4PZ0A

The crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
b'DKKKADDVKFAFIPKLTGVGFFTSGGEGAKEMGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDALMVSSTSVDGLSQSLQRAKKKGMTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAKEIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENLKMDKKVVVTGFSTPNVMRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar ABC transporter, sugar-binding protein
publication title The crystal structure of a solute binding protein from Bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (AI-2).
rcsb
source organism Bacillus anthracis
molecule tags Sugar binding protein
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pz0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pz0A01
2IKSA 3KYJB 4YLEA 4EYKA 1ZN2A 2E4WA 4WUTA 5CNJA 3OO1A 2L2QA 3KS9A 3TMYA 4IMJB 4XAQA 3OM1A 4PEVA 4MGEA 1JX6A 1LBHA 3T95A 4Z4HA 3GT7A 3CNBA 3H5VA 1VPWA 2PL1A 3H5TA 3O2JA 3OM0A 3VNAA 5EWJA 4P98A 4DQDA 3LTEA 3RH0A 5HM6A 1ZAYA 3R0JA 4UHJA 3UK0A 4F11A 2JVKA 2WB4A 3C3WA 3GYBA 2PL9A 3HS3A 1JYEA 4LRQA 4RSMA 5GOTA 1GUBA 3EJWA 1TJYA 5JNRA 4G0QA 4HNSA 3CZCA 4EVSA 3LUGA 2JK1A 4NQRA 4MQEA 1U2QA 1FFGA 1AB6A 2Q5CA 4D6YA 1LJUA 4Z9AA 4EYGA 3HDVA 1JDPA 3URMA 1YVUA 2MYNA 1T34A 1USIA 3H5WA 1M5TA 4XFKA 2N9UA 3CLKA 2LP4Y 3F6CA 4W5NA 3D8UA 1YK1A 1WETA 1EWKA 2ZWMA 5FWYA 3P9YA 3O1HB 2JVIA 2NUBA 4GNRA 2CD7A 1TM2A 2E4YA 2MSWA 4RDCA 2AYXA 3FMVA 4LE2A 4RS3A 4YWHA 4FB4A 4ZJPA 5IEJA 2A9QA 4KRFA 2LPMA 4KQCA 2LIVA 1DZ3A 2QR3A 1EWTA 4OLBA 3H1EA 5CNIA 1D1PA 2FN9A 1VLZA 2IPAB 2PUBA 1M2FA 1USGA 1I3CA 5IX8A 2J48A 3HUUA 4FE7A 2FSPA 3QX9A 2FMIA 3JTEA 2QXYA 4F3TA 3RVOA 2JBAA 4FE4A 2PE5A 1D1QA 4Y9TA 1KMIY 4W5RA 4JA2A 4TMYA 2XDYA 2PAFA 4MLCA 4RKQA 4YR7A 3RVKA 3CS3A 3N0RA 3IP6A 3L49A 3OMXA 3HDGA 3QK7A 4OATA 4RXMA 1DC7A 1PEAA 3EULA 4G0YA 5HSGA 3IPCA 5TQJA 1DBPA 4O5AA 4QYWA 4IF4A 1KRWA 1Z2DA 2PKXA 1BDIA 2HPHA 4ML3A 4N41A 1BA2A 4MS1A 1E6LA 2R48A 3LFTA 4YV7A 5IUNC 3C3KA 1SRRA 4RY8A 3MYYA 1JLKA 1YMVA 2FLKA 3C97A 1TVMA 3HUTA 2CWDA 1ZY2A 4MR9A 1CEYA 4LDAA 1DC8A 2OQRA 3LUJA 2JVJA 4Q7EA 4KFCA 2IOYA 3M9WA 1QKKA 1M2EA 1DG9A 3UUGA 1OXBB 1ZITA 3CKMA 3MMNA 1RZRA 4O1IA 3KTOA 3Q41A 2PJUA 2ZAYA 4KNYA 2P9HA 2VUHB 4Z4EA 4WT7A 1QP4A 5C5EA 4IGAA 4EYOA 3EQZA 1D4ZA 2HSGA 4YS6A 1JHZA 2AYZA 5JNWA 2VK2A 3BRSA 4JAVC 5IBQA 3CTPA 1JFTA 5FBHA 1PNTA 3A10A 3JVDA 1A0OA 3Q7RA 2FQXA 1P6UA 5EWLA 5FWYB 5IC5A 2B1JA 1K66A 2V0NA 3ROFA 1NXOA 1QNLA 5DTEA 3LUFA 1NTRA 5KWSA 2F8SA 4YRZA 4LE1A 4E7OA 5ED4A 1QPZA 1GCAA 3OMWA 4N76A 2HQBA 3CG0A 3H5LA 1ABEA 2LUOA 4N0QA 1Y1LA 4ETMA 3HO1A 4Q6BA 3GBPA 5JS2A 3ILYA 4PICA 2HJ9A 3VNBA 8ABPA 5HQJA 2FXIA 2JBAB 2RJOA 1LJLA 2GI4A 1YK0A 1NXWA 3BBLA 5C5CA 5KQLA 2I6FA 5FBKA 1XHFA 1BDHA 1DCKA 3MF4A 5CNMA 3FDFA 4W5QA 4Z4FA 4CBVA 3KSMA 2WY2D 3OLXA 4G0XA 4MS4B 2H0AA 3MA0A 4YO7A 4ZPJA 4JB0A 4UHKA 1Z16A 3A0UA 3CU5A 1PUXA 4KV7A 3A0RB 5CHYA 4MS1B 1SXHA 1MVOA 4GPAA 6ABPA 3N0WA 1E2BA 4MR9B 2GX6A 1GLGA 4KVFA 3QLUC 1K68A 3JS5A 4MR8B 4KQ9A 4RU1A 2RDMA 3H6HA 5DGCA 3CRNA 4D74A 4HNRA 2E4UA 1U04A 1DBQA 1YS7A 4WZZA 2IYNA 3OLZA 1DCFA 4DN6A 4KK3A 1JFSA 2FTKE 4O1HA 1U2PA 4RXTA 4MS3A 5FWXB 3H1GA 3F6PA 4HNQA 4EVRA 1RXEA 3G1WA 3I42A 5IEBA 1GUDA 3RVNA 4S04A 3D02A 5CNKA 3O75A 3A3KA 1MB0A 1NATA 3QELA 1L5ZA 3S99A 3W9SA 4YP9A 3GV0A 5BQ3A 5PNTA 2GWRA 5EWLB 3T38A 3IP9A 3I5AA 3N75A 4Z0NA 1LK0A 3NBMA 4HYEA 4RZSA 4L4UA 1JWLA 4Z4IA 3KJXA 1HEYA 2F8TA 2WJAA 5TE9A 5JNUA 1E6KA 1JYFA 1NXVA 3CHYA 3M6MD 1DP4A 4KMRA 3N6VA 3GA5A 5JNVA 3QX8A 3QEMB 3MQ4A 3G85A 3KKEA 5EWMA 4RXUA 4MS4A 4F06A 3OQMA 2FVYA 4QICA 1YTUA 2L18A 1M5UA 1R8JA 3BREA 1BAPA 2MYTA 1Z2EA 5D2CA 5IUKC 1DCMA 1ZH2A 3E61A 5T3YA 1Z13A 4D6XA 4EYQA 5T7BA 5JNTA 3C3MA 1PNRA 5KI6A 2FEWB 3RVRA 2NZUG 4LDZA 4MQFB 4YGXB 4RK0A 1F4VA 4OBBA 3H6GA 3NHZA 4MR8A 1LBIA 5TPWA 2O20A 3SM9A 4DADA 4EUKA 2R4QA 1JBEA 3QLVC 2HQRA 5TPZD 2MSKA 3LKBA 1A2OA 2A9OA 4L85A 1RNLA 4MLDA 2ID9A 1JF8A 1VKRA 3RVPA 4LX8A 1EAYA 3OLWA 4XXHA 3MM4A 5JNSA 3T6KA 5FWXA 1P6QA 2RJNA 3IDOA 3RVQA 4WXMA 1D5WA 3NNDA 3QLUA 2E4XA 4Q6WA 2QSJA 1YMUA 4H60A 1YS6A 3B2NA 2CHFA 2R47A 3EDCA 2PUDA 1DRJA 4IRXA 3OLVA 4MS3B 4N03A 3Q7SA 3OO0A 3DLBA 3HZHA 4QPJC 4MYRA 4B09A 1SXIA 1NXSA 4H3KB 1C4WA 3QELB 4F8JA 3HJFA 1P2FA 2TMYA 3I09A 3I45A 3OQOA 3SQNA 4WWHA 1PHRA 3FFTA 3O1IC 3Q7TA 2JRLA 5B3JC 4KREA 4RY9A 1Z26A 3JPWA 5BRJA 3QEMA 4S05A 5I4CA 1D2AA 2PUFA 2MYPA 1EHCA 4TLMB 3CZ5A 3RQIA 3FFWA 1DBWA 4QYMA 1AB5A 3RVMA 1QO0A 2NT3A 3N0XA 4IMIB 1E6MA 3O1JC 3H5OA 3O74A 1U8TA 3GWGA 3HSYA 9ABPA 1URPA 3RVJA 3DBIA 1L5YA 3OLYA 2FMKA 2FQWA 5E3JA 3H5IA 1Z25A 3NHMA 4XASA 3EQ2A 5EWMB 3QLTA 4MQFA 1MAVA 2JB9A 1PEYA 4MR7A 4EGSA 1QMPA 3LKVA 4Z9BA 3EODA 1Z18A 2LBPA 2A9PA 1XHEA 3DLHA 4OLAA 4ZMSA 3JPYA 4RWEA 4MRMA 2CHEA 1W25A 1SD5A 4JB2A 5KQGA 4P1ZA 3JY6A 5TPWB 5KQMA 1KRXA 3SG0A 5JS1A 3K4HA 4ETNA 1VRVA 3EAFA 3BRQA 2WMYA 1KGSA 3QEKA 2JCGA 1NY5A 3JVIA 3HV2A 4Z4GA 2IPMA 4ETIA 1ZHHA 3N53A 3QLVA 1Z15A 3F73A 2QU7A 5KC8A 3N8IA 4NV3A 3LUDA 3HXMA 5KC9A 4E7PA 2KYRA 2MYUA 3GRCA 3Q15C 3DGFC 1DJMA 2PMCA 3ROTA 2H3HA 3LMKA 1QQAA 4RV5A 2A9RA 4F12A 1USKA 4H3HB 5TQ0B 4G0PA 5TQ2A 4OTZA 3RVSA 