4PZDA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with nad+
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
molecule tags Oxidoreductase
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
total genus 102
structure length 283
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzdA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzdA01
1Q0LA 2TMDA 4MP6A 4UULA 5IN4A 5JPIA 4Y98A 3RASA 4IY1A 5KIAA 3WSWA 3DOJA 4IQ8A 3ORFA 4QSMA 2FZEA 1SZJG 4CLRB 4DRYA 1CYDA 1Z7EA 5IZCA 5L7WA 5JYDA 5C37A 1N7HA 4PLFA 5DOZA 4LVUA 4J90A 4RVDA 2E82A 4D3FA 4RGBA 4D0SA 1X1EA 2CDAA 4OHUA 2HMSA 3WLFA 4XDYA 4EUHA 4BO1A 3O4RA 4NJMB 4A10A 4L75A 2X9VA 4MVJP 3U0BA 4O1MA 4YA6A 1DRUA 1JLLA 3U9LA 3VPGA 4R9SA 5TT1A 4F3YA 3ZWNA 3H4VA 3IDSA 2AEFA 4A27A 3GFGA 1E1MA 5HWSA 1A7KA 1PR9A 3L4BA 4MIEA 3E18A 4J4TA 4RO0A 1AUPA 3OF2A 1RWBA 4AJIA 4BNKA 1PU2A 3ADOA 5KVCA 4W82A 2JD1A 2GN9A 4AJ2A 4D44A 5CEJA 3R1IA 2VN8A 4PLHA 4BKQA 1XKQA 2DPHA 3SJ7A 2R2GA 3OSUA 4BO2A 3QE3A 2J3IA 5A5FA 3JYOA 3GAZA 3DBRB 4X54A 4QECA 7ADHA 4JCOA 2E48A 2Q3EA 4DQUA 2EF1A 1JAXA 3JQBA 4WLVA 3TOXA 1IPEA 2PLAA 1VE9A 3VKUA 3SBOA 4H7PA 2O2SA 2VOJA 4PG6A 2BF7A 4W7HA 4GVXA 1UDCA 3BTOA 3KETA 3TZQA 2X9NA 1YB5A 1YBMA 1GV0A 2XPCA 3H5RA 4J43A 2JCYA 1FDWA 3ZNOA 2IEBA 4TRNA 5L40A 4ZHSA 1E7QA 1NP3A 1XHLA 2DKNA 2RAFA 4UEJA 4YT4A 1N9GA 1DC5A 3JQFC 5AXDA 1GCOA 2GN6A 3JQFA 3F1KA 2Q2QA 1QYWA 4CM1A 2NM0A 4E4YA 4I9NA 3AFMA 1U7HA 3QLJA 4J91A 4DIOA 3JQ6A 1H9BA 1MUUA 1YJ8A 1LEHA 4Q3CA 1S6YA 1ENYA 3H3JA 3HE3A 4W4TA 7MDHA 1A4UA 2E6UX 2Y1FA 3C85A 3ZZNA 3CTMA 3FNGA 3G0OA 2ZYGA 3ZWVA 2HMTA 4DPKA 2Q1WA 1U8XX 4BNTA 4YAJA 4KUGA 1NQAO 4OH1A 5JY1A 1ZSYA 1R0SA 4LN1A 3WYEA 1H6DA 5I8WA 1DPGA 1YDEA 1SC6A 1MA0A 2JFGA 2C7VA 3RUEA 1VL6A 4ZN6A 5IXYA 1SMKA 3PHGA 4HBGA 2FR8A 2BRUA 1JVSA 4WKGA 4CM3A 1CERA 1V35A 1T1SA 4UUMA 1HLPA 3RKRA 4UREA 3ZWCA 5CDTA 3HDJA 4BNHA 4UUPA 2AW5A 3ASVA 4PLPA 2Q4BA 2JCVA 2DT5A 3TZHA 4PZCA 3L4BC 2AE1A 3LU1A 2ZYAA 3H5NA 3MTJA 3I6QA 4PCVA 3OQBA 4GH5A 5TNXA 3PTZA 2NU8A 4M55A 4UEKA 4B7XA 2SCUA 2V6MA 4MIYA 3B1KA 4E6PA 2I3AA 4D79A 5DBFA 3QQPA 1C1XA 1DAPA 4EDFA 2ZTUA 1SEPA 1X0VA 4KQXA 3JQAD 3W6ZA 2Y1OA 2IODA 3PQFA 1P31A 2UUPA 3DHEA 4GX1A 5LDGA 3GZ4A 4CMBA 4M86A 5COAA 4A03A 4E33A 1LLCA 4KMSA 1YBVA 1DIRA 2I76A 3ZV4A 1X13A 3VAZA 5G4KB 1EDOA 1GYPA 2NADA 3GGOA 3PWSA 1ML3A 5BT9A 1YQXA 1GUYA 5KJEA 3TOZA 1UDAA 1UXKA 1EUCA 4OOFA 1SPXA 3K6JA 4FJ2A 4CLRA 6LDHA 3CTVA 1MB4A 1KETA 1FJHA 3ETEA 3QWHA 3LQFA 4JP3A 4O6VA 4EI2A 3ZDFA 1IOLA 3M2TA 1PJTA 2EKQA 3DC2A 5C3MA 4RVFA 1LSOA 4IMPA 4YPOA 1I36A 3OQ6A 5CG1A 4CM8B 1X7DA 1X14A 3GR6A 1SOVA 4CLOB 3GGPA 4A73A 2O7QA 5I9NA 3LVFO 4BO7A 4L9RA 2VYVD 4OQYA 4BO6A 1VRWA 5BSGA 3IJRA 1C0LA 2EKPA 3AY7A 2F00A 2Y93A 1H5QA 5TS3A 5AXAA 3CMMA 3JD0A 3V1YA 3RFVA 4XEHA 4YRBA 3ICCA 5EQFA 3CKYA 1WZIA 4TKMA 5JXWA 2EW8A 2R6JA 4W7IA 3JQ8B 1Q7GA 1KEPA 3UOGA 3WSVA 4L0QA 2NWQA 3JQEA 3JD3A 4DXHA 1E5LA 1PJ4A 3TZCA 3B70A 5G4KA 3WQQA 1EMDA 4ALJA 3KYBA 2FSVA 4OOEA 3JQ9A 4DBZA 1O89A 3W4JA 5JMWA 4XGKA 3WJAA 2C2XA 3K31A 3HNPA 2O3QA 4IDEA 2VRCD 2W4QA 4E3ZA 4D3SA 3RC7A 5EL0A 2A92A 2GRAA 2J5RA 2HCTA 4FFNA 5L45A 2OBYA 1YOVB 2HQ1A 1P1IA 2GZ1A 3TDKA 4OKIA 4JIGA 2VQ3A 4R3NA 1K89A 2AHRA 4B3IA 2B0JA 3Q1LA 4BNGA 4YJHA 1NFQA 1YOVA 5IDYA 1ZSNA 4XB2A 4QFDA 4WUVA 1KEUA 1TB4A 5B1YA 3W8DA 4QQRA 1DAOA 2D2IA 1EVZA 4GX0A 1TT5A 1N8KA 3HN2A 4CMEC 3IJPA 4R16A 4RLHA 3DHNA 5AOVA 1CRWG 3I3OA 1O94A 3Q9NA 1E3LA 4CM8A 1NQOA 2A4KA 4IINA 4AICA 4DREA 1E3SA 4HV4A 1PEDA 3PLNA 3IKTA 1BVRA 3FPLA 1ISIA 1YJQA 2YDYA 3E5RA 3GVIA 1R16A 4LW8A 4AJPA 2XXBA 3V8BA 3NDJA 5L9AA 3R6DA 3DEYX 1O0SA 5L7YA 1PJLA 5JE8A 1V6AA 2FMUA 1LRJA 1N1EA 1M67A 5TX7A 2QYTA 2VHXA 3RFXA 1NFFA 1F8FA 2YW9A 1N5DA 4R68A 3U5TA 3RU9A 3RQSA 4Z3DA 1SCUA 3RKUA 3D5QA 1NXQA 4IIUA 3WQSB 3UAGA 1P77A 2OXIA 1ZMTA 2JFFA 1PJBA 3PFWO 3E5MA 4MVJH 2G82A 3ZW8A 1U2DA 2B36A 3PRJA 1WW8A 3D4PA 4WASA 3KYCA 3PGXA 1J4AA 3KEQA 4PLWA 4PVCA 2PZJA 3CIFA 3R3JA 2PK3A 3VPFA 3F47A 1CIVA 3MJ4A 4XJTA 1P9LA 4R5MA 3WGTA 3AM5A 3SEFA 4N5NA 3F6YA 1I2ZA 3H9JA 1K2WA 1XQ6A 4F46A 1ZW1A 1E3EA 1D1TA 3GN1A 3LF2A 5F21A 4LMRA 4YYZA 1ISMA 2WYVA 3GF4A 4RPHA 4CMJA 3FNHA 1NWHA 4WOJA 1NYTA 2GUGA 2X1HA 3BTSA 3T4EA 4MP3A 2P9EA 4Q3DA 4HFRA 2C0CA 2GN8A 4RVSA 4GSKA 5G4LA 1SEVA 1IZ9A 2Q1UA 5A9SA 2LDBA 3AY6A 1WWKA 2HRZA 4MVJE 4Q3EA 5DZSA 3ZH2A 1R12A 2P4QA 2DU8A 4GGPA 4BKPA 1E3JA 1OBFO 4L4RA 1I10A 3TFOA 2VZ0A 2B37A 2RH8A 1P1KA 4XYMA 1Y6JA 3QW2A 5JAZA 5AYVA 4IJVA 4IJUA 4BNZA 2BH9A 2DTDA 1P1JA 2OHXA 3DHYA 3UCFA 1LDMA 4BO3A 5KTKA 1BRMA 2HO5A 2ZB4A 4A7PA 5TIIA 2V7PA 1DC3A 4YJFB 4XCVA 2PGLA 4EEXA 4ZQEA 4J9UE 3WS7A 4FJ0A 4CV0A 3JQ7A 5HTOA 1NR7A 3GNTA 4XRRA 2NUAA 2FY8A 4PLTA 4ESOA 1NASA 1D1SA 1OOEA 1VJ1A 5FWNA 3GEGA 3PVZA 3S2FA 3FI9A 3WXBA 1VC2A 4E2XA 8LDHA 1MC4A 3ZN2A 3JQ7B 2QRKA 4LGVA 4CPDA 1Y9AA 2H63A 3GZNA 1YBAA 3MOGA 1Y5MA 3W4KA 4IDBA 4MDHA 3INGA 4G65A 2B35A 4QO8A 5TJ9A 1KVRA 4DYVA 5I7SA 2P5UA 3LDHA 3WOHA 4XQ9A 5HS4A 1UAYA 1Z82A 1DDOA 2NVBA 1QG6A 3A4VA 5THKA 4ZD6A 1N9GB 2PKQP 1PJSA 2HK7A 4QO7A 1YL5A 2C07A 1XU7A 3WLEA 