4PZ5A

Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of bbk32 from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
b'EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Borrelia burgdorferi Protein BBK32 Binds to Soluble Fibronectin via the N-terminal 70-kDa Region, Causing Fibronectin to Undergo Conformational Extension.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4pz5A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4pz5A02
1Z92B 1ZJKA 2BZMA 5FO8C 1OJYA 1Q3XA 2WIIC 2V8EA 2W81A 2ERJA 1GKNA 1O9AA 3ERBA 4JHSA 2KRIA 3CALA 1E88A 3KXVA 1GKGA 1TPGA 3OP8A 2EC3A 2RKYA 5HZPB 3ZD2A 1GPZA 4ZH1D 2IZ3A 1UOTP 4J38B 2JGWA 5HYTB 3OXUD 1SS2A 2W80A 3IU3I 4B2SA 3M7PA 2UWNA 1H2QP 2XRDA 3EJHA 3SW0X 1PPQA 3TVJA 2JRAA 1OK9A 2IZ4A 4WJG2 4CSYA 2KMSA 5HYPA 4IGDA 5I0QB 1OK2A 1OK3A 1CKLA 2XWJI 3GOVA 4FXGG 1VVDA 4PZ5A 3O8EB 3INBC 2LOJA 2RKZA 1H04P 2RLQA 1MD7A 3IX0A 3NFPI 4KKDA 3L89M 1H2PP 4F4OC 2RL0A 1C1ZA 1H03P 3KZJA 1HFIA 3OEDC 4AYEA 1GHQB 2B5ID 2A55A 3MQLA 1QO6A 2XWBF 1G4FA 1ELVA 1TPMA 2YBYA 1FBRA 1OK1A 2XQWC 1E5GA 2CG6A 2XRBA 4LOTA 4DJZA 3T5OA 1MD8A 1NWVA 1U5MA 2MCZA 2G7IA 3R62A 4LOSA 3GXEA 1E8BA 1QGBA 2QY0A 2YRAA 1OJVA 1TPNA 1HFHA 2EHFA 2MCYA 1SRZA 3ZD1A 4AYIA 5HYUB 1G4GA 4K12A 4YNXA 3RJ3D 2CG7A 2O39C 2CKUA 4ONTD 1VVCA 1HCCA 4C16A 3ZRZA 4A5WB 2JGXA 1QUBA 4AYDA 1OJWA 4B2RA 5JPMG 2RLPA 4AYMA 4MUCA 1LY2A
chains in the Genus database with same CATH superfamily
1Z92B 5DN5A 1ZJKA 2BZMA 5FO8C 2Y8SA 1OJYA 1Q3XA 2WIIC 3ZLEA 2V8EA 2W81A 2ERJA 1GKNA 1O9AA 3ERBA 4JHSA 2KRIA 3CALA 1E88A 3KXVA 1GKGA 2Y8TA 1TPGA 3OP8A 2EC3A 2RKYA 3ZLDA 5HZPB 3ZD2A 1GPZA 4ZH1D 2IZ3A 1UOTP 4J38B 2JGWA 3FGRA 5HYTB 3OXUD 1SS2A 2W80A 3IU3I 4B2SA 3M7PA 2UWNA 4APLA 1H2QP 2XRDA 3EJHA 3SW0X 1PPQA 3TVJA 2JRAA 1OK9A 2IZ4A 4WJG2 4CSYA 2KMSA 5HYPA 4IGDA 5I0QB 1OK2A 1OK3A 1CKLA 2XWJI 3GOVA 4FXGG 1VVDA 4PZ5A 3O8EB 3INBC 2LOJA 2RKZA 1H04P 2RLQA 1MD7A 3IX0A 4PO7A 3NFPI 2X2ZA 4KKDA 4YIZA 3L89M 1H2PP 4F4OC 2RL0A 1C1ZA 1H03P 3KZJA 1HFIA 