4PZNA

Crystal structure of phc3 sam l971e
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPAEKICARINSLKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 3
total genus 24
structure length 70
sequence length 70
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pznA00
1V38A 2EAPA 5JTIA 1COKA 2JV3A 5L1MA 1V85A 4IS7A 3K1RB 2KMDA 4RQMA 2QARB 1UCVA 3TADA 2QB0B 1LKYB 2EAMA 1F0MA 2YTUA 3SENA 1PK1A 2ESEA 2K4PA 2QKQA 2QB1A 5KNIA 2KE7A 5F3XB 1X66A 2DKXA 3BS5B 2B6GA 4PZNA 2E8OA 2EAOA 2F3NA 2LMRA 3BQ7A 2D3DA 2EANA 3KKAA 3BS7A 3TADC 1LKYA 4RQNA 1Z1VA 2DL0A 1KW4A 1SXDA 1WWVA 5JU5A 1SXEA 2DKZA 2K60A 2ES6A 4PZOA 1JI7A 4NL9A 2KG5A 2FE9A 2L5YA 2F44A 4NJ8A 1SV4A 3IDWA 2KIVA 2F8KA 1DXSA 4MHVA 2KSOA 1OW5A 1B0XA 2Y9TA 1RG6A 3H8MA 1B4FA 1SGGA 2E8NA 2GLEA 1X9XA 2Y9UA 3SEIA 1PK1B 2E8MA 2LPEA 3TACB 1SV0A 1X40A 1SV0C 3BS5A 2D8CA 5J8YA 4NL9C 1PK3A 1WWUA 3HILA 2QARA 1OXJA 2KSOB 5JRTA 1UQVA 5J8YC 2E8PA 3KKAC 2QB0A
chains in the Genus database with same CATH superfamily
3NRZA 3OGUA 2EAPA 3AU2A 2FMSA 4CDGA 4UQGA 1D8BA 1JMSA 1XWLA 3MGIA 1J2MA 3N7RC 4UBBA 4TUQA 2JEFA 4ELVA 1U48A 4Q44A 3QUBA 1BNOA 4DOAA 3KHGA 4GC6A 3KZIU 1SL1A 1RQLA 1ZETA 4J9PA 4I2BA 5J0QA 5ALRA 1TAMA 3D6JA 3NRWA 4IRKA 2LYBA 5DG9A 4R65A 1NKCA 4BUGA 5KT5A 3HKZC 2EAOA 2NRTA 3RF9A 3PNCA 2BCUA 2ZIUA 4O3OA 4F4YA 1LB2B 4RQNA 4AYBF 2ZIXA 2HW3A 2UVVA 4YP3A 2E5SA 2KK0A 4FO6A 4J9RA 5ALXA 3ZDAA 5ALSA 2V4QA 5B5EU 4C4SA 3PW7A 2HCFA 4IQUA 3UM9A 4EZ6A 3C2MA 4R66A 3G6XA 5AKEA 3I76A 1L7PA 1C20A 4PHAA 4P0PA 1UT8A 3QU7A 4DS5A 3T5KA 4DFDA 1NJYA 4MFAA 2XY5A 2GLEA 4P4MA 3GFKB 3MR3A 2YX8A 1KL9A 1ZD4A 3OTQA 2IHNA 1TFRA 2MUTB 5A0LA 3FM9A 1S0NA 5AM4A 3RAQA 8ICKA 9ICOA 3Q8LA 2QARA 1KQQA 2W3SA 3Q8QB 1K5OA 1BNPA 4QZHA 3T3FA 4KLLA 5KFUA 3ZDEA 5JTIA 1V97A 8ICOA 3WU2U 3NVZA 1BPYA 1U45A 3AEVA 5J2BA 1QLNA 1RXWA 2AJQA 4EX6A 1IV8A 4USAA 2Y1IA 4PL1A 3SMVA 5KL8B 1QQ7A 4ED0A 4A8EA 3J81j 2EAMA 3SENA 1U9LA 4RQ8A 3I1YA 5EE9A 1XSNA 2QB1A 4O3MA 1PUZA 2AQ4A 4KLDA 3E0FA 4DL7A 1S10A 2IOFK 1QTMA 1UT5A 8ICVA 4PGYA 1ED1A 1HEKA 2XC9A 1WYGA 5IIOA 5IIJA 2ASLA 4MFFA 2N1RA 2R8KA 3WK7A 5CJ7A 1L3TA 1KDHA 1ZQTA 4DO9A 5ALIA 1X6IA 4UAVA 5KG4A 4DL4A 3WKDA 5J0WA 4KLTA 4P0QA 4R8UA 2OEHA 8ICJA 1F5SA 4R63A 3BQ2A 4ECSA 5GTIU 4QIWC 2PMZC 7ICEA 4UW9A 5HHIA 1DXSA 1ZQNA 2EZZA 2FJ6A 3T5JA 9ICMA 4M9NA 1DK2A 4DL2A 2KJ8A 5KFQA 4QZ8A 5TZVA 1S0VA 4DL3A 4DFMA 2RLTA 1MA7A 2D8CA 1L7NA 5AK6A 5BOMA 3M7DA 4DQRA 4UAWA 1MC8A 4DQQA 2OHFA 2ISOA 5KFMA 3LWMA 5KFHA 3H0LB 3UPQA 5DQGA 9ICJA 3UMCA 1QH9A 3MR5A 3HWTA 3BZKA 3RR8A 4DWIA 3K1RB 4OO1J 3HT3A 3C5GA 3F53A 3TAQA 2ZG6A 1O03A 1VJ5A 3Q8PB 2PXIA 4KLQA 2WF5A 2ESEA 2EH9A 4DSEA 4Y2YA 2QKQA 4F2SA 2DWQA 3CW2C 5E79U 3H7IA 4UB4A 4I29A 5G5GA 4DSJA 5KG1A 4M6WB 2W9MA 9ICAA 2ISPA 5DLFA 2C28A 3LVWA 2DL0A 3PSIA 3AMZA 2W7OA 2MAXA 1BPEA 4QWCA 1TAQA 2YQEA 4RPYA 5KFXA 5AIBA 1B22A 9ICNA 2P6RA 1Q46A 2AGOA 3M1YA 4O3PA 4TUSA 2FE9A 2HHQA 4RPXA 4KLGA 3LDAA 2HI0A 2YMPA 4PH5A 4IRCA 4GXKA 1OW5A 2ZTDA 3WK8A 3ICXA 5AI0A 3MBYA 3IV6A 4I2FA 1NK8A 2BPFA 1KTQA 4F4WA 1NJWA 3E58A 2UVWA 7ICHA 3N7PD 5EWEA 2WTFA 4DSFA 3QZ8A 4B9VA 4F5PA 4EELA 4DLEA 2BGWA 4FFDA 5J8YC 7ICOA 4NY8A 1ZQKA 2V9WA 1V38A 3PSPA 5DDMA 3PX4A 1NKEA 5KFVA 5KAFU 2F8LA 5L1MA 1NK4A 4I2GA 5HP4A 3F2BA 7ICQA 2BQRA 1KFSA 4GLXA 1COOA 8ICYA 4Z6DA 5CEHA 4F93B 2RQ5A 5HMMA 4ECYA 9ICKA 1ZRMA 1TK8A 1PK1A 3KBBA 1Z00B 3N7SC 3H0MB 4YR2A 3IP4B 1CUKA 