO 5YASA 3HJGA 2EBHX 4FE4A 5FBHA 2W6ZA 3T41A 2KWIA 3OO1A 3OIWA 1Z8HA 5E6RA 1EKXA 2ZITA 2ZI9A 4HAVA 5JYBA 5CYOA 3LA8A 4A9AA 3DEIA 4JEMA 1O4VA 1WIWA 2JFBA 4L2IA 4P3OA 2AEFA 1GZ5A 5E6RB 3RS8A 1ECJA 1WEKA 3EGCA 5FULA 3BRQA 3AT1A 1SXIA 5AYVA 1KOGA 2H1SA 1P81A 3AHEA 4L2IB 4DIEA 4ZZ3A 4A8JC 2BKAA 1T2AA 4X9XA 5HKOA 4C1NA 1M8GA 2D2IA 1WQ3A 3HUDA 1H4QA 1ETHA 3A3PA 3BH0A 3B48A 2C59A 4Q7KA 3EVEA 3EY4A 3LX6A 4HRAA 4EL0A 3WIVA 4BZWA 1MJFA 3LP6A 1MC8A 3K2QA 3H05A 1NBWB 1NMXA 3LUKA 4OBEA 4PE5B 5HTKA 5DJ5A 4YX9A 5ALKA 1B4DA 3TMYA 1MOQA 1XHLA 3D6TB 3GAFA 3IC5A 4KG7A 3TTTA 3VFDA 1DRKA 1QGAA 1Y1SA 1P4SA 1AN9A 5JD4A 1O5OA 2G0TA 3A4IA 4QEZA 3WGKA 1P7VA 3TW8A 2NZVG 3VVCA 3H99A 3L8EA 1AURA 1PUXA 2H1RA 1AK2A 2WMDA 3IBSA 1ID8A 5IKOA 2ODAA 1YKFA 2LKCA 4UAVA 1GPNA 1XPRA 2X8AA 2JIDA 2HMTA 3VAZA 2XCLA 3GARA 1FTYA 4PRYA 4JLWA 3TW8B 1JKFA 1IPEA 2FEWB 2MT9A 2NSHA 1L4EA 2OBYA 3GA7A 4IG9A 3ZTYA 1XDZA 2VZ0A 4N03A 2XEDA 4TTPA 2Z57A 3S8MA 3BVPA 2GXQA 2I9PA 1YH3A 4F3YA 1MEEA 1RVDA 2B2NA 3A70A 4PM4A 3KETA 2ZVJA 5GIPE 2LGJA 1LF5A 3B8HA 3C3EA 4GM4A 3RC2A 3TSZA 3PHJA 1PDOA 5TR9A 1E9SA 3IERA 4Y2GA 1KIAA 3G3EA 1SOUA 2IEGA 5LA6F 1QIGA 3JSXA 4MARA 4WADA 3CR3C 1GN8A 1CXZA 2PYDA 3KO8A 2A3RA 3LPLA 2GA9A 4V1CB 5HFJA 2RB4A 4RJTA 4GYWA 5F7OA 2JASA 3WWYA 1SC3A 2X4LA 3EXHA 1CKEA 3D0QA 3KTFA 4N6OA 1D2GA 4QOIA 221PA 3UMJA 1CUSA 5JLJA 3U1VA 3WGVA 3DHNA 2LPMA 4OM8A 3E9QA 3O73A 3L7NA 4Y2JA 2CLSA 4LE0A 1Z5PA 1ZWKA 1T0BA 1MX3A 3T0GA 4OLBA 1ZUNA 5AUOB 3RUPA 4V0NA 3IBFA 1QHGA 3EA4A 4V0OA 4DV0B 4R2WA 1PFUA 1D4ZA 2ZI5A 3E23A 2Y66A 2CNWA 3DE5X 3DEAA 2XV1A 4U1RA 5FNVF 4JR2A 4KP7A 4G1CA 1ZUNB 3QEMA 3NHUA 4NCIA 5JWRA 1AO0A 2ZR9A 2VDNB 4XLZA 5M5BA 3HBAA 4KE7A 1RXEA 3B3QA 4KQ6A 4OIMA 2CD9A 3Q0EA 1GYQA 3G5UA 4ZRDA 1A77A 2WHEA 1XAJA 3FDZA 3W7BA 3QEMB 1SELA 2JI8A 3QTTA 4FLEA 2GZDA 3JR3A 3GCDA 1UDXA 2QLBA 3FSGA 2J6BA 2RAPA 1Z2OX 4CR6A 3HG7A 4EECA 4FFSA 2I03A 3FDZB 2V7XA 2Q7DA 3ONNA 3W4IA 2HIGA 1XHEA 2JAUA 2O1SA 1UIMA 3H2KA 2ZJAA 1HSOA 3I05A 3JAKA 1H05A 1TYZA 2YV1A 1TL7C 1YC2A 3SS9X 4ND8A 5EZ6B 4ZYUA 4YONB 4JD5A 2C5AA 1F4LA 2V55B 3GUZA 3W2TA 2PZFA 4B43A 4Z7OB 1CUDA 2WKPA 3QSGA 2I6GA 4WOBA 3ZD7A 5BY2A 4JOBA 3WLEA 2ZRQA 4DSUA 1JW9B 2NXNA 3CLTC 4IZHA 3D1VA 3PA8A 4KFCA 1IHPA 3H04A 2PWYA 3LCRA 2VP4A 5FO0A 3VYSB 4AUNA 2G9RA 4IX9A 5HQ3A 1OFUA 1SHZA 3CTMA 5DNWA 3GZNB 3NB0A 1DXOA 3TQIA 3N6RA 2BI4A 1AHHA 1UPFA 4JITA 4KIGA 4UBJA 4YT2A 3ZJUA 3T3MB 4DRYA 1OILA 3SHVA 4BVGA 2EP5A 3DE3X 2W7TA 2X1MA 3ICPA 3M8KA 4QX6A 3OI7A 1ZJ6A 5HQ3B 4JZKA 4A15A 2KE5A 3NJ4A 4MNTA 5IYZB 