4PZ5A

Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of bbk32 from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Borrelia burgdorferi Protein BBK32 Binds to Soluble Fibronectin via the N-terminal 70-kDa Region, Causing Fibronectin to Undergo Conformational Extension.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4pz5A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4pz5A02
4FXGG 1LY2A 4IGDA 2QY0A 2RKYA 1O9AA 3ZD2A 2XWBF 2BZMA 3INBC 4PZ5A 1GKGA 4LOTA 3IX0A 1QO6A 3KZJA 2KMSA 1G4GA 3OEDC 4DJZA 1E5GA 4YNXA 3MQLA 2CKUA 3RJ3D 1QGBA 1QUBA 3KXVA 3ZD1A 2ERJA 1TPGA 1H2PP 2JGXA 1PPQA 1UOTP 1ZJKA 3GOVA 1HFHA 1OK1A 5HYTB 3CALA 2W81A 1SRZA 1TPNA 3OP8A 2RKZA 2XRDA 4CSYA 4WJG2 3R62A 1H04P 2EC3A 1Z92B 2JGWA 1H2QP 5I0QB 1VVDA 1OJWA 2JRAA 4AYEA 2G7IA 5JPMG 2YRAA 3L89M 2YBYA 4LOSA 1CKLA 2IZ4A 1OK9A 4K12A 1GPZA 2O39C 1GKNA 2LOJA 2RLQA 1HFIA 1OJVA 4A5WB 2W80A 1OJYA 4JHSA 4B2RA 5HYPA 1OK3A 3IU3I 1G4FA 1SS2A 4F4OC 3ZRZA 2KRIA 1GHQB 4J38B 3ERBA 2RLPA 1E8BA 2MCYA 3O8EB 1ELVA 1HCCA 1FBRA 2CG6A 2V8EA 1U5MA 1C1ZA 3TVJA 4AYDA 1VVCA 3OXUD 3M7PA 4ZH1D 1Q3XA 2XWJI 2WIIC 2MCZA 4ONTD 3SW0X 1OK2A 2XRBA 2XQWC 1MD8A 5FO8C 1H03P 4KKDA 1MD7A 3GXEA 3T5OA 2RL0A 4AYMA 2IZ3A 2A55A 3EJHA 5HZPB 4B2SA 1TPMA 2CG7A 4C16A 2EHFA 1E88A 4MUCA 1NWVA 4AYIA 2UWNA 2B5ID 5HYUB 3NFPI
chains in the Genus database with same CATH superfamily
1RLHA 4FXGG 1LY2A 4IGDA 2QY0A 2RKYA 1O9AA 3ZD2A 2XWBF 2BZMA 3INBC 4PZ5A 1GKGA 4LOTA 3ZLEA 3F6KA 3IX0A 1QO6A 3KZJA 2KMSA 1G4GA 3OEDC 4DJZA 1E5GA 4YNXA 3MQLA 2CKUA 5DN5A 1QGBA 1QUBA 3RJ3D 3KXVA 3ZD1A 2ERJA 4YIZA 1TPGA 1H2PP 2JGXA 1PPQA 1UOTP 1ZJKA 3GOVA 1HFHA 1OK1A 5HYTB 3CALA 2W81A 1SRZA 1TPNA 3OP8A 2RKZA 2XRDA 4CSYA 4WJG2 3R62A 1H04P 2EC3A 2ZYCA 1Z92B 2JGWA 1H2QP 3FGRA 4APLA 4PO7A 5I0QB 1VVDA 1OJWA 2JRAA 3FGTA 3WSXA 4AYEA 2G7IA 5JPMG 2YRAA 3L89M 2Y8RA 2YBYA 4LOSA 1CKLA 2IZ4A 1OK9A 3ZLDA 3WSYA 4K12A 1GPZA 2O39C 1GKNA 2LOJA 2RLQA 1HFIA 1OJVA 4A5WB 2W80A 2X2ZA 1OJYA 4JHSA 4B2RA 