8ICHA 2FPKA 5F3XB 3G6YA 5J29A 2WF6A 2W8KA 2M0NA 4Y2TA 4J9QA 3RRGA 3DDHA 4JK1A 2DPJA 1ZQPA 3LYSA 1N62A 2PMZF 4FBTA 1YZ6A 9ICIA 1JRPA 5ALEA 4GFJA 3TADC 5J2FA 3C28A 5AM5A 3WKAA 1KW4A 3F5EA 1OUQA 3ETLA 2FLLA 2ES6A 1NK0A 4ECTA 4F92B 1KKXA 4QWDA 2KG5A 4XRHA 3HX0A 7ICTA 1TE2A 3DV9A 1YZ7A 1TKDA 4YXJA 3SAFA 4F5NA 2JR5A 2WAQC 1NI3A 4RQ0A 4PHEA 1ZQAA 3H8MA 3GIIA 2KEYA 1SGGA 2EDUA 1SWVA 5DG8A 4UB8U 4M04A 2XVTA 4KX3A 1SV0A 3OJSA 4US8A 3C21A 1IG6A 3C5FA 1RXVA 4NM2A 2GO7A 1N63A 2OH2A 4O5KA 5KG3A 5ALDA 3C2LA 3ALRA 4BX9C 2W04A 1ZD3A 3NGDA 2FPMA 2W9AA 1ZYQA 4QW8A 5ALPA 5J2CA 3KZXA 2G5HB 4J9OA 2JGAA 4Y2XA 4ECRA 4QZCA 3RBDA 3RH4A 1ZQGA 1NK5A 2HBKA 7ICIA 2KP7A 2QB0B 4O3QA 2A1JB 9ICVA 4KX5A 4ICAA 2FPLA 4UB6U 3RH6A 5DGAA 3H8SA 5KG2A 2W9BB 1UA0A 2ZJ8A 4DL5A 5HR7A 3AL0B 4JWNA 2F3NA 4KMOB 3KKAA 4WJ3B 4HYKA 2FMPA 3EWAA 4FZNA 3TQ1A 4Z6EA 1Z1VA 4MFCA 2ZXIA 5JU5A 3GV5B 2PI4A 2G07A 3SV3A 3NS1A 5DG7A 1QCKA 4RQ7A 3PW0A 4CF5A 1ZD2P 2VKQA 2I1QA 3N97B 2I9GA 3AU6A 2I5HA 4YQWA 5F9LA 1K1QA 4DS4A 2PFNA 3RB3A 1ZQQA 5J2KA 1AROP 5KG7A 3IG5A 2JH7A 4F71A 1ZRNA 4C80A 3MR2A 3OSNA 2VJ5A 3MGVA 4TQSA 1RM6C 2A1JA 4JWMA 2YMMA 2LPEA 4M0AA 4ED1A 4QZEA 4G3IA 1PK3A 3HILA 3OSPA 5AI4A 5KT3A 2KKVA 1CI4A 7ICSA 4NXZA 4F2RA 5BPCA 1COKA 3UXPA 1LV5A 3HKZF 4O0IA 4U7CA 2KV2A 3C2KA 3EYZA 3O0FA 4Q8FA 4B9NA 2P66A 3PZPA 1SKRA 3IN5A 2K4HA 3SAGA 4C8KA 3QU9A 3TI0A 4BXOB 4UB1A 1A0PA 4OJ6A 5ALWA 2ZIWB 2K8BB 4UAUA 4BGDA 1X66A 2HBJA 1X9SA 2W43A 1ZQRA 2ASJA 3RRHA 8ICNA 1ZXIA 2JXJA 3QUQA 5AHXA 4YXMA 1UPHA 2WB1C 3WKCA 2PFPA 4NLBA 1TK0A 9ICSA 3F2DA 2VA8A 3MFHA 1A6SA 2MUTA 8ICCA 5CP2A 4DFJA 4DQIA 3LVVA 2XY7A 2JZBB 8ICBA 2A1AA 3PW2A 5AKIA 5KFRA 3VCBA 4RUAA 4DCCA 4DOCA 4G9BA 8ICMA 1SZPA 4KMUA 1O08A 4PHPA 2LHTA 1L7MA 1RQNA 2EZXA 3M9OB 1H38A 4JV0A 2C2DA 2KTQA 2MA1A 5KFSA 5KFCA 5AI5A 3NVVA 2F1HA 3S6JA 4QZAA 2JEGA 4BXOA 4KN7A 3OJUA 3TACB 3HJEA 4BWMA 1X40A 3QU4A 4ELTA 3V7KA 4YR3A 3HP6A 1X2IA 5DQIA 1RPLA 3H4DA 1UQVA 4GC7A 4O3SA 3T5LA 3KHRA 7ICJA 1Z1BA 4DF4A 5KFZA 2RDIA 4DFKA 4EENA 1P7DA 3THVA 3V7JA 2KZZA 3AM9A 4XUSA 5KT2A 4F4ZA 3PY8A 3NASA 4Y2VA 4Z6FA 2FLNA 4F3OA 1ZQDA 4IR9A 5B66U 3B0YA 3BS5B 5D46A 3QE9Y 2YMLA 4ECXA 8ICGA 2DFLA 4MEXA 1N5WA 3TAPA 3C1ZA 4JB3A 4LZDA 2HDOA 4FE3A 2W55A 1ZQMA 1J97A 2IA6A 5C0YA 3QUCA 2DKZA 4PZOA 2C22A 3QEBZ 1FEZA 4UAZA 3H8WA 5AK3A 3GV7B 3D2SA 2AH5A 2Q4TA 1DGJA 4BDPA 5KFDA 5ALUA 2HOIA 4QWAA 5KT7A 4DF8A 4B9SA 4K4IA 3I28A 1NJZA 1ZOLA 1U47A 1PVPA 1PVQA 2F8KA 8ICQA 1X42A 1S8OA 4RNOA 1NK9A 2IHMA 2KZ3A 1BPXA 1B0XA 2J6TA 3CNHA 7ICVA 3SEIA 4KLMA 4DL6A 4CF3A 2KN7A 2KOBA 5J8YA 5DGBA 4CNQA 4UBCA 2VA2A 2KSOB 1TK5A 4DQPA 3R9KA 4UB3A 1S97A 5ALZA 8ICPA 5KFFA 1BPBA 3UQ2A 1JN3A 4UARA 1URJA 4MEYA 2FLPA 5AKXA 4LJXA 7ICGA 1QQ5A 5ALKA 4YFKA 1HUOA 4C0ZA 3FC4A 2Y1JA 2BR0A 7ICLA 2XGPA 3MABA 4FS1A 8ICZA 3SQIA 2IOFA 8ICTA 2FDRA 2KD1A 1DK3A 5J2DA 4EEYA 1X9MA 1D9DA 3RAXA 3V72A 5ALMA 1TV9A 2ATLA 5AI6A 4KITB 8ICLA 1Q3UA 1LKYA 4ZOHC 3NVWA 4Q45A 2VANA 5DQHA 4P0PB 3GILA 3BDPA 1SXEA 4RQ4A 2K60A 3RFAA 1IXRA 1JI7A 3KD3A 3GIKA 2K8AA 4FZLA 4M6WA 2KIWA 1XS9D 1SB3C 3FDSA 2O6KA 3NVYA 3K4GA 1X6JA 3BQ0A 1S0MA 1RYRA 3QZ7A 2MSNA 2KJ5A 1S5LU 4JV1A 4FZMA 4XQ8A 4C7ZA 1T3QA 3QNMA 2HHSA 4CE6A 3UXNA 1B4FA 4ED6A 1KFDA 1BPDA 5CA7A 5HR6A 2BPCA 2R8JA 2G0AA 5KFIA 1PK1B 3FAHA 2RRDA 2WFAA 2KVCA 3GIMA 1TAUA 4YD2A 2PI5A 4C7YA 4K4GA 1ZQYA 3KFUF 3KTQA 4I2JA 5KFOA 2HOFA 3CP8A 4Y2PA 4J9SA 3EZ5A 