4OHYA 2W6ID 1VLLA 4PYKA 4HEJA 3GJQA 1WDWB 1QJ4A 1J99A 2OV8A 3GVXA 1TQ8A 2CZCA 3PGXA 4NS4A 1NJ2A 3K9BA 4HWGA 4RH1A 3ZI0A 1W48A 3U3XA 2NVBA 3ZH9B 2ZBPA 1H2YA 4DUYB 5JATA 1N36B 1SCBA 4CVNA 1OTYA 5EMNA 1QYCA 3BBLA 1O2DA 4DMHA 2A9OA 1ZD9A 5K6RA 3F9IA 2BHSA 1FFAA 3ER8A 2ZYWX 4G8DA 2K2WA 4MP6A 1WVIA 2MSCB 2QD3A 3W3AA 4U3JA 3ZIAA 3TUIC 2FG6C 4LHVA 4C7BA 3EGOA 4IMPA 1L7QA 1RJ9B 2A59A 4G1FA 4PZEA 4K8RB 1M2JA 3VKFA 1E5QA 4KV7A 1Z5WA 1COWA 4U3JB 5LNK1 3N2LA 5H82A 4B4VA 2J0EA 3CVJA 5K4AA 2JFGA 3V2HA 5HWSA 2AKAB 4H1TA 2ZAOA 4YP7A 3VV3A 4Y2UA 5FPHA 1NW8A 4XVHA 4IM7A 1NF3A 3HB5X 2X0EA 4AUMA 1AQIA 5ERXA 2PKXA 1GN9A 2WNSA 5JS6A 3BXXA 3RSOA 3LFHA 4G5QA 2AJLI 3EN0A 2ZIGA 3ENWA 5BURA 2Q2OA 1OFUX 1I2BA 2Z56A 1QIKA 3FBTA 5DTRA 5ILQA 4X3OA 2WAOA 5I8PA 1ZOLA 2VC2B 3OFKA 4YJGB 2ZUCA 3GDOA 1IMJA 2B4TO 1YR7A 4HGRA 3CC8A 2GETA 1U7UA 1G0NA 3C1TA 3DTYA 3EYWA 4FFOA 4TROA 1B0UA 3PFNA 2HJ9A 2Z5VA 2PMEA 4BX9A 4IXTA 4A23A 4QLBA 1IN1A 3Q5EA 4JY7A 3GUYA 3W9YA 1DBPA 3COWA 2FMUA 4FBGA 1Z5NA 1H5QA 4KLNA 2VA9A 2YZ2A 1N9ZA 3WGIA 5J2TA 1VBKA 3A28A 4LRXA 5GY7A 3RV4A 4RVFA 3STVA 4K0RA 5H83A 1WE2A 3A3NA 4I08A 1WA5A 1FVXA 3H9EO 2X5NA 3ENKA 3IELA 3MCUA 5EUCA 3FUUA 4EW1A 1MXFA 1OHHD 4B6RA 1X6VA 2MSWA 4NEHB 3W04A 5J2TB 1Q3HA 4EK9A 1Z4MA 3ADCA 3E70C 5CH5A 5TQVA 3BYZA 3WL5A 3T5MA 2CV0A 1YV9A 3BJIC 1I4WA 1NP6A 2YIVX 4PCLA 3V8PA 4E6EA 3CNEA 1PKXA 1TAGA 5K4HA 2HPAA 1QHYA 2IHVA 3JZFA 5G1OA 1QANA 4YP1A 2O57A 3CF6R 3IEKA 4GR9A 1Z6YA 4YRBA 1CJKC 5IPFA 5KKAA 4ARSA 3L7OA 5JRJA 4LHEA 3TAHA 5FJJA 2AI2A 5F3RA 3RS0A 1L4UA 4Y0VA 2F17A 1ZA1A 2BKLA 3HN6A 3IQHX 1V8DA 1JIKA 2I2XB 1MCZA 2KHZA 5AI6A 1J7JA 1DL5A 3BPSA 5AHRA 3V3TA 2QD1A 1HBJA 3DEYX 1BDMA 2R8OA 4YYEA 4ZI5A 1GPYA 4EY6A 1VKZA 3AJ8A 3SBDA 3CVVA 3NVKI 1PR4A 4K03A 4EB8A 2DGDA 2I62A 4G5GA 4P58A 5JCOC 3M70A 4GZ6A 1CEYA 1G9SA 1ODLA 4XWTA 1YVDA 2IVZA 3AZPA 3HCBA 4YMLA 5BNZA 1UQUA 5EMHA 3N5KA 3ZJ4A 2GBIA 3MBKA 3GAMA 4BYMA 2RB5A 1X3SA 4Z1OA 4KO8A 4AUEA 2WWRA 2V8BA 1OSNA 5K3EA 3F46A 2A14A 2WV7A 1A0OA 3KCNA 4DBVO 4DWWA 4C04A 3ANLA 3ZR4B 4EY8A 1TPYA 3D8BA 3TIGA 5B12A 3EGXB 2AI1A 1Z35A 1E1LA 3HMQA 2IH4A 2QV0A 4X8HA 3MA0A 2COEA 4KPUA 1XQ6A 1XT6A 1QH0A 2HLPA 2WILA 3WZLA 1QP8A 4RK0A 3CLKA 2NSJA 4OHVA 1TEXA 4KR3A 3RUHA 4M1KA 1D5CA 1KYZA 2ZUUA 1P2UA 3G02A 2DQZA 3B70A 3L7DA 5JS2A 4ZO7A 1TTQB 1XEXA 4CXMA 1CZNA 3CKKA 1ZH8A 1YUBA 3N2GA 1PYOA 3MCAA 4TLEA 4ZVLA 2K7FA 1QCYA 2R6CA 3WOVA 2CJWB 1XEXB 5IEJA 1VSQA 3N2GB 5J4HA 1ISFA 5CFPA 4UCXA 4RHYA 4WXEA 4XWOA 2R1VA 2PMWB 3BIOA 5I47A 3NIBA 3WHIA 3IA2A 1YR2A 2PX4A 