1FSPA 4IILA 1FQWA 1TLFA 3ILHA 3HCWA 1EFAA 2FMHA 2W42A 3Q9SA 2FEPA 2WRZA 2NZVG 3T8YA 4PZ0A 3H1FA 1NXTA 2FW0A 1BVHA 1CYEA 4EVQA 2E4VA 4NICA 5BR1A 3HK2A 1ABFA 3KCNA 4TLLB 1NXXA 2FKAA 3KHTA 4KZKA 1Z17A 4G0MA 4MPTA 5IUJC 1QP0A 1JFVA 3EGCA 1JL3A 3C6QA 4JP1A 1ISRA 3SY8A 5KQPA 5DCLA 4RY0A 1FFWA 3KLNA 3LUCA 2X7XA 4N47A 1RZRD 1JH9A 4RK5A 5B3JA 3L6UA 1W9HA 3HVRA 3CFYA 3IP7A 3IP5A 3F7NA 4PYRA 2YHBA 1Z12A 1ZGGA 3K9CA 3KLOA 4ZMRA 4OG2A 1QQBA 3TB6A 1ZESA 2PUAA 3GBVA 2NT4A 2E4ZA 5IULC 4NCBA 3LOPA 1QP7A 3OQNA 1A04A 2L19A 3HEBA 4MR7B 2WWVD 2QV0A 2FQYA 4XARA 4RK7A 5F64A 1CHNA 2VUIB 3LUKA 2GKGA 3NNSA 3SNKA 3IPAA 3O21A 2PLNA 1ISSA 3CG4A 4JASB 4MRMB 3LUAA 1IIBA 1MB3A 1RPJA 3MIZA 4G0ZA 4W5OA 2BGGA 3RVLA 3NNNA 4NCAA 2L17A 4G86A 1YIOA 2M1ZA 3FFXA 1S8NA 6CHYA 2IPNA 4JOQA 5EWJB 1U0SY 1ZH4A 4RK4A 1P8AA 1QO0D 1FFSA 4MAAA 2MSLA 3KYIB 5TQ0A 3KG2A 4ZYLA 3BILA 2ID7A 4LE0A 2GBPA 2RGYA 7ABPA 3HM9A 1H9CA 2PUEA 3FGZA 1BDJA 2IDMA 4KK4A 2QVCA 5GQSA 1ZDMA 3GL9A 4Z4CA 2PUGA 2P4UA 4RKRA 5TQ2B 1ZVVA 1NXPA 4MQEB 4G97A 1J56A 1XWWA 1GCGA 2FEKA 4XLTA 5DLEA 3TX6A 3TO5A 1APBA 2DRIA 4WXEA 4TN5A 4RK6A 5BRAA 3LUHA 2QVGA 5DKFA 3SAJA 3DZDA 1JDNA 4RK1A 2YHAA 2VYCA 4PE5B 1OXKB 2QZJA 4W5TA 4Z99A 1C0EA 1B00A 3H75A 2HQOA 1UDRA 4LZLA 4G0OA 5TPZA 2FLWA 3DGEC 1SXGA 4YCSA 5HKOA 2PUCA 1MIHA 3UKJA 2WJWA 3M9XA 2IPLA 3O2QB 3E3MA 4N0PA 2OENG 5ABPA 4EY3A 2FN8A 3O2SB 2M98A 3TD9A 4KPYA 1DRKA 2B4AA 1EWVA 1F51E 1TMYA 4M88A 2QW1A 2R25B 2FMFA 1ZGZA 1RXIA
chains in the Genus database with same CATH superfamily
1SC1A 3RU2A 1XQWA 4F60A 2P6PA 2YDXA 4O2BA 2J3QA 3VR3D 5U9CA 2QAGC 4BVLA 4WUTA 4CEJA 2DKOA 3ENNA 1GSHA 4E32A 2JDIA 3OUTA 2VHXA 3UVEA 4MGEA 1TAUA 1ND5A 4JELA 4KLCA 3U3RA 2NTYC 3AERB 3GT7A 3CNBA 3HE3A 5DNDA 1Q1BA 2O5EA 2BM8A 2AF4C 3EVCA 1NASA 3IVRA 1WZCA 3O47A 5HM6A 5EERA 1Y1TA 4Q7MB 5TB5A 5JD6A 1KL7A 3LUBA 1KFJB 3PXDA 3BHMA 5MGBA 1GA6A 4DS3A 3ZZTA 5BMOA 1VXRA 3HBMA 5GOTA 2O3QA 1XTJA 5ENDA 5CPFA 1ONOA 2W0SA 2Z6VA 3CLVA 4DIOA 5A4FS 1E9CA 1JQ5A 2HZBA 4P9NA 5AK3A 2CVOA 4YA6A 2P9BA 3D6UA 1A96A 2QTFA 2UZ1B 4ZVKA 2PMFA 1IOWA 3NHBA 4FXPA 2ZUWA 4BQRA 1KJWA 2C2KA 2R6HA 4DUZB 1G20A 1EFVA 1LJUA 1CYEA 1ML4A 1P1KA 1CZKA 3IH5A 1FTQA 2OZPA 1US8B 2HXSA 4UUQA 3HXOA 4UTOA 2D8AA 4HBGA 4MUXA 1BE8A 3PKIA 2R1TA 5I9BA 5HZHA 5DT2A 3EQ8A 1LDEA 1OFGA 2FPGB 1RMQA 2WVAA 3QF4B 3U9SA 2PT5A 4RV9A 1O6ZA 2ZWMA 3ISJA 1KHTA 2QLMA 4I1RA 4BZQA 2FFJA 2QUBA 3I0ZA 1I7LA 1AKRA 1YMQA 5K3EA 2CL7X 3L1VA 1M2WA 1Z38A 1TMOA 3TQOA 4BTLA 2BH2A 3LY9A 3MB8A 2R8EA 4RVCA 5KHOC 2A9QA 3MTBA 3WGHA 1UJ4A 5FWAA 1ICEA 2Q27A 4GLFA 2OILA 1ZICA 4I9HA 3TK1A 4FT2A 5IVDA 4B4OA 1H0HA 2GEBA 4B79A 2QZ4A 5KJEA 1KVUA 2SKEA 1YR8A 1ZL0A 5AVSA 1MT0A 1W36C 3DT9A 1CJMA 2P9TA 3KVNA 4QOGA 3KJNA 1UWKA 4OA8A 1U9ZA 1WHSA 2ROQA 2PV7A 1F6DA 3ZWCA 4BVGA 5TMBA 4F3TA 2P2YA 4MX8A 4LOAA 5GZ3A 1QV7A 2PZFA 4WDRA 2JI8A 4FYYA 3L04A 5JJLA 3T52A 2GVDC 3WLTA 2XCIA 4CL8A 4M8IA 2VHZA 3P9IA 2DYKA 3SYLA 3L0CA 4FOTA 3U3MA 3OFSA 2JL1A 1GYQA 1Q15A 5I7AA 3PFGA 2XEDA 5L7YA 3ZGXA 3DDZX 1SB8A 3DKPA 1RADA 3AR9A 1NMSA 1GXSB 1W96A 1Z2DA 1Q57A 2CNKA 3F9IA 2B98A 4WI1A 4X1IB 5D87A 3X1XA 1RXUA 2W6NA 4WOPA 3IDZA 3LFTA 4MIYA 4DJDC 3VI4B 4TV9B 3PP8A 1YMVA 2FY8A 2Q8QA 3A6EA 4J8PA 3FRJA 1B23P 2SBTA 4GEKA 1ZY2A 2X2EA 1K75A 2CJXA 2UYGA 1G5IA 4LDAA 1VHTA 5HDBB 4E14A 4YT2A 2A0KA 2IOYA 3A9WA 3AR6A 4PY2A 3E9RA 2ZANA 3R7BA 5FTLA 1T25A 4IQ8A 3GNTA 4Q4DA 1L5WA 3EF1A 4QOSA 3DNMA 4BO4A 3FSEA 5KNBD 2X2PA 1W4AA 3EUFA 3LG2A 4L2IB 3KOZA 1VCMA 3GN2A 4JBHA 5LIPA 4BL5A 1QP4A 1I1NA 1CIVA 1T8YA 1NNUA 1M72A 1XQVA 4FP9A 4IGAA 1Y7PA 4PLZA 4RULA 1UAAA 4FYXA 4MB0A 5GONF 2VC2B 4JQZA 3LYHA 2PWZA 3LBAA 5DM1A 4BNGA 4U2FA 1M5RA 3SBEA 3ZU2A 5FBHA 4X3OA 1U9CA 1WLYA 2IQIA 1FS4A 2XTZA 4CI0B 5FWYB 4RANA 4BLTA 1G8YA 3KTDA 4C6RA 1H3EA 4RY2A 5IARA 4LDPA 4A36A 3IYLW 5HOEA 1LLFA 2PQ0A 4MHOA 2BBSA 3THOA 1YOVA 2XV1A 3I6YA 3RBAA 4DV0B 4BNWA 3IUEA 4GEGA 4W4TA 4DM3A 5CG1A 4RCVA 1P0QA 1Y6FA 4O4HF 3KIPA 3MB5A 4FBLA 2G36A 1QHXA 1VPTA 1WHTA 2WHYA 3GJ5A 3H5LA 3Q7EA 4H35A 3RU3A 1XXHB 3PPIA 4ZYTA 3OIVA 2AZDA 2KPOA 1KNQA 2BEUB 2Y66A 4M7PA 1SULA 3AF5A 2Q5IA 4KQ1A 5HRAA 4ZAXA 1Y89A 1FP7A 5TMDA 1XDSA 4PICA 1B41A 2QOEA 3K6SB 2BSXA 1MFPA 1O87A 1IMOA 1ZMOA 2GI4A 1R9MA 2AB0A 3P4UA 4GMXA 4HRAA 1QZTA 1V8ZA 4OEHA 3QHPA 3BBLA 4H1TA 2UZ3A 3TIIA 1Q17A 2D2IA 2VHTA 3LXRA 3IJEB 4LHZA 1Z7GA 3VV3A 4EP1A 1C8VB 4EO4A 3WIUA 1QU2A 2WU4A 4JBIA 3UIEA 3ZS9A 3HVIA 4MS4B 1JLSA 1VJCA 1PR0A 4K0RA 2VQ6A 1TUBB 3ADDA 1DQNA 1QB7A 2OFWA 2VXOA 2Y99A 4X7BA 1JB9A 3A6LA 4JB0A 5E9WA 4MCIA 4IDHA 3WB1A 3FOWA 4PG8A 3S2IA 2R8BA 1QIDA 3GFQA 2EDAA 4IICA 3O93A 3SC4A 4CLXA 3NALA 3TKLA 1W5AA 2IZ1A 5C46F 3EVTA 3FRHA 2PKWA 1R16A 1PZGA 1FFDA 1OREA 2B5WA 3SS8A 5KYYB 3DLPX 4MR9B 1DMSA 4KIJA 1NVFA 1P3DA 2AOXA 4ZWNA 3COPA 2PUTA 3RE1A 2FPIA 1TQ6A 3K6RA 1V8PA 4JOBA 2PWPA 3A6GA 3P9QA 3E9EA 2E7ZA 2ZTLA 2O8CB 5A3JA 4JU8A 2CJWB 5H82A 4TKUA 4E94A 1G2QA 1HL3A 2QD3A 2XD9A 3U9TA 1CB7A 3IKTA 4D96A 1JKXA 1LTQA 4KB5A 5KOYA 3G0GA 2X58A 3I42A 5IFLA 2Q0SA 4S04A 2A5FA 1X87A 4UASA 2AW3A 4D9KA 5K05A 1Y1RA 2B4TO 3QELA 1CZUA 1W9MA 2M6RA 3JALA 4KAAA 4YEDA 3BT7A 