4B9TA 1PVRA 2YY6A 5AKZA 2W9CA 2C2RA 9ICHA 5AKHA 4M9HA 4F5OA 4RPZA 5AI8A 2KFNA 5L1IA 5ALYA 2ALZA 1QSYA 4RQMA 5EWFA 5AM3A 1N2XA 3EPGA 2F77X 4KN4A 5AI9A 3V6JA 4IC9A 3UQ0A 3CYMA 3AQEA 5J2AA 1ZQVA 2YTUA 4UB5A 2JEJA 1S76D 5CB1A 3ETRA 5HNKA 5J2EA 2YB4A 4YMOA 1L3UA 4RNMA 1DGSA 2E8OA 4LVSA 2CXYA 4U6PA 3BQTA 4YCXA 1FO4A 3OHBA 4J03A 4R8UB 4P0QB 1FIQA 1KBUA 3ED5A 7ICRA 4YG2A 3T79A 4ED2A 2AXTU 1Q3VA 2NO5A 3WK9A 2KHQA 3QXGA 2JRZA 4O9MA 3QYPA 8ICXA 1ZQCA 4RQ5A 2W3RA 1PZNA 1L3SA 1U49A 4NJ8A 5KFJA 9ICRA 4US9A 3JPNA 1NZBA 4RQ6A 1SKWA 2BCVA 4YMNA 1XO0A 2DF4B 1L8LA 3RJKA 5J2HA 4RT3A 5DBBA 3M8RA 3PW4A 2BQ3A 2Y9UA 2NRXA 4ED8A 2ZJAA 4RUCA 5J0PA 3ZDCA 1N61A 5DDYA 5H2FU 9ICPA 4RQ3A 1RZTA 3WK6A 2Y0SC 1RYSA 2KNJA 4NLNA 1RYUA 2HHWA 9ICGA 4IS7A 2RHFA 5KFGA 2WF7A 1IIPA 5L1LA 4J9LA 2PKEA 4RZRA 1D8LA 5J2GA 3TKAA 2F76X 2K4EA 2K4IA 2A19A 3D2NA 1ZQFA 3RJHA 4JV2A 4UB2A 3SYZA 9ICCA 2G08A 1KLNA 5AM1A 1L8OA 1QQ6A 5AKGA 4Q43A 2HHXA 4C4TA 2MRLA 2ZUBA 4TUPA 2M9NA 4I2EA 2KVSA 2AQ0A 1XSLA 1TVAA 1WUDA 2HVIA 3MFIA 1JALA 2BCSA 1F44A 5J0TA 2OYYA 3A0BU 2VA3A 2IBKA 1Z3EB 7ICFA 4Y2UA 3PX0A 1K1SA 4KLHA 7ICMA 5CRXA 2C2EA 3RJJA 4TURA 1SL2A 4MF8A 8ICUA 3KHHA 1L6NA 4QZIA 4FS2A 4OD0A 4IQVA 5KG0A 4J9MA 4CCHA 4MF2A 4YD1A 3Q8SB 3RBEA 9ICEA 1T3NA 4CGZA 5JUMA 4KLOA 4PHDA 2E8NA 1Z19A 1NNLA 5L9XA 3N4MB 5J2JA 3IM1A 9ICWA 4O3NA 1ZQWA 3H40A 3RH5A 2HHUA 4YMMA 4K4HA 4C4RA 3KKAC 1ZJMA 2XY6A 5KTQA 2BZFA 4NLKA 1YT3A 4UASA 1S77D 3TFRA 4F50A 1Z00A 7ICPA 2HMXA 2HHTA 4QWBA 3H0RB 2OWOA 3JPQA 1Q8KA 1V85A 4EZ9A 1KSPA 4DSLA 1JROA 1FFUA 5TISU 2QARB 3RB0A 4PL2A 2HVHA 5CHGA 4DQSA 2ZIVA 5AICA 4TQRA 1ZQZA 3PV8A 3F5AA 5KT6A 4KTQA 1XO1A 2HOQA 2W8LA 4RQ1A 4FBUA 2KE7A 5ALOA 2ZUDA 2RDJA 2WAQF 5HHHA 5KFNA 1CEZA 2EANA 1NKBA 3PMNA 1J2NA 4B9LA 5ALNA 1ECWA 4DFPA 9ICFA 4X5VA 5J2IA 1MSWD 4XA5A 4QZGA 3JPOA 8ICRA 5HMLA 2J6SA 4HAIA 2NYVA 1T4GA 4OJOA 1JIHA 3WKBA 2E1FA 3BQ1A 4I27A 1HUZA 4ECZA 1S0OA 5K4LA 4J9NA 3ZDBA 2G5IB 5KT4A 4MHVA 2LYHA 3ISBA 2LKYA 1WCNA 2ZIVB 1HJPA 3M6ZA 4RU9A 2HHVA 2DGZA 2NO4A 1ZQUA 2FMQA 9ICQA 2AU0A 3C1YA 4DSIA 1BPZA 9ICXA 4Y2QA 3HW8A 3BS5A 3C23A 4ECQA 3HPOA 4DLGA 1EXNA 1WCLA 1Y88A 5EE1A 2JHDA 1ZQOA 1GO3F 3M6KA 3RB4A 4EYIB 3IRUA 4O5CA 2QB0A 5GTHU 1VDVA 5J0SA 2IMWP 5AKJA 1ZQXA 2K89A 4J9KA 2DBYA 9ICUA 3C29A 5AK5A 2I6XA 5C5JA 1D8YA 4OJLA 4PGXA 4Y2SA 4O5EA 2R8HA 4NLGA 1N5XA 5ALTA 4DOBA 3GQCA 5DKWA 5D49A 1N48A 3SI8A 4PZNA 3WK4A 3RJGA 3HRDD 2LM4A 2FI1A 1NK6A 2OXOA 4OCZA 2YN4A 1L5UA 4Z6CA 3MR6A 1XC9A 5DBAA 1N56A 1ZQLA 4QZDA 4F4XA 2GH1A 2YMQA 3SD7A 3V7LA 2BPGA 3ONNA 5ALVA 1JXLA 7ICKA 4UAYA 2LM1A 2JMGA 3NUQA 3PX6A 2CRXA 5IINA 2KIVA 4AYBC 4EYHB 3M9NB 3JPPA 3NTUA 5AM2A 5IILA 1NZPA 2WB1F 4IR1A 5J0OA 5J0UA 3GIJA 2ZIUB 4BJQA 4EEKA 2H3FA 4NM1A 3SAHA 2ZIXB 4NL9C 3MDAA 4JUZA 2V4RA 2W03A 2E1EA 3ZI4A 4PPXA 4NLZA 4ELUA 5EOZA 3GDXA 1KRPA 2KKPA 3LK9A 3QEAZ 4O3RA 1ZQBA 2ZIWA 1XU4A 3B9JA 2PFQA 4QJFB 2RP5A 2KMDA 1V9PA 4YR0A 3TFSA 2LBOA 4Y2JA 1DOQA 2DQNB 3IG8A 2W54A 2IOHA 1F0MA 4ECUA 2UVUA 3BJYA 4GXIA 2OM6A 5KFYA 3UMBA 3PR5B 2G09A 2NV3A 3T5HA 1ZQSA 2VJ4A 4R64A 2G06A 3PW5A 1ZQHA 1WWVA 3MC1A 4DEZA 1VLBA 3FYHA 3PO4A 1XNSA 3N28A 5EWGA 4Y2RA 2KZMA 4NL9A 3B0XA 3WKEA 1NJXA 5ALHA 3EW9A 3IHQB 4IRDA 2XO7A 4I28A 2CN1A 3IDWA 3VC8A 2LYAA 4KLJA 9ICLA 1UA1A 5G5HA 3L4PA 4GXJA 2H3ZA 2ZUCA 3ORYA 3M8SA 1X9XA 3Q8RB 4IQTA 7ICUA 2ZTEA 2E8MA 4F4KA 1KFTA 1CRXA 1L3VA 3EUB2 4YVZA 3TARA 4I2HA 1MN8A 3GV8B 