4LRUA 4RTLA 3R7NA 5KSOA 1G5TA 1QH9A 2OAGA 2FH5B 2RG1A 1BGXT 2H1HA 5A0FA 4B3BA 4CCAA 2QRHA 2R1VB 3HEBA 4ZAFA 3IP9A 5E4YA 1YCFA 3FJYA 2PXXA 3TO5A 4EHKA 3PDWA 1QVZA 2FW0A 1M8FA 1FMJA 1DDGA 4MMYB 4H7KA 1MW8X 1LTQA 2GBFA 1IZ8A 5AVXA 5I7WA 1QAOA 2A4MA 2G7ZA 5FAXA 4OXYA 5LYJA 3WDKA 3ZZMA 1SVLA 4N39A 1F6BA 4BNKA 4OK5A 2FW6A 4OIFA 5B1HA 1RDFA 4OA8A 1Q3TA 2RH4A 4HFMA 2GKOA 3R7LA 4Z3DA 2QK4A 4FBMA 1HT1E 4HS4A 5ALTA 4GRIA 1O5TA 4QDXA 4AF8A 3F2IA 2PKQP 2P2ZA 3V97A 3ZCPA 5ICSA 1U3VA 2IPAB 3EZYA 2D7JA 2NM0A 1CNMA 4KVFA 2PT7A 2FCRA 3HCCA 1JLHA 1MUUA 1HEYA 1MDBA 3AHFA 4R8RA 2C2YA 4DEYA 1JGTA 3S70A 2C4WA 2HFKA 3IHLA 1W93A 3IEVA 1MA0A 4ONEA 1KZ4A 3A4MA 1NXQA 3CQ9A 5L3ZA 2NVUA 3A1CA 4LDJA 4P36A 1SVIA 1A97A 3PGKA 1ZKDA 5IARA 3GP3A 1SKQA 2HUPA 2H9YA 1U8FO 3FBWA 4TTTS 5ALIA 3RSCA 3ZHCA 4C0JA 4D0LB 1CY7A 1QP7A 4DYVA 2P4HX 3UK6A 4NU6A 2NVUB 1HDYA 4YWJA 1VIDA 4EKYA 1XZPA 1V7QA 2RC5A 4TKUA 1OBFO 2BRUA 4ER3A 3PHBE 4R41A 1NOJA 4S1WA 1YR6A 3ASYA 1FTGA 3OQHA 2VAVA 4JAVC 4MYTA 2ZZKA 5EMJA 4WFJA 2EX4A 1UK9A 3GEDA 4XSHA 2DUWA 4TKUB 1XRLA 3RRBA 2XMCA 4D4MA 2G88A 4QYWA 4FR2A 2GD1O 3JRXA 1WP9A 4CMJA 4Z3OA 4LJLA 4BV8A 1SU6A 1EIZA 3C3BA 2A1TR 2H2AA 2XJ9A 4Y1EA 1C9NA 2XMDA 1R16A 3QPWA 4CKEA 4UVHA 1POXA 2DUNA 3HVJA 1RE1A 3KB1A 5HCIA 4KGXA 1CVIA 3R5SA 5CNIA 1CF4A 2VBGA 4BHTA 4BVFA 1P2BA 4D41A 1XA3A 4F9EA 1IZ0A 4O8CA 2BFAA 2ZJBA 4IILA 1F5SA 1EVEA 1XCPA 2C2WA 2EKZA 2ILVA 1HE3A 2IW3A 5EUBA 1MBZA 5C5DA 4U2KA 4JJIA 4QOFA 3OECA 3RJMA 4AP5A 1SHJA 2QORA 3L43A 3SYNA 2DPYA 3BE6A 2R0QC 1OKKD 5KJFA 2V7QD 3N8KA 1KZ1A 4I4CA 2E82A 3CO5A 4JLJA 4MV7A 4WKPA 5CK4A 5NULA 5DM60 4C7VA 5HKLA 3SMQA 3CCBA 3QKWA 1S1MA 4AJHA 3KT3A 4IVPA 2GK3A 4RDIA 1C81A 3RK0A 4UFPA 4KQJA 4Q47A 5T7BA 5D5HA 1H1DA 4LNUA 4ZT7A 4DJAA 4L5AA 4UNRA 4PO8A 1QIHA 5D51S 1BJTA 2YWHA 1KS2A 3DAGA 3INTA 1DMRA 1EQ2A 2VUSA 3QPCA 4RGYA 4CU2A 3WWPA 2PFGA 1UPBA 2Q4RA 5A4MS 3L0PA 3DT6A 3GP5A 3N3BC 4IEFB 2DBYA 4KAXA 4QBTA 4HNVA 1GNTA 3VNVA 3HB7A 4XUEA 5C53B 2V97A 4HSEA 4YJ2B 5ALDA 5JUWA 2PKQO 4EA7A 1I4EB 1LLQA 3P5BA 3SNHA 3DBIA 3FLEA 2XE8A 1AGPA 5AOBA 1BJKA 3LTNC 3Q7SA 2A1IA 2HREA 4PC7A 3COVA 1TZJA 3EAFA 5HDQA 2F6RA 2OP0A 3AVYA 1THMA 1TCVA 1IM5A 4X65B 2V5VA 1PQ4A 4R9RA 4ARCA 4POOA 2GZHA 1ZBQA 5CX1A 1NYTA 2I2WA 1A5ZA 1LRLA 5TY0A 3V8VA 4CL3A 2EJWA 1GADO 1RTKA 1TW2A 1XF9A 4JVSB 4KREA 2UXDB 3KSDO 1N1MA 3TGPA 5FBLB 1QO7A 3L0ZA 3OM8A 3PFBA 1SQFA 5CX1B 4GVPA 2HRZA 3SMVA 5SZHB 4C22A 2CCKA 4L1KA 4EFMA 3JTEA 2J0UB 4PSCA 4UUMA 3DXFA 1F06A 1WEHA 1F12A 4TSRA 1D7AA 1MB3A 2Q2QA 3M4XA 4I1YA 1K1EA 