4FFRA 3GNSA 1T4BA 5A03A 2G1UA 4YTEA 3O03A 2AXQA 4GX2A 4NBVA 4Q3BA 1QYCA 1E7MA 2NQ8A 3BA1A 4TVBA 4UVHA 4C4OA 2Q2WA 4OYRA 4DC1A 3DZBA 2WMDA 4J6FA 3I6IA 3GQVA 3WGOA 1P74A 4YT8A 1Q7BA 2FHSA 4GMGA 3RJ5A 2C54A 4R1TA 2PD4A 1HZZA 4JJFA 4MKRA 4HFNA 3UW3A 4U0KA 4PZDA 3QIVA 1G1AA 5TRTA 4BQRA 3EY4A 5DN9A 3F1LA 3GNQA 4CMIA 2QQ5A 1UXGA 3IL2A 1NNUA 3PXXA 2HMWA 3Q0EA 5IG2A 1F0YA 1AXGA 4BNXA 1EUZA 1QKIA 3AOEA 1ARZA 5A9TA 4HY3A 1YB4A 5COQA 3HUDA 1YL7A 3GHHA 4URFA 1F17A 1S7CA 3PDJA 2Y1EA 4JK3A 4TRRA 2OZPA 4ZQGA 2DQ4A 3OEWA 3NYWA 3P2OA 4KP7A 3WGHA 2C29D 4ZVVA 4GQAA 1LLUA 5ER9A 1GADO 3ZV3A 3LT1A 3UCXA 4BNMA 1NVTA 3JCZA 3LLVA 3WICA 2AQHA 1YB1A 2P4HX 3LT4A 1HE3A 1U3WA 3O26A 5IXSA 2GCGA 3TWOA 4PZEA 4B3HA 3PZRA 4YVFA 2PZMA 3UH1A 2PTGA 4TSKA 2RHRA 4G5HA 4JBIA 3GEDA 3HWRA 2CY0A 3H9UA 3AW9A 5G0SA 3S2EA 3JYPA 1HTBA 5JLAA 5B4UA 1Q0QA 3BMQB 3CZMA 5ENDA 4JNKA 4L4XA 2Q99A 3D0OA 1P3DA 3UGKA 1NBOA 4E2WA 1DIBA 3KVOA 4XGIA 2C2YA 3O38A 4R69A 4DMMA 1HDRA 4KQWA 3C1TA 1PR3A 4R3WA 5T6BA 4OXNA 3IP1A 3JQBC 1ZBQA 5G2OA 1CF2O 1YRLA 1UUFA 1PS0A 2JHGA 1T26A 3G79A 4QT0A 1Q0HA 3GUCA 4MVJF 4E12A 1IYZA 1ULUA 2X5OA 2ZQZA 3GZNB 4MINA 1W0CA 2NQTA 3MTGA 1B14A 5IDQA 4EUFA 3OIFA 1U5AA 4KZPA 4GKBA 2BFPA 3BMCB 3ZV5A 1HDOA 1L1FA 2V65A 1LX6A 2GLXA 3GUYA 3PWZA 3A14A 4ID9A 4WOKA 4GGOA 3D1LA 5K0ZA 4J4HA 2PH5A 2P9GA 2B4TO 5K9ZA 3UKOA 2Q50A 3RD5A 3C7DB 3WX0A 2B5WA 1W6UA 4UEOA 4CM9A 5A06A 1BG6A 3C8MA 3OECA 3QRWA 3ITDA 3Q3CA 4WCFB 4J16A 4DLLA 3L9XA 3G1TA 2WD8A 1HYEA 1JKIA 3DAPA 3W6UA 4DIBA 4LSWA 4PLZA 3I9NA 4RPKA 4FC6A 4FS3A 1Z74A 2HUNA 1EVYA 1ISJA 1U4SA 4N5MA 2JJYA 4IDGA 4WCFA 5JCJA 4BNLA 4WCFC 2EW2A 4F6CA 5HS6A 3H7AA 4LRTB 1GUZA 1EDZA 1IHXA 3GVCA 4IZHA 4DPLA 4CR7A 1PWXA 2J3HA 1GEEA 1I3MA 2P68A 4OSOA 1C1XB 3L07A 1O6ZA 1VKNA 1V0JA 1HKUA 1U3VA 4K6FA 4F6LA 1DRWA 2DAPA 2CFCA 4IPTA 5THQA 3CINA 4P8RA 4NPCA 2AG8A 4YJDA 1ZSVA 2DBVO 3JSAA 3ZNNA 4IM7A 1SB8A 4BGEA 4R54A 3PI7A 3CMCO 1I01A 2G0TA 1M76A 2VCYA 2EJVA 3P19A 1EQUA 2CMDA 3L4SO 4FOSA 5COBA 3JD2A 1DSSG 4BGIA 1U9JA 2HRBA 2JD0A 4DIFA 1Z73A 2X6TA 1F14A 4M87A 4LSMA 2FPIA 3DAGA 3QVXA 1ISHA 2R00A 4QUKA 5IJZA 1GAEO 1ORRA 1CQJA 3RAJA 4D7AA 4W6ZA 3BMOB 3VKVA 4CQMD 5EINA 2CD9A 3P2YA 4NU6A 4UVIA 3WMXA 4XYGA 2IXBA 3NGLA 3PYMA 4ALKA 1N92A 2VT2A 5BR7A 2X86A 2J3JA 1GCUA 3INRA 5H83A 3WQRA 5JFOA 3VZSA 2BMAA 3MEQA 3VC7A 5G0WA 4JX8A 3AOEC 3TJRA 1EFLA 4OXYA 1R4NA 1RKXA 1JQBA 3ITKA 3BHJA 2OMEA 5G0TA 1EZ4A 3QP9A 3S2IA 1OAAA 1UDBA 1A5ZA 1LDGA 5IAAA 1EE9A 4B7CA 5KKCA 1GQ2A 2GR9A 4DPMA 3QWBA 3NT4A 5AVOA 4WLOA 2UAGA 1JTVA 1WLYA 1WMAA 3RJ9A 1JAYA 1EBFA 1TT7A 4OIMA 2IRWA 1I5RA 1HF3A 3FR8A 4BO4A 4FFPA 1GEGA 1FDUA 4Z6KA 1VM6A 3D3WB 4Z0TA 1GYRA 4AG3A 3HZZA 4XIJA 2DUWA 3JYQA 4YQYA 3G3EA 3FRJA 1ZEMA 1H94A 3LC1O 4ZICA 5JSFA 3BMOA 4ZA2A 2ZB3A 1U4OA 2BI7A 2CSUA 3LT2A 3VH3A 1KVTA 3LC7O 1LJ8A 3I9LA 3E1KA 1V3VA 5KVVA 3TL2A 4OL9A 2VYND 2AQIA 1B3BA 2D0IA 1R15A 2E49A 3G17A 1LDEA 3RBVA 4B7UA 1U2GA 3K73O 3H2ZA 1VJTA 4QTZA 3TL3A 4BS9A 1D3AA 4YAKA 4BV9A 1HDGO 4P4NA 2H5LA 1BW9A 1DIAA 4J1SA 3PIDA 1H6BA 2W2KB 3QV1A 4E2ZA 2PKQO 2BGKA 5JC8A 2W2LD 2VHYA 1ZEJA 3OHSX 1UZLA 1XIVA 3ASUA 2PV7A 1L7DA 5CP8A 2IDZA 4UVEA 3BMCA 3LK7A 3NV9A 4CM4B 3DZJA 2UDPA 5JDCA 5TT0A 2ZTLA 1AHHA 1O5IA 4WJZA 3ZHZA 2P91A 4FFLA 1UP7A 3DMYA 1ZXLA 1XELA 4I1IA 4II3A 4BGVA 4BIIA 3KRTA 3I52A 4RVHA 4RJTA 4TROA 4MVJA 1TEHA 3KB6A 4Q3NA 3PHJA 3ZU3A 2EKLA 4HNHA 3GC6A 1T24A 1PZGA 5KVQA 4BOYA 1HDCA 3VTFA 3GGGA 4H16A 2Q4EA 2CDBA 3GEMA 2WSBA 1RJWA 3DMTA 1N7GA 4UUOA 2Z5LA 2RBEA 4BKUA 4B4VA 2OFPA 3GY0A 1M66A 1YONA 2YQ4A 2O3JA 1V3TA 4DA9A 5DCWA 3WTBA 5JAIA 4ZU3A 5JW6A 1I2CA 3LT0A 2FPPA 3UVEA 2ZQYA 3DONA 1NTOA 2VUUA 3WGZA 3WGQA 2V6GA 4NFHA 1QYXA 3OP4A 3WWZA 1C1DB 1ZFNA 4IXTA 2NV6A 1BW9B 4DYDA 1SAYA 3OA0A 1ADCA 4N7RA 1V8BA 2GF2A 3E03A 2IE0A 1EE2A 3VZRA 3I4CA 2Y66A 3JQCA 1K6IA 1UXHA 2OGUA 2Q1TA 4K9DA 1ZKMA 1GY8A 1ZK1A 2NSDA 5HM8A 3TFQA 3H6KA 4Y6PA 2WJPA 3WG9A 4CMKA 2D8AA 3WMWA 1C0IA 5L53A 1A7AA 4J7UA 4NFSA 4IS3A 4ZRNA 2YY7A 3G49A 1XCBA 2I99A 2OP0A 1LRLA 1GTMA 3LSYA 2EP7A 4Z9FA 4YAGA 4OKNA 3L6EA 3GN2A 4N54A 3ROPA 1KS9A 1P45A 2FOIA 3TNLA 3JQGA 3S1LA 4FPXA 3ZHYA 4E0BA 1XG5A 3F4LA 1RPNA 1M75A 2FRDA 1G0NA 1X15A 4GI2A 3QVTA 2XAAA 3NT5A 1P33A 3DB2A 3T7CA 3U62A 2QG4A 4HUJA 2P5YA 3UXYA 1PGNA 1Y8QA 5KNLA 1LLQA 3C7AA 5I8ZA 4BO5A 1P1RA 3EAGA 4PLYA 2G76A 4E21A 1XU9A 5I9LA 1UXIA 1MP0A 1TI7A 5T57A 2AEMA 4GBJA 3ZU4A 1ZNQO 1Q1NA 2IYPA 4NI5A 4YDRA 5IZ4A 1DC4A 1WP4A 1A71A 2PD3A 5GZ3A 1T25A 2O48X 2IYOA 3IOYA 1WMBA 1GZ6A 1CDOA 4J1QA 4NHEA 4OMUA 5F5LA 4I5DA 1NPTO 5TGDA 1VSVA 3OETA 3K5PA 1K6JA 2AQKA 2RIRA 3GMSA 4XIYA 3DFUA 4DLAA 5DF1A 4Q3AA 1DFGA 4NK4A 4L73A 1ZCJA 2X58A 5CDYA 4RDIA 5KJ6A 4RF4A 4J0FA 1KBZA 1KVUA 2V6BA 2J5QA 3AUAA 3AUUA 3U4CA 5JS6A 3QA9A 4LK3A 3VPHA 4D43A 5DOVA 4NIMA 1MV8A 3WBBA 3V5NA 4D46A 3HB4X 1ZK3A 2NACA 1SB9A 1HE2A 2OL4A 4FFOA 1NPDA 4E2YA 1PL7A 1T2EA 1GUFA 2JHFA 5DP1A 3DBLA 1MXFA 3FWZA 3E48A 3PK0A 1LA2A 1PL6A 1U28A 2YV1A 3T7EA 3AU8A 5J23A 1XDWA 1F12A 4R51A 4L4SA 4EITA 1W73A 3GPIA 4YQZA 1PZFA 4EGFA 3OJFA 3K2EA 4O0LA 4ZRMA 