2BCQA 4QZBA 5L1JA 4NWIA 8ICFA 2BKEA 4IL6U 4QNLA 2LI6A 3RB6A 1ZD5A 2PFOA 2R18A 5KFPA 2NRWA 2P35A 2AGPA 4ECWA 3U26A 3RJEA 2XIDA 4F5RA 3SZ2A 3PVXA 2AGQA 4I2CA 2YB1A 5DLGA 4B6JA 2VIXA 1SKSA 4EX7A 5KFWA 2W9CB 3V6HA 5AKYA 5EE3A 3RJIA 2KFZA 5T14A 3F2CA 3GZFA 2B6GA 1X9WA 4ED7A 4EBCA 3UXOA 5DB7A 4BWJA 4F91B 5AK4A 3BQ7A 3A0HU 4ACOA 2Q0ZX 5L1KA 5F9NA 1Z4NA 4DSKA 1ZQIA 2F2AB 3BS7A 3WK5A 2EZYA 4QZ9A 1A76A 4Q8EA 1ZQJA 2ZXHA 3RTVA 1SXDA 2MU2A 3PSFA 2E3TA 4P2HA 1BGXT 4RQ2A 1M6YA 2BDUA 5ALQA 1A77A 1QSSA 5AM0A 5ALGA 9ICBA 2ZJ5A 4E0DA 4NLCA 2ASDA 3QX7A 1T94A 1XSPA 4I2IA 2H5XA 3QU5A 2BHNA 2HSZA 4LZGA 2KSOA 5J0YA 2Y9TA 2Y0SF 5IIMA 2J6UA 1HIWA 2F1IA 2DPIA 1BVSA 1WG8A 4F72A 3GU3A 2UVRA 2GWSA 2EQYA 1T7PA 2NRZA 3KHLA 4C8LA 4AP9A 1UHUA 1ZJNA 4RNNA 3Q8MA 4RT2A 4QWEA 5KFLA 3H4BA 2WF8A 1Z4OA 3EPIA 1S9FA 2XCAA 5KFBA 3AN1A 3CRXA 3UMGA 3AQFA 5KFAA 1LKYB 4OJPA 4ED3A 3DEEA 1DRGA 5IIIA 5KAIU 1T8EA 5KFTA 1NK7A 2DKXA 1JXEA 2H3QA 3PMLA 8ICEA 5KG6A 3Q8KA 3SR6A 4KLFA 3V6KA 2LMRA 1SWWA 1SL0A 4C8NA 2DUYA 4P4OA 3ISCA 2H3VA 3JPTA 4P4PA 8ICIA 1KN5A 3ISDA 2XGQA 4B9MA 7ICNA 1MQ3A 1KEJA 3ZD8A 4PGQA 4M2YA 4KLSA 2L5YA 4OJ5A 5BOLA 2CPRA 2R8IA 1QSLA 2K8CB 2W11A 2WHEA 5IIKA 2NRVA 5DB8A 4KLIA 4QZFA 4I2AA 5AKLA 3K1ZA 2XCPA 2KJ9A 8ICAA 5ALJA 1RG6A 3G6VA 2JZBA 1AQ6A 5J0RA 5J0XA 2BDPA 3OHAA 4I2DA 2GOLA 1SZHA 2H3IA 2JH1A 5DBCA 4M47A 4F5QA 1SV0C 4M9LA 3L5KA 3MGHA 4ECVA 3RJFA 1WWUA 9ICTA 1OXJA 5JRTA 3L3FX 5ALLA 4B9UA 4GIBA 3ZDDA 2XI9A 4QW9A 4M9GA 3QU2A 2W7PA 5KL1B 8ICSA 2JV3A 5DB6A 2WF9A 4C8MA 2KICA 5KFKA 2B21A 1RDFA 5CR0A 3JPRA 2BQUA 1NOMA 3KOOA 1UCVA 4F8RA 3TADA 5ALFA 4KLEA 3K75D 2K4PA 3LWLA 8ICWA 5DB9A 1ZQEA 5KNIA 2BCRA 5KFEA 1ZQ1C 5AKKA 4UATA 3TANA 5FP0A 4IQWA 5EE0A 1L7OA 1MQ2A 2D3DA 4NV0A 3D2QA 3BZCA 4EBDA 5D4BA 1JUDA 2OCEA 2A3VA 2Z7JA 4M9JA 4ZH4A 2P6UA 4YN4A 2D6FC 2ODGA 5AIAA 4CF4A 3PSTA 4PJ0U 4KLUA 2R8GA 4EBEA 4CRXA 3M9MB 3E2EA 1N60A 1D9FA 1JX4A 5KG5A 2F44A 1SV4A 3ZD9A 5CWRA 3SV4A 2HBMA 3PO5A 3H8JA 2KHVA 2AHOB 2W9BA 1IM4A 2ZTCA 4C8OA 2JEIA 2F1JA 2XICA 2HBLA 1B43A 3OPXA 3RR7A 3MDCA 1SIJA 4JMUA 1FFVA 1C7YA 3PR4A 4QIWF 3JPSA 3AUOA 2B0CA 1U4BA 3QUTA 2QLTA 2E8PA 1LVHA
chains in the Genus database with same CATH topology
1V38A 2EAPA 5JTIA 1COKA 2JV3A 5L1MA 1V85A 4IS7A 3K1RB 2KMDA 4RQMA 2QARB 1UCVA 3TADA 2QB0B 1LKYB 2EAMA 1F0MA 2YTUA 3SENA 1PK1A 2ESEA 2K4PA 2QKQA 2QB1A 5KNIA 2KE7A 5F3XB 1X66A 2DKXA 3BS5B 2B6GA 4PZNA 2E8OA 2EAOA 2F3NA 2LMRA 3BQ7A 2D3DA 2EANA 3KKAA 3BS7A 3TADC 1LKYA 4RQNA 1Z1VA 2DL0A 1KW4A 1SXDA 1WWVA 5JU5A 1SXEA 2DKZA 2K60A 2ES6A 4PZOA 1JI7A 4NL9A 2KG5A 2FE9A 2L5YA 2F44A 4NJ8A 1SV4A 3IDWA 2KIVA 2F8KA 1DXSA 4MHVA 2KSOA 1OW5A 1B0XA 2Y9TA 1RG6A 3H8MA 1B4FA 1SGGA 2E8NA 2GLEA 1X9XA 2Y9UA 3SEIA 1PK1B 2E8MA 2LPEA 3TACB 1SV0A 1X40A 1SV0C 3BS5A 2D8CA 5J8YA 4NL9C 1PK3A 1WWUA 3HILA 2QARA 1OXJA 2KSOB 5JRTA 1UQVA 5J8YC 2E8PA 3KKAC 2QB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V38 A;  2EAP A;  5JTI A;  1COK A;  2JV3 A;  5L1M A;  1V85 A;  4IS7 A;  3K1R B;  2KMD A;  4RQM A;  2QAR B;  1UCV A;  3TAD A;  2QB0 B;  1LKY B;  2EAM A;  1F0M A;  2YTU A;  3SEN A;  1PK1 A;  2ESE A;  2K4P A;  2QKQ A;  2QB1 A;  5KNI A;  2KE7 A;  5F3X B;  1X66 A;  2DKX A;  3BS5 B;  2B6G A;  4PZN A;  2E8O A;  2EAO A;  2F3N A;  2LMR A;  3BQ7 A;  2D3D A;  2EAN A;  3KKA A;  3BS7 A;  3TAD C;  1LKY A;  4RQN A;  1Z1V A;  2DL0 A;  1KW4 A;  1SXD A;  1WWV