5HYPA 1OK3A 3IU3I 1G4FA 1SS2A 4F4OC 3ZRZA 2KRIA 1GHQB 4J38B 3ERBA 2RLPA 1E8BA 2MCYA 3O8EB 1ELVA 1HCCA 1FBRA 2I2LA 2CG6A 2V8EA 1U5MA 4BWCA 1C1ZA 3TVJA 4AYDA 1VVCA 3OXUD 4N7EA 3M7PA 4ZH1D 1Q3XA 2XWJI 2WIIC 2MCZA 4ONTD 3SW0X 1OK2A 2XRBA 2XQWC 1MD8A 2Y8TA 1H03P 3CI0J 1MD7A 4KKDA 5FO8C 3GXEA 3T5OA 4MSLA 2RL0A 4AYMA 2IZ3A 2A55A 3EJHA 5HZPB 3NJAA 1TPMA 4B2SA 2CG7A 4C16A 2EHFA 1E88A 4MUCA 1NWVA 4AYIA 2UWNA 5DN4A 2B5ID 3VWOA 2Y8SA 5HYUB 3NFPI 3K3TA
chains in the Genus database with same CATH topology
4FXGG 1LY2A 4IGDA 2QY0A 2RKYA 1O9AA 3ZD2A 2XWBF 2BZMA 3INBC 4PZ5A 1GKGA 4LOTA 3IX0A 1QO6A 3KZJA 2KMSA 1G4GA 3OEDC 4DJZA 1E5GA 4YNXA 3MQLA 2CKUA 3RJ3D 1QGBA 1QUBA 3KXVA 3ZD1A 2ERJA 1TPGA 1H2PP 2JGXA 1PPQA 1UOTP 1ZJKA 3GOVA 1HFHA 1OK1A 5HYTB 3CALA 2W81A 1SRZA 1TPNA 3OP8A 2RKZA 2XRDA 4CSYA 4WJG2 3R62A 1H04P 2EC3A 1Z92B 2JGWA 1H2QP 5I0QB 1VVDA 1OJWA 2JRAA 4AYEA 2G7IA 5JPMG 2YRAA 3L89M 2YBYA 4LOSA 1CKLA 2IZ4A 1OK9A 4K12A 1GPZA 2O39C 1GKNA 2LOJA 2RLQA 1HFIA 1OJVA 4A5WB 2W80A 1OJYA 4JHSA 4B2RA 5HYPA 1OK3A 3IU3I 1G4FA 1SS2A 4F4OC 3ZRZA 2KRIA 1GHQB 4J38B 3ERBA 2RLPA 1E8BA 2MCYA 3O8EB 1ELVA 1HCCA 1FBRA 2CG6A 2V8EA 1U5MA 1C1ZA 3TVJA 4AYDA 1VVCA 3OXUD 3M7PA 4ZH1D 1Q3XA 2XWJI 2WIIC 2MCZA 4ONTD 3SW0X 1OK2A 2XRBA 2XQWC 1MD8A 5FO8C 1H03P 4KKDA 1MD7A 3GXEA 3T5OA 2RL0A 4AYMA 2IZ3A 2A55A 3EJHA 5HZPB 4B2SA 1TPMA 2CG7A 4C16A 2EHFA 1E88A 4MUCA 1NWVA 4AYIA 2UWNA 2B5ID 5HYUB 3NFPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXG G;  1LY2 A;  4IGD A;  2QY0 A;  2RKY A;  1O9A A;  3ZD2 A;  2XWB F;  2BZM A;  3INB C;  4PZ5 A;  1GKG A;  4LOT A;  3IX0 A;  1QO6 A;  3KZJ A;  2KMS A;  1G4G A;  3OED C;  4DJZ A;  1E5G A;  4YNX A;  3MQL A;  2CKU A;  3RJ3 D;  1QGB A;  1QUB A;  3KXV A;  3ZD1 A;  2ERJ A;  1TPG A;  1H2P P;  2JGX A;  1PPQ A;  1UOT P;  1ZJK A;  3GOV A;  1HFH A;  1OK1 A;  5HYT B;  3CAL A;  2W81 A;  1SRZ A;  1TPN A;  3OP8 A;  2RKZ A;  2XRD A;  4CSY A;  4WJG 2;  3R62 A;  1H04 P;  2EC3 A;  1Z92 B;  2JGW A;  1H2Q P;  