4J7XA 2DTEA 3DZKA 3NUGA 4I08A 1QV6A 1Z6ZA 4IDCA 4NJOA 5CDUA 2I67A 4NDNE 3U3XA 4D42A 2A35A 5I7FA 1RYEA 3BHMA 5ITVA 4I5FA 2CDCA 3W8EA 5CFZA 1XLTA 1IUKA 4IUYA 1LSUA 5JDIA 5JO0A 1IL0A 1XSEA 1KEWA 4ZQFA 4W9NC 5DT9A 1TXGA 1R0LA 3MCVA 1Y1PA 1ZZEA 2FP4A 2NVWA 4IXWA 4PRKA 4Z3KA 5ILGA 1P1HA 2ZB7A 3G1UA 3M1AA 3PIIA 3KYDB 4KOAA 3F46A 1GDHA 4MVJD 5DBIA 1A4IA 4J1NA 4WLUA 2AEJA 5FFFA 3F5SA 4FC7A 4OXKA 1LQUA 1E0DA 4JGBA 4QEDA 4EJ6A 2P9CA 3JQGB 1LSJA 1HEUA 1I8TA 3WGYA 1YKFA 4GSLA 3WIDA 5EN4A 1R0KA 4XX0A 3U4DA 2YZ7A 1I24A 2WE8A 4E32A 4BV8A 2GZ3A 3DBRA 4CQLB 4DQXA 3VDRA 2J8ZA 4PG7A 3VHRA 3I5MA 1NAIA 2I3GA 4IDFA 4O5OA 4XB1A 2EXXA 2VHVA 3ROKA 3K96A 3GRKA 2JCXA 3DBHB 4YWJA 1T4DA 4PLCA 3NJ4A 4TMFA 1PIWA 3TZ6A 3ANMA 3WJ7A 4PVDA 5U1PA 3SLKA 4XQCA 3GG9A 8ADHA 1RYDA 1LDNA 4LCEA 2P2SA 4CM9D 3AM3A 9LDTA 1KIFA 3DL2A 3OJLA 1KEVA 4AJHA 2YUTA 4BB5A 3C7CB 3LLSA 3H65A 4TZTA 3VH1A 3EGOA 4LISA 5DCYA 2Y67A 5KVSA 1E3WB 2DVMA 1XEAA 2OBNA 2QX7A 4EZBA 1V3UA 2QYSA 4ALIA 2WE7A 1BDMA 1ZXBA 1I3LA 3DOCA 4AJ1A 2BGLA 3AJRA 3L0DA 4R1SA 1SO8A 3FR7A 4RLSA 4GKVA 3HB5X 2XOXA 4F45A 4KUHA 2WM3A 3K30A 1O9BA 1PJ2A 3RUFA 1AGNA 2X0NA 3O9ZA 5EPOA 3KSZO 1E6WA 2EHDA 2V6FA 1CQIA 1KY5A 4K26A 4CLXA 3IP3A 3LF1A 1EUDA 5L95A 4YRAA 4KWHA 1OZAA 3AI3A 5FI5A 4EEZA 3WR5A 2RHCA 3V2HA 2VUSA 3E9MA 1T1RA 1MGOA 3PEFA 3QY9A 2HK8A 3FBTA 4BKOA 5JCXA 1KVQA 1I2BA 1PS9A 4HP8A 4JBGA 4R5HA 4CM4A 2Z95A 4CV3A 2FN7A 2QW8A 4FB5A 2GZ2A 2OOSA 4Y6SA 2YHUA 1HE4A 2D5AA 4J9VA 1EFKA 3DXFA 4CLOA 1P1FA 1PGOA 2Q2VA 1E1LA 4WNCA 4W9NA 3RC9A 3IC5A 1JA9A 1ONOA 2GSDA 1PWZA 2PR2A 4ONEA 3VDQA 1EVJA 1Z7BA 1PJCA 1BTOA 3P5SA 1WXDA 1EEHA 3VZQA 2ET6A 1PSDA 4ND5A 2W90A 4NFYA 4BGUA 3UCEA 3ENNA 4E5MA 4BNIA 3E9NA 1ZH8A 4I5GA 1LSSA 3FHLA 1ZMOA 4RF5A 1ENOA 3DZHA 5TSDA 4MOWA 1ID1A 3WGIA 3IUSA 2EGGA 2DTXA 3H9EO 4XJSA 4DVJA 1CWUA 2VNSA 3HDYA 3KHUA 4RPLA 1G0OA 3V1TC 3I9MA 3K2BA 3V2UA 3WB9A 1X7HA 3HJAA 1H2BA 3GDFA 4XGNA 4B4UA 2BHLA 2VTEA 3A06A 3I9KA 3GVXA 1VL0A 2YYYA 1Y8RB 3ULKA 1DEHA 3W4IA 3KSUA 4HWKA 4WNIA 4PN3A 4CV1A 3P7MA 4GWGA 2QZZA 3QJ5A 2H6EA 4XR4A 5JDCC 4WEOA 1BXKA 2J3KA 2B4QA 3PJDA 5A9SB 3JYLA 2JD2A 3JD4A 1F8GA 1JKJA 4A5OA 4G2NA 1BVUA 1LC0A 3COSA 1SOWA 4EJMA 4U8GA 3ZW9A 3NDRA 1HL3A 3EW7A 5T8KA 2G5CA 5TLSA 1B3RA 5KKAA 4BMVA 1KOLA 1J49A 2YFHA 2GN4A 3N58A 1QRRA 4XRGA 3D7LA 2DFVA 3K92A 4IGEA 4CLHA 4ND1A 3E6AA 3H5AA 5BSFA 1A27A 2BLLA 2GD1O 2I5PO 1C1DA 2RH4A 4TKLA 4CV2A 1Z75A 4NNJA 1D8AA 3ROQA 1OMOA 3Q11A 1VKOA 3OBBA 5F3RA 3FCOA 1T2CA 2HK9A 1U7TA 2OORA 5ER6A 4IDAA 3UF0A 1N2SA 1DFIA 3CZRA 3OICA 2YFQA 5GZ6A 3BTVA 4WCDA 3F3SA 4BMSA 1YWGO 4ILKA 1GU7A 4MKXA 5C7OO 1B8UA 3VVBA 4KUEA 2PGDA 4DUPA 3RUCA 1ADFA 1GPDG 2VUTA 5TC4A 5BNTA 3EZYA 3WGGA 3E82A 4Z9YA 4E13A 3CUKA 2Y0DA 3CXRA 1NWCA 4CM6A 4L74A 4QFCA 1PGPA 3DFZA 3MWEB 2FPGA 9LDBA 1DOHA 3ZWPA 1YQGA 2EP5A 2O7SA 5KOIA 4PG8A 2HU2A 3GDGA 1JN0A 1ENPA 4BO8A 2I6TA 3ADPA 3ZNQA 3PPIA 1LRKA 2PH3A 4YR9A 4K6CA 4GX5A 3V1UA 4RF3A 1MC5A 5U4QA 5CEEA 2QRLA 3NT2A 3RC1A 4MO2A 1F06A 1YQDA 4O59O 4TQGA 1GQQA 3W1VA 4P4GA 3IQDB 3L6DA 3EC7A 1OC2A 3DBLB 3GPDG 3ZV6A 3PGJA 1VSUA 2Q1SA 4JXKA 5AXCA 3WTCA 3NAQA 1MG0A 1VI2A 2PY6A 4HXYA 1DO8A 1OFGA 2X23A 4FSHA 3TRIA 5DCUA 2H9IA 4C7JA 4NBRA 2G17A 5A3JA 1GZ3A 4IZIA 2AE2A 3QWIA 1UZMA 4WEQA 2Q46A 1W8DA 4UVGA 1L7EA 4CMGA 2PGJA 3KYDA 3NKLA 4CR6A 5JAQA 1MLDA 3DTYA 5ENVA 1YE3A 5A4DA 2WDZA 2X5KO 3MJSA 3RSHA 3ABIA 3ZWBA 4ITUA 3SC6A 1E7YA 2NTVA 1HDXA 4NJMA 3R3SA 5IFLA 2I66A 5DBGA 4CMCA 1ADBA 1K0UA 3I4FA 1TA4A 3TF5A 2UV8A 4RCVA 3FSRA 3MOIA 1EBUA 3HDQA 2NLOA 2UYYA 4FR5A 4AJ4A 4B8ZA 1HDZA 5H81A 4BB6A 1XYGA 1TLTA 5CEFA 2OO5A 4ND4A 2NNLD 5T67A 4IDDA 4TZKA 4PG4A 1B16A 4IS2A 1IE3A 2H1SA 4XDZA 2DUUA 3EVTA 2X7HA 2O23A 4IQGA 1U8FO 3H9GA 3ANNA 3DR3A 3E8XA 3IKVA 2ZB8A 4W99A 1E7SA 3BAZA 2Y05A 2ZATA 3AI1A 3VPSA 4IMRA 4CMHA 1RM4A 6ADHA 1IULA 1Y7TA 3GH3A 2DFDA 2BI8A 4WLNA 2C20A 3WFJA 1B8PA 1UP4A 4NMHA 3GFBA 3TN7A 1LU9A 2BFOA 3QWFA 5F1OA 1NPYA 4DTIA 3RBZA 2BKAA 1UR5A 3O8QB 3OQ1A 4KTVE 3C3XA 3FBGA 4OM8A 4ZGWA 4NBWA 1R6DA 2OP1A 1LDBA 4O63O 4Z0PA 2YQ5A 3R0IA 4D0RA 4YT2A 4R9RA 1H6CA 5C7IO 3ETDA 4B8WA 1E77A 2ZJ1A 1I3KA 3INTA 1PZHA 1IHYA 1XR3A 1ZK2A 3KSDO 2IZZA 5JYEA 2X9GA 3UFXA 3BXXA 2FR1A 2I9PA 4L8VA 1H2HA 1LBEA 1E3IA 4YAEA 5JDIC 1Q2XA 1EVIA 2PNFA 2IXAA 5F1KA 2EWMA 2XF8A 4R1UA 5A1TA 3BIOA 2GGSA 2AG5A 3HDHA 2EEZA 3CEAA 3X2EA 5JBIA 1DB3A 3OJOA 3A9WA 3NDIA 4I9UA 4DMLA 3VPXA 1AN9A 4RVGA 1V9LA 4BNUA 1J5PA 1EK5A 4E31A 2VZ9A 2O4UX 3EMKA 4DQVA 3RFTA 1IY8A 1XWFA 3GT0A 1DHRA 4CL3A 3AOGA 3KV3O 2HAEA 1KVSA 1CETA 3SLGA 4NR0A 1YXMA 1ZJYA 4AFNA 3EHEA 3SVTA 3U09A 4FN4A 4CQLA 5LCXA 3S55A 2YDXA 4R4JA 1VLLA 3FNFA 3QHAA 1PQPA 2EJWA 3N74A 4FOOA 3RI3A 3D3EA 2VWHA 1GYQA 3OFSA 4HFJA 1FDVA 1GZ4A 2CZCA 4DC0A 4EYEA 5L4NA 3ZWMA 2JL1A 2HKIA 4P4LA 4OO3A 3FF4A 3PHLA 3DWFA 4TWRA 1PTJA 1SBYA 5FF9A 4NBUA 2WWRA 4Y6RA 3K8ZA 3RUDA 2B5VA 2X4GA 4K1LA 2BFMA 1FXSA 4FCCA 3KM0A 1DLIA 3PYLA 4E30A 4UVDA 2OUIA 5JC1A 2WEKA 3Q2KA 1KC1A 3D4OA 4GL4A 2J5KA 3GOHA 4BKRA 3C24A 5A9RA 3ZWYA 2DBQA 3A1NA 1BGVA 5L7TA 2GNAA 1HZJA 4BVAA 1HLDA 4IGFA 