2PSSA 3WLOA 1NNI1 1RM0A 3NHRA 4LI3X 1O94D 2GAOA 2Q7XA 1YKSA 4UQPA 1Y98A 1O58A 4MW5A 4PG8A 2Y1KA 5B3KA 2IFTA 2N0SA 3T61A 2DBVO 4JK3A 2HRRA 2PLFA 4RX1A 4NBWA 3WMWA 4JC0A 4AMGA 1ZISA 2WM3A 4MYHA 3ZLTA 2EOAA 4ZGWA 4QDKA 4L07A 4L8VA 4OI4A 5A3JA 4GP9A 4EW2A 1V5WA 3SHWA 5JCOA 5EWMA 5IKPA 3A05A 1GNLA 4B6FA 4GZ3A 4PVDA 2ODPA 1QV6A 2HA4A 1H93A 4OMCA 3Q87B 1Q0UA 3K8YA 3MYRA 1X39A 2NTVA 5EWMB 3QOWA 1F3OA 5SZJA 4FU0A 3MMXA 4CMGA 2WQ7A 1SEVA 2A8YA 1IXYA 1SIWA 3QPAA 4DQDA 2ZWOA 3BZUA 3T3IA 1P7WA 2JH3A 4UUNA 2C1XA 3TOCA 5H3HA 3L0YA 5AKEA 4RIFA 2CXTA 3LPAA 1B2LA 3S81A 4CTNA 1TJYA 3OX3A 2X8JA 3WLNA 4E46A 2WHXA 3VR3A 3GZTB 4LGVA 3KXKA 4Q9AA 4NI5A 1YS9A 2BIFA 3M1YA 3QWAA 3EZLA 4L02A 4QFDA 2BFFA 3UHFA 4KW7A 1KI7A 3OZCA 2X8JB 1P17A 4JBYA 4LV8B 4N6GA 1Q6ZA 1TCCA 5DTQA 3TR0A 5K0BA 1PCXA 4QFBA 8MHTA 1OCEA 5K0CA 2O59A 3L8DA 3AUFA 2PGXA 3AILA 5IUKC 4X8MA 3IOMA 4FN4A 4F5DA 5BMVF 2FK7A 2FQ1A 4DV5B 5JMTA 2Q3HA 3L79A 4MKGA 2HM7A 3LRTA 1B3RA 3AMVA 2QYSA 3GJ0A 3F1LA 2WUEA 3QXJA 3WGLA 2GILA 2FHPA 1Y42X 1E62A 3H1BA 2NYVA 3DVLA 3BXHA 3G8BA 1OX5A 1PT9A 2ALJA 3LCVB 1Z68A 5BR7A 1MRSA 3WYCA 1JHDA 1KR5A 2H07A 3QLTA 4TMFA 3ETDA 3E9CA 4WRRA 5TPWA 4ZRNA 2PRZA 4PX2A 4M60A 4ZIRA 4ESEA 5AUQA 1NM5C 1VPLA 3AR6A 5IWAB 3RWBA 4WDQA 1EWVA 1E4OA 1TAUA 2ABWA 2QUBA 3IUPA 3IUSA 1SB8A 5TPWB 4KWTA 2R85A 4ZIRB 5ARBA 1BWRA 2RONA 3UGKA 3TS1A 4HDCA 5FEUA 4FLFA 5DCYA 5FQOA 2PKCA 4BP9A 3BWEA 4QDZA 4MLZA 3RVSA 1ONPA 4EB6A 2ZIXA 3IQWA 3IRVA 1NW4A 2B8WA 3EPHA 5F64A 5DB4A 2HAEA 3N8GA 4H6VA 5HCUA 2H18A 1XJQA 5KDDA 4KCGA 1D2RA 4JEHA 3LVBA 4EB6B 2ZIXB 2X76A 3KYIB 1KORA 3NNDA 3WK8A 3NMUF 1DBQA 4AM8A 1K3TA 2W58A 4ZJUA 5LXTF 3TQSA 1WUYA 1WWKA 4RSGA 4I99A 3CCFA 5CFQA 5IZ4A 4BEJA 4JBWA 2UXCB 2QUAA 4WKNA 2YYSA 4LPKA 2BSAA 2NZJA 4G2NA 1GKKA 4IKOA 4ESVA 5C1PA 4N5NA 5JTTA 3IUQA 2VXBA 1E3JA 1E2DA 3K0EA 3L1IA 3T3HA 2HU5A 5KNBH 2BUBA 4RA6A 2G80A 2PIAA 3N3AC 5TGZA 2Z3VA 3HUFA 1VJ5A 3KZCA 5F2NA 5I9NA 4AS2A 4CNQA 3FKSA 1ETUA 2WABA 4XWAA 5IAJA 3KM0A 3B20A 4BMXA 3HXPA 3QHPA 5GZ3A 2QRGA 2NO5A 3IAM1 3W1WA 1D2AA 2OORC 3AM4A 4P8RA 1XTPA 1M34A 1CY0A 3RIGA 5BWOA 4OGFA 5JDCC 4B4UA 1RPZA 4JI7B 3E3LA 5ICMA 1A88A 2N3ZA 4CIAA 3RBVA 3ELUA 2E5WA 4JMLA 4B8ZA 5ITWA 4DLKA 1PGQA 3QBEA 1XPUA 1W0CA 3TGLA 3RCBA 1FFSA 4QGAA 4IP0A 1FZTA 4CKBA 7GPBA 4JB2A 5FRDA 1UOEA 4BS9A 1CETA 4EHFA 2WHPB 3DTVD 1ZOPA 1UM9A 4MWDA 5FOUA 3EE6A 3MSXA 2VH1A 5J2UF 4MZXA 3ZHVA 1RKXA 2Q5EA 4CKBB 2HJWA 1KEKA 3HCEA 1SH7A 1LDYA 1KSHA 3O7WA 1E3SA 2X6TA 4WJZA 2Y1LA 3FGPA 4GPAA 3PHIA 1L4LA 2GN2A 4P4TA 3O4HA 5IJWA 