5I0Q B;  1VVD A;  1OJW A;  2JRA A;  4AYE A;  2G7I A;  5JPM G;  2YRA A;  3L89 M;  2YBY A;  4LOS A;  1CKL A;  2IZ4 A;  1OK9 A;  4K12 A;  1GPZ A;  2O39 C;  1GKN A;  2LOJ A;  2RLQ A;  1HFI A;  1OJV A;  4A5W B;  2W80 A;  1OJY A;  4JHS A;  4B2R A;  5HYP A;  1OK3 A;  3IU3 I;  1G4F A;  1SS2 A;  4F4O C;  3ZRZ A;  2KRI A;  1GHQ B;  4J38 B;  3ERB A;  2RLP A;  1E8B A;  2MCY A;  3O8E B;  1ELV A;  1HCC A;  1FBR A;  2CG6 A;  2V8E A;  1U5M A;  1C1Z A;  3TVJ A;  4AYD A;  1VVC A;  3OXU D;  3M7P A;  4ZH1 D;  1Q3X A;  2XWJ I;  2WII C;  2MCZ A;  4ONT D;  3SW0 X;  1OK2 A;  2XRB A;  2XQW C;  1MD8 A;  5FO8 C;  1H03 P;  4KKD A;  1MD7 A;  3GXE A;  3T5O A;  2RL0 A;  4AYM A;  2IZ3 A;  2A55 A;  3EJH A;  5HZP B;  4B2S A;  1TPM A;  2CG7 A;  4C16 A;  2EHF A;  1E88 A;  4MUC A;  1NWV A;  4AYI A;  2UWN A;  2B5I D;  5HYU B;  3NFP I; 
#chains in the Genus database with same CATH topology
 1RLH A;  4FXG G;  1LY2 A;  4IGD A;  2QY0 A;  2RKY A;  1O9A A;  3ZD2 A;  2XWB F;  2BZM A;  3INB C;  4PZ5 A;  1GKG A;  4LOT A;  3ZLE A;  3F6K A;  3IX0 A;  1QO6 A;  3KZJ A;  2KMS A;  1G4G A;  3OED C;  4DJZ A;  1E5G A;  4YNX A;  3MQL A;  2CKU A;  5DN5 A;  1QGB A;  1QUB A;  3RJ3 D;  3KXV A;  3ZD1 A;  2ERJ A;  4YIZ A;  1TPG A;  1H2P P;  2JGX A;  1PPQ A;  1UOT P;  1ZJK A;  3GOV A;  1HFH A;  1OK1 A;  5HYT B;  3CAL A;  2W81 A;  1SRZ A;  1TPN A;  3OP8 A;  2RKZ A;  2XRD A;  4CSY A;  4WJG 2;  3R62 A;  1H04 P;  2EC3 A;  2ZYC A;  1Z92 B;  2JGW A;  1H2Q P;  3FGR A;  4APL A;  4PO7 A;  5I0Q B;  1VVD A;  1OJW A;  2JRA A;  3FGT A;  3WSX A;  4AYE A;  2G7I A;  5JPM G;  2YRA A;  3L89 M;  2Y8R A;  2YBY A;  4LOS A;  1CKL A;  2IZ4 A;  1OK9 A;  3ZLD A;  3WSY A;  4K12 A;  1GPZ A;  2O39 C;  1GKN A;  2LOJ A;  2RLQ A;  1HFI A;  1OJV A;  4A5W B;  2W80 A;  2X2Z A;  1OJY A;  4JHS A;  4B2R A;  5HYP A;  1OK3 A;  3IU3 I;  1G4F A;  1SS2 A;  4F4O C;  3ZRZ A;  2KRI A;  1GHQ B;  4J38 B;  3ERB A;  2RLP A;  1E8B A;  2MCY A;  3O8E B;  1ELV A;  1HCC A;  1FBR A;  2I2L