4RQUA 1H9AA 3PJGA 3M6IA 3STHA 4B79A 1GFSA 1QSGA 2VWQA 1TT5B 3VOSA 4L76A 3KOUA 4HNGA 3JYNA 3GHYA 2PFGA 5KCZA 3IS3A 2WTBA 2Y0EA 1NVGA 4BO0A 5IF3A 4HKTA 4E5YA 4S3MA 2A94A 3BZUA 3RWBA 1TVEA 5AXBA 5EJ2A 2W98A 4BNWA 1QLJA 3DDNA 1E1NA 3OIDA 4D3DA 3KO8A 5KJ1A 1T2FA 4RDHA 1NFRA 4E5PA 1Y9EA 4YBZA 5HA5A 1LXCA 1HETA 4II2A 1ONPA 1NAHA 4Q9NA 3DAFA 3D3WA 1NX6A 1H93A 4PGFA 1DJNA 3MWDB 3DMTC 4WE3A 5JAMA 1BHSA 1E5QA 1DRVA 1WDKA 1M6WA 5F5NA 3CH6A 1MFZA 4ZQBA 1Y5RA 1Y81A 4NH4A 1NR1A 4IQ0A 1DIGA 3DO5A 4YCAA 1ONNA 1Z45A 4Y9DA 4JQCA 4RL6A 4CUKA 2QIOA 4HFMA 1I33A 1ULSA 2NTJA 3QSGA 1P0FA 3F9IA 3JV7A 4I9HA 3EK2A 4BNJA 3WBFA 2O3TA 3NTQA 5L4SA 2X22A 1I32A 1KY4A 5L51A 4KDEA 4DLBA 1I30A 4YACA 1B15A 5A3VA 4LVCA 1R66A 3AUTA 1DLJA 3WDSA 3NTOA 4YJHB 4YAIA 4B3JA 3L9WA 4D45A 3GG2A 1LC3A 5BSEA 3LZ6A 4WK6A 3O8QA 3JQAA 1I3NA 1H0KA 1DIHA 5TQVA 1YVEI 1O8CA 4MJLA 1HDYA 2DPGA 3HADA 2Z1NA 3GDOA 3H2SA 3HHPA 2Z1MA 3Q9UA 4QX6A 2F1KA 4FDAA 2BD0A 2NTNA 4KTTE 2Y99A 1BMDA 1WDLA 1P44A 4JP2A 4CJXA 5ICMA 2XXJA 3AI2A 1NVMB 3ETGA 3B20A 3F4BA 3MJCA 2NU7A 4R1NA 3FD8A 5CPFA 1QMGA 4FIZA 4MP8A 2C5EA 3A28A 1KYQA 4I8XA 4CLEA 4JBHA 3KEOA 2GDZA 4XYEA 1NQ5A 4YEDA 4DGSA 5LDHA 2HMVA 1PS8A 2WYUA 3PHHA 3UUWA 1PQWA 2PZLA 5GY7A 1YL6A 3QVOA 5K6AA 1ZUD1 2CF5A 5A05A 2VWPA 1FF9A 1T2DA 2YJZA 1A9YA 1JU9A 3FN4A 2BFAA 4NK5A 5MGBA 4BMNA 2HLPA 3NRCA 2JAHA 1U3UA 5LC1A 3H9QA 1QORA 3RUAA 2E4AA 3IUPA 1BXGA 3MJEA 1HSZA 1WZEA 3FPCA 3OIGA 1MFPA 1BXZA 3AUSA 1IB6A 4XWYA 3NTRA 4CMAA 2TMGA 5B12A 3W8FA 1BDBA 2NVUB 2HDHA 3I1JA 3ZWWA 4FJ1A 3ANLA 4NBTA 3F5QA 1VJ0A 4BNFA 2FSSA 3KXDA 4ALMA 2HSDA 3OMLA 4M49A 1HWYA 1VPDA 4EBFA 1LQTA 1MX3A 3I83A 1B0AA 2E37A 2EV9A 1MXHA 2Q45A 1E7WA 3ZCXA 1YO6A 2Y1CA 1ZK0A 2PA3A 5L3ZA 1UZNA 2AA3A 1YDWA 4QXMA 4Y8VA 3DZGA 4RVUA 3VH4A 3EYWA 3U4IA 1E7RA 2AMFA 4RPJA 1YH3A 4NU5A 4GLLA 5B4VA 1Y8QB 2FR0A 4U6SA 4UAGA 1C0KA 3GAFA 3C1OA 4S1VA 2D5CA 4J2HA 4AJLA 2Y1GA 3EZLA 5IN5A 2PKRA 1PGQA 1SNYA 3AWDA 3BTUA 5B37A 4BNVA 4J1TA 1QYVA 4GVLA 1XQ1A 5TJHA 1OI7A 1A9ZA 1NM5A 5DDIP 2C82A 4OAQA 1YGYA 5JO9A 5H82A 3ZWXA 5HRUA 1DXYA 4JJIA 1HRDA 4RQTA 3PJEA 2DBRA 4ZJUA 2VHZA 3MJVA 2C59A 4MVJI 4BUCA 2JKVA 4RPGA 4R01A 1GD1O 1UH5A 4AJKA 4XQEA 1JWBB 3S8MA 5EERA 2VWGA 4XA8A 4B4OA 3DQPA 5DNAA 3SC4A 5KJFA 2UVDA 3PJFA 2W2LA 3GVHA 3DZFA 1AHIA 2IZ0A 4RZIA 4ZQHA 2JAPA 3VVCA 3WNVA 4BO9A 5T8KC 4C7KA 3ZNPA 4TRMA 1R37A 4YB8A 3PYXA 4J0EA 1B2LA 4LMPA 2CVQA 1E1KA 1BXGB 2PZKA 1JW9B 1R4MA 3GA0A 3KTDA 3OEYA 4OGWA 1DFHA 4E5KA 5EESA 3AK4A 3GVPA 4OQZA 4LRSB 4FGSA 2YHIB 2WYWA 1FDSA 1ZIDA 1GV1A 4BL5A 2EGHA 4I5EA 2X8LA 1Q7CA 1HXHA 4BNNA 3ONDA 2EIHA 1FMCA 4ALNA 4AJNA 3AM4A 4FBGA 4FD3A 3GRPA 4U0JA 5BSHA 3RROA 3EUWA 5CPBA 2IEDA 4R41A 1ISFA 4CM7A 1E3WA 3PWKA 3PP8A 3I9OA 4WLFA 1ZO8A 2YV2A 3WYCA 5CG2A 4JN6B 4XYBA 3BMQA 4J2OA 2B69A 2NU9A 2FWMX 3ZI0A 1D7OA 4Q39A 1X1TA 4OSPA 1J0XO 4JJGA 4U7WA 3RUIA 3WIEA 4ALLA 4GMFA 3ROMA 1B7GO 1B26A 2CUKA 1DJQA 3VH2A 3WWYA 1WAMA 1PQUA 1YS4A 2EERA 2HJRA 4PRLA 4XKJA 4NG5A 3BMNA 1JKFA 4FW8A 1EK6A 2X0JA 4RF2A 2CVZA 1R4NB 2O3SA 3M2PA 4YXFA 4Y67A 3FWNA 5I7EA 3RCBA 3UN1A 2VTDA 2FZWA 5BNIA 4CMIB 1XA0A 5BQFA 2CNBA 3U49A 2ZKLA 1K6XA 3OA2A 4EUEA 1LDYA 1RM3A 4XR9A 3E9QA 2O4CA 4EJ0A 1LTHR 3DTTA 5MDHA 2W8ZA 4IJWA 4XD2A 5I7VA 1PJ3A 5ICSA 4GAEA 3FTPA 3PQEA 2B83A 2DLDA 5T5QA 5ES3A 4AJOA 4CM5A 4FGWA 4OJNA 3SJUA 2GPTA 2GASA 3KUXA 4AJJA 1AXEA 1D4FA 4N5LA 3JQ9C 5K6AC 4GWKA 3GLQA 4ROSA 3HQ4O 3HFSA 1QR6A 5JMPA 3PLRA 2C5AA 2EG9A 4U6QA 3ZHBA 4J3FA 3RBXA 2UUOA 4AL4A 3NJ8A 1E92A 1PX0A 3ENKA 4H3VA 2O3UA 1M2WA 2HMUA 3ONEA 3UICA 1RM5A 3D5TA 4CR8A 1UP6A 3BHIA 4B4WA 3HSKA 3JTMA 3QVSA 1WPQA 4KDFA 2ZTMA 1Y8RA 1QXSA 2NU6A 3CSDA 3D64A 4CQMB 4YJFA 5EIOA 3WFIA 4UUNA 3N7UA 3EVNA 3HN7A 3PZBA 1ADGA 3ZWOA 3BMNB 2X0IA 1PGJA 1QYDA 1WDMA 5ITWA 3ST7A 1DHTA 1AE1A 3K9QO 3FNEA 4J4BA 5CHEA 3BYZA 4XYLA 4CMEA 1ZVMA 2VYNA 3ZWAA 3TSCA 3GK3A 3VZPA 4BHTA 1CEQA 1LNQA 2A9FA 2Y68A 4RV9A 4PFJA 2CVOA 2J6IA 2C7GA 4CL8A 3TQHA 4RORA 4N18A 3VTZA 3QWAA 4Z9XA 2ZIZA 4Z0HO 1QV7A 3NGXA 3LC2O 3RIHA 4A0SA 3WNQA 4MPDA 4J49A 1OC4A 3I9JA 5U9CA 2AQ8A 2ZCUA 5L4LA 4IJKA 3TPCA 2VT3A 1FDTA 1P0CA 2DM6A 3GMDA 4PIVA 3KZVA 2POQX 2VZ8A 3UHAA 5HBRA 4AVYA 3B1FA 1QLHA 5AQ1A 1C14A 1HYHA 1KC3A 5ADHA 1X0XA 1B8VA 1IZ0A 1DC6A 3IAHA 4M8SA 4KWIA 3RVDA 1JDJA 3S2GA 1IPFA 1E6UA 2HJSA 2D59A 2ZJ0A 3Q6IA 2VHWA 4CUJA 1ENZA 3X2FA 5C5IA 3AFNA 3ZU2A 1JWAB 1LI4A 4M89A 1UXJA 4YJGB 4A2CA 4M54A 3HFGA 3CPSA 4HX5A 4PLGA 1HYGA 4DWVA 4WGGA 1E6EA 2GERA 4HADA 3KBOA 3ZHXA 2D1YA 2O50A 4YJGA 3U4HA 1N1GA 2VYVA 3NEPX 3SX2A 4NZ9A 2CF6A 3DBVO 5DULA 4LCJA 1FK8A 4XZ3A 4CQMA 1M6HA 4ND2A 5FYDA 5T64A 1GPJA 3KLPX 1C0PA 5A5EA 3I23A 3JQ8A 1WVGA 2QZ9A 4JLWA 4CLDA 4RZHA 5JY6A 1GR0A 2ZTVA 3B1JA 2GYYA 2ILTA 4MIOA 1NQTA 1LLDA 3SXPA 2Y1DA 3DBHA 5A04A 4E5NA 3DZIA 4XQGA 1O95A 3OM9A 4A26A 3IIEA 3OJ0A 4DL9A 4IIVA 4CODB 1HE5A 4BNYA 5GZ1A 1NHGA 1PZEA 2Y0CA 4IBOA 5IZCC 2B4RO 5EMHA 2YV3A 3RUHA 5ILOA 3WYBA 3IMFA 3RC2A 2DBZA 4YRDA 4J7CA 5BNFA 5KJCA 4AJEA 1NHWA 3B6ZA 2BGMA 3KLMX 5GMOA 3JQDA 3ICPA 3ONFA 5FI3A 2VOEA 4TRJA 1MG5A 3PHIA 1BSVA 