A;  5JU5 A;  1SXE A;  2DKZ A;  2K60 A;  2ES6 A;  4PZO A;  1JI7 A;  4NL9 A;  2KG5 A;  2FE9 A;  2L5Y A;  2F44 A;  4NJ8 A;  1SV4 A;  3IDW A;  2KIV A;  2F8K A;  1DXS A;  4MHV A;  2KSO A;  1OW5 A;  1B0X A;  2Y9T A;  1RG6 A;  3H8M A;  1B4F A;  1SGG A;  2E8N A;  2GLE A;  1X9X A;  2Y9U A;  3SEI A;  1PK1 B;  2E8M A;  2LPE A;  3TAC B;  1SV0 A;  1X40 A;  1SV0 C;  3BS5 A;  2D8C A;  5J8Y A;  4NL9 C;  1PK3 A;  1WWU A;  3HIL A;  2QAR A;  1OXJ A;  2KSO B;  5JRT A;  1UQV A;  5J8Y C;  2E8P A;  3KKA C;  2QB0 A; 
#chains in the Genus database with same CATH topology
 3NRZ A;  3OGU A;  2EAP A;  3AU2 A;  2FMS A;  4CDG A;  4UQG A;  1D8B A;  1JMS A;  1XWL A;  3MGI A;  1J2M A;  3N7R C;  4UBB A;  4TUQ A;  2JEF A;  4ELV A;  1U48 A;  4Q44 A;  3QUB A;  1BNO A;  4DOA A;  3KHG A;  4GC6 A;  3KZI U;  1SL1 A;  1RQL A;  1ZET A;  4J9P A;  4I2B A;  5J0Q A;  5ALR A;  1TAM A;  3D6J A;  3NRW A;  4IRK A;  2LYB A;  5DG9 A;  4R65 A;  1NKC A;  4BUG A;  5KT5 A;  3HKZ C;  2EAO A;  2NRT A;  3RF9 A;  3PNC A;  2BCU A;  2ZIU A;  4O3O A;  4F4Y A;  1LB2 B;  4RQN A;  4AYB F;  2ZIX A;  2HW3 A;  2UVV A;  4YP3 A;  2E5S A;  2KK0 A;  4FO6 A;  4J9R A;  5ALX A;  3ZDA A;  5ALS A;  2V4Q A;  5B5E U;  4C4S A;  3PW7 A;  2HCF A;  4IQU A;  3UM9 A;  4EZ6 A;  3C2M A;  4R66 A;  3G6X A;  5AKE A;  3I76 A;  1L7P A;  1C20 A;  4PHA A;  4P0P A;  1UT8 A;  3QU7 A;  4DS5 A;  3T5K A;  4DFD A;  1NJY A;  4MFA A;  2XY5 A;  2GLE A;  4P4M A;  3GFK B;  3MR3 A;  2YX8 A;  1KL9 A;  1ZD4 A;  3OTQ A;  2IHN A;  1TFR A;  2MUT B;  5A0L A;  3FM9 A;  1S0N A;  5AM4 A;  3RAQ A;  8ICK A;  9ICO A;  3Q8L A;  2QAR A;  1KQQ A;  2W3S A;  3Q8Q B;  1K5O A;  1BNP A;  4QZH A;  3T3F A;  4KLL A;  5KFU A;  3ZDE A;  5JTI A;  1V97 A;  8ICO A;  3WU2 U;  3NVZ A;  1BPY A;  1U45 A;  3AEV A;  5J2B A;  1QLN A;  1RXW A;  2AJQ A;  4EX6 A;  1IV8 A;  4USA A;  2Y1I A;  4PL1 A;  3SMV A;  5KL8 B;  1QQ7 A;  4ED0 A;  4A8E A;  3J81 j;  2EAM A;  3SEN A;  1U9L A;  4RQ8 A;  3I1Y A;  5EE9 A;  1XSN A;  2QB1 A;  4O3M A;  1PUZ A;  2AQ4 A;  4KLD A;  3E0F A;  4DL7 A;  1S10 A;  2IOF K;  1QTM A;  1UT5 A;  8ICV A;  4PGY A;  1ED1 A;  1HEK A;  2XC9 A;  1WYG A;  5IIO A;  5IIJ A;  2ASL A;  4MFF A;  2N1R A;  2R8K A;  3WK7 A;  5CJ7 A;  1L3T A;  1KDH A;  1ZQT A;  4DO9 A;  5ALI A;  1X6I A;  4UAV A;  5KG4 A;  4DL4 A;  3WKD A;  5J0W A;  4KLT A;  4P0Q A;  4R8U A;  2OEH A;  8ICJ A;  1F5S A;  4R63 A;  3BQ2 A;  4ECS A;  5GTI U;  4QIW C;  2PMZ C;  7ICE A;  4UW9 A;  5HHI A;  1DXS A;  1ZQN A;  2EZZ A;  2FJ6 A;  3T5J A;  9ICM A;  4M9N A;  1DK2 A;  4DL2 A;  2KJ8 A;  5KFQ A;  4QZ8 A;  5TZV A;  1S0V A;  4DL3 A;  4DFM A;  2RLT A;  1MA7 A;  2D8C A;  1L7N A;  5AK6 A;  5BOM A;  3M7D A;  4DQR A;  4UAW A;  1MC8 A;  4DQQ A;  2OHF A;  2ISO A;  5KFM A;  3LWM A;  5KFH A;  3H0L B;  3UPQ A;  5DQG A;  9ICJ A;  3UMC A;  1QH9 A;  3MR5 A;  3HWT A;  3BZK A;  3RR8 A;  4DWI A;  3K1R B;  4OO1 J;  3HT3 A;  3C5G A;  3F53 A;  3TAQ A;  2ZG6 A;  1O03 A;  1VJ5 A;  3Q8P B;  2PXI A;  4KLQ A;  2WF5 A;  2ESE A;  2EH9 A;  4DSE A;  4Y2Y A;  2QKQ A;  4F2S A;  2DWQ A;  3CW2 C;  5E79 U;  3H7I A;  4UB4 A;  4I29 A;  5G5G A;  4DSJ A;  5KG1 A;  4M6W B;  2W9M A;  9ICA A;  2ISP A;  5DLF A;  2C28 A;  3LVW A;  2DL0 A;  3PSI A;  3AMZ A;  2W7O A;  2MAX A;  1BPE A;  4QWC A;  1TAQ A;  2YQE A;  4RPY A;  5KFX A;  5AIB A;  1B22 A;  9ICN A;  2P6R A;  1Q46 A;  2AGO A;  3M1Y A;  4O3P