4EENA 2GK6A 4YI3A 3CFYA 3W7AA 1BYUA 2ZQ5A 3ROEA 4E2WA 1V3QE 3FVRA 4EI9A 3WL8A 2CHVA 1LJUA 3DDCA 3LUAA 5ARDA 3LPDA 2DHEA 3M6XA 4J91A 2PS3A 3ETGA 4M1ZA 3U4IA 2IYLD 1NBOA 4OREX 4XCQA 4JOSA 2VT2A 2QPLA 1FTQA 4JOQA 5K0GA 1Z0DA 3PX3A 4RV9A 3VXKA 4BMSA 2G25A 2L2QA 2FG5A 3OLYA 2FP3A 1A9XA 3TPCA 4FYMA 4QUHA 2J0SA 1RLIA 2O2YA 2QAIA 3OC0A 4R1NA 3OVMA 2H4ZA 3OZBA 3QY0A 3ZEIA 1JMVA 1TM5E 4RANA 1QBGA 4MAAA 1YQUA 2D8MA 3T95A 1FFCA 1A9XB 1N32B 5KX5F 4N40A 2Z8XA 5BT9A 2C58A 2Q3LA 1NW9B 3PQ5A 4FSDA 2Z8ZA 3TLJA 2ZIAA 3UHJA 4D4GA 4FYWA 2Q2NA 3D3KA 2BFCA 4QYMA 2RC6A 2XWPA 3NOOA 4WINA 4TTIA 2XRZA 3CW2A 3M3DA 3ZVMA 3C5CA 5E95A 4JP3A 2J3JA 1PJBA 1FU4A 4DMUB 1ZVKA 4M9XA 2QMOA 1HG1A 1EE2A 2BFCB 1DC3A 5FBWB 4FIZA 2ZLBA 3ASUA 3RO7A 5CJJA 2C8KA 2NG1A 3PDIA 1I4TD 1T2FA 1TPZA 3BJZA 4MUGA 5CAEA 2BEWB 2GCOA 3G82C 3TOSA 4HZUA 3JQDA 3QMMA 1S2OA 4JB0A 4RJ2A 2XZOA 3OIGA 3WA6A 4ABYA 4BMDA 3WIOA 1Q0RA 2RHLA 5E7QA 4NYIQ 4AY4A 3WKAA 2OGTA 4Q00A 1XELA 2ZJFA 4AIRA 2NP6A 1VXOA 3RVBA 3A4YA 4HZUB 5FIUA 4H77A 4HN9A 5KOHB 2CDCA 2C82A 3PHHA 3RRZA 1YZYA 3GQVA 4B5LA 4M0EA 1CYDA 1G2IA 2YZKA 4CIWA 5IC4A 2GFHA 2ZJ8A 2X9LA 3BDIA 4XM0A 1Z2AA 4YO8A 5G41A 2Q5FA 3EVBA 1XYYA 3G2QA 3RI3A 5KB3A 3N1UA 4I4IA 4O63O 2I2CA 3V4PB 2YS7A 2FWIA 1OYYA 4L5IA 4ZT6A 2QX9A 4B2YA 2GD0A 2I6UA 3UOAB 1CQPA 1GKIA 3H8VA 2HX1A 4TS4A 3GIDA 1T9GR 4JJEA 3ZE8A 2QR5A 2RGEA 2W0MA 5CLFA 4NXNB 3B9PA 1XEAA 3T7IA 3I04M 3H4VA 4QOSA 3MJDA 3GPLA 3R3JA 5FNZA 4DL9A 1E0AA 3DFIA 4H7JA 4MQUA 3HBLA 5GONF 1JHOA 2WJWA 3MD9A 5IHXA 5I3ZA 3JVVA 2R00C 3KXPA 3G2NA 4PIVA 3KEGA 1XXLA 5DIFA 1EINA 2Q0XA 1K8ZB 4BVBA 5CLGA 2X3FA 5HRCA 1KY5A 2P5SA 3BIFA 1E2NA 2YV4A 1P44A 4RKWA 3GG2A 3GRRA 4WTOA 4ZGGA 2GYVA 2C88A 2N42A 4UBIA 4YTEA 4AJLA 3R8CA 5JNSA 4JBIA 1BE6A 1H8HA 4EWLA 2XUGA 2H1IA 4FFRA 3PR3A 3QVUA 1FDSA 1Q3KA 3TB6A 5LKRA 4LFBB 1I9GA 1TDJA 5A2GA 3R77A 1ZVVA 5JHGB 1XZ8A 3CZQA 5BVGA 1A7JA 4ZDWA 3M1LA 2XR1A 3OZFA 4KUGA 3PUIA 3SXUA 1NNUA 3HQ4O 4MV3A 3U48A 4REOA 4F06A 4MHTA 4MHSA 4ZO6A 4QU8A 2QZZA 4DJ5X 4ZCQA 5BVGB 2Q3CA 1Q83A 3TW4A 4DR3B 1CEEA 2H63A 3CG4A 2WKRA 4WHMA 4CODB 3SIRA 3SE7A 3M6IA 4EYOA 2DVMA 3H8WA 1JLRA 3GEMA 4Q3BA 4G36A 1KVUA 4Y2XA 1O7JA 1YZLA 2CD7A 1H94A 3Q9UA 1NM5A 4D6PA 5H59A 4DPLA 2GCNA 4MGZR 2PGNA 2X1VA 1CCWA 3BSSA 1XD8A 5I9MA 2ZW9A 1ZN8A 4RZ2A 4DDVA 1ZSNA 1F17A 3F5MA 3KUDA 1LZKA 3IV6A 1R88A 2CLDX 5BV1A 4LJRA 4D3YA 1K88A 1II9A 1Z6AA 1ZNXA 1G3QA 3ONVA 4R5HA 1YK0A 3EC1A 3MUEA 4I4NA 4WK6A 1U9ZA 1Y9ZA 2GHIA 2QRVB 3F1KA 2B8NA 3S5JA 4RL4A 2CHFA 4PPNA 2XRYA 4OJYA 2FN9A 3QWBA 1JWBB 