2O2YA 2GO1A 1JVBA 3L6OO 2X0RA 3KYCB 5DP2A 2QRJA 2X5JO 5CAEA 1UJMA 2WD7A 2Q49A 4H15A 4MKZA 4K28A 4WLEA 1H6AA 2O3RA 3HG7A 5JCJD 1HSOA 1I0ZA 1K3TA 3H3FA 3C1AA 1VL8A 3QVWA 4MVJM 4YT5A 4FFMA 5C7LO 3JD1A 4INAA 1W4ZA 5G0VA 4EW6A 1DBVO 3FTNA 5TF4A 1CJCA 5IDXA 4JROA 2BELA 4TVOA 1A72A 2PWZA 1UAGA 4PG5A 1QP8A 2LDXA 1BWSA 1HT0A 5CDSA 5CDGA 4WECA 4MVJG 1R4MB 3PDUA 2VRCA 4M1QA 3AY3A 2RCYA 3T4XA 3MJTA 1ISGA 3AU9A 3L77A 3Q2IA 3TZKA 1EQ2A 4BQPA 2DC1A 2VNAA 4FQ8A 2VRBA 2D3TA 3M1LA 1ZJZA 3ZU5A 2ZK7A 3DOOA 3ON5A 1XGKA 1ZK4A 5EQDA 5A02A 2ZCVA 5IDWA 1WNTA 4DBVO 3V2GA 1U3TA 1C3VA 1U1IA 4U5QA 4D41A 3H8VA 5KWEA 4GLOA 1G6KA 1RM0A 1T2AA 1K5HA 2YHIA 5JNLA 3JQAB 2PD6A 3OJEA 5I9MA 2I65A 3EDMA 2D4AA 3RU7A 1X7GA 2IZ1A 3OH8A 1U5CA 3LYLA 5G0UA 1GL3A 3MZ0A 4P38A 1PJQA 2W2KA 2R00C 1J6UA 3PFFA 4PLVA 4P22A 4GPD1 2WD7B 4CUZA 4G81A 1PL8A 3NX4A 3CE6A 5B4TA 2JFHA 2NVUA 3D4NA 5F1PA 1GQYA 1KERA 2QHXA 4NQZA 4WPGA 4ND3A 5FEUA 3ZGYA 3PQDA 2ZYDA 1LUAA
chains in the Genus database with same CATH superfamily
1MRNA 1Q0LA 2TMDA 3SP1A 2BEUB 2I3DA 4Y98A 2JLXA 3B6MA 2F4NA 3WWDA 4AKTA 2VUHB 3AKEA 3RLIA 2FZEA 1SZJG 4QBIA 3L40A 4CN9A 1V41E 3CR3C 1EP2B 2FGKA 2ON6A 1NKTA 3TFWA 3QITA 1JEJA 5IAOA 5SY6A 1AD2A 4D3FA 1YFZA 1ZVKA 2WSMA 3MB8A 4JAVC 4JB0A 3VX4A 4D0SA 1X1EA 1XQVA 2R68A 4G2TA 1NIJA 4OHUA 4XDYA 4EUHA 5J58A 2A5DA 4NJMB 3LO8A 3NW9A 5DT2A 2F1IA 5E9WA 1S2IA 1ACMA 4TMVA 2YL2A 1TDJA 3G13A 1DKOA 1R9NA 1T6ZA 4JBXA 1DRUA 4IJMA 4YXWD 2WQ6A 3H2KA 2O1XA 4MLZA 4OMCA 4DLNA 4WIAA 3PEWA 3ZWNA 4ZZIA 2OCKA 3D6HA 3TTUA 2ERCA 1DV1A 1PR9A 3L4BA 4MIEA 4C5BA 4J4TA 1U2DC 1JZQA 1VLZA 4TX1A 4ZVPA 5LQSA 5KU7A 1AUPA 1FYVA 5ADWA 1AO0A 1M2VB 1O6BA 1UKZA 3I6BA 3RUFA 3PX7A 3F9RA 2VDWA 1BJTA 4Q4CA 1KMIY 1Y4DE 2WYHA 5LJLA 3KAQA 5AKGA 1W34A 3WLPA 3G8BA 2FMKA 1UPXA 5AHOA 3HBAA 5CEJA 1EQAA 3P1JA 1W0KA 1XKQA 1PX2A 3H11B 3JSXA 7MDHA 1RC8A 4CCSA 1W52X 3BDIA 1P0MA 3Q88A 5KHLB 3RYHA 2YWBA 1H2YA 2PL3A 4DDWA 5BW6B 5JYBA 2J3IA 4BQQA 3W9SA 4CKXA 3KEFA 1TIPA 2GM3A 3HUFA 2HFJA 1V39A 1J97A 2IHUA 3EVFA 1OVMA 3DBRB 3AVXA 3L7OA 4QECA 4X54A 2LWIA 3NANA 2RH9B 1JA0A 2RHHA 2A5FA 4N3BA 5CGZA 1SQ6A 2XQGA 3HL4A 3JQBA 2Q6LA 3E7PA 1S8FA 1E59A 2YNMC 5J2TB 4CU5A 1IY0A 3SBOA 1T2VA 1Z4NA 2YNMA 3PGVA 4YONB 3O94A 4KLZA 3BTOA 1F0NA 1X77A 4P7FA 1JDBB 1YB5A 3VOTA 4BLPA 1WXEA 4XLLA 3HKCB 5CJPA 3UXHA 4IDQA 4J0CA 1ESMA 2IEBA 3CX8A 2VH2A 2IV2X 4JKYA 3N76A 2QX9A 1E7QA 2DFKB 1N1MA 1RLOA 1XHFA 3FWHA 4Q16A 4Y0VA 5E2BA 3SIXA 2BLNA 2BZ1A 3R6WA 1JV2B 3JAKB 1ODKA 4GR5A 4HDNA 4YMIA 2YYZA 3A8TA 5K51A 3TS1A 1CQJB 4CIVA 3OQOA 5DLYA 4O8ZA 4Q4HA 2X8WA 4I9NA 1L5QA 3ZI7A 1MUUA 4QG3A 4UFNA 5K3SA 1U3DA 4I55F 4L9AA 4PX2A 4PZUA 1ENYA 1RAIA 4G5QA 4TWJA 1I51A 4W4TA 1A4UA 1A2BA 2Y1FA 4QXRA 5ERYA 2AZTA 4D9CA 1GU1A 2OB2A 3CTMA 4DLZA 4UBLA 3ZWVA 2HMTA 2JGMA 4DPKA 4OCZA 5JAOA 2CV2A 3CLKA 1NQAO 3NG1A 4MH0R 5JY1A 2I3ZA 2IYEA 1ZSYA 2YJ6A 3HP7A 4FQ7A 2FPKA 4LNUB 3PX2A 3RIMA 3UHFA 4DWOA 3K1AB 5DHQA 1H6DA 4IIEA 2BFBB 2K7FA 1L3BA 2F9LA 4LY9A 2RIPA 2C7VA 4FINA 3RUEA 3SICE 4ZN6A 1X9IA 1M2JA 4GM1A 4CIWA 1R0ZA 3PB3A 1AG9A 1PD0A 4HBGA 3FZEA 1BFDA 2BRUA 3ID6C 2IIQA 4WKGA 2BFBA 3PFHA 4YFVA 1CERA 4CM3A 5JU6A 1Q3HA 3NPAA 4L4ZA 2FW1A 1FTYA 3RKRA 4F93B 5JNVA 2V3CC 3COWA 3ZLVA 5BV2P 3LO5A 4INZA 2IPAB 6REQA 3FZNA 4A8JA 3P52A 3K1ZA 3HDJA 4A2WA 3L1JA 1JFLA 2GAAA 3OIWA 5FWYA 3UK2A 1HNNA 1E6MA 1KYWA 5EGSA 1JQ5A 1N2BA 2P11A 4RU1A 1JPVA 1EXVA 4ZDIA 2H7CA 2JI9A 3UJ9A 3WADA 5C3UA 2H2FA 1NVEA 2O2JA 1G5FA 1VGVA 3B53X 3L4BC 3MTJA 3LU1A 2ZYAA 1RWKA 4W5JA 2QMYA 1RYZA 3PTZA 1JDNA 4HDNB 2CW5A 5CLQA 4K9OA 3Q72A 2WUGA 1P5RA 4MIYA 3T0GA 2O2CA 4J0GA 4UU0A 5HMMA 4B0PA 2P0AA 4X60A 1DAPA 3DO6A 1FUIA 2LPMA 2ZTUA 1FFXA 4FUQA 3RIYA 4BE9A 1GKLA 3DOUA 1X0VA 5LKRA 3W6ZA 3I9V1 3PQFA 4FHFA 4OD0A 1DTWB 2HA4A 3GZ4A 3MUNA 2OZEA 2ZBGA 5COAA 1L7MA 1LLCA 4OF4A 4E33A 3HB0A 4RY8A 4IKOA 2J9FA 2RD2A 1JH9A 2DETA 1DIRA 3GCDA 5G4KB 1A4RA 1KYYA 4RVNA 1KJYA 1EDOA 1KL7A 1XDZA 1Z33A 4UDXX 5JEEA 2QTGA 3WL6A 3PC2A 4BV2A 4XOUA 2ODPA 2V55B 4JVMA 1UDAA 1UXKA 1EUCA 3GDHA 2I9KA 2QD4A 1VYHA 1GQRA 1IZ7A 4F8YA 1J99A 4KIJA 3CTVA 1CU1A 3FH0A 5F64A 4DR4B 2IC5A 1IRIA 2YZ2A 4EI2A 2QT9A 2EKQA 4Q9KA 5CJ2A 4TMKA 5CYGA 3TIXB 1LSOA 4IMPA 4ESVA 1F6BA 3HJHA 4YPOA 1R8JA 3B9BA 1DGQA 1X7DA 1X14A 1SOVA 2M6SA 2NX2A 1FS6A 1XVTA 2Y9PB 2O7QA 4P86A 4A73A 4DARA 5I9NA 2V59A 4H31A 2AI3A 4BO7A 1A88A 3ZTYA 5BSGA 3V7YA 2YIVX 1BCRB 3AY7A 3B7GA 1OSNA 3H3XA 4LA4A 5FTKA 2NIPA 1ITZA 4DA8A 4GZ5A 5AXAA 1KJ9A 5FUQA 1X7ZA 1XMOB 4I0WB 1QO0A 1FMJA 3CUVA 3I9FA 4XEHA 1YJBA 1Y80A 3K70B 5EQFA 2ZUCA 3RFUA 2C42A 3OX2A 3KQTA 2YXNA 2R6JA 1SUPA 3P9ZA 3COJA 1GSAA 1LBIA 5IF9A 4F4CA 3LRPA 3G68A 3L3BA 5AK5A 3UOGA 3WSVA 4L0QA 1DQSA 4WESA 2W0SA 2BGJA 2XUKA 2YZGA 2ZE7A 3A3PA 2GAJA 4V39A 2HHAA 4JDPA 2FJ0A 2K87A 4Q9JA 1VJCA 1ZONA 5G4KA 4UAJA 4F3TA 4ALJA 2IKQA 4C43A 2RHBA 1N0IA 1QFXA 1OXKB 4KI0A 1P4HA 2Z04A 2H18A 4WUTA 2FW0A 1XHEA 5AK6A 4EUNA 1O89A 4F6RA 3IGFA 5ALUA 3B7PA 1YRHA 1D5WA 4BLSA 5KSOA 3GH1A 2VSNA 3UPDA 1ABEA 3WLLA 1DDGA 5C8DA 5FLEX 4E51A 1YU6A 3HGMA 4D3SA 3RC7A 1CQXA 4ZI5A 