3OEDC 4AYEA 1GHQB 2B5ID 2A55A 3MQLA 2I2LA 1QO6A 2XWBF 1G4FA 1ELVA 1TPMA 2YBYA 1FBRA 1OK1A 1RLHA 2XQWC 1E5GA 2CG6A 2XRBA 4LOTA 4DJZA 4BWCA 2ZYCA 3T5OA 1MD8A 1NWVA 1U5MA 3VWOA 2MCZA 2G7IA 3CI0J 3R62A 4LOSA 3GXEA 3NJAA 1E8BA 3FGTA 1QGBA 2QY0A 2YRAA 3WSYA 1OJVA 1TPNA 1HFHA 2EHFA 2MCYA 1SRZA 3K3TA 4MSLA 3ZD1A 3F6KA 4AYIA 5DN4A 5HYUB 3WSXA 1G4GA 4K12A 4YNXA 3RJ3D 2CG7A 2O39C 2CKUA 4ONTD 1VVCA 1HCCA 4C16A 3ZRZA 2Y8RA 2JGXA 1QUBA 4A5WB 1OJWA 4AYDA 4B2RA 5JPMG 2RLPA 4AYMA 4MUCA 4N7EA 1LY2A
chains in the Genus database with same CATH topology
1Z92B 1ZJKA 2BZMA 5FO8C 1OJYA 1Q3XA 2WIIC 2V8EA 2W81A 2ERJA 1GKNA 1O9AA 3ERBA 4JHSA 2KRIA 3CALA 1E88A 3KXVA 1GKGA 1TPGA 3OP8A 2EC3A 2RKYA 5HZPB 3ZD2A 1GPZA 4ZH1D 2IZ3A 1UOTP 4J38B 2JGWA 5HYTB 3OXUD 1SS2A 2W80A 3IU3I 4B2SA 3M7PA 2UWNA 1H2QP 2XRDA 3EJHA 3SW0X 1PPQA 3TVJA 2JRAA 1OK9A 2IZ4A 4WJG2 4CSYA 2KMSA 5HYPA 4IGDA 5I0QB 1OK2A 1OK3A 1CKLA 2XWJI 3GOVA 4FXGG 1VVDA 4PZ5A 3O8EB 3INBC 2LOJA 2RKZA 1H04P 2RLQA 1MD7A 3IX0A 3NFPI 4KKDA 3L89M 1H2PP 4F4OC 2RL0A 1C1ZA 1H03P 3KZJA 1HFIA 3OEDC 4AYEA 1GHQB 2B5ID 2A55A 3MQLA 1QO6A 2XWBF 1G4FA 1ELVA 1TPMA 2YBYA 1FBRA 1OK1A 2XQWC 1E5GA 2CG6A 2XRBA 4LOTA 4DJZA 3T5OA 1MD8A 1NWVA 1U5MA 2MCZA 2G7IA 3R62A 4LOSA 3GXEA 1E8BA 1QGBA 2QY0A 2YRAA 1OJVA 1TPNA 1HFHA 2EHFA 2MCYA 1SRZA 3ZD1A 4AYIA 5HYUB 1G4GA 4K12A 4YNXA 3RJ3D 2CG7A 2O39C 2CKUA 4ONTD 1VVCA 1HCCA 4C16A 3ZRZA 4A5WB 2JGXA 1QUBA 4AYDA 1OJWA 4B2RA 5JPMG 2RLPA 4AYMA 4MUCA 1LY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z92 B;  1ZJK A;  2BZM A;  5FO8 C;  1OJY A;  1Q3X A;  2WII C;  2V8E A;  2W81 A;  2ERJ A;  1GKN A;  1O9A A;  3ERB A;  4JHS A;  2KRI A;  3CAL A;  1E88 A;  3KXV A;  1GKG A;  1TPG A;  3OP8 A;  2EC3 A;  2RKY A;  5HZP B;  3ZD2 A;  1GPZ A;  4ZH1 D;  2IZ3 A;  1UOT P;  4J38 B;  2JGW A;  5HYT B;  3OXU D;  1SS2 A;  2W80 A;  3IU3 I;  4B2S A;  3M7P A;  2UWN A;  1H2Q P;  2XRD A;  3EJH A;  3SW0 X;  1PPQ A;  3TVJ A;  2JRA A;  1OK9 A;  2IZ4 A;  4WJG 2;  4CSY A;  2KMS A;  5HYP