2ZJ1A 3JASB 3OZGA 4DV4B 2HIAA 5AJWA 2XZPA 2XUIA 2N47A 1N2HA 2YY7A 2PNJA 1K86A 3O1LA 3I62A 2F17A 4LFCB 1DAMA 1O57A 4MUHA 4OHVA 1OJ7A 2H4HA 2I62A 2VJMA 4LXQA 1DTWB 4WESA 3SXPA 3CVXA 1PQUA 1OFUX 1B8PA 3CURA 1VDMA 5EXDA 2GBCA 2N0SA 2A5DA 2WD8A 3QVWA 4A5SA 4EPRA 3V5NA 1DIBA 1PG2A 5FL7A 3SYKA 1YTUA 3NKFA 2YW9A 3DDCA 2V6GA 3KU1A 1RJDA 3LY5A 5I7WA 1UJBA 4HQNA 5TC4A 3ZOKA 5G2OA 2E18A 3LC1O 4OMUA 1G7RA 2QLLA 2NYAA 4J9VA 3TL2A 5JZSA 5M2QA 1Y8RA 1XMXA 2XHZA 2Q6OA 3AR5A 4MYTA 3PXGA 4KQIA 1P77A 2OZLB 1ORHA 5FNZA 3TTSA 3T99A 3A4VA 2F3PA 4A8JB 2NGRA 4ZCSA 5IZ4A 3G5AA 4MH0R 1PLJA 1JBEA 1CUUA 2VH5R 3D7KA 5CT9A 3W8EA 2NIPA 2PH5A 4EJ2A 3SJZA 2EKZA 3I9OA 1NW7A 3NAGA 4ESHA 1B15A 3DULA 4R9SA 2VXBA 4XXHA 2UVPB 4JP2A 3V42A 1OBCA 4UFOA 4BUCA 1QS0A 1KJNA 4Q9DA 3PDUA 2BEKA 1KEZA 2UZIR 4N6OA 4RHYA 2F1OA 5TEWA 4DDHA 3OESA 1ITZA 5JAHA 2G09A 4G5GA 5FP0A 1K6JA 5FUXA 4LZPA 3G17A 3WFIA 1UAGA 2GN8A 1S2GA 3V8NA 1WU8A 1K2WA 1TYDE 4YUYA 3BK1A 4QXRA 1UH5A 4C4RA 4FHCA 4N8DA 3W79A 3K96A 5T4EA 1GCIA 1K8YB 2COEA 5JAUA 2IH5A 5EZYF 2ZDQA 3I04A 1UMCB 3ENKA 2WWFA 3PQ6A 4GRAA 1O77A 1LPMA 3H8WA 4A8PA 1U31A 1J24A 5LBTA 1DT5A 1J06A 3KO8A 1I4LD 2ICAA 1OV6A 2B1IA 3D4LA 4TLMB 1HG1A 3A25A 4FYKA 2FCAA 5C7IO 3NIWA 3L7MA 4YREA 4WOKA 4DL9A 2C99A 1NG9A 4IUDS 4EY7A 3NVDA 4BLSA 1IWPB 1V1RB 3JQ9C 3VNUA 3K20A 4IWNA 4C30A 4ZU3A 1U7TA 1EFTA 2V7QA 5LP6C 1FTNA 5CXSA 1E61A 1R37A 4AN0A 4CTKA 1SA0B 5K09A 1WM1A 1ZINA 2B2NA 3BB1A 2CUZA 3BIOA 4LJ4A 2BMDA 5JO0A 1WVIA 3ZE1B 2EOAA 4JEMA 3I9NA 1I94B 1ZH6A 3AQ4A 4ZV7A 5EMJA 3F9RA 3ZIAD 3FTFA 5E6RA 2RHCA 3B85A 4FQ7A 2Q7XA 4OD0A 3U1BA 2HWXA 4MW0A 5EZ5A 5ALRA 1C7ZA 2EZTA 1XRQA 1SIWA 1F8FA 3E5NA 5K8LA 4BQEA 1RYYA 2O2DA 8OHMA 2OY0A 1NOIA 1KRXA 2VPPA 3PHHA 4ETNA 1JDZA 2FWPA 1FEZA 1XZGA 5HCNA 2VDOB 1DZIA 4YNBA 4IVRA 4HDOB 4J3JA 1NI4B 3UMGA 4ER6A 4D3SA 4R71A 3UJ8A 4QOJA 1YUNA 3NTOA 1O5IA 1JAHA 1GKLA 2OORC 2WKQA 3DLTA 4NP6A 3VJKA 3TVYA 3ONNA 4RELA 4ZYWA 2DY0A 4BTEA 2QRHA 4IJWA 2GKSA 5AW3A 1CUGA 2ZYAA 3JQ6A 1N7IA 1LKZA 2VJYA 2W2VA 4FQ8A 4M86A 1LQ2A 3ACBA 1BFKA 1NQUA 1FJ2A 1MJNA 1QH9A 1NKSA 1RHKA 1SU6A 3IQGX 4OTZA 3V4OA 1TKRA 5BVHA 4EHHA 2RG1A 3JZDA 4K6OA 2R79A 2PT6A 3L05A 3TDMA 4RH3A 4QOFA 3HXLA 3SVLA 1KH3A 1YRLA 3WMXA 1IZ9A 4B0PA 4EQ6B 2W8BA 4GX1A 3LX6A 2ASVA 4HLCA 2D2FA 5E7MA 2ZUSA 1OU0A 1FFXA 2DC1A 1ATIA 1DEOA 1GARA 3JQAD 3UT5A 4N5IX 3GRAA 1LRLA 1UBEA 1PNOA 1P2DA 4FFMA 3LFHA 2EDCA 3GLRA 4FGKA 3KOMA 1IHUA 2HH9A 4L4XA 2HWKA 4X6LA 1ISRA 1L5KA 1OX4B 4F2WA 2YZNA 1A4XA 2BKEA 5KQPA 1Z2OX 1XWFA 3N2LA 2OAGA 4N3BA 2VDLB 1YS4A 2B8TA 4U39A 2R1VB 3MK31 1E20A 4LZOA 4YAUA 2BUBA 1NULA 4BIMA 3CFYA 4BRUA 3R20A 5IFKA 3QWHA 1MDFA 3CVJA 3HVRA 1HKHA 3FKJA 2QZ9A 3MWGA 1YJQA 2JEYA 4XKJA 1V4VA 3D4OA 2ONKA 4UVDA 4DUGD 5I5EA 2IHBA 3B82A 1S3GA 5ESRA 1N2OA 1RKUA 3EW7A 3M2PA 4BAGA 4AJPA 4EHLA 2Y4OA 1KMNA 3RU9A 5H80A 3TRJA 3AUSA 3V3KA 2QYHA 3L8ZA 1BMFD 3ND8A 4MRRA 3V1MA 1GL7A 3BZBA 3ZW9A 2IS1A 1F2TA 1K2VN 3AHIA 1MABB 1P7WA 4H08A 2VHEA 4GBMA 5F98A 2LNDA 3VH4A 1FFHA 3TAXA 1ZCBA 3K30A 2XMQA 1U2GA 3K1AA 4FHFA 5DULA 1NSTA 4DDWA 1ZK2A 1LD3A 4M0DA 3R41A 1Z2AA 1KZ7B 4R05A 2QTLA 1S0UA 1BOOA 5CW2A 1C3XA 3EGVA 5B1HA 3TH5A 2AG1A 2QHXA 1U9JA 5KAMA 2QE7D 2FKNA 5LOVA 2EIHA 3JCZA 2AVDA 1OCEA 4C1BA 3ODGA 1PVVA 3TD6A 2AC7A 1L4YA 2K2WA 2QTNA 4WK4B 1PYGA 4NU0A 1BWRA 1V8OA 5DHPA 3TX6A 4ERXA 4XLTA 3BMCB 2J09A 3G5MA 4UU8A 5IC4A 4DC9A 5J5VA 1EG2A 4V0RA 3RAJA 4KX5A 4TUYB 3BF7A 4RK1A 2ZWAA 1BD3A 1R0KA 2GESA 2QY9A 2PXCA 4IINA 1S2OA 1QG0A 2VSFA 4CEIA 5FTJA 5AW9A 3W5BA 4DXDA 4CTNA 2XJ9A 4GYKA 1NP7A 6LDHA 1S2LA 2H1WA 5BW8A 1RHRA 3R9XB 4FZJA 3V7WA 4FFOA 2EGHA 4L5IA 1AKWA 3DGEC 4IUBS 1J00A 1T35A 3OCZA 1JSCA 5K6RA 4EUEA 2C00A 4PG6A 1EB9A 4LJ7A 3VSCA 2YXPX 4K9RA 5DOZA 1JQKA 3MSCA 4ZI2A 3O2SB 4QM7A 2FWRA 1CRPA 2XKBA 4E2XA 3ASZA 3C5CA 3V1KA 3OWHA 5IWCA 5KS2A 4IMJB 2ZB4A 3GRYA 3ICOA 3NRCA 3QVMA 2Z4RA 5KYNA 1FTGA 1PZNA 2PCJA 4JHXA 5FULA 2WB2A 2ZB7A 1J9GA 4NX2A 4YLEA 1ZN2A 1N5KA 2BFDB 4BB0A 3GLFE 4PLWA 3FMIA 3URKA 1S9DA 2AZMA 1VCNA 2XDWA 3QVUA 1IY2A 1A9TA 1JHQA 1LBHA 1SCNE 1KI4A 1ZLXA 2GZRA 1HNNA 4J0DA 2PL1A 3QE3A 2FZKA 4WINA 1TYBE 5ALSA 3TR6A 3UAXA 5CB0A 4FGJA 1R5BA 3RH0A 2QQ0A 1NLZA 5LYJB 1ETHA 1JHDA 1CE8A 4B82A 2PSHA 2X6TA 3QKSB 3R0JA 3PQCA 1O96A 1FL9A 4MQUA 3B70A 3TEMA 1DIAA 1V3TA 2JC3A 3CN9A 5EEHA 2ZSUA 4OMCA 3EJWA 4P8RA 4QPPA 1TJYA 3T7RA 3TRDA 3F2IA 2G71A 2WU8A 3CLSC 2J07A 3CISA 3FGPA 4B7UA 2RSLA 2H51A 5DWDA 3E03A 1IHXA 4FBMA 4Q16A 2Z6QA 4AS1A 1I24A 1L5OA 2YWEA 3NFYA 4GBGA 5D7BA 4FW8A 2I54A 5FTKA 4OOEA 1R0YA 1UMDB 3UGKA 3ZKAA 1O95D 4DYVA 2Q4OA 1T34A 1IONA 2CC2A 3G5TA 3I0MA 2QPOA 4XUDA 1SCDA 3I8XA 1T5SA 2G7ZA 2V7WA 1OB5A 3LL7A 1LBEA 1TMKA 1E8DA 1BN7A 2QTRA 3F6CA 3M5DA 2PS1A 2HC9A 2TS1A 3S70A 4MB2A 1PD1A 3I9V6 1AS2A 3FIJA 3ZK8A 4XVCA 1TM2A 2GH1A 2QL6A 3PC2A 3KWMA 1N6LA 4MKRA 3DP9A 2FR8A 4JHLA 1Z4NA 4PYOA 4EG3A 1PL6A 4IS3A 3D3QA 4NAHA 4GMKA 2H92A 4RTSA 1CU1A 2OK7A 2VF4X 3PFNA 3HUUA 3WGGA 3ADKA 2GBLA 4DTIA 3QOWA 2NV0A 4JWKA 3FWHA 3OE7A 3PUKA 2JI6A 2XBUA 2XLBA 2XMDA 3JQEA 3PITA 3V8EA 1EZ1A 2GJ4A 2AG8A 2WHRA 4MW1A 3VPXA 1HE1C 1KY5A 3FHLA 5NULA 4B35A 2VDPB 4YI3A 