1IXKA 1ND6A 2GRAA 2J5RA 4FFNA 1Y42X 3SSNA 2OBYA 4YRFA 5FWDA 2VFAA 1M34B 4TS4A 3IE0A 4KXYA 3UAYA 1S7GA 2H1HA 5FCDA 2VQ3A 4KAFA 3V4FA 5K8LA 3ND7A 2APJA 3NAGA 4B3IA 4FHGA 4WWHA 2WHEA 2Y76A 4DB4A 4YJHA 1Q95A 3OOEA 2QBYB 2O0KA 1PCXA 1TB4A 2GLUA 3FXAA 3G2KA 3OHPA 4W1PA 1Y1LA 2VF4X 3U37A 1TMKA 4AJ9A 4JFAA 4E09A 1TT5A 4HK4A 1N8KA 2WNSA 4AZWA 3HN2A 1DKPA 3LXUX 3HVIA 1V8FA 5A4MS 5BWBA 5KX5F 3IVGA 4BBPA 5AVRA 3ER9A 5LMCA 2ESRA 5AJTA 1PV1A 5HK9A 3ZE9A 3WJ1A 1SZCA 4KPUA 1F8YA 1E3LA 1XROA 2RARA 4BCBA 4DCTA 4HV4A 3PLNA 4KRYA 2A9KA 2G9ZA 3FPLA 4FGKA 2R8YA 5LZ5A 5LD2B 1JJAA 3PNLA 1R16A 5MFPA 3IYLW 5SY9A 2CXNA 3BHNA 4RIHA 5IBRA 2DH6A 2Z6QA 3E7WA 5ALSA 1B6TA 1DAFA 1UWVA 4CN8A 5L9AA 4HDOB 3D6MA 5JE8A 5FUWA 3W3AA 2FMUA 1LRJA 1F5SA 4JEIA 5TX7A 4KXNA 2E55A 2IHJA 2VHXA 2YMPA 3RFXA 1J90A 1NFFA 2VI5A 1O5OA 2R8PA 1O57A 4PM4A 3B85A 2AK2A 4EHAA 4R68A 4XUDA 3ZGNA 2PYZA 1M2GA 2BKXA 5HDQA 4LFCB 3EVDA 1CUZA 3GJZA 3RQSA 4Z3DA 1JILA 2X76A 4BRZA 1UBJS 4HT3B 1NXQA 4O2RA 4Y9RA 2HU5A 3GJXC 2G6BA 1BIFA 2RGNC 3ED5A 4GQIA 4H59A 5JT1A 3AFIA 3DL7A 3ECCA 3FMPB 3GT7A 4JLJA 2OXIA 3K0AB 4B9AA 1CE8B 2AOUB 2D7DA 4U63A 5GAJA 2NMVA 1FQJA 5AVWA 1PJBA 1KSGA 3TB6A 3PTLA 4AZ3A 3ZX5A 3ZHTA 2O2IA 3BCUA 1YVPA 5HP4A 1DJPA 4F9TA 5LUBA 3H99A 3PRJA 2ZRMA 3D4PA 5K3DA 1N2CE 2BAGA 1QIEA 4LZLA 4PVCA 3R3JA 3CIFA 1QZXA 1U5BB 5ED0A 1ZLXA 4DB2A 5IYZA 2CFSA 4XJTA 2PVPA 4R7GA 2E0IA 2C4MA 2V3WA 3W5DA 4JJZA 3DJFA 1RXCA 3C3CA 3AM5A 3V8VA 5I7RA 3GLIB 4AROA 3A25A 1FY2A 1Z63A 4ZO8A 3UANA 1GZDA 1XJ0A 1XQ6A 4EO9A 4PHHA 5GV7A 3BGDA 3HCEA 2AJ8A 1LPAB 1ZW1A 3R2JA 1E3EA 3FOZA 2HM7A 2PX2A 4F2GA 4YUZA 2R4QA 5ALZA 5TDHA 3HCBA 1T6NA 2IEYA 5FH9A 1NV8A 1O95C 4YMGA 4JX9A 4RFSB 4CF5A 1ISMA 3GF4A 4RPHA 3TRHA 4DEVA 4CMJA 1U3GA 2MYNA 2LP4Y 1ZD1A 2WA2A 3T4EA 3EFBA 1I3CA 3MD0A 4R6XA 3OQNA 4GBGA 4N5IX 3EISA 5JZBA 3U61B 3CVXA 3CUWA 4MP3A 1C7QA 4JMPA 3FCXA 4KFTA 2JZOA 2GN8A 4RVSA 1OI2A 4JT8A 1GN9A 1RKBA 5AKKA 1MDBA 1Q1QA 5CIYA 5A9SA 2I03A 4UTRA 4OMFG 2HRZA 1JEQA 3CA8A 4KNWA 4TL8A 4TS1A 3KKPA 3NJRA 2V0CA 4TYYA 2AZDA 2EATA 2ECKA 4KAXA 4UHKA 1G4HA 3DDUA 4EQ6B 2VZ0A 3TFOA 1P1KA 4CT0A 1A95A 3ZIUA 3FMIA 2I2DA 4GF5A 2V7UA 1KAGA 1Y6JA 1JLSA 5JQGB 1C41A 4HD8A 4U7TB 5EHGA 4IJUA 1E2IA 4AWAA 3TW8A 2GZDA 2BH9A 5AI5A 1IZZA 1P1JA 2NZXA 2VHQA 3DHYA 5BWCA 3UAXA 4K87A 2VDUE 4EH1A 2EX0A 3OD1A 2WWTA 2BKLA 4YJFB 1D0VA 1T3ZA 3PV0A 1FPMA 1UJBA 3EPJA 4G5SA 5HTOA 4EY8A 3GNTA 1P18A 1U8EA 1HKHA 4CEJB 5F9HA 3OFND 1KARA 4X1KA 3OPYB 5G41A 3PITA 1IHUA 2XQJA 1OOEA 1IJBA 1U3FA 3EG5A 3RK0A 3WXBA 8LDHA 4IP0A 1VC2A 3LW7A 3ZPXA 3HA2A 1C3EA 3MOGA 4JUIA 4WNYA 3W4KA 5HUJA 5JXHA 3IXMA 3OPMA 4DCPA 2XDQA 1AB5A 1TZ2A 1Q19A 2QOEA 4FIDA 4B44A 4ECEA 1U5BA 1R00A 1YS2X 4QO8A 3ZLJA 1CV2A 2QT1A 3F2VA 3L8DA 5I7SA 2P5UA 3MHPA 4D56A 4FFDA 1X1SA 2DULA 3X1XA 2PYDA 1AT1A 4RE5A 2WJWA 3DQZA 5THKA 4N40A 4GE0A 1N9GB 4IICA 3K5HA 1GU0A 2PKQP 2Q4DA 3TGWA 1PJSA 1BRTA 1QAQA 4QO7A 4TXJA 4C0AC 2C07A 1W8IA 3GNSA 4PGGA 3AJ8A 3G2JA 3ESQA 5FQOA 5A03A 5LFAA 2UZAA 1MEEA 3CWCA 4UVHA 1HYBA 1E7MA 4ENQA 3BA1A 4L8GA 4TVBA 1N6IA 3BGSA 1G63A 2WAMA 2WZDA 3A0UA 3CKKA 5BQOA 4CKWB 4YQFA 4W5HA 2Y6VA 4ZI2A 2CXPA 1ZCBA 3BB4A 4QDZA 2WMDA 1C29B 3DZ8A 3IUJA 4PINA 1P74A 1QHSA 1ZL2A 1XWWA 4X84A 1ZL0A 1Q7BA 3DGEC 4ESEA 3RJ5A 1UKEA 3CLVA 4MVWA 2MSLA 2YHSA 4R84A 3UK7A 4JJFA 3AVOA 2QLNA 4MKRA 4ZJZA 1K3FA 1DKQA 2PSSA 1FW8A 4U0KA 3SJBA 4P0PB 3RYTC 4PLZA 3ZZ0A 4UHBA 4BLUA 1G1AA 3IMCA 1I2AA 5D1HA 1Y1RA 4KH0A 4Y1RA 1UADA 1SKMA 3OZFA 1G21A 1H3NA 2OBFA 3CO0S 2RGYA 3DVAB 1NNUA 2I4RA 5AW3A 1F0YA 4CI0B 2HCBA 3TJMA 1EUZA 5EE9A 3M3PA 3UW1A 1APBA 4HY3A 1PNQA 4MWSA 4UE6A 4CFSA 1YB7A 2EQ5A 4ND8A 4M38A 2BFCB 1DWUA 5BV7A 1YL7A 4C2TA 2W58A 2ZSUA 4YRIA 1S7CA 4FYVA 5FPSA 1TVKA 2ZJ7A 3EQ7A 5JQWA 1KO1A 1RHRA 2WUFA 5AW7A 1YR1A 4NENA 4TRRA 3CWZA 5FI1B 4H35A 1WBDA 2Z98A 2OZPA 4QGSA 4XFKA 5IDVA 1A2OA 5AT1A 2EDCA 3NYWA 3P2OA 3WGHA 5M5BA 2C29D 2I4IA 2JAOA 2NUPA 3OEED 3EEFA 1X7YA 3KD2A 1VCNA 4X62B 1NBIA 2ZT8A 4RHEA 2BL4A 1YZHA 4Q6WA 5WRFA 4KNYA 4C2UA 5F12A 2AQHA 2QVBA 3QYAA 4ZO4A 3HI6A 2Z2KA 1BZYA 1TYCA 2YMLA 3CZ4A 4NV1A 3E2MA 4NCAA 3HPQA 3NVDA 4K3UA 3MW8A 4U4AA 2XUFA 1TO2E 3IIIA 4ETWA 3P0FA 1LNSA 4TSKA 4J0IA 2WABA 2X2PA 3M6LA 3W2GA 4OHOA 4QG7A 2XDAA 1MKYA 5LLSA 2JATA 2ZU6A 3P97A 4KRXA 5JLAA 3FOWA 4EYGA 5B4UA 4NS1A 5ENDA 4IXNA 3IA2A 4L4XA 2D1TA 3D0OA 3VNVA 3UGKA 4RANA 4E2WA 3Q7PA 4CZ2A 1KEZA 1IN6A 4UNIA 5E95A 3THYA 2YV5A 3JQRA 4XGIA 4Q19A 3ZZMA 4DMMA 1DL5A 3ZCSA 1GRCA 4EW1A 2HJ9A 3PX3A 4KOEC 1UANA 4KQWA 4BZQA 1X7XB 3AC0A 3TRFA 3F90A 3PUVA 2IXGA 4FYYA 1T9KA 5EIHA 1CY7A 3I92A 1HQYE 3HCCA 5HW0A 1QGED 1ECBA 2EX4A 4E12A 1S3GA 1XUOA 2Q5HA 2X5OA 3GUCA 4HH3C 4MVJF 5CT9A 2NQTA 2WKPA 3BD8A 5K3OA 5GADl 1FVHA 2RMKA 3NBXX 1J22A 1U5AA 1UFVA 4KZPA 3ESYA 3U3KA 3ZJ5A 2AG1A 3BMCB 4QPZA 2YFKA 1AF7A 1NZDA 5HCUA 1KU0A 2WOOA 3D6AA 4PWYA 2O20A 4ID9A 1K6MA 2H29A 3AY0A 1YGPA 2PU7A 2PRJA 4JI2B 1NYLA 2B1GA 4HDMA 2F3QA 4DSAA 2PH5A 2P9GA 3IBYA 1O03A 3SNHA 3OLZA 5K9ZA 4TL9A 3L8FA 3OU7A 4BMOB 4X45A 4MCAA 2FK8A 4XEUA 2B5WA 1WMDA 2XVZA 1MOPA 1EDBA 5LQRA 