A;  4IGD A;  5I0Q B;  1OK2 A;  1OK3 A;  1CKL A;  2XWJ I;  3GOV A;  4FXG G;  1VVD A;  4PZ5 A;  3O8E B;  3INB C;  2LOJ A;  2RKZ A;  1H04 P;  2RLQ A;  1MD7 A;  3IX0 A;  3NFP I;  4KKD A;  3L89 M;  1H2P P;  4F4O C;  2RL0 A;  1C1Z A;  1H03 P;  3KZJ A;  1HFI A;  3OED C;  4AYE A;  1GHQ B;  2B5I D;  2A55 A;  3MQL A;  1QO6 A;  2XWB F;  1G4F A;  1ELV A;  1TPM A;  2YBY A;  1FBR A;  1OK1 A;  2XQW C;  1E5G A;  2CG6 A;  2XRB A;  4LOT A;  4DJZ A;  3T5O A;  1MD8 A;  1NWV A;  1U5M A;  2MCZ A;  2G7I A;  3R62 A;  4LOS A;  3GXE A;  1E8B A;  1QGB A;  2QY0 A;  2YRA A;  1OJV A;  1TPN A;  1HFH A;  2EHF A;  2MCY A;  1SRZ A;  3ZD1 A;  4AYI A;  5HYU B;  1G4G A;  4K12 A;  4YNX A;  3RJ3 D;  2CG7 A;  2O39 C;  2CKU A;  4ONT D;  1VVC A;  1HCC A;  4C16 A;  3ZRZ A;  4A5W B;  2JGX A;  1QUB A;  4AYD A;  1OJW A;  4B2R A;  5JPM G;  2RLP A;  4AYM A;  4MUC A;  1LY2 A; 
#chains in the Genus database with same CATH topology
 1Z92 B;  5DN5 A;  1ZJK A;  2BZM A;  5FO8 C;  2Y8S A;  1OJY A;  1Q3X A;  2WII C;  3ZLE A;  2V8E A;  2W81 A;  2ERJ A;  1GKN A;  1O9A A;  3ERB A;  4JHS A;  2KRI A;  3CAL A;  1E88 A;  3KXV A;  1GKG A;  2Y8T A;  1TPG A;  3OP8 A;  2EC3 A;  2RKY A;  3ZLD A;  5HZP B;  3ZD2 A;  1GPZ A;  4ZH1 D;  2IZ3 A;  1UOT P;  4J38 B;  2JGW A;  3FGR A;  5HYT B;  3OXU D;  1SS2 A;  2W80 A;  3IU3 I;  4B2S A;  3M7P A;  2UWN A;  4APL A;  1H2Q P;  2XRD A;  3EJH A;  3SW0 X;  1PPQ A;  3TVJ A;  2JRA A;  1OK9 A;  2IZ4 A;  4WJG 2;  4CSY A;  2KMS A;  5HYP A;  4IGD A;  5I0Q B;  1OK2 A;  1OK3 A;  1CKL A;  2XWJ I;  3GOV A;  4FXG G;  1VVD A;  4PZ5 A;  3O8E B;  3INB C;  2LOJ A;  2RKZ A;  1H04 P;  2RLQ A;  1MD7 A;  3IX0 A;  4PO7 A;  3NFP I;  2X2Z A;  4KKD A;  4YIZ A;  3L89 M;  1H2P P;  4F4O C;  2RL0 A;  1C1Z A;  1H03 P;  3KZJ A;  1HFI A;  3OED C;  4AYE A;  1GHQ B;  2B5I D;  2A55 A;  3MQL A;  2I2L A;  1QO6 A;  2XWB F;  1G4F A;  1ELV A;  1TPM A;  2YBY A;  1FBR A;  1OK1 A;  1RLH A;  2XQW C;  1E5G A;  2CG6 A;  2XRB A;  4LOT A;  4DJZ A;  4BWC A;  2ZYC A;  