2XODA 2RGUA 5DP1A 3RVKA 3ZYZA 1E79A 2P1DA 5F78A 3HUDA 2NVWA 4X20B 2PQ6A 1BO6A 3E7PA 3E9CA 2QD1A 3WR5A 3PLAE 4A0QA 3HLTA 1SUSA 1DBPA 3G7UA 3GQBA 5KO2A 4LXXA 3CF4G 2HF2A 1B43A 3IIEA 1IRIA 1N4DA 1Z0JA 1WX1A 4D26A 1LBTA 4K81B 1W85A 1I1HA 4PSVA 3UO8B 3C87A 2BZ1A 2EZUA 4WFIA 4BVJA 5DI9A 2P9YA 3VBCA 1WXWA 2OCPA 1TCVA 2EATA 1DO8A 4AS2A 2TMGA 5HF8A 3TMAA 1GRNA 1ODIA 2ZWOA 1NJSA 4RW0A 3SZMA 3WGUA 4E6PA 1B74A 1K7CA 4KNVA 4TVSA 1E69A 3QEAZ 3NHKA 2V4ZA 4N5DA 5LWQA 1U0HC 4B6RA 2HQSA 2VRCA 2R7NA 1XDUA 1P0FA 3GLVA 3KTOA 1RM5A 4MDFA 1XZCA 2F67A 2M32A 3N76A 3C0KA 4IDDA 4BLPA 2D13A 3EXG1 1IQUA 3F7OA 4OP3A 4URXR 2C7PA 1MO2A 3PF8A 4J6EA 2PUWA 5HKAA 3THYA 2B8EA 2Y77A 1PLLA 1TYEB 2O5VA 1E1LA 1MAUA 3D0KA 6GPBA 1IN4A 1CJSA 5JMWA 3JVDA 1P5RA 3DPSA 4C0KA 4NE9A 2V0NA 4FMPA 5AYVA 4TTTS 3SSOA 5A4JA 5L9AA 3Q9NA 1UDAA 4MKXA 4CDMA 5KNCD 2DWUA 2HGSA 3HGMA 3H87A 4IGFA 5SV2A 2KM1A 3FPBA 3QFFA 4ZCQA 4QRHA 5CAEB 1AIPA 2AEJA 4M22A 1OTXA 2HW8A 4PGGA 3FHCB 2V7GA 2ZYRA 4ESEA 3KJGA 3AKZA 1CUVA 5LUAA 4RLHA 5DCYA 1I4WA 1R0BA 1R8SA 4D0RA 4PNHA 5K8TA 3ZLVA 2JFGA 2QYOA 2V8BA 1UC9A 1W0KD 1SXJD 2VR1A 1LXCA 1SKQA 2VJOA 1XHLA 1GZUA 2GRUA 3PNQA 3PEVA 5EYPB 1F2DA 2I6FA 1WULS 3ZQKA 4Y0AA 2HRCA 1B42A 4CTOA 4KLZA 3Q3IA 1L1RA 3VI3B 3QIVA 3KSRA 1Q20A 3LIPA 3MCTA 4HYTA 1MT3A 4NHEA 4RJTA 1VIVA 3FSGA 3GY0A 4RSRA 5IMBA 5AFSA 3AVTA 1ADBA 2MJLA 4JVLA 1N5LA 4KBFA 2AKYA 2BMVA 4ZXPA 3R0QA 2QAGB 5HF9A 3TLGB 4Q15A 2QJTA 3SZ3A 4C4TA 4XUEA 5DM0A 4HNAB 4KE9A 4H6VA 4JCOA 1DC5A 3UEOA 3X1ZA 3WAKA 1F5NA 1W1WA 4NECA 2ZDGA 4QHTA 3V2UA 4URVR 1DTEA 2C4UA 3W5AA 1OILA 1E0KA 3NWOA 4HHEA 1K68A 4C0QC 4FYHA 3QEBZ 1QIMA 3L6BA 4CDGA 2W6CX 1SIOA 4NU5A 2PMDA 3UY4A 2PWAA 1GGNA 3OLZA 4OX9Y 2CNWA 4TZ6A 3L93A 3VKHA 2G6TA 3ISTA 1XTSA 1L4GA 2O2YA 4I1VA 1ZPDA 2WC1A 1FQKA 1M0TA 4IV0A 4OLJA 2NV2B 4FDLA 4NRDA 4NOKA 4O1HA 2FWAA 2GRAA 4K9OA 4RXTA 4V0SA 3ITNA 3RG8A 1OD6A 2Z6AA 5EJ4A 4NZNA 4A6PA 3FCEA 4WBXC 3IUQA 4M53A 3B1FA 2AK2A 4HXYA 1E1RA 2GHRA 1ZW6A 1I3MA 4FFDA 4UM8B 1C80A 3ZWXA 4A2WA 5A9SA 3FPHA 3CNNA 4HUTA 1QLJA 1CWUA 1ODTC 2GWRA 3AFNA 3R7WA 3SIRA 2H48A 4FEAA 4JIMA 1HDGO 3B78A 3ON5A 2VG8A 4JR1A 4KXVA 4NESA 1HYQA 2EWMA 3NBMA 2V45A 2QT1A 2W2LA 3T3DA 2CB0A 3JWJA 3FVWA 1NVGA 3OZSA 4LJ8A 4LYGA 1IN7A 4II3A 4XSHA 1ADYA 1XWIA 3KPWA 1T6BY 5L4LA 3C6XA 4L07A 4Z9FA 4I55A 2XWSA 4GM0A 1A71A 5G02A 3VPSA 4AD8A 1CR2A 4ZYYA 2J32A 4N7RA 3K16A 2YFHA 3VGJA 3KALA 2HMUA 3AF0A 3ERCA 3WGLA 1W36B 1K3UB 2GJ8A 2QV7A 1NAHA 1X7WA 1ZUWA 2VDWB 3P9RA 3QPWA 5GMOA 3OQMA 3EXIA 3JZAA 4RJJA 1E7SA 2PZMA 3OU6A 1V9SA 4IUYA 4MWTA 3FI0A 4Y6RA 1CF4A 3AUYA 5F23A 2GLUA 4I9NA 2VDQB 4KGDA 4WBNA 5AOAA 3MHTA 1PDVA 5JWRA 3C5VA 5IBPA 5HKBA 3W3AH 4G0UA 3AX6A 2NO9A 1QRSA 1JILA 1L3CA 1LBIA 1D0VA 4DADA 4IDCA 2O1EA 1PQYA 3HVJA 3VPDA 2J33A 2MSKA 4GXTA 4OHOA 4AG3A 5EVCA 5I5GA 1U3TA 2VF5X 1T2NA 5BWBA 2H16A 3NBQA 4I6JA 3WJ7A 1NM5A 1Y3DE 2GAOA 2VZ0A 2NX2A 3G68A 3HCEA 3RVPA 3KSAC 5D7NA 1ZJZA 2Q4DA 4GLLA 4DKJA 3BIXA 4AKGA 3IDOA 3U44B 5JRZA 1J25A 1LY1A 4OVKA 2Q7DA 3ZHTA 4F7WA 1C8KA 4HKTA 2QM0A 4FLMA 3L6DA 1LPAB 5BQFA 4PIMA 4M98A 2C54A 4D3DA 1SD2A 4A8TA 1E3QA 2OG1A 1EYZA 2OBXA 2DFNA 3S29A 1R8QA 4OUDA 4DA9A 3OO0A 4AXXA 2WJVA 4MYRA 2OUIA 4YRQA 1F2UB 4XWKA 1M7GA 2WV9A 4IHJA 2FF5A 1LQUA 1UBOS 3EVNA 1FYDA 2G83A 2KJQA 2HLHA 5DYIA 2OEPA 5FBRB 3B38A 2EW2A 3KV1A 3MPOA 4RYDA 5GM2A 4EPYA 1W48A 3WNBA 2Z8YA 2PFGA 3BGDA 3DBRA 1TM1E 4RIEA 3P0JA 3ZK7A 3PC6A 3V6LA 3VHLB 3ZTWA 2ZJOA 3LCUA 4UHBA 1EJ0A 1NJ1A 4LISA 4QYMA 2JFPA 5KDOA 2FFQA 1XALA 3N0XA 5BRNA 1H69A 4RPCA 2NU7B 1H2RS 2FSFA 4HDMA 4OFWA 3VH2A 3O84A 5IAOA 4I5DA 1ISIA 4Z0TA 2EYUA 4KO3S 3C6KA 3C70A 3USCS 1N2ZA 1M1YE 2OD9A 3ZHBA 5JXGA 1IYZA 1RHMA 1FDVA 1IPHA 2AFRA 2Q5FA 2WDZA 4IIFA 5ALQA 3CLHA 3AEZA 4CODB 5LMNB 2IEGA 2W6OA 1PEYA 3KR0A 1A5BB 1P72A 1RXCA 2G9QA 2VNJA 1RLTA 3KE8A 5TRTA 4CUZA 4EJSA 2P1ZA 4TV9F 4AF8A 1OHHA 1JHMA 4HL6A 3DEZA 2C2YA 4AJIA 2TSYB 5F52A 2AJDA 3MS4A 2H7XA 4CT0A 4YDQA 4ZMSA 3JPYA 1JHXA 3DO8A 1R74A 3H1AA 3K8QA 3TD2A 1U2GC 3RIXA 4A26A 2WQ6A 2DUWA 4K28A 1VBNA 3ZDDA 3E2IA 3HFGA 4EI9A 2YYZA 3D4BA 4W5WA 1DO0A 5JYCA 4JK3A 1TGVA 2WMYA 1IOVA 4LNHA 4RTNA 4IUCS 1JYSA 4X5OA 3V4SA 4Z4GA 2IX3A 4MWCA 3FGNA 1X7XB 1EPUA 1PJ4A 3PQEA 4ZICA 1PVOA 1YS1X 3GPCA 3HWRA 4QFDA 4RZ2A 1GQYA 3AU8A 1U0FA 3T4PA 1YO6A 2ZW9A 2JEZA 3H18A 4UMDA 4W8GA 5BSMA 4G5FA 3HRKA 1RJFA 4OSPA 1G5PA 3F4LA 5CDFE 5F2OA 1BGWA 3HMKA 2DFDA 3MRTA 4BQIA 1PRYA 1FY2A 3R4VA 1UJ6A 5HIKA 3KJHA 4QULA 1FQWA 1YD7A 3R5JA 3TL3A 1AV7A 1ZVJA 1U8XX 2I9PA 1JBKA 1SBNE 1U7PA 3K9BA 1HZJA 1N9GB 5A5FA 3GLGE 3BL8A 1E7YA 5TF0A 2C2GA 4AB1A 1KO5A 4ALMA 2AR0A 4Z1MA 2R44A 3FX2A 5AMXA 5HA5A 2HA2A 3T5CA 1W46A 3KYDB 721PA 3PUHA 1N77A 1UFQA 5DO9A 5ALHA 2Z58A 1S2IA 4G0MA 3PWSA 4AZ0B 4D4GA 5DBIA 5DZSA 3D7MA 1Z75A 4FI3F 2PR7A 4RY0A 4P0QB 1VSUA 4NH0A 3KXDA 1RWVA 2VDRB 4HGYA 5K4HA 3U61B 1FSZA 2F3UA 1RYFA 3TPZA 1X7GA 4LK2A 5A6SA 4F46A 4M1TA 3KUKA 1Z63A 4B4DA 2Q3HA 1JPVA 5IKOA 3AETA 1F8UA 3OZTA 2H8KA 5FLKA 5E6UB 4Y1FA 3SJUA 3W3ZB 3DNFA 1SZDA 4DLUA 3LRXA 1G2IA 5K3OA 1QP7A 1JB1A 2Q29A 1A04A 4QWWA 4BO5A 2DXIA 3PNVA 3IL2A 3CH7A 1J49A 1H6BA 4P7BA 1V2GA 