4D26A 1BG6A 3OECA 4FMCB 3Q3CA 5LP6F 4WCFB 2AD5A 4YO8A 3OUZA 4J16A 3O8BA 5EI5A 3HH8A 1N4AA 3L9XA 3VGJA 3KJQA 4FWTA 1BMQA 1G8HA 5L6MB 1QPZA 2DXIA 1KAHA 3PLAE 1MBZA 1NBMD 2PZGA 4OHZA 4TV8F 1PK9A 1XZJA 4FS3A 3KQQA 4IHJF 1FX0A 1ISJA 4N5MA 5TQ0B 5K8CA 1BVYF 1M1NA 3ADCA 1DU4A 2GCIA 1D6JA 3ZVNA 4CNQA 4FXPA 2FG6C 1SCBA 3GVCA 3MFQA 4YS6A 4DPLA 4FM9A 1U11A 1LI5A 2J3HA 1P39A 1TZKA 3UAZA 3WB1A 1E79A 4G5XA 4OSOA 4YCJA 4EP1A 3O1HB 4O4LA 5IM4A 1EESA 2WM2A 2ZAOA 4F2WA 2FZ5A 2ATEA 4K6FA 3PGKA 4F6LA 2AZMA 1DRWA 4IPTA 2C31A 2IKSA 4NZMA 1PR4A 1XBTA 5THQA 3T7RA 2WKSA 3AVYA 1O4VA 3K9WA 4B87A 1GL9B 4NPCA 1DI0A 4B3FX 3DHWC 3AEQA 4PN7A 4CGZA 3AESB 4BGEA 5F5XA 3K15A 1H1DA 3PI7A 5FA6A 4EMUA 5HKAA 4CCAA 3AEXA 1I01A 2G0TA 4KXUA 1M76A 5BN3A 5BSVA 2CMDA 4ZDKA 1DSSG 4JVOA 4BGIA 1U9JA 1UPFA 4JC0A 5HF8A 3BFXA 3C41J 4LJYA 4A8JB 1Z73A 1JE1A 1TCVA 2X6TA 3B2QA 4F06A 2ZREA 2HXSA 1G8SA 1H4QA 2AMVA 1MW9X 2IDMA 4IKEA 4UOZA 3JVEA 3SHVA 3T3HA 2V3VA 3CPEA 2Z30A 4JELA 5K3FB 2RK3A 4DR6B 1TF7A 2WU8A 2ZI6A 4IRXA 4W6ZA 3BMOB 4CQMD 4D7AA 3LHKA 2OE2A 3SF8A 2JLCA 1TTQB 2IXBA 4WD3A 1J2EA 4C4ZA 1L9XA 2Z8YA 4X41A 2PJDA 1CZKA 5JHGB 1K2VN 1X38A 2IYAA 3GT4A 1ZA2A 8OHMA 2A9OA 2VT2A 1VHLA 2GJ4A 3ORHA 5BR7A 1RXUA 4MGZR 4UD6A 1XO1A 1MCZA 1JBEA 5JFOA 3NM5A 5BQPA 2PUTA 4BBJA 3NBZC 2EEPA 4LZWA 4O5AA 3AOEC 1G4AE 3T1QA 1WHTB 3GEEA 2QJFA 4OXYA 1EI9A 1RKXA 4ZVKA 5C4IA 4A6PA 4EX7A 4HQKA 2OMEA 4BX0A 2G04A 1NYRA 3ZEIA 3EGWA 3S2IA 2PMFA 3CF2A 1RXEA 3WYFA 1UDBA 2V7VA 3NTLA 4EATA 1UFQA 1QOZA 1GQ2A 3R0XA 1EFPB 3T7AA 3UJCA 4LX8A 1C9NA 2QN3A 2B1RA 4C7MA 5BUQA 1RBQA 3GLFE 3GUZA 5KYXA 3SQXA 1V96A 1XCOA 1Y3DE 2OR3A 4KWCA 4WLOA 1XJCA 1E1YA 2ZRBA 1WLYA 4OIMA 4DKXA 2IRWA 3CNNA 2I2AA 3TI7A 4BO4A 2XIJA 3QXXA 2AG0A 5KYXB 1X8KA 3KE9A 3O7MA 4U2KA 3I62A 3NRJA 3TTSA 4O3FA 2LCFA 5H80A 4CBVA 1XQ9A 1FDUA 4URYR 4Z6KA 3L43A 1MIOB 5IBCA 3R9KA 1T4GA 3HUUA 4H7HA 1XZBA 1VKZA 5DB4A 4DV0B 3BK7A 1YOBA 2QJTA 2PZFA 1RDFA 3NWJA 2BM9A 5ELLA 3HB9A 3O73A 4EHLA 5CK4A 3JYQA 1BE8A 3DL4A 3DPUA 1G8FA 4MRNA 4AMVA 5D5PA 2W6PA 1QRSA 5HQTA 3SDBA 5JSFA 2LTAA 1UK7A 5D86A 1F4VA 1WEKA 4YAOA 1W49A 2BEJA 3UBMA 3VH3A 5LQAA 2ZAMA 4P4SB 1RBZA 1P91A 5KWVA 2ZGVA 3TEMA 1EK1A 1V1MA 3LC7O 1LJ8A 3HWWA 3I9LA 3PC7A 4RPIA 4RPKA 3TLCA 1DTWA 3KBBA 5J4VA 3OLWA 4LX0A 1KZYC 2ENWA 2ZIXB 1YDHA 4DWJA 1GA6A 1Z9BA 2E5LB 3M33A 1FP4B 3G17A 4D6XA 3UO8B 1H5NA 1U9ZA 4IXMA 3FETA 1OXBB 4Y1RB 1UOPA 4QUJA 4EHBA 4QTZA 2LCQA 3VOBA 4BS9A 1HDGO 4P4NA 5KB3A 1BW9A 1WUYA 3ZQ4A 3ZHRA 3PIDA 1H6BA 5A4KA 5JH7B 2JLSA 3VJMA 1JE0A 1MNQA 1QS0A 4YHBA 1FCJA 5JC8A 1YCDA 1LNZA 1UZLA 1FQKA 2ATVA 2PV7A 1X87A 2IDZA 3LK7A 4KAJA 5LYYA 5BMVB 1DKLA 5F76A 3Q8KA 2AZXA 2Q7OE 4CM4B 1INLA 1RYYA 2QUKA 2UDPA 2ZYSA 2ZTLA 1AHHA 1YUBA 3HP4A 2F2TA 1UMBA 4O25A 1ZXLA 4CKCB 3KD3A 3VC1A 1QNFA 4BIIA 3KOOA 4DEXA 5CB4F 2MSDB 1FFHA 3LHFA 4MVJA 4N3NA 2PUVA 4WN9B 1E94E 1Z4QA 2HXYA 4RSMA 2O8FB 3K53A 4FLFA 5EP3A 4EY4A 3U56A 2X9QA 1T24A 1PZGA 3LA6A 2FFQA 1HDCA 2HF8A 3GGGA 2Q4EA 2Y1KA 2WSBA 4ZXFA 1XJQA 1N7GA 3VZDA 1P9NA 2Z5LA 1MB9A 2QRGA 4AWXA 1S2MA 4DN6A 2I6FA 4OI1A 2FKAA 2YQ4A 3HJFA 2F1HA 2D00A 1C4XA 2Y1WA 5AOBA 1FRNA 4EJFA 1ZRHA 1ECLA 4JT4A 4PAQA 1KGSA 1PW5A 2CSXA 4X1IA 1W2WB 3LT0A 1GSHA 4L5CA 5FPHA 3UVEA 5BYAA 1CS4C 1NI5A 2ZQYA 2H4FA 4YDSA 3WGZA 5IS2A 2V6GA 2VTBA 3I2HA 3AHFA 4RL4A 3UYLA 5JWHA 4N1AA 2B61A 4PZYA 2AF3C 2CUTA 4ZCQA 1JHOA 1ZFNA 4IXTA 2R8BA 4C7OA 2RSLA 1BW9B 1G9TA 4DYDA 3QLTA 4NOMA 1C9DB 1V8BA 3UUFA 2GF2A 1HGXA 3MIIA 2IE0A 2JGNA 1EE2A 3BFKA 5E6SB 1IBKB 1ZM2A 1ZG3A 2FZ4A 2CVFA 3NIFB 3QLVC 3SFTA 4D4GA 5K4GA 5KSWB 2XXAB 3KKMA 2J3EA 2ZUTA 1ZKMA 3OZBA 4LGYA 3DMGA 3RAPR 2ZIVB 4Y6PA 4DM7A 3MNFA 4Z7OB 4AQYB 4G4JA 4TLLB 3WMWA 3SHWA 1E5DA 1Z0AA 3RF6A 1KE1A 1OFIA 1BJKA 2D1SA 3EEOA 1YTLA 4MAAA 2WTNA 4JGGA 4NFSA 2FVYA 4X8HA 1S8NA 2OMKA 4RTKA 2OK7A 4E3WA 5JZVA 4U5XA 2N1BA 2DSNA 3DOEA 2VP4A 4WXRA 2NO4A 1KI7A 5FNZA 1TVMA 2BMDA 2O2EA 1RBMA 3A4TA 3LSYA 2EP7A 3VYTB 4GICA 1W59A 1CUXA 3JARA 3L6EA 4GPIB 4N54A 3UJ3X 2O0MA 2P27A 1P2GA 4KSCA 4PHFA 4P9NA 1PF7E 2J9FB 1SR8A 1JLLB 3R0JA 4GLJA 2WHYA 3IVRA 1XNHA 2XAAA 5I7UA 3OZRA 4QZVA 3EIHA 1Y9DA 1SA0B 4MQMA 4BWGA 4FZ5A 3UAWA 5JQGF 1DEOA 5KPJA 3BWVA 3UXYA 1BOFA 1UBHS 2VXYA 3E9EA 2QS9A 1C30A 3LPNA 4I36A 4E11A 4F56A 1PGNA 1Y8QA 2P2NA 3VKGA 3C7AA 1RHKA 2Z8ZA 3L01A 3JVUA 2C9BA 4UCWA 4M46A 4L5JA 3GLHB 1KRWA 3WMFA 4ITUA 1L5ZA 5A3JA 3ANXA 4NBSA 3EQ6A 5E1OA 1UBEA 5LQNA 5BUZA 1I80A 2Y9YA 1OUMA 1GQSA 3RVSA 3LUHA 3ZU4A 1T3HA 1Q1NA 5IZ4A 1DC4A 1SH7A 1T9CA 2C9DA 3E7FA 2BTQA 4TWZA 1J06A 2NXJA 1COWA 1JGTA 3CBQA 4BB9A 5AVQA 5TGDA 2WVHA 4J6EA 1I4TD 1B00A 1MORA 3MT0A 4IFIA 4DABA 2IEGA 4LF8B 1K6JA 2AQKA 3GMSA 3WL8A 1J5XA 5DVZA 1QK3A 4GEGA 4NCBA 1ORVA 5KINB 3O8LA 3C6BA 5EYPB 2BMWA 2ZYHA 3IPYA 1ZCJA 1KEEA 4I6GA 3IURA 2Z6AA 4UAUA 4XI9A 4DSNA 4NZPA 1FRZA 4FSDA 4L27A 4W6QA 4RDIA 4UCXA 2JH3A 3Q4GA 4RHXA 4WK4B 5KYGA 3JW8A 3NOOA 4J0FA 1KBZA 2J5QA 5KI6A 3U4CA 3AUAA 1Z2CA 2IU0A 5DM4A 3QA9A 3WGVA 5E6RB 2J0VA 5DOVA 1MV8A 3W2TA 1JAHA 1Z7WA 5JLJA 1IFXA 4LHVA 1EJ6A 3BQNB 1YK0A 3ZY6A 1SU4A 1XEWY 1TK3A 