3T5O A;  1MD8 A;  1NWV A;  1U5M A;  3VWO A;  2MCZ A;  2G7I A;  3CI0 J;  3R62 A;  4LOS A;  3GXE A;  3NJA A;  1E8B A;  3FGT A;  1QGB A;  2QY0 A;  2YRA A;  3WSY A;  1OJV A;  1TPN A;  1HFH A;  2EHF A;  2MCY A;  1SRZ A;  3K3T A;  4MSL A;  3ZD1 A;  3F6K A;  4AYI A;  5DN4 A;  5HYU B;  3WSX A;  1G4G A;  4K12 A;  4YNX A;  3RJ3 D;  2CG7 A;  2O39 C;  2CKU A;  4ONT D;  1VVC A;  1HCC A;  4C16 A;  3ZRZ A;  2Y8R A;  2JGX A;  1QUB A;  4A5W B;  1OJW A;  4AYD A;  4B2R A;  5JPM G;  2RLP A;  4AYM A;  4MUC A;  4N7E A;  1LY2 A; 
#chains in the Genus database with same CATH homology
 1Z92 B;  1ZJK A;  2BZM A;  5FO8 C;  1OJY A;  1Q3X A;  2WII C;  2V8E A;  2W81 A;  2ERJ A;  1GKN A;  1O9A A;  3ERB A;  4JHS A;  2KRI A;  3CAL A;  1E88 A;  3KXV A;  1GKG A;  1TPG A;  3OP8 A;  2EC3 A;  2RKY A;  5HZP B;  3ZD2 A;  1GPZ A;  4ZH1 D;  2IZ3 A;  1UOT P;  4J38 B;  2JGW A;  5HYT B;  3OXU D;  1SS2 A;  2W80 A;  3IU3 I;  4B2S A;  3M7P A;  2UWN A;  1H2Q P;  2XRD A;  3EJH A;  3SW0 X;  1PPQ A;  3TVJ A;  2JRA A;  1OK9 A;  2IZ4 A;  4WJG 2;  4CSY A;  2KMS A;  5HYP A;  4IGD A;  5I0Q B;  1OK2 A;  1OK3 A;  1CKL A;  2XWJ I;  3GOV A;  4FXG G;  1VVD A;  4PZ5 A;  3O8E B;  3INB C;  2LOJ A;  2RKZ A;  1H04 P;  2RLQ A;  1MD7 A;  3IX0 A;  3NFP I;  4KKD A;  3L89 M;  1H2P P;  4F4O C;  2RL0 A;  1C1Z A;  1H03 P;  3KZJ A;  1HFI A;  3OED C;  4AYE A;  1GHQ B;  2B5I D;  2A55 A;  3MQL A;  1QO6 A;  2XWB F;  1G4F A;  1ELV A;  1TPM A;  2YBY A;  1FBR A;  1OK1 A;  2XQW C;  1E5G A;  2CG6 A;  2XRB A;  4LOT A;  4DJZ A;  3T5O A;  1MD8 A;  1NWV A;  1U5M A;  2MCZ A;  2G7I A;  3R62 A;  4LOS A;  3GXE A;  1E8B A;  1QGB A;  2QY0 A;  2YRA A;  1OJV A;  1TPN A;  1HFH A;  2EHF A;  2MCY A;  1SRZ A;  3ZD1 A;  4AYI A;  5HYU B;  1G4G A;  4K12 A;  4YNX A;  3RJ3 D;  2CG7 A;  2O39 C;  2CKU A;  4ONT D;  1VVC A;  1HCC A;  4C16 A;  3ZRZ A;  4A5W B;  2JGX A;  1QUB A;  4AYD A;  1OJW A;  4B2R A;  5JPM G;  2RLP A;  4AYM A;  4MUC A;  1LY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...