A;  4TUS A;  2FE9 A;  2HHQ A;  4RPX A;  4KLG A;  3LDA A;  2HI0 A;  2YMP A;  4PH5 A;  4IRC A;  4GXK A;  1OW5 A;  2ZTD A;  3WK8 A;  3ICX A;  5AI0 A;  3MBY A;  3IV6 A;  4I2F A;  1NK8 A;  2BPF A;  1KTQ A;  4F4W A;  1NJW A;  3E58 A;  2UVW A;  7ICH A;  3N7P D;  5EWE A;  2WTF A;  4DSF A;  3QZ8 A;  4B9V A;  4F5P A;  4EEL A;  4DLE A;  2BGW A;  4FFD A;  5J8Y C;  7ICO A;  4NY8 A;  1ZQK A;  2V9W A;  1V38 A;  3PSP A;  5DDM A;  3PX4 A;  1NKE A;  5KFV A;  5KAF U;  2F8L A;  5L1M A;  1NK4 A;  4I2G A;  5HP4 A;  3F2B A;  7ICQ A;  2BQR A;  1KFS A;  4GLX A;  1COO A;  8ICY A;  4Z6D A;  5CEH A;  4F93 B;  2RQ5 A;  5HMM A;  4ECY A;  9ICK A;  1ZRM A;  1TK8 A;  1PK1 A;  3KBB A;  1Z00 B;  3N7S C;  3H0M B;  4YR2 A;  3IP4 B;  1CUK A;  8ICH A;  2FPK A;  5F3X B;  3G6Y A;  5J29 A;  2WF6 A;  2W8K A;  2M0N A;  4Y2T A;  4J9Q A;  3RRG A;  3DDH A;  4JK1 A;  2DPJ A;  1ZQP A;  3LYS A;  1N62 A;  2PMZ F;  4FBT A;  1YZ6 A;  9ICI A;  1JRP A;  5ALE A;  4GFJ A;  3TAD C;  5J2F A;  3C28 A;  5AM5 A;  3WKA A;  1KW4 A;  3F5E A;  1OUQ A;  3ETL A;  2FLL A;  2ES6 A;  1NK0 A;  4ECT A;  4F92 B;  1KKX A;  4QWD A;  2KG5 A;  4XRH A;  3HX0 A;  7ICT A;  1TE2 A;  3DV9 A;  1YZ7 A;  1TKD A;  4YXJ A;  3SAF A;  4F5N A;  2JR5 A;  2WAQ C;  1NI3 A;  4RQ0 A;  4PHE A;  1ZQA A;  3H8M A;  3GII A;  2KEY A;  1SGG A;  2EDU A;  1SWV A;  5DG8 A;  4UB8 U;  4M04 A;  2XVT A;  4KX3 A;  1SV0 A;  3OJS A;  4US8 A;  3C21 A;  1IG6 A;  3C5F A;  1RXV A;  4NM2 A;  2GO7 A;  1N63 A;  2OH2 A;  4O5K A;  5KG3 A;  5ALD A;  3C2L A;  3ALR A;  4BX9 C;  2W04 A;  1ZD3 A;  3NGD A;  2FPM A;  2W9A A;  1ZYQ A;  4QW8 A;  5ALP A;  5J2C A;  3KZX A;  2G5H B;  4J9O A;  2JGA A;  4Y2X A;  4ECR A;  4QZC A;  3RBD A;  3RH4 A;  1ZQG A;  1NK5 A;  2HBK A;  7ICI A;  2KP7 A;  2QB0 B;  4O3Q A;  2A1J B;  9ICV A;  4KX5 A;  4ICA A;  2FPL A;  4UB6 U;  3RH6 A;  5DGA A;  3H8S A;  5KG2 A;  2W9B B;  1UA0 A;  2ZJ8 A;  4DL5 A;  5HR7 A;  3AL0 B;  4JWN A;  2F3N A;  4KMO B;  3KKA A;  4WJ3 B;  4HYK A;  2FMP A;  3EWA A;  4FZN A;  3TQ1 A;  4Z6E A;  1Z1V A;  4MFC A;  2ZXI A;  5JU5 A;  3GV5 B;  2PI4 A;  2G07 A;  3SV3 A;  3NS1 A;  5DG7 A;  1QCK A;  4RQ7 A;  3PW0 A;  4CF5 A;  1ZD2 P;  2VKQ A;  2I1Q A;  3N97 B;  2I9G A;  3AU6 A;  2I5H A;  4YQW A;  5F9L A;  1K1Q A;  4DS4 A;  2PFN A;  3RB3 A;  1ZQQ A;  5J2K A;  1ARO P;  5KG7 A;  3IG5 A;  2JH7 A;  4F71 A;  1ZRN A;  4C80 A;  3MR2 A;  3OSN A;  2VJ5 A;  3MGV A;  4TQS A;  1RM6 C;  2A1J A;  4JWM A;  2YMM A;  2LPE A;  4M0A A;  4ED1 A;  4QZE A;  4G3I A;  1PK3 A;  3HIL A;  3OSP A;  5AI4 A;  5KT3 A;  2KKV A;  1CI4 A;  7ICS A;  4NXZ A;  4F2R A;  5BPC A;  1COK A;  3UXP A;  1LV5 A;  3HKZ F;  4O0I A;  4U7C A;  2KV2 A;  3C2K A;  3EYZ A;  3O0F A;  4Q8F A;  4B9N A;  2P66 A;  3PZP A;  1SKR A;  3IN5 A;  2K4H A;  3SAG A;  4C8K A;  3QU9 A;  3TI0 A;  4BXO B;  4UB1 A;  1A0P A;  4OJ6 A;  5ALW A;  2ZIW B;  2K8B B;  4UAU A;  4BGD A;  1X66 A;  2HBJ A;  1X9S A;  2W43 A;  1ZQR A;  2ASJ A;  3RRH A;  8ICN A;  1ZXI A;  2JXJ A;  3QUQ A;  5AHX A;  4YXM A;  1UPH A;  2WB1 C;  3WKC A;  2PFP A;  4NLB A;  1TK0 A;  9ICS A;  3F2D A;  2VA8 A;  3MFH A;  1A6S A;  2MUT A;  8ICC A;  5CP2 A;  4DFJ A;  4DQI A;  3LVV A;  2XY7 A;  2JZB B;  8ICB A;  2A1A A;  3PW2 A;  5AKI A;  5KFR A;  3VCB A;  4RUA A;  4DCC A;  4DOC A;  4G9B A;  8ICM A;  1SZP A;  4KMU A;  1O08 A;  4PHP A;  2LHT A;  1L7M A;  1RQN A;  2EZX A;  