2OL4A 1HE2A 4FFOA 3WL7A 1NPDA 3RYCB 1PL7A 1Q20A 1VMAA 4UNPA 5GONB 1IIRA 1MXFA 2B4YA 2M2IA 3FVWA 3KKKA 4G8BA 4DR1B 3PK0A 1AOXA 2YXPX 4CIBA 1F2DA 1PT9A 1XDGA 1T0BA 3B1YA 2JFBA 3QG5A 5EWMA 1KO7A 4BJHB 4Y2QA 3V1KA 2AFVA 3CVYA 5JMOA 4EITA 2BZGA 4GYYA 4C89A 3K6RA 4TYWA 4K9SA 4QJ5A 5F2OA 4FT4A 4DDHA 2ZITA 2IOHA 1M34E 2LBPA 4J7XA 4D9JA 2DTEA 2RK6A 3RT7A 3T1OA 1XQYA 2IL1A 2UU9B 1U4NA 4OGFA 3VNQA 3U3XA 2OG1A 2DGDA 2N47A 3AETB 4RKYA 2CDCA 3W8EA 3TKYA 4PZLA 2OO3A 1KO4A 1XLTA 4PPGA 1WW2A 5JDIA 2YWFA 3PE3A 1TUIA 4JUCA 1XSEA 4CDRA 1KEWA 4ZQFA 3CH7A 4W9NC 1TXGA 3ZDEA 4K2HA 4D4JA 2AZ4A 1X1CA 3NWEA 2OCPA 1CHNA 1PJ8A 3C6XA 3M1AA 3I8OA 2HBRA 3F6CA 3F46A 1GDHA 1F20A 4IQFA 4NCIA 4ODIA 4QU8A 1A8IA 4B71A 4QELA 1I4WA 1JLHA 1QF9A 4FC7A 1M6EX 3KUCA 3L1VA 3ZY3A 3KHTA 1V5GA 4QEDA 4RADA 3ZC3A 1D0SA 1AF4A 2HQOA 1I8TA 4Z8YA 1XRNA 1V1MB 1YQQA 3HB7A 4BLOA 5CLHA 1R0KA 1Z7GA 4Y18A 5EN4A 5K0GA 1M6NA 4E32A 4OYLA 1ZC3A 4MV7A 3I1IA 2GAOA 2J8ZA 3OZCA 4PG7A 3VHRA 1PRYA 3A3OA 3I5MA 2XNDD 1N33B 1O1YA 4O5OA 2EXXA 2VHVA 1G2QA 4AN1A 3BXGA 3GRKA 3GROA 3TQIA 1PWEA 2ZRDA 4AXBA 2H2IA 4TMFA 2VA8A 3TZ6A 4CKEA 3TW0A 1ODIA 2G1JA 2Z4TA 2A0UA 2PSHA 2QRPA 1M7HA 2WM9B 4Q7KA 3WLAA 3RHFA 3ZOKA 6AT1A 1GXSA 1LDNA 4UBNA 3RFCA 8ADHA 1U2QA 2NN3C 4R8KA 1LY1A 4ZAWA 3PC4A 2QP9X 4LZJA 5A62A 2X0EA 1KIFA 2JFNA 3LCRA 2FX5A 1LF0A 2B9VA 2I22A 2YUTA 5K3AA 5EIEA 1T6XA 4E1AA 3T9FA 3VH1A 1XZGA 2VCEA 3EGOA 3S2ZA 1UBTS 2DVMA 4KPGA 2J33A 1XEAA 1ZUIA 2OBNA 3EXIB 3R7DA 4DNPA 1S4QA 1V3UA 2QYSA 4PNHA 4NOKA 4ZPJA 1XCMA 4HX2A 2HDNB 2NO0A 3L0SA 4LTMA 5IJAA 4OGKA 1J7JA 1TYZA 1MB0A 2JB9A 4HLNA 2BGLA 1IDOA 1IDN1 3W9YA 2IY9A 5ALNA 3SYKA 3X1DA 3ZS9A 1SO8A 3FR7A 2AJCA 3LQ4A 3OY7A 4M9ZA 1UEXC 4RLSA 3RADC 1HFEL 2A9QA 1YCHA 4BN4A 5JISA 2WM3A 3NZEA 5IC6A 1O9BA 1PJ2A 1Z08A 1B2RA 3O9ZA 1X80A 5EXEA 2NOAA 1E6WA 3T5TA 4IR7A 4JA0A 3Q1KA 2HIHA 1F4LA 4K26A 4KQCA 4OREX 4WKNA 3IP3A 3UMGA 4CLXA 1EUDA 3MUOA 1C3XA 2BF4A 2ORVA 5L95A 2BEWB 4L02A 2AFIB 2Y4OA 4FE4A 4O4IA 1IZYA 3PHBE 4REOA 1M8GA 3V2HA 2F48A 3WVNA 2VK2A 4U3JA 1E2PA 2ANBA 2C5SA 2GRUA 1ZM3A 3FBTA 1RAAA 3L7CA 2IPMA 2BHSA 3MLAA 1SUAA 5JCXA 3H5IA 4MJ3A 1MHTA 4KFCA 4DA7A 4JI8B 5CCXA 3HVJA 3VVLA 1SXJC 4EPRA 3LWZA 3OO0A 4UUQA 4XSVA 1RMQA 2GZ2A 4JB3A 4IL5A 3R75A 3IQGX 2YHUA 3K20A 1EA7A 1E1QD 1A50B 1DT5A 3FVTA 1EFKA 2D2FA 3LW8A 5A7HA 1ZRSA 3R4CA 4CLOA 1R0CA 1ZLYA 3RRYA 5IRCD 4X65B 3QBDA 4QE3A 4R9UC 4GXRA 1MQ9A 1W0KD 4WNCA 3OEEA 3RC9A 3QYPA 1JA9A 1L5FA 2OENG 3DE6X 5G3YA 5BRJA 5HZMA 3R4VA 1BTOA 2VQDA 3O8RA 4PO8A 3L4EA 5DM0A 1WXDA 3S1AA 4QUEA 2A5LA 3FLEA 4NFYA 7AT1A 1SU7A 1ZH8A 4M0FA 2YZMA 1PN3A 2Z2YA 3N6VA 3T1NA 1T5BA 1ZMOA 4KDCA 1RADA 3WLNA 1ENOA 2EWWA 3D7MA 3DZHA 1ID1A 2FYTA 3F5MA 4F72A 1FTSA 3IUSA 2EGGA 2DTXA 4XJSA 3IQIX 3PQ8A 1KI6A 1DAMA 1CWUA 4GIBA 1G8AA 3HDYA 4NQRA 1UWLA 4EBBA 3PEUA 4V03A 3V1TC 2YBDA 3NKFA 4G5FA 1FNNA 1Q1GA 1XZPA 3HJAA 2I91A 3FMVA 1JZTA 1H2BA 5DWDA 3GDFA 4YX9A 3M7IA 5HKBA 2MWMA 4PE5B 5C81A 4NJEA 2WFZA 2O6LA 3A06A 3MS2A 2AFRA 4RS4A 1VL0A 1YIOA 2YYYA 4DJTA 4GP6A 2QW1A 4XM2A 3HB1A 4HEJA 4H3KB 2X15A 2JLRA 3PE4A 1RABA 2ZRHA 3TINA 4PN3A 5A4IS 2HSGA 1PK7A 3SKYA 2VJCA 2QN7A 1DCMA 4GWGA 3IUBA 2CLIB 1SC9A 3I34X 2H6EA 4XIGS 4G0WA 4N8DA 5EIAA 2FW7A 1QIJA 2PS9A 4ICIA 4LZNA 4DDMA 2ECQA 3WGLA 2JD2A 1JSXA 1XDUA 1C8BA 1E9VA 1JKJA 2HI0A 3IPCA 4HEA6 3U3OA 2X40A 2AX4A 4DNFA 3DCIA 5EEGA 1LC0A 2JGRA 3LBHA 3COSA 1RI1A 5DWQA 3UHPA 4U3JB 1G8KA 3GO4A 4U8GA 2XRZA 5LKAA 2W6QA 4QODA 4PX3A 5TLSA 5C34B 3TNYA 4X97A 1Q1BA 3LUCA 3GBVA 4YI5A 2P3LA 4EB6A 1OILA 3EASA 1ZAYA 1J49A 4IO0A 2WP8J 4WBXC 1TA0A 3DE0X 3I04M 4MW1A 2GTPA 3L6CA 5DASA 1ATIA 2WI8A 1JR3A 3PE6A 4XRGA 1X1AA 2ZM6B 3K92A 3SVLA 1XNQB 1WXXA 4ND1A 4AZSA 4FNOA 1SXGA 1KEEB 2C4VA 4H17A 4NWIA 5E7IA 1LBQA 3H5AA 4MKIA 1NSYA 1A27A 2V54A 4B8YA 4ZVSA 2RH4A 1Z5NA 2X8BA 3B5IA 1TRKA 4WK0B 1BJRE 3DNFA 3ROQA 3B36A 1OMOA 4QA9A 5DHTA 4A2PA 4C01A 4U2CA 4AYTA 3DZDA 3WV4A 1U7TA 1IUOA 1PBNA 4IDAA 4YCCA 1N2SA 2X7XA 4RD1A 1P9WA 4C0SA 2G0AA 3CZRA 3NGMA 2JAUA 1QE5A 3EGEA 4GR9A 4LMBA 1MVNA 3BUSA 1JG3A 4MB2A 3ZGVA 2HWXA 3TR5A 1CB7A 5K0CA 3LBNA 2H0AA 4WY2A 2ZBEA 3GP8A 1C3LA 3IPLA 3C4JA 1YD7A 3VVBA 4Y2SA 1FRVA 5AI9A 2I1QA 1XZKA 2D8MA 1SPBS 4MR8B 1GPDG 3S4YA 1E96A 3S1SA 3EMVA 2WJ4A 3MTQA 3X1MA 5BNTA 1BWQA 3KPVA 4FU0A 1ULBA 3E82A 3QJGA 4Z9YA 3WBKA 1WSBA 5DTRA 4AP5A 4DSOA 4ARZA 1CVLA 3RRXA 1NWCA 5D3KA 3L7BA 3CHYA 4L74A 4LJKA 3DFZA 2QM7A 4QFCA 5EJMA 5AWFC 1CHDA 1AQJA 2YS7A 3BSSA 1K98A 2ZWMA 1YQGA 2PAFA 2O7SA 2HL6A 3H8WA 1Z4MA 1AVTA 1KYTA 3EIOA 4ZFNA 3GDGA 1PJRA 5K0JA 3PSAA 4J0QA 1YBHA 3A3NA 4HZUB 3B3JA 4G4GA 1UQTA 4EOGA 4M7RA 1EVLA 3TSAA 1Z0KA 1NRJB 2A3NA 2JH8A 3NEAA 4YR9A 5LWHA 2UZ0A 3W5HA 4ZZ3A 5CEEA 2AFHE 4ETMA 1GPLA 3B2NA 3RC1A 2GJ8A 4IJ5A 4HQFA 4P33A 3C45A 3UK1A 4OV6B 1QJ4A 1XTKA 4G84A 3DBLB 1N36B 1EP3B 3PGJA 4GOOD 3IEUA 4JXKA 1NJFA 5E7JA 3IO3A 3J7TA 1HE8B 2EQBA 4HXYA 2WQ7A 4X20A 2HHCA 1JFFB 3Q15C 4FSHA 2J6CA 2DG2A 1YIDA 5FV4A 5DCUA 2H9IA 4H77A 1L7OA 1DJOA 2FNAA 3CZ5A 1WTCA 4MQFA 4NBRA 4WZAB 4TKUA 521PA 1GZ3A 5IAGA 2EFDB 5J9FA 3RRZA 1Z34A