A;  2CG6 A;  2V8E A;  1U5M A;  4BWC A;  1C1Z A;  3TVJ A;  4AYD A;  1VVC A;  3OXU D;  4N7E A;  3M7P A;  4ZH1 D;  1Q3X A;  2XWJ I;  2WII C;  2MCZ A;  4ONT D;  3SW0 X;  1OK2 A;  2XRB A;  2XQW C;  1MD8 A;  2Y8T A;  1H03 P;  3CI0 J;  1MD7 A;  4KKD A;  5FO8 C;  3GXE A;  3T5O A;  4MSL A;  2RL0 A;  4AYM A;  2IZ3 A;  2A55 A;  3EJH A;  5HZP B;  3NJA A;  1TPM A;  4B2S A;  2CG7 A;  4C16 A;  2EHF A;  1E88 A;  4MUC A;  1NWV A;  4AYI A;  2UWN A;  5DN4 A;  2B5I D;  3VWO A;  2Y8S A;  5HYU B;  3NFP I;  3K3T A; 
#chains in the Genus database with same CATH homology
 4FXG G;  1LY2 A;  4IGD A;  2QY0 A;  2RKY A;  1O9A A;  3ZD2 A;  2XWB F;  2BZM A;  3INB C;  4PZ5 A;  1GKG A;  4LOT A;  3IX0 A;  1QO6 A;  3KZJ A;  2KMS A;  1G4G A;  3OED C;  4DJZ A;  1E5G A;  4YNX A;  3MQL A;  2CKU A;  3RJ3 D;  1QGB A;  1QUB A;  3KXV A;  3ZD1 A;  2ERJ A;  1TPG A;  1H2P P;  2JGX A;  1PPQ A;  1UOT P;  1ZJK A;  3GOV A;  1HFH A;  1OK1 A;  5HYT B;  3CAL A;  2W81 A;  1SRZ A;  1TPN A;  3OP8 A;  2RKZ A;  2XRD A;  4CSY A;  4WJG 2;  3R62 A;  1H04 P;  2EC3 A;  1Z92 B;  2JGW A;  1H2Q P;  5I0Q B;  1VVD A;  1OJW A;  2JRA A;  4AYE A;  2G7I A;  5JPM G;  2YRA A;  3L89 M;  2YBY A;  4LOS A;  1CKL A;  2IZ4 A;  1OK9 A;  4K12 A;  1GPZ A;  2O39 C;  1GKN A;  2LOJ A;  2RLQ A;  1HFI A;  1OJV A;  4A5W B;  2W80 A;  1OJY A;  4JHS A;  4B2R A;  5HYP A;  1OK3 A;  3IU3 I;  1G4F A;  1SS2 A;  4F4O C;  3ZRZ A;  2KRI A;  1GHQ B;  4J38 B;  3ERB A;  2RLP A;  1E8B A;  2MCY A;  3O8E B;  1ELV A;  1HCC A;  1FBR A;  2CG6 A;  2V8E A;  1U5M A;  1C1Z A;  3TVJ A;  4AYD A;  1VVC A;  3OXU D;  3M7P A;  4ZH1 D;  1Q3X A;  2XWJ I;  2WII C;  2MCZ A;  4ONT D;  3SW0 X;  1OK2 A;  2XRB A;  2XQW C;  1MD8 A;  5FO8 C;  1H03 P;  4KKD A;  1MD7 A;  3GXE A;  3T5O A;  2RL0 A;  4AYM A;  2IZ3 A;  2A55 A;  3EJH A;  5HZP B;  4B2S A;  1TPM A;  2CG7 A;  4C16 A;  2EHF A;  1E88 A;  4MUC A;  1NWV A;  4AYI A;  2UWN A;  2B5I D;  5HYU B;  3NFP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...