3M9O B;  1H38 A;  4JV0 A;  2C2D A;  2KTQ A;  2MA1 A;  5KFS A;  5KFC A;  5AI5 A;  3NVV A;  2F1H A;  3S6J A;  4QZA A;  2JEG A;  4BXO A;  4KN7 A;  3OJU A;  3TAC B;  3HJE A;  4BWM A;  1X40 A;  3QU4 A;  4ELT A;  3V7K A;  4YR3 A;  3HP6 A;  1X2I A;  5DQI A;  1RPL A;  3H4D A;  1UQV A;  4GC7 A;  4O3S A;  3T5L A;  3KHR A;  7ICJ A;  1Z1B A;  4DF4 A;  5KFZ A;  2RDI A;  4DFK A;  4EEN A;  1P7D A;  3THV A;  3V7J A;  2KZZ A;  3AM9 A;  4XUS A;  5KT2 A;  4F4Z A;  3PY8 A;  3NAS A;  4Y2V A;  4Z6F A;  2FLN A;  4F3O A;  1ZQD A;  4IR9 A;  5B66 U;  3B0Y A;  3BS5 B;  5D46 A;  3QE9 Y;  2YML A;  4ECX A;  8ICG A;  2DFL A;  4MEX A;  1N5W A;  3TAP A;  3C1Z A;  4JB3 A;  4LZD A;  2HDO A;  4FE3 A;  2W55 A;  1ZQM A;  1J97 A;  2IA6 A;  5C0Y A;  3QUC A;  2DKZ A;  4PZO A;  2C22 A;  3QEB Z;  1FEZ A;  4UAZ A;  3H8W A;  5AK3 A;  3GV7 B;  3D2S A;  2AH5 A;  2Q4T A;  1DGJ A;  4BDP A;  5KFD A;  5ALU A;  2HOI A;  4QWA A;  5KT7 A;  4DF8 A;  4B9S A;  4K4I A;  3I28 A;  1NJZ A;  1ZOL A;  1U47 A;  1PVP A;  1PVQ A;  2F8K A;  8ICQ A;  1X42 A;  1S8O A;  4RNO A;  1NK9 A;  2IHM A;  2KZ3 A;  1BPX A;  1B0X A;  2J6T A;  3CNH A;  7ICV A;  3SEI A;  4KLM A;  4DL6 A;  4CF3 A;  2KN7 A;  2KOB A;  5J8Y A;  5DGB A;  4CNQ A;  4UBC A;  2VA2 A;  2KSO B;  1TK5 A;  4DQP A;  3R9K A;  4UB3 A;  1S97 A;  5ALZ A;  8ICP A;  5KFF A;  1BPB A;  3UQ2 A;  1JN3 A;  4UAR A;  1URJ A;  4MEY A;  2FLP A;  5AKX A;  4LJX A;  7ICG A;  1QQ5 A;  5ALK A;  4YFK A;  1HUO A;  4C0Z A;  3FC4 A;  2Y1J A;  2BR0 A;  7ICL A;  2XGP A;  3MAB A;  4FS1 A;  8ICZ A;  3SQI A;  2IOF A;  8ICT A;  2FDR A;  2KD1 A;  1DK3 A;  5J2D A;  4EEY A;  1X9M A;  1D9D A;  3RAX A;  3V72 A;  5ALM A;  1TV9 A;  2ATL A;  5AI6 A;  4KIT B;  8ICL A;  1Q3U A;  1LKY A;  4ZOH C;  3NVW A;  4Q45 A;  2VAN A;  5DQH A;  4P0P B;  3GIL A;  3BDP A;  1SXE A;  4RQ4 A;  2K60 A;  3RFA A;  1IXR A;  1JI7 A;  3KD3 A;  3GIK A;  2K8A A;  4FZL A;  4M6W A;  2KIW A;  1XS9 D;  1SB3 C;  3FDS A;  2O6K A;  3NVY A;  3K4G A;  1X6J A;  3BQ0 A;  1S0M A;  1RYR A;  3QZ7 A;  2MSN A;  2KJ5 A;  1S5L U;  4JV1 A;  4FZM A;  4XQ8 A;  4C7Z A;  1T3Q A;  3QNM A;  2HHS A;  4CE6 A;  3UXN A;  1B4F A;  4ED6 A;  1KFD A;  1BPD A;  5CA7 A;  5HR6 A;  2BPC A;  2R8J A;  2G0A A;  5KFI A;  1PK1 B;  3FAH A;  2RRD A;  2WFA A;  2KVC A;  3GIM A;  1TAU A;  4YD2 A;  2PI5 A;  4C7Y A;  4K4G A;  1ZQY A;  3KFU F;  3KTQ A;  4I2J A;  5KFO A;  2HOF A;  3CP8 A;  4Y2P A;  4J9S A;  3EZ5 A;  4B9T A;  1PVR A;  2YY6 A;  5AKZ A;  2W9C A;  2C2R A;  9ICH A;  5AKH A;  4M9H A;  4F5O A;  4RPZ A;  5AI8 A;  2KFN A;  5L1I A;  5ALY A;  2ALZ A;  1QSY A;  4RQM A;  5EWF A;  5AM3 A;  1N2X A;  3EPG A;  2F77 X;  4KN4 A;  5AI9 A;  3V6J A;  4IC9 A;  3UQ0 A;  3CYM A;  3AQE A;  5J2A A;  1ZQV A;  2YTU A;  4UB5 A;  2JEJ A;  1S76 D;  5CB1 A;  3ETR A;  5HNK A;  5J2E A;  2YB4 A;  4YMO A;  1L3U A;  4RNM A;  1DGS A;  2E8O A;  4LVS A;  2CXY A;  4U6P A;  3BQT A;  4YCX A;  1FO4 A;  3OHB A;  4J03 A;  4R8U B;  4P0Q B;  1FIQ A;  1KBU A;  3ED5 A;  7ICR A;  4YG2 A;  3T79 A;  4ED2 A;  2AXT U;  1Q3V A;  2NO5 A;  3WK9 A;  2KHQ A;  3QXG A;  2JRZ A;  4O9M A;  3QYP A;  8ICX A;  1ZQC A;  4RQ5 A;  2W3R A;  1PZN A;  1L3S A;  1U49 A;  4NJ8 A;  5KFJ A;  9ICR A;  4US9 A;  3JPN A;  1NZB A;  4RQ6 A;  1SKW A;  2BCV A;  4YMN A;  1XO0 A;  2DF4 B;  1L8L A;  3RJK A;  5J2H A;  4RT3 A;  5DBB A;  3M8R A;  3PW4 A;  2BQ3 A;  2Y9U A;  