5DH9A 3ADCA 3KFXA 5CEFA 4NNPA 2BW0A 2ZYTX 2PA3A 3EC2A 2PZGA 5I9MA 3B51X 4ZT6A 3T61A 1FXWF 2YVQA 3TBFA 2OPBA 3FPLA 4PBRA 1RQ2A 3A11A 3G82C 4D80A 2EJCA 2UUBB 3O8QA 1M8FA 1H1LB 3CW8X 2FUNB 2P3OA 4KCGA 5DN6A 5DEOA 2JZNA 1P9OA 3NBAA 4X61A 4C22A 5KJCA 2GPBA 1MTOA 3SS9X 4GOJA 4E3ZA 2IA5A 1R6VA 2O8BB 3RK0A 2D2VA 3LCVB 4ZAYA 5IKEA 2JANA 1K63A 1VMIA 2OUKA 4D8YA 3UMSA 4IEIA 3AEUB 3GJ4A 4IZOA 4P7GA 1NMQA 1Z74A 3STYA 3W5DA 5ERYA 1IN8A 1KOGA 3G2IA 2A0FA 4AO7A 4DQ0A 2XT9A 2YOGA 3I1JA 2QQ5A 4Y7CA 1KYVA 1TUIA 4Q4JB 5ESXA 3OEHA 2GLTA 3WQQA 4EIWA 5BMVB 2HI0A 2CHGA 5EMNA 2FR8C 1TT5B 4ZO8A 2JLCA 1U2SA 1EGQA 2ALJA 4LI0A 4V3CA 5DKFA 3S2ZA 3WBBA 5B1IA 3ZWMA 5HM8A 1XPOA 3UPDA 1MW8X 4U9IS 2YHAA 4YUVA 2GBLC 5KTKA 1HURA 2PRJA 1BVYF 1P17A 2QTMA 4UKDA 3EZXA 3JARA 1HE8B 3IS3A 3SKYA 4RIHA 1GNPA 2EFCB 4S1NA 5E6SB 4BVKA 2VTBB 2EYQA 1SPBS 1WXGA 2V58A 4D02A 4KNWA 4KQGA 5LFAA 4NSNA 3EPPA 4OK5A 3NHFA 1NW5A 3HDHA 5TGZA 1HV8A 2XYVA 1BHO1 3U4AA 4EY3A 5J23A 1KI6B 1ECCA 3G2MA 3KZNA 3AOGA 3AZPA 4JI3B 2Q6LA 2C29D 4IH9A 3U3DA 1HE5A 2G1UA 3ENQA 1O6GA 4AJHA 1XEFA 4U8HA 3WGJA 4EF6A 5B55A 1PF7E 2ECFA 3OT4A 2GCIA 2VPWA 3QVLA 4P5DA 3RT1A 1PDWA 1OW3B 1G8JA 4L3OA 3WMFA 4OM7A 5I01A 2B21A 1VHLA 3RABA 1POWA 4HQKA 2CK3D 4KR0A 4FVTA 1YI1A 2ENWA 2AN3A 4PC3A 1VCHA 3U6BA 3ORYA 1KDOA 1A9PA 3D59A 4ANFA 4D9FA 2AXEA 1IBMB 1HDXA 5KUTA 2FOIA 3BS4A 1LW7A 1O2DA 4G5HA 1BGXT 1D0SA 1EQ2A 1LVHA 3OT1A 4DW8A 2OC9A 4Q4CA 2GA9A 3LDGA 4TL8A 1CTQA 4XSGA 2IDZA 4GMFA 3X2SA 2JAQA 1B2LA 3NBUA 4TYQA 2C3MA 3SN6A 4DILA 2O23A 4NYMQ 2BONA 4PIPA 3L7YA 1G3UA 4GC9A 4QDKA 9MHTA 2GVZC 1CRZA 2JIMA 4DSNA 3A58B 4DDVA 1BCRB 2YQ5A 3M6UA 3QE0A 3STWA 1JNXX 4KXNA 3SCZA 1EFPB 1XMIA 2YQ4A 3WYGA 1ST2A 1PE0A 1J9ZA 4LOLA 3E48A 4KRFA 2N9UA 2ZRDA 3C3JA 1CQXA 1UM9B 4DQUA 1YK1A 4FN4A 1XZKA 4N6NA 5DJ5A 3I5MA 5MFZA 2D1YA 3A06A 3BPSA 4JWTA 1S7CA 2HN9A 2NTJA 2YXEA 4C4PA 4D3XA 3SQNA 2QI9C 4JJ7A 2CD7A 2BBOA 3SC6A 4FB4A 1RAEA 1KGDA 4XW2A 1TQ8A 1VHWA 3GEGA 1SK8A 3FPJA 2CKDA 3PPVA 4NJOA 3VQTA 1JTEA 1K98A 1M2FA 2NXEA 3ETEA 5J4VA 3IXMA 5HX7A 1KO7A 2P5YA 3DT8A 1RYZA 3ONFA 4F5WA 5LXTA 4MUFA 3KKOA 4O29A 1EAMA 2FMIA 2X6QA 2BMAA 2WOOA 1T9DA 1T5BA 5SICE 1T5HX 1ZEMA 3F6BX 1X1CA 3I3SR 3NONA 5DX0A 3CF4A 5IAKA 1BYUA 4BP1A 1HMPA 2REOA 1TUGA 1M74A 4BE9A 3R0ZA 1EVJA 4MLCA 4BNUA 1Q0ZA 5REQB 5P21A 5BYAA 2V4MA 1Y7HA 5E3HA 5K2MA 4YP7A 4I2VA 4BX0A 4AKHA 2YC2C 1UZNA 1EK5A 1QQ6A 2VSXA 5AO9A 4CF3A 4CEJB 3BWVA 1Y5NA 1V11A 4MYDA 2DT8A 3H2SA 3OJ0A 2R6JA 2C7RA 3LM8A 2JHFA 3GVXA 5SYAA 4FGUA 1JDBC 1N1EA 2NZWA 1VPLA 2C07A 1PEDA 2Y1DA 2VP9A 5PGMA 2ZQ5A 3AC0A 3K5PA 3AR4A 5SZIA 5K99A 2XZTA 3NO4A 5CVEA 4F97A 2RHGB 4AUMA 1TPZA 2A5LA 2Y76A 2NUPB 3LQ1A 3BE5A 2GZ1A 3P0FA 4C07A 1NQVA 1DQZA 2JIOA 2VSOA 3T0FA 1KYYA 3FCCA 1VJ5A 3O73A 5BYJA 1KEEA 4DB4A 4QNRA 3M82A 1H4QA 4XCQA 2ZAYA 3MJSA 2W48A 1UEXC 1YB7A 2XNDD 2XCOA 4YCAA 3ZNQA 1G20B 1EFVB 4BNFA 1L8AA 4YJHA 2WWXA 2BDEA 4OHFA 1SFRA 3RUPA 2H1CA 3TRKA 2CZGA 1EJBA 1WQ1R 4F6RA 4F9FA 2R1TB 1JFTA 2B36A 4OI0A 3A2MA 4DLRA 2JCSA 5IXYA 3ONVA 3OC6A 2WF5A 1D7OA 2C4VA 3ADOA 4Q24A 2V5AA 4WLNA 2ZXUA 1CETA 3LGAA 1V16A 3OFNA 4YRLA 3GUZA 4ERNA 4XVRA 4CKEA 3BH6A 5IP5A 4M0MA 5DSZA 4NJMA 4PNZA 2J9GA 4D0LB 3OMWA 2ZRPA 3V46A 1T2VA 4QXQA 4PO9A 1TK2A 2BD0A 2PVSA 1Z88A 5IK2A 1A98A 3G8BA 1IVSA 1JJAA 4P3OA 3SSMA 1YZKA 2YY5A 1L4FA 1NVDA 3GEHA 1IXSB 4GAEA 8ABPA 4KVGA 2C97A 3O8BA 3TQHA 2O14A 4GWGA 3HTXA 1USWA 3VYUB 5HBGA 2PVPA 4O33A 3WOVA 4YK7A 4H3SA 5FA6A 3T5MA 4UAGA 5DV9A 2GCOA 3OJCA 1TL7C 1DCKA 3HO8A 3DAFA 1HFKA 2AS0A 4O8ZA 1U9IA 1NMZA 1L1FA 3F7MA 1IZ7A 4QBKA 2Q4TA 3NIDB 1CJKC 3IQWA 3CU5A 2VOEA 4YRIA 1IH8A 3Q8MA 1F17A 3KRTA 3VAYA 2DPMA 4J9UE 3SHVA 2OHJA 4H17A 4BOYA 1NM5C 1YU6A 4EDHA 4TTQA 4EK9A 2F62A 2WHEA 3B1XA 2BHNA 2QN1A 1IQ0A 3KOXA 4Q00A 4RD0A 5AJUA 3UWSA 3VZQA 1V6SA 3AJEA 1J8QA 3HYLA 4HXGA 3BBPA 1UBTS 4ZHQA 4MITA 2OCYC 1UPFA 3U9LA 4U2GA 4KEAA 1LWOA 1OLXB 2CYAA 1VG1A 2I76A 4WZZA 3SJ7A 1MMFB 4X00A 1G5RA 3I72A 2HHJA 3EX7C 2OECA 4NE7A 2JASA 2ANBA 1GRCA 2CXPA 3VZDA 1NPTO 2HF7A 3FUCA 4ER7A 1JEQB 1NSYA 2Y3IA 3B52X 3ASYA 5TVKA 3NANA 4H15A 2WJHA 3Q8LA 1FSPA 3DBHB 4FFNA 2GNAA 3WWZA 1TTPB 2O7SA 3DR3A 3WMWA 3AJAA 4TUYF 3BXGA 3AVOA 1XD8A 3PYXA 3MTGA 2CMGA 4HF7A 4TXNA 1N5DA 7MHTA 1WW2A 1B8UA 1GAJA 2XB8A 1R4ZA 2AJLI 4Q9AA 3PXEA 4ZRMA 4CUJA 4GOXA 4M0FA 2AXQA 2RCYA 2ZVJA 3KOOA 4Y2PA 5SYMA 3B48A 3UAWA 2OHHA 4P86A 4ICIA 3ZY6A 1Y42X 2OOKA 2EJTA 1RWQA 1KAMA 4JQSA 3R7FA 5J4HA 4D8WA 5TVGA 4E4YA 5C51B 2X14A 4MVWA 1T2DA 4Q02A 2XRMA 5C1DA 4A2PA 1PCXA 1YOVB 1MZPA 1ZD3A 2XTJA 1ZSVA 3DWEX 1LJ8A 3LHKA 1N5RA 3ZVNA 3SIPA 4KQXA 1WZ2A 4U3JA 5BVGB 1NUPA 2BLLA 3ZE9A 4L0CA 4ACBA 4BNLA 1YJ8A 2WTNA 3M6MD 4LQLA 5EPOA 3GJ7A 2XRFA 4P82A 4PW0A 2MU1A 1VLLA 2JIDA 5BUCA 3DVRX 1PWEA 2UDPA 4LS3A 4F85A 4EJSC 5EWMA 1JG4A 1J22A 3O38A 4L76A 4DT1B 6NULA 4IWXA 3K2BA 1O08A 1R8JA 1XYGA 3OC0A 3RF7A 2EEPA 3PA8A 3JYQA 3J7TA 4PPFA 5FEMA 1WRBA 1SWVA 1Z13A 2P4EA 3GMSA 4YJDA 2Q8PA 2FU5C 3X1YA 1FYFA 1G7CA 5FUYA 1BU5A 5EJ6A 5LQKA 5LYJF 3JVVA 4Y6QA 3DMTA 1XZDA 1KC3A 5D1NA 1WCV1 4O2AB 3CZ4A 5AHWA 1IXYA 3VTZA 4D3YA 2NWQA 2XUJA 1FDUA 3Q5GA 5BNWA 5E38A 