4U6QA 5HJ2A 5ICFA 3TVYA 3UW1A 1LX7A 2JB9A 3T5GA 3OCJA 4TUYF 2OSVA 5K99A 4QASA 4BFWA 5KNDD 2VTDA 4GR4A 4D9MA 3RHFA 2NV6A 1FDVA 2WJ3A 5L7WA 2EW2A 3NBXX 4PLZA 4EAAA 3ZY5A 3WIBA 1J21A 4R9VA 3DYBA 4QRHA 4FFWA 5AW0A 3K5PA 4QJ4A 2AMVA 2PGIA 1PR0A 3EFHA 4YP0A 5DHUA 3G88A 3IEIA 3R20A 5ECGC 2ZTUA 1SXHA 1TT5B 2I71A 3H5LA 2OD7A 2SKCA 4GQBA 1MDFA 2X9QA 1I7SB 2H0RA 2BGMA 1K5GA 1MTOA 2ZYUX 2JL1A 4EVQA 4TT8A 4C0BA 4I1VA 1RCFA 2BKEA 2V98A 4UPDA 3UQZA 2C5HA 3EXEA 1YO6A 4I4TA 3DGFC 5K0NA 3PPVA 5F51A 2BAGA 4TKMA 1WUJS 5AXBA 4PYMA 4RELA 5ALNA 5CVCA 3ZX5A 5JDCA 5EC8A 3I58A 1BTOA 3I9MA 2HJVA 3EXEB 4PR3A 5FWYA 7REQA 5FFNA 4I2NA 3S55A 1QNFA 2QM7A 4L0CA 1AGXA 2QYHA 4U0KA 4X84A 4LMBA 1NVUQ 7REQB 2OXRA 4IWXA 4KTTE 4RDCA 5DEIA 3ADBA 2IS1A 4QUEA 5JI2E 2VATA 3B8EA 4AW9A 4DCCA 3OOYA 1DEKA 3K1TA 5CITA 4TVKA 3U3ZA 4PQGA 1NVEA 3QXSA 5LVAA 1J2EA 5JNRA 3VC7A 1I1HA 4TV9F 2WG2A 5IDYA 1PWEA 4EJ0A 5K8UA 1D2MA 1FQWA 3HCDA 1DINA 2YW2A 3NC0C 4RACA 1V9SA 2ZR0A 3CWQA 3B9QA 3CRRA 2PWBA 3PE4A 2Y2UA 3CU5A 4IFTA 3SBEA 4OMDA 1YJCA 2C7QA 4UEJA 2WZDA 3M4ZA 1E2GA 1RNLA 1I5EA 4BMPB 4N9QA 1QLWA 1L8LA 2C78A 2ECPA 2WA1A 3QFTA 1AGRA 5JT1A 3UJAA 3QI2A 2O8BA 5LZ5A 3KTAA 5AICA 4R9NA 2QUJA 3C41J 3NONA 3MELA 4X7RA 4LXTA 2HLDD 4D8UA 1UOQA 3D6VA 1LK5A 2MYTA 2PBZA 2BV3A 5CVDA 4XOUA 4B75A 2UYYA 4K05A 4DCVA 1RTTA 1P60A 5JNTA 4TYYA 4HTAA 1UKYA 3F74A 3Q72A 4H3KB 4IDPA 1DAPA 4HATA 1QQAA 2AN5A 1DDOA 5ENZA 3KL4A 4L4ZA 3WBFA 3RU9A 1PJTA 1PN3A 4WNYA 1UMCA 3T1VA 3T7SA 1W29A 2H4HA 4RFSA 5KU7A 1HXHA 3H9QA 4WSOA 3P0JA 3VHLB 3VNBA 4X1IB 3ZDYB 1EHIA 5EJFA 4ZTBA 3F7NA 4OUDB 5DN9A 2BBTA 1SRQA 1AQYA 4ZT3A 4QTZA 4MUNA 3N28A 4FQ5A 4JC4A 4OYLA 4RFSB 2WICA 3PENA 1Z07A 3WADA 3RYCA 4KYVA 1I6KA 5AR1A 5FOQA 1YGYA 2Q3FA 1SR8A 2RI6A 1BWPA 2H2GA 5TQ0A 3QG1A 1JTFA 1NI5A 1AKMA 2G7MC 2ZUDA 3K30A 4S12A 4DCPA 1GV1A 4RY8A 1V3VA 2V1XA 3W5UA 4BNGA 3I6BA 5LLDA 2MSKA 2C3YA 4EHAA 2OV4A 4OHBA 3VPAA 1C2TA 4BLPA 1IY2A 3OFSA 3TNFA 1U3TA 2KW5A 3Q9SA 4KQEA 5TQ0B 3U4GA 5JNVA 4OFZA 2IQIA 2ZBUA 3V34A 1RAFA 1MF7A 2WRZA 2OOKA 3MQ2A 4IFBA 1X1SA 3BHNA 4G5FA 4QQRA 3G23A 1AK9A 3L5OA 4LSZA 3DZDA 1L8QA 4MA4A 4UD2A 3RHZA 3K4PA 4QULA 3B1FA 2A57A 1SXJB 3HSYA 3IMKA 4BNZA 2OECA 5EZ5A 5FR2A 3ZD8A 2GH1A 4W1RA 3C5WP 1QYDA 3BREA 3Q5DA 3E3NA 3ML1A 5CDSA 1FU7A 1KJNA 1GV0A 2FEMA 3TNDA 4TV8A 5ED4A 2HLHA 2WU1A 3GZJA 4OHRA 1GTVA 1XYVA 1G8GA 3OLZA 3W1EA 4YT5A 3GFSA 3D7NA 3FR7A 3I1FA 3WY9A 3E8SA 3FH0A 4H16A 3WKCA 1Z6XA 3HJNA 3VC1A 3VQTA 4IGKA 4TV8B 4JX9A 3AY3A 2R00A 3GCZA 3H5VA 1V37A 5M3BA 1E2KA 2WDZA 4RU1A 5DWVA 