2NRX A;  4ED8 A;  2ZJA A;  4RUC A;  5J0P A;  3ZDC A;  1N61 A;  5DDY A;  5H2F U;  9ICP A;  4RQ3 A;  1RZT A;  3WK6 A;  2Y0S C;  1RYS A;  2KNJ A;  4NLN A;  1RYU A;  2HHW A;  9ICG A;  4IS7 A;  2RHF A;  5KFG A;  2WF7 A;  1IIP A;  5L1L A;  4J9L A;  2PKE A;  4RZR A;  1D8L A;  5J2G A;  3TKA A;  2F76 X;  2K4E A;  2K4I A;  2A19 A;  3D2N A;  1ZQF A;  3RJH A;  4JV2 A;  4UB2 A;  3SYZ A;  9ICC A;  2G08 A;  1KLN A;  5AM1 A;  1L8O A;  1QQ6 A;  5AKG A;  4Q43 A;  2HHX A;  4C4T A;  2MRL A;  2ZUB A;  4TUP A;  2M9N A;  4I2E A;  2KVS A;  2AQ0 A;  1XSL A;  1TVA A;  1WUD A;  2HVI A;  3MFI A;  1JAL A;  2BCS A;  1F44 A;  5J0T A;  2OYY A;  3A0B U;  2VA3 A;  2IBK A;  1Z3E B;  7ICF A;  4Y2U A;  3PX0 A;  1K1S A;  4KLH A;  7ICM A;  5CRX A;  2C2E A;  3RJJ A;  4TUR A;  1SL2 A;  4MF8 A;  8ICU A;  3KHH A;  1L6N A;  4QZI A;  4FS2 A;  4OD0 A;  4IQV A;  5KG0 A;  4J9M A;  4CCH A;  4MF2 A;  4YD1 A;  3Q8S B;  3RBE A;  9ICE A;  1T3N A;  4CGZ A;  5JUM A;  4KLO A;  4PHD A;  2E8N A;  1Z19 A;  1NNL A;  5L9X A;  3N4M B;  5J2J A;  3IM1 A;  9ICW A;  4O3N A;  1ZQW A;  3H40 A;  3RH5 A;  2HHU A;  4YMM A;  4K4H A;  4C4R A;  3KKA C;  1ZJM A;  2XY6 A;  5KTQ A;  2BZF A;  4NLK A;  1YT3 A;  4UAS A;  1S77 D;  3TFR A;  4F50 A;  1Z00 A;  7ICP A;  2HMX A;  2HHT A;  4QWB A;  3H0R B;  2OWO A;  3JPQ A;  1Q8K A;  1V85 A;  4EZ9 A;  1KSP A;  4DSL A;  1JRO A;  1FFU A;  5TIS U;  2QAR B;  3RB0 A;  4PL2 A;  2HVH A;  5CHG A;  4DQS A;  2ZIV A;  5AIC A;  4TQR A;  1ZQZ A;  3PV8 A;  3F5A A;  5KT6 A;  4KTQ A;  1XO1 A;  2HOQ A;  2W8L A;  4RQ1 A;  4FBU A;  2KE7 A;  5ALO A;  2ZUD A;  2RDJ A;  2WAQ F;  5HHH A;  5KFN A;  1CEZ A;  2EAN A;  1NKB A;  3PMN A;  1J2N A;  4B9L A;  5ALN A;  1ECW A;  4DFP A;  9ICF A;  4X5V A;  5J2I A;  1MSW D;  4XA5 A;  4QZG A;  3JPO A;  8ICR A;  5HML A;  2J6S A;  4HAI A;  2NYV A;  1T4G A;  4OJO A;  1JIH A;  3WKB A;  2E1F A;  3BQ1 A;  4I27 A;  1HUZ A;  4ECZ A;  1S0O A;  5K4L A;  4J9N A;  3ZDB A;  2G5I B;  5KT4 A;  4MHV A;  2LYH A;  3ISB A;  2LKY A;  1WCN A;  2ZIV B;  1HJP A;  3M6Z A;  4RU9 A;  2HHV A;  2DGZ A;  2NO4 A;  1ZQU A;  2FMQ A;  9ICQ A;  2AU0 A;  3C1Y A;  4DSI A;  1BPZ A;  9ICX A;  4Y2Q A;  3HW8 A;  3BS5 A;  3C23 A;  4ECQ A;  3HPO A;  4DLG A;  1EXN A;  1WCL A;  1Y88 A;  5EE1 A;  2JHD A;  1ZQO A;  1GO3 F;  3M6K A;  3RB4 A;  4EYI B;  3IRU A;  4O5C A;  2QB0 A;  5GTH U;  1VDV A;  5J0S A;  2IMW P;  5AKJ A;  1ZQX A;  2K89 A;  4J9K A;  2DBY A;  9ICU A;  3C29 A;  5AK5 A;  2I6X A;  5C5J A;  1D8Y A;  4OJL A;  4PGX A;  4Y2S A;  4O5E A;  2R8H A;  4NLG A;  1N5X A;  5ALT A;  4DOB A;  3GQC A;  5DKW A;  5D49 A;  1N48 A;  3SI8 A;  4PZN A;  3WK4 A;  3RJG A;  3HRD D;  2LM4 A;  2FI1 A;  1NK6 A;  2OXO A;  4OCZ A;  2YN4 A;  1L5U A;  4Z6C A;  3MR6 A;  1XC9 A;  5DBA A;  1N56 A;  1ZQL A;  4QZD A;  4F4X A;  2GH1 A;  2YMQ A;  3SD7 A;  3V7L A;  2BPG A;  3ONN A;  5ALV A;  1JXL A;  7ICK A;  4UAY A;  2LM1 A;  2JMG A;  3NUQ A;  3PX6 A;  2CRX A;  5IIN A;  2KIV A;  4AYB C;  4EYH B;  3M9N B;  3JPP A;  3NTU A;  5AM2 A;  5IIL A;  1NZP A;  2WB1 F;  4IR1 A;  5J0O A;  5J0U A;  3GIJ A;  2ZIU B;  4BJQ A;  4EEK A;  2H3F A;  4NM1 A;  3SAH A;  2ZIX B;  4NL9 C;  3MDA A;  4JUZ A;  2V4R A;  2W03 A;  2E1E A;  3ZI4 A;  4PPX A;  4NLZ A;  4ELU A;  5EOZ A;  3GDX A;  1KRP A;  2KKP A;  3LK9 A;  3QEA Z;  4O3R A;  1ZQB A;  2ZIW A;  1XU4 A;  3B9J A;  2PFQ A;  4QJF B;  2RP5 A