8ADHA 2QLBA 5BN3A 1COZA 3KLPX 1Z6PA 1W581 3I28A 4F5EA 4LFBB 3LKBA 3NJ8A 3EEIA 4LMBA 2RHOA 3GEPA 4MVJI 3C3CA 4ALIA 5EJEA 4D8TA 3LWBA 2HBYA 4M0KA 2P9EA 3PIIA 3VV2A 1U7XA 1VP9A 1H0KA 1KJQA 1ODJA 2ODNA 3H16A 2JG3A 4P35A 1E0AA 1U8EA 4LHWA 5J5AA 1FRQA 3EAGA 2FDCA 1PT6A 3VO1A 4UC0A 1GRQA 3KXLA 4DAOA 4LXUA 1YMUA 5JWHA 1P5ZB 1FTYA 1WR8A 4QTZA 4TKUB 3S2UA 3NB0A 3MCVA 1SNYA 4EKYA 2FZVA 1FLVA 4BMSA 3F71A 1D04A 3U09A 2JFFA 2KX7A 2QTVA 3KOUA 2FG6C 2IDKA 2C8LA 2Q2QA 2PV0A 3LHIA 5EE1A 4P83A 1MA3A 3HZHA 4X8OA 1RRPA 1J0XO 3S4YA 3IBYA 4B09A 1YCGA 2DQSA 2IS2A 1NXSA 4H3KB 4EGJA 1CQJA 3GWZA 4Z5XA 3QELB 3T3NA 5BWNA 1MC5A 3JALB 1KK2A 4GE0A 4Y2GA 1LDNA 3SM3A 1I0IA 1UPCA 4C04A 1RKXA 2HCBA 5CFLA 1DBRA 1CJTC 1QV6A 3OTWA 4XPZA 3DOEA 3R5TA 2HMSA 4DXAA 4YUXA 2A0XA 2OFFA 1XD2A 4QO8A 2JIQA 3PNSA 3TBHA 3KTAB 4JSTA 2Y6UA 3H9QA 3MRXA 5TEVA 4RSHA 4CI9A 1DV1A 1YNSA 1V25A 3FNHA 1D4FA 2VJMB 4DB2A 3SQDA 4WESB 2W11A 4FJ0A 1F0PA 1FUKA 4ENRA 4A2QA 4EX6A 1E89A 1X80B 1I33A 3SF8A 3DBIA 2F8LA 1EG7A 3IHWA 1Y1KE 3LIIA 3A1SA 1UDXA 2P6OA 4I9UA 4RD3A 5IJ9A 3QYJA 4KIFA 4Y6PA 2K4MA 4UEKA 4XASA 4BC0A 5K6TA 1ND6A 1FU7A 1TECE 3E15A 3I4LA 1M8KA 1T9ZA 2E2WA 4N3GA 2WA2A 3O4IA 2VA8A 3KP1A 3W2EA 4G67A 4WCFA 4W99A 2JFWA 2G0AA 1BRTA 3I8OA 1S8FA 4H7DA 3PHJA 5EKTA 3VDRA 4G89A 4ECEA 2JLXA 3N8DA 1YB5A 3DD5A 4EYEA 3HFSA 1HFJA 1QLWA 2FPWA 2GF0A 3GZNA 2EKPA 3NTLA 4Y18A 2ZWPA 1OIVA 4FLFA 4NBRA 4BC1A 4EY4A 1T9GR 2D4HA 1G6OA 3B3FA 4QTTB 4FMCB 4PRYA 4CM3A 3PJDA 4DRXA 2J3DA 5JG7A 4ZOAA 3T1YB 3UOWA 4PZYA 4XGNA 1FDRA 1PV1A 2A35A 1P2SA 2MTBA 3Q8WA 2ETVA 3C3XA 2AFVA 5DCUA 3U81A 2WG2A 3WLHA 1QS0B 3MBIA 4GH5A 2GJKA 2KYRA 4CM8A 3EVEA 2NP6A 1H4TA 3FPCA 4G1FA 2ZSEA 3G2OA 3DEJA 3O7WA 4A8HA 3BM5A 3B6KA 5JPCA 3F5MA 3TB4A 5HYVA 3DCJA 4MVJF 3KXIA 5CK5A 2H63A 3L7OA 3CPJB 2GK3A 1K8ZB 2FEPA 1CXZA 2NZVG 3WYDA 1KYXA 3NAZA 1J8MF 3Q11A 4G65A 1G64A 1KVQA 2Y6VA 4P36A 4EB6A 3TE6A 2ZIWB 3WK8A 3PG5A 3KCNA 1V45E 1A5TA 4JC5A 2R3SA 3WYEA 4ZZ3A 4KAFA 4B6EA 5BURA 2BZSA 3ST7A 4DIBA 3IIMA 2VYNA 4F4UA 1R0SA 4JUIA 3WG9A 1W4LA 2J5XA 2X7XA 1GTVA 1A82A 2EU8A 3A6DA 3GDOA 5FWNA 1PWYE 1TTHA 3L82B 4MQ4A 1YT5A 2IP1A 4LZJA 4M8SA 1NF3A 2B37A 2F4NA 1YXMA 2IEYA 5GINE 1RRCA 1TE2A 1NSFA 1MEJA 2WTEA 2ZRAA 1TCUA 2VPYA 2R2AA 3EEBA 4P93A 2Q3MA 4AJLA 2PU7A 1HA3A 2ZUDA 3TLMA 3BHNA 4CN8A 4RH0A 3VBEA 4TWIA 1X2BA 5EXPA 1LK5A 3LOPA 2G1AA 4K8RB 4K0KB 1D1SA 3BVPA 2OV3A 1RC1A 3EK2A 4YP1A 3PPYA 2VUIB 3IAS1 2JFQA 3BE6A 1IEVA 1WCXA 4L7VA 4Q1FA 3F6RA 5HF5A 3O21A 4F6LA 1ISSA 2ACKA 3I1FA 1L4NA 4K46A 1IIBA 1D09A 4GKAA 1RLOA 1N1GA 1P74A 4KE6A 1ISJA 2O2HA 2PKYX 1PKXA 2IEBA 4KH0A 5F77A 4AQYB 4NCAA 2RAVA 5EQDA 1QTNA 2B2CA 2RGAA 2NUAA 4WEOA 4OB7A 3BE4A 1NYTA 1P8AA 4QM6A 5B53A 4QPZA 2IS6A 5TQ0A 1UDCA 2C0PA 3P9CA 4O1MA 3RAEC 4DCOA 1RE0A 3EXFB 2QLFA 5LZ5A 4B81A 1EK1A 2V7QD 2ZJYA 2Y71A 4PPNA 5GGYA 4D43A 1KJ9A 3T3GA 5K8CA 3R44A 2R0QC 5JDCA 1MORA 1MO3A 3FUVA 1IJEA 2X5KO 1ZDMA 1QIEA 4J0QA 1TRHA 2CYBA 1CHDA 3FUXA 2HOQA 1GTJ1 5BVHB 1XA4A 1QZUA 3DV0A 3K3PA 4MQEB 5IKPA 3G0OA 1TIBA 1XCGB 4L51A 3C6MA 3EISA 5C1BA 4MQMA 4RK6A 3O8CA 3AUXA 3LHDA 4RPKA 4GZMA 1WOMA 2W8BB 4L4ZA 3BXOA 3SD7A 3I3OA 1HYHA 4G26A 1EEXB 3BWBA 4J2TA 3S7TA 4FC6A 1XCOA 1FFXB 2GM3A 4B83A 3EXAA 3P4YA 1ZI8A 2AQHA 4BJHB 2EGGA 1EUDB 2JA1A 1SEVA 5IBCA 4M0UA 5J2TB 3NM5A 4G0OA 4HZGA 3AW8A 4B2LA 2FX3A 4FDUA 1NFRA 3AZOA 1KJJA 1DEKA 3GFVA 3L79A 3VR1A 4DDKA 4EUHA 1H22A 1T8PA 2ON6A 4N0PA 4FYVA 1EJ6A 2OENG 2GXQA 2OCIA 2RCNA 4GW3A 3ZWWA 5ABPA 2HU5A 4ZVVA 1H2FA 2WJ4A 2XAUA 2J6BA 2QMHA 3C8UA 2I87A 1DU4A 2Q1UA 4PU0A 4QSMA 4O4IA 1IAVA 3D2BA 2A33A 2X8AA 2X4LA 4FK8A 3DE5X 5IVHA 2VUUA 2QU8A 2ZPAA 4BFCA 3ZWOA 4OM8A 5LQRA 3GDWA 3OCYA 1V41E 3P26A 3PC4A 3WTCA 4MCJA 1KK0A 2CD9A 3D4PA 4LXHA 1K5HA 5LJLA 4BAUA 4BXOA 1AZTA 5CHEA 2PZEA 3DEKA 1QPGA 3FYHA 1U0GA 4UHEA 3VNAA 3JD4A 5HMLA 2WABA 4BMDA 4EM6A 1XPRA 1F2TB 1XV5A 3ZLTA 5HZGA 3IRVA 4DNFA 5DM4A 1JR6A 4F5YA 2PD6A 3HABA 2OBBA 3W0LB 5FORA 2XUQA 2JJQA 3K1AB 3MD9A 2YC4C 1B8NA 2PX3A 2W2NA 1AC5A 2FJUA 1NQOA 4D42A 2B2XA 2H4JA 1CDZA 3R1IA 2O2CA 4YMTA 3F6SA 3GGCA 4LYHA 1QG4A 4BV2A 2I55A 5IWAB 4D8UA 3UKOA 1CQZA 2ZIFA 2DFPA 4HH1A 3QWBA 3WL8A 1SPXA 4HN4B 2VNSA 5LOVB 2ZRJA 1HGXA 3GUCA 4GMHA 4KN5A 5EMHA 1E4EA 2IITA 1OI3A 2QN2A 4KFSA 3FGOA 1H94A 3NHLA 4JJ6A 4L8YA 1YZTA 2Z5VA 3FRIA 1DG3A 1ECBA 1OXXK 1YFZA 3OWXA 4ZQCB 4L27A 4YPFA 4LZNA 4B5KA 4DMKA 3BTOA 2PRKA 3TFWA 3LA6A 2ZJ3A 1TF7A 2JVIA 2MSCB 1I5EA 1W87A 2PQ2A 2NXWA 1EQUA 2WVJA 4KO1S 4X9XA 1YKSA 4ZJPA 1HUQA 1R4AA 2VT3A 3A3NA 4X44A 3BF8A 1MNQA 2A1UA 5JCOA 4YBZA 1L8QA 2IK8A 3VOAA 4TMZA 5B1EA 2M2IA 1EWRA 4O59O 4UBLA 4AJ4A 5K0SA 2C9DA 4RVOA 1YZFA 1MRSA 1EDDA 2Y1KA 3U4IA 3OFVA 4B45A 3DV2A 1CNEA 1N4AA 3EVAA 1G8PA 1PJCA 1IY1A 2RIRA 3PCXA 4JUAA 4OFXA 1XFAA 4OHXA 1Q0QA 2V7VA 3BWMA 3T3OA 5HIIA 3ZEAA 2J3IA 3AY7A 4JBYA 4WLUA 1U9IC 2P4HX 3N0RA 1UQRA 4BQQA 1LW6E 3O0TA 4XIIA 2W4MA 4UD6A 2RONA 3IBTA 4XGIA 2YIVX 3LHFA 4AQDA 1R6TA 2XQIA 3EULA 4G0YA 4PRZA 2GA8A 2H6EA 3GJRA 4IF4A 2ZG6A 2K5UA 2C2MA 1Q5PA 2DSTA 3E7DA 4C4SA 1Q19A 2I7TA 3V4FA 1WMDA 4Y2QA 3AF1A 1BA2A 4E46A 5FI5A 3SXUB 2WHPB 1PGQA 3OPVA 4GLBA 1JLKA 