5F23A 1UMBB 1DDIA 2NO4A 4MV8A 2I33A 4XE5A 1ODKA 3V32A 4P80A 4R83A 4IZIA 3B51X 3RW9A 2B4YA 1LSUA 4RIGA 4H0NA 3EXFA 3ZQKA 3UJ8A 1FMTA 2R44A 2IY9A 1S89A 1CFJA 4RD3A 4TL8A 3EEBA 3GLSA 2OM6A 1QM5A 3ZGXA 1VI2A 2FR0A 2I8AA 3F2VA 3O92A 3EXFB 4MVJD 2X58A 1YAJA 1E1YA 5CNKA 4NBRA 1AF4A 3E5NA 2RGAA 3GJXC 2QSZA 4GXQA 3UXMA 4ZOAA 5ES4B 3DAHA 3K71B 4AN0A 1QWSA 1X1TA 1YULA 3AUJB 4MAFA 1DKNA 3KPVA 2JAWA 3FPSA 3VO1A 4OI0A 1CF9A 3CB2A 2B9EA 2I4OA 2MYPA 2IX3A 1DQYA 1HZZC 4HY3A 4KYIB 1S96A 2XMSA 3HCFA 3PFHA 1R5BA 3IUNA 4MP3A 3QK7A 3Q9NA 2CXNA 3BS4A 3P2MA 3QV2A 4DMCA 4NYJR 2QUHA 3N0VA 4EEZA 2Q49A 3STTA 3CLRD 3GCGA 2F8TA 4AXXA 1T4DA 4DY6A 1LLUA 3DWGA 3H16A 3LUCA 3UC5A 5J5CA 4EI2A 4HWSA 1CDZA 3EJ6A 1TVKA 3T1HB 1Y80A 4A2QA 3A9TA 4Y6GB 1V41E 2WT4A 3NI2A 4CF4A 5L3QA 1VCIA 1QK3A 2IXBA 3KDSE 1E4VA 1F9EA 3I1IA 4FFPA 4H17A 4RD6A 4RMIA 4BNHA 3LBNA 4KR2A 5LA6A 2NV2B 4OD0A 2FJUA 3AHDA 3R4VA 1TVKB 3I4CA 4ZT4A 3WLFA 6ABPA 2IS4A 1Y5IA 2X9VA 3LKDA 5ECWA 4ZVQA 4CV0A 4D4JA 2SBTA 3GFBA 5L3QB 3LLUA 2VHWA 3O8QA 1DMSA 1PVVA 1SBHA 2FR1A 3EWNA 5LA6B 3UJPA 1JFSA 2P41A 5JWHA 2GM9A 1XDBA 3GLTA 2GO7A 3ZGLA 4A8HA 4D92A 2B8TA 4TXMA 1SUPA 2B94A 1KJZA 4L22A 1S2NA 1MAUA 1NVGA 1T9AA 3E5HA 3PJDA 3QA3E 5TX7A 1V11A 4OFBA 4C2AA 3GNSA 4OCZA 4CT5A 1KMHA 3GBPA 4EA9A 5BWLA 3L7CA 3IP6A 1KTIA 1OB5A 3BFVA 5EAIA 4C06A 2P9TA 5FNVA 5DBIA 4BWFB 1V11B 3U4CA 1DQZA 3KDPA 1X1DA 3KUCA 3LU1A 3M4NA 1JNYA 3IQXA 4HGOA 4KXUA 4PSAA 2NPFA 1VHJA 4DR2B 1KI2A 4KIWA 3ZY3A 2DWPA 2I2FA 5FNVB 1NTRA 4GRDA 4MVJI 3TPZA 1PL6A 2JLZA 2GN1A 2B7BA 2Y2VA 5KNLA 1GLGA 4YJHA 3VPDA 2OENG 3FWKA 1ISJA 4YCLA 4CMKA 1H2BA 1QUFA 3FY4A 4G24A 2WHRA 3ASZA 1KDVA 3WKEA 4KODA 4N41A 4KN8A 1CF2O 4YJHB 1ORWA 1YR1A 2YFQA 1XIVA 1QQ6A 5EPEA 3W6NA 1Q77A 4XUGB 3WGNA 5DVZA 1NKTA 4UUPA 5HA5A 1YHYA 1RPTA 3VSAA 4JX8A 4JJZA 2CBXA 3AR2A 2C31A 4MINA 3S2YA 1MJ5A 3IJEB 3HYSA 4DR5B 4DEXA 1U1IA 3F90A 4HDOB 4JI4B 3HR7A 2BH9A 5H4HA 1C8KA 5IK2D 2B7CA 3W5IA 2B1IA 3FMIA 4BQFA 3X1WA 1H0HA 2WYOA 1KA9H 1O5IA 4BLQA 4IV5A 2O2DA 2PSFA 3ETJA 3U9SA 1IH8A 2X7XA 5DSTA 1P3JA 3T1OA 1L5HA 3A06A 1K8QA 1SZPA 4PZ0A 3F6RA 2XCTB 2AF3C 2R6HA 3AHJA 5FH9A 1XLVA 4M8NE 1RBYA 2AN9A 1JA0A 1DP4A 3PSHA 4K9QA 1NLZA 4KMMA 3G79A 1G6HA 4MCAA 4BE4A 4DHWA 2VJMB 3KB8A 4R0MA 3Q0TA 4EJ2A 1XEWY 2QLFA 3BDVA 4EG4A 3BT7A 2BGIA 1QFSA 4NNOA 3T1NA 1WY5A 3NANA 3WL3A 3HVHA 4DYDA 3A2MA 4FDAA 4HD8A 5LDHA 1UM8A 1WHSA 5CA1A 3GX1A 3OZWA 2VK1A 4NULA 3ICQB 1Z6ZA 2DPGA 1N5IA 1NFFA 8ABPA 3D6FA 3SYTA 1JDVA 3AH8A 4Q3AA 1JR6A 1FPQA 1TUGA 3GHYA 3JQ6A 1N9KA 4RHUA 1TU4A 