4RSGA 1G17A 5AM2A 5FCDA 2Z1DA 1TVMA 3C97A 1OR8A 2CWDA 3HGQA 2PX4A 3G2HA 1DJNA 2O05A 3AEXA 3HKEA 4S3MA 3WZ2A 4BE4A 1CE8B 3IXQA 3MQ2A 1ENOA 1CW2B 3BFPA 1O96B 1XVLA 3PQDA 4UMVA 4YO8A 2IZ5A 2JA2A 3VH3A 3U16A 2HTEA 1PZFA 2GJAA 1EFLA 4QXPA 4GXRA 4BJ1A 1ZITA 1YOBA 4WN9B 2R7KA 3IOMA 2IUUA 5BT9A 1RWOA 1GNRA 3B6JA 1L1EA 2P9HA 4JA0A 4G3XA 2CFOA 3JRWA 3BORA 1V35A 3DMGA 3KE9A 4DCSA 4INZA 1KYIA 4POAA 2FB9A 2QP3A 5COQA 2P0YA 5LC1A 3GLIA 3ESCA 1WCYA 3GAAA 3HKDA 3HN6A 5H02A 2IXBA 1ZM4A 3ED5A 2X42A 3W8NA 2WT8A 1PNTA 1K27A 2WM2A 3OY7A 5DPMA 4XTRA 1CZNA 2B78A 3EEFA 3FAZA 1JR2A 2FZ4A 1B3RA 2G3YA 2RGEA 4MKZA 4BBPA 4O63O 1MV5A 2C5HA 1AUVA 2JHPA 2ATEA 2J1LA 1P39A 1QC5B 2WE8A 3L0YA 4DZRA 5A02A 3W2FA 3TQQA 1E3SA 3GK3A 4E7OA 1XYVA 3NGMA 4RF2A 2F3RA 3RV3A 3TSWA 4EG8A 1HYGA 1NLMA 1YL6A 2BHRA 2BFMA 2LUOA 3DYIA 4N0QA 5LNK1 2ENUA 5BQOA 2DG2A 4IJQA 2QJFA 2I29A 2BF7A 1FNMA 2QRMA 1WCWA 4NXMB 4TVKA 1ZHFA 2FFRA 5G0SA 3K0AA 3VMFA 2Y1EA 4W9NA 5FR2A 3RSOA 2OBFA 4OKSA 4C0LA 1FDTA 3PFCA 2DBQA 2OR3A 3V9PA 2Y1CA 4MVJH 1UF9A 2Y4NA 3FPSA 5KQLA 2VDKB 3FD8A 4YRTA 5FBKA 3ETCA 2C94A 5C5CA 3DMTC 5IMSA 2YJGA 2YN4A 2CV0A 1Y7TA 2ACWA 3DAYA 5EN4A 1VB3A 3M8KA 2WY2D 5JY1A 2TRSB 4B84A 4WAUA 3O3CA 2BCEA 2OLKA 2ZCUA 3GQBB 3I9KA 3KB2A 4UTVA 2VQFB 2XXJA 5H70A 4CEHB 4Y2VA 2AT1A 2FE4A 3QXJA 1WD5A 3WLEA 3PEUA 1F0NA 2TYSB 1W85B 2RH8A 5A6VA 2H29A 4WY2A 1E1QD 2H9AA 1FUIA 3DYBA 2E87A 2VAWA 2ZATA 4UOQA 5FPQA 3N6RA 4ZZ0A 5EPUA 5MN6A 1JG3A 2Q1TA 4KVFA 2DJIA 5CT8A 3W8FA 1UJCA 2ORVA 2IJGX 2QX8A 3H13A 4NOMA 4X64B 5JCJD 2P0AA 2I4RA 1G41A 3FAKA 3OE7D 1SUIA 2EBWA 1J1ZA 3BDAA 3PVCA 4LBYA 1R00A 3UANA 3HU3A 4HXFB 4YTEA 1O7JA 3FKSD 2WF8A 4LJAA 4RNCA 2C57A 2MSEB 3IUMA 2JLQA 2WPNA 3RCBA 2IWHA 3R9IA 4ESVA 4BPRA 2LGJA 1GJRA 4KXLA 4PG7A 2CLIB 3HJNA 3O90A 4EJ0A 2H1FA 4ZOLA 1RP7A 5EOVA 3AP1A 3IMGA 3HSSA 1MVLA 2VSYA 4RUKA 4QAQA 5CNKA 4AY3A 1P18A 3A36A 1GU7A 4P38A 621PA 5L4NA 2ZLBA 3AILA 3KQKA 3PE6A 1E9SA 1WCIB 3F90A 3KVVA 2XGGA 4JVNA 3TR0A 2AKAB 4EG7A 4GNKA 3B12A 3TLCA 4XUGB 2XKAA 3VC1A 2V96A 5C8XA 1HRDA 3AEKB 3IE2A 3UZUA 1Z2NX 3N70A 5KCMA 2O8EA 1UINA 5JW6A 1RQGA 1JMVA 5ALDA 1M2NA 2X15A 3UAYA 3H5AA 3E5HA 1EMDA 3CHYA 1VMEA 3LE8A 1U4SA 3UCEA 1QAOA 4IDOA 4PLHA 1XZ8A 3GA7A 1P5HA 4FKBA 2XX3A 3QEMB 4BDSA 1ZKMA 1J07A 3MQ4A 5GVRA 3ND5A 1W4RA 2I2BA 1WEHA 1L5LA 4UBIA 1N78A 3QUCA 1E8NA 4EW3A 1EXNA 2G77B 2Y0CA 4WCFC 5A9RA 2PJDA 1UXOA 1RC0A 3LHSA 3MT9A 1YS9A 2YH2A 3RYHA 2I3BA 1UOOA 3MFQA 3E61A 4MAFA 3GYGA 2Q3LA 3TRIA 5T7BA 4I46A 3AM4A 5IPFA 3T9EA 4EA6A 3C3MA 5JNTA 2N1BA 2HRZA 2ISCA 3DPIA 1Z8NA 2PUVA 3KQUA 2ES4A 2OB1A 4J75A 1CIPA 1KE2A 3UYKA 4UNQA 1E9EA 3PRHA 4Y1RB 3K0HA 3KL2A 5C34B 1DAGA 2IL1A 3RSLA 3ZDQA 1MDBA 5BO5A 1UXJA 1Z28A 2DBVO 3CO5A 4L0QA 4EA7A 1RJ9A 1O4VA 3HFRA 4OCZA 4HRYA 1PX0A 1TAQA 3DMPA 3QPBA 4NNOA 5EGSA 4YUWA 1AF7A 1IFXA 1M6WA 5F21A 1JDBB 3GVHA 1P0CA 2XA2A 4HVTA 4J0EA 1I4TD 5FDFA 3UUFA 3MM4A 1PS9A 3LVQE 4G6ZA 4NWIA 4E1AA 2RHDA 2DGDA 3R6WA 2RJNA 2G9UA 3KNZA 4QYSA 4WXMA 4C3ZA 3QP9A 1C1XA 1F8GA 2BMWA 2JI7A 1ZRHA 2IGTA 5HS4A 5LLTA 4AUKA 3EDMA 3ZE0B 4DLYA 1NNEA 2JS7A 3KAPA 2EFDB 1IIRA 2WF7A 3DFUA 4PFJA 3AVXA 2XE8A 4IRXA 1FMLA 4PFSA 3ZCTA 4R40A 1FC0A 4F4DA 3EWIA 4M9XA 3V32A 2OGUA 4G07A 1IXKA 2DPYA 4D4IA 1L7XA 1SHZA 1SXIA 4I9GA 2WR8A 4E5MA 3E23A 2VDNB 4JYPA 3NCTA 3GI1A 1J20A 1T0JB 2X0DA 3UPUA 3FSGD 5A9SB 3U62A 2ZYVX 3U48A 4F4IA 4YRNA 2I6QA 3PQ7A 1RRMA 2B5OA 4Z1OA 4P2BA 2H4ZA 2HU7A 1EWYA 1LPBB 5KWJA 3M6VA 4UARA 5G0TA 4BEBA 2ZI5A 4FWIB 4B7ZA 2YRWA 4FSDA 2W71A 1FLAA 4N48A 1X8KA 2WYHA 1DBWA 1C1HA 2FWMX 3JQ7A 3L0IB 3N87A 2H11A 1E6MA 3PYMA 2YMQA 2IE8A 4I55B 5GZ6A 4GLJA 4EEKA 2QRUA 1NW3A 2X0NA 1TB4A 2J5KA 3QBJA 4M3NA 1DI0A 4TMVA 3EQ2A 4AMYA 3WAJA 1KDTA 1NP6A 1X7WB 2GSDA 3I2YX 3QLTA 1MAVA 3ELBA 1COWD 2XRYA 4GQBA 3OJOA 4YMIA 3QBEA 2YXNA 5HKKA 4RENA 3DHWC 4LY9A 4E03A 3EODA 3F47A 5FF9A 2LBPA 4YHBA 2CL6X 2VFAA 3WKBA 2C3OA 3NDIA 5K6AA 3DLAA 5KKNB 1XHEA 3ZEIA 1E1RD 2MINA 3DLHA 1JHRA 3DOIA 4M7OA 4LNAA 4R8LA 4YAJA 4WBNB 1DCTA 4YXFA 4YMVA 4YUAA 5B4VA 2A4MA 3MJVA 1J5XA 4P1ZA 3QA3E 3K8ZA 5G4KB 3R0XA 4RS4A 3S8EA 4G36A 3DTNA 1MNAA 3FWZA 3CCCA 4LYAA 2W2LD 3ZCPA 4CG3A 1VMKA 3O8LA 4C1NA 2FFAA 2V97A 1G5QA 2VNKA 5IHPA 4QDZA 5I8ZA 5JDCC 1KDYA 1SM4A 4NV3A 3BQMB 2E5WA 4XVHA 2CLLB 2XDQA 2BKVA 4EZEA 1FNDA 3RIGA 5I45A 1Z6AA 1IG3A 2G63A 3LUPA 5GV8A 3P2JA 2NQTA 4JN6B 4NYIR 3RFXA 2X8BA 4YHHB 4X3CA 4OJYA 3HZRA 3UA4A 2NTEA 4M1SA 4ARZA 4WOJA 1FYVA 2FX5A 2I4TA 1C7QA 3EWSA 3P9ZA 2DKFA 4GGPA 1FVFA 4OUDB 5JVDA 3C2QA 4HK4A 1EBFA 3M89A 4LSMA 1G66A 3KUUA 1CB0A 1XLTA 1RWBA 5AW1A 1JEDA 1HDYA 5L51A 3VU1A 2XQVA 3M5PA 4X95A 2Z98A 1RT9A 1U2EA 2Q1XA 1YA8A 3IIKA 3OPXA 4PAOA 3HNOA 2PX2A 5ENVA 3C6QA 1Z8FA 3AMVA 3LBFA 3DBRB 1Z5GA 2EJUA 1YQDA 3SHOA 4N47A 1XIVA 4KIGA 1OZFA 4TN1A 4DCGA 4DV7B 4AWAA 1AX9A 3TTUA 3GJ6A 4M1KA 1KQGA 2G72A 3DTVA 3LKDA 4FSHA 5G1PA 3DM9B 3IQDB 1NV8A 5ERXA 1Z56C 2Z2KA 4HFNA 4RKYA 3RG2A 1K0FA 3SEZA 2PUAA 5DTJA 2NYVA 1SJ9A 3CMMA 3GCZA 3MVEA 4HAZA 4OHBA 3ZS8A 2O52A 2Z1NA 4ZCMA 4GP6A 1X8LA 1GPDG 2PLAA 1YZNA 1QZXA 5T4BA 1R6DA 5HE9A 2MCFA 4HWSA 1KPHA 4JYBA 4W7SA 4XX0A 4CM1A 2ZM5A 3Q2OA 