2XRFA 4MS1A 3FWZA 3BG5A 2PUAA 3V7UA 3N74A 2O1XA 5ANRB 3UUFA 5CFZA 2N1MA 3VKWA 1HRKA 1G55A 4M0DA 2HRQA 4NZYA 1Y0BA 3GFQA 2IYZA 4MS1B 3TDMA 1GJRA 4O4IA 2A58A 3F6YA 4GECA 3SI7A 4DAEA 3DVSX 4ZOQI 2EF1A 4MUMA 1E2IA 4ZAXA 1DQSA 1Z88A 4R98A 3RS9A 4AJNA 2FUG1 3GC6A 5B7GA 3FDIA 5FHRA 3H0KA 2HOQA 4IQ4A 3CT6A 4UDXX 4E1VA 1A95A 1VZ3A 1TM7E 1PP4A 2BT4A 2VS1A 1HLGA 1DAOA 4R8MA 1Z37A 1DC5A 4AZ0A 1YASA 4JWKA 3LC1O 2VAMA 3MJVA 3EZ7A 4R2XA 4XTCS 2JANA 1RHJA 1PS9A 4WDRA 2R68A 1PRYA 4WASA 1T25A 1DBWA 4I5FA 4TTQA 4MRAA 2AX3A 3S99A 2A1UA 2ZIUB 3EH1A 3GDHA 5BQXA 1ESNA 1E5TA 3FYCA 5ALRA 3G89A 1CQJB 1TA0A 1XEWX 1P7ZA 2XGMA 3RABA 3CRMA 1SCJA 3ICWA 1Z36A 4UZEA 1BWSA 2OC9A 4A82A 3RODA 5AO9A 2A1UB 4RGVA 3IVMA 4WNCA 4B6PA 3DDWA 1J00A 1XZEA 2R1UA 3B13B 3BD7A 5K20A 4GPD1 4JBXA 4QUAA 3EFBA 5T5QA 4RDXA 1M8JA 1IUOA 4KZKA 1FYDA 3D64A 3W2HA 2P6NA 3DHEA 1HNWB 621PA 5CMLA 1UXHA 1HE5A 2D0DA 3GMIA 1NXVA 3OUZA 3RUIA 1WBDA 3OETA 2QMHA 3ZJTA 2OD2A 3IQFA 3TNYA 3PUHA 3A6JA 9ATCA 4P7JA 4LF4B 4IVRA 2J6HA 4PNEA 1IHOA 3KT0A 4Q4JA 4CM9D 1RAIA 3AQ4A 3OLXA 4N0PA 3UFBA 4A0RA 4EG8A 4YMTA 3FPEA 3HCWA 3BTVA 1FK8A 1E99A 4O0LA 3EGIA 4C1BA 4J6FA 2Z98A 3WS7A 4PZDA 1ZGZA 2IC5A 4ZEXA 1I2CA 3EIHA 1A1VA 4ZYLA 4Q4JB 3DD1A 5BN3B 1N6IA 1N4DA 3QUQA 5A71A 4GPBA 1UWVA 1JR4A 5DNEA 1JHQA 1BDBA 1XNJA 3E22A 3UK1A 1J5EB 2HU7A 4AXBA 3L4KA 2X8LA 1OA1A 3ZDQA 3KHSA 2B5OA 1Y3CE 3OLCX 5H9WA 1M0EA 1YKGA 1GTZA 1XI2A 2DTXA 5AD1A 2FZ4A 4RO0A 1IG0A 1V1MA 2VSOA 3E22B 4ZU3A 1G7CA 3I4LA 1MB9A 5CDHA 3QSYA 2X7JA 4X8OA 1ZN2A 2V6BA 2QJTA 3M3PA 5M7EA 4CUKA 4R54A 5KQSA 3T6KA 2RI0A 1HZZA 3FSJX 4P7BA 1V1MB 4R1SA 4M9UA 1EXMA 2LIVA 2I9KA 5AOCA 1EWYA 3D4IA 2RH8A 2RDMA 3D81A 3MCWA 4R01A 5ES3A 2BGLA 2H3HA 1YK1A 5FTNA 3ZHTA 2JS7A 1UMKA 1YDGA 5BSMA 4PLYA 3PC8C 1MRZA 5D86A 3LECA 4F11A 1XF1A 1PLKA 1R8SA 1KAMA 4LGYA 4D82A 2PHZA 3ITEA 2IPOA 2JNWA 1LVHA 1U04A 4JGIA 3DE0X 3GD7A 1LDBA 2RIRA 2V7VA 1GQSA 1LNSA 2OC4A 2YHUA 2PL5A 3KLMX 4QHYA 1ZKMA 3TE6A 4BB5A 1T3ZA 1EFAA 3GLQA 3ND8A 4IXWA 2R2GA 1P1IA 2II6A 3IFSA 5K0JA 1XZQA 5CVJA 1ZD8A 1ZJZA 4V3BA 2C7VA 3UGJA 5JPDA 4LF6B 3ZPXA 4G1BA 1OTHA 3KHKA 4EVRA 3LHIA 2OA0A 1EMDA 1GQRA 3DZFA 5FO1A 4BGVA 3PX7A 1K8RA 1JWAB 4I5DA 2FQQA 4Q4HA 4F4CA 2JRLA 4PWYA 2EU8A 2AIRA 2HSDA 4D8VA 1RJWA 3S2ZA 4ED9A 1M7HA 1KMNA 1RP7A 2RJNA 4W4TA 5BWNA 4Q3NA 4MQEA 3I9LA 4Q4HB 1SXJE 3SQLA 3WQSB 3B52X 2Y67A 1VKRA 4CN9A 4ZPJA 2IU0A 1D8AA 4L4XA 2WJ6A 3WGJA 5LJIA 4YRQA 4R05A 5FBVB 3OX2A 4MQEB 1QZUA 4MROA 1GR1A 4BVLA 3R0IA 2K87A 4OGWA 4DWOA 3I9KA 1E6KA 5EXTA 4B81A 2Q1UA 5CCXA