5FI0B 4ED9A 2F3QA 4GYJA 3I52A 2W6ZA 3CJQA 1ZC3A 1N0HA 1E8MA 2BGGA 2GEJA 3K8YA 2A5JA 3M4NA 1I2CA 1RHJA 5AR1A 1S02A 4TQ9A 4REMA 2KMLA 5FLYA 4IEEA 1U6IA 1WSAA 4R84A 3NOVA 1LFAA 2YRFA 4ZYVA 2PG3A 1JFFA 1A8IA 2A9VA 2BM0A 4K3UA 5TX7A 2VSQA 4PQRA 4BMPB 4C06A 4BP8A 4GL2A 5KINB 3NUQA 2B34A 2HX1A 3SKVA 4YMLA 1FUUA 3Q8KA 1OOEA 1GADO 2A58A 1E2JA 2XWQA 5TQVA 1P19A 2OYSA 2ZI4A 4QX6A 1AKQA 1U3DA 3DF7A 4I50B 4IYRA 3GFRA 1K92A 3KVYA 4AWBA 1W49A 2GBGA 4RKRA 3AM1A 3CLUD 4UBJA 3GPDG 2PWYA 1D9XA 3HKBA 1GQFA 1OHHD 1IZYA 1TC1A 3ELWA 1PGNA 3G49A 3N5CA 4C5AA 3FY4A 4LZZA 1LGYA 4QGBA 2ZBEA 3PKJA 1ZXBA 1NBEA 1NUSA 2LTAA 3PT5A 2QVGA 4FZ3A 4L6CA 3UUEA 1OYWA 4K1XA 4H1WA 5I4IA 1H9CA 2B94A 3TCKA 1XC7A 4ZAWA 1M2HA 1QHGA 2EX1A 3EH1A 4X94A 3NDBB 2WFZA 3HUFA 4RLQA 1LLUA 5ITVA 1KI1A 2AN5A 4GR4A 4LY6A 4BO2A 5I6DA 1AA6A 1XNJA 4LHSA 3OIDA 1ACLA 1ZMXA 2P8SA 1DHTA 3AHEA 3H8VA 3UICA 4CQMB 1U02A 2ZAOA 4NQZA 2XMBA 4GUAA 4ARIA 1WUJS 4YCSA 5IDXA 3ZIUA 4FFRA 1G8KA 3O2QB 4RD6A 5E9AA 2C2WA 3RJZA 1QDUA 3G2NA 3NTUA 3TD9A 4A91A 9GPBA 1UM8A 3NDPA 5CVVA 2FMFA 1NZJA 4KBYA 2XTMA 1RAIA 1VB5A 2AI1A 2FZCA 3AETB 3ZLUA 3AXTA 5B6PA 1MIOA 4O2AF 1EZZA 4B8ZA 1F2VA 2ECQA 3PFIA 1R15A 1GPYA 4ZCIA 3R0VA 4XJTA 3JTMA 1DFGA 4G1VA 4L02A 5ESDA 3SHQA 1Q7TA 2NVUA 3OM1A 3KVRA 1KDPA 3QJGA 5T41A 2IV2X 4CM9A 1GYRA 2F9MA 4Z1MD 2YCBA 4M1EA 1VPWA 4G9BA 2XADA 3JR3A 1X8JA 4J0GA 3M1YA 2FHSA 3FMGA 4NV1A 3VKWA 2QIOA 3C8MA 4LK3A 4J6FA 4IIDA 3TLJA 2WB4A 3C3WA 4LRQA 1JYEA 4RSMA 2GETA 4JB8A 4LXGA 5FTNA 3VR6A 2H08A 2FNAA 2QL7A 2VBCA 3OF5A 3P71T 4HFMA 2EW1A 3RVDA 2M1XA 2ZSJA 4HNSA 3UK7A 1MO6A 1OFVA 2PZLA 2QVLA 1RBQA 4I6GA 2EFYA 5ICSA 1RWXA 2CWWA 1R0XA 1TD1A 4QL3A 3AUKA 3UQYS 4D4LA 3I2FA 4TSFD 5EJIA 1H2YA 4ZIRA 4B9AA 1FFGA 1EVZA 2AG5A 1II8A 3F1KA 1TJ4A 3JAKB 4Z9AA 1IK4A 4EYGA 1KERA 2YHIB 3ANSA 1YVUA 3MEQA 5IAGA 4E21A 1QGUA 1KY4A 2HRBA 2VNHA 4IP0A 2DUJA 5F5LA 1Z7BA 2F59A 1CY4A 1E3DA 2LP4Y 3H9BA 4EH1A 3GGPA 3H04A 4KUHA 2DHDA 4FOOA 4HGOA 3UAGA 3A4NA 2YWRA 3ABZA 4MVJE 5ES3A 3I9JA 3TVDA 4NFYA 3WSWA 4FD3A 1WUIS 2AV6A 2NU6A 3GFTA 1OQAA 2E4YA 4RDCA 5JLJA 3FMVA 4NU8X 1QO9A 2Q0XA 1L4EA 2NLOA 4JMLA 1DZ3A 4KQCA 2QR3A 1OYVA 4HADA 5B4TA 2DOKA 4YAIA 1QE0A 4XIJA 3RSCA 3KR1A 2IKQA 1K8XB 3GR6A 3JARB 4W9NC 3NORA 1AUOA 4FMDF 3K0EA 1BCSA 1N2CE 3SSNA 4EKNB 1X15A 4BO8A 3FDZA 4Q3AA 5FPYA 3K0KA 5JS8A 1R10A 1VCIA 1FYXA 3OX3A 1U7ZA 3Q1KA 2JBAA 3UWOA 5KWVA 2SECE 4JLJA 4HFRA 3AUUA 3LVRE 3T34A 4EFLA 1CV2A 2B30A 4BFVA 2XDYA 4DCCA 2Y9MB 1JXMA 1JHVA 3PRYA 2V7XA 2ODPA 2YVLA 4ZJZA 4OX9B 2R5NA 3OEHD 1CDDA 1NMYA 1UOPA 1SUFA 4L5CA 3GBSA 4M6WA 3EG9A 4MRAA 5FYQA 4IXNA 1R9GA 2TECE 2XMSA 2P2DA 4FMCF 4NHOA 3TZHA 2O2IA 3X1WA 1NRWA 4EUFA 3V8RA 4CM7A 3MWEA 1KE1A 3BGSA 3HVKA 3E9YA 3M4YA 4KI7A 3R7DA 2WKRA 1TDJA 4CETA 1N2IA 1OH8A 1SVKA 3HP7A 2ZTSA 4HH4A 5DTRA 3W5JA 4PHHA 5C0OE 4LTNA 5AW0A 4NABA 4AG5A 3C24A 4BX8A 4KFCA 1C7EA 4WKGA 3AVYA 1KHHA 1E1CB 2XPCA 3OT1B 4HDSA 4N8SA 3MJ4A 3H5NA 3TLZA 4Y2SA 1AJEA 1RZRA 3F3YA 1G5FA 2AD1A 4JUDX 4YR9A 5F9HA 3RTDA 3SE0A 1GO2A 1EUCB 1WKCA 4PAMA 3H4IA 1QVRA 4LWOA 4TLCA 5J9FA 4A0HA 5H9WA 2C5BA 4JLSA 5C5EA 1G3QA 3Q3GE 1NX6A 3EQZA 1N5MA 3D7NA 2ZB3A 3TIFA 4DLKA 4URFA 2DTEA 4XEUA 2RI1A 3K4QA 4EHJA 4YN3A 4JJKA 4R16A 3CA8A 2G5CA 3K70C 3DAHA 2ZTMA 3SGLA 5CIYA 3CRZA 2ZVQX 4B4KA 3CNQS 2C7QA 4XD2A 1YIDA 2Z9CA 3EDOA 2C78A 2ZEJA 1J0EA 2EVWX 2Y0EA 1NUAA 8GPBA 4HQFA 2F8SA 2D3WA 2L42A 3FBGA 3OJLA 3K1TA 4H6XA 3COWA 1JQDA 2WD7A 4P4NA 4V2IA 1X8XA 1G2PA 4XQ0A 4RM2A 3WQRA 7MDHA 1CY1A 3C6YA 2HXYA 3E9QA 1IU9A 2IVFA 3AHJA 5I47A 5KNLA 3P2EA 1X3SA 3UB4A 5LXTB 3ZHXA 1T4CA 1ZGBA 3FYTA 4EHFA 4YMWA 3MJCA 4JH0A 4K87A 7GPBA 5K01A 3GLUA 1P29A 3ILYA 3ZDYB 1J7KA 5EFOA 5IF9A 1X1DA 1XRRA 1G18A 4ZC8A 2JIZD 1WZEA 3OTHA 3BFJA 4LC1A 3SQLA 3ZD7A 3QG1A 3MOGA 3ZJ4A 2PHZA 3TRFA 4XIGS 1SH7A 4PG4A 4UUAA 4RHCA 4WXHA 1BIFA 1S7GA 3RANA 4YV1A 4DIEA 5JR3A 3A28A 4G0XA 1OA1A 1YBMA 3QU5A 4Q47A 3IQXA 3K15A 3K1ZA 4R1PA 5AM3A 1V11B 4JI4B 3PRKE 4NPAA 1RFLA 3QOXA 5E7JA 1H66A 1PG0A 1ESMA 2NSLA 4R1OA 3N74A 4ZANA 4FONA 2O54A 1FF9A 4C0SA 3QV1A 5DYNA 3ZBQA 1M67A 1MC4A 1T5DX 2PT7A 2XR1A 3HPQA 2P9CA 3KT8A 3LO8A 4UUBA 5HQ3A 4US2R 3IT2A 4PYMA 3JS5A 4J3FA 4KQ9A 3U40A 2XZOA 4I19A 3OE1A 2DQYA 5JYBA 5J58A 1W5EA 1WXXA 3WWCA 4I1IA 4AM8A 1TU3A 1GL3A 1T3SA 1KEEB 4WHMA 1NFQA 3AI1A 2ZBQA 1JFSA 1A95A 4KR3A 2WUVA 3WIBA 3BMNA 1U2PA 3L8YA 4JLAA 1U8ZA 3DEIA 4MS3A 4QJ3A 1XNQB 3A04A 4EO9A 4EVRA 5IEBA 5EKDA 1PZHA 1NGSA 1CK4A 2C0QA 3H86A 4BNIA 4UHFA 1GNQA 5AVJA 5K8UA 2CLFB 3D43A 4LRWA 3B7GA 3EMBA 3HEMA 1B0ZA 2YWBA 5J2TF 1ZG3A 1T4MA 4FGWA 2G5PA 4KMOA 4NTZA 3GZTB 3VSAA 4F71A 4PHTA 2VHJA 3GHYA 2REQA 1OBHA 2GMWA 4QUIA 4RJIA 2NSYA 1N2JA 5FH9A 3UPTA 1KAEA 2QX7A 4CKEB 3OE5A 4D44A 1H5UA 4F2HA 4NJMB 2E5LB 4QYIA 4K6MA 3K2QA 4LXYA 1R5JA 2QENA 1PKEA 3V6MA 4CL2A 1IC6A 3K0FB 2TMKA 1KXZA 2W4IA 1KR5A 4OQNA 1ST3A 3DBLA 3M70A 1UOEA 2P9JA 4OBWA 2FPXA 2WG1A 5FBWB 3GA5A 1SU7A 3HJBA 1SRQA 1T1IA 3OTGA 3PWTA 4TKLA 3V4ZA 3ZU3A 3Q7PA 1ESEA 1T29A 2J3HA 3AG5A 3CJTA 3IDSA 4W8OA 5LMCA 4UJ5A 1S3SA 4F06A 1P5FA 3EZLA 1QKJA 3FWKA 4OJKA 2HJGA 2HRQA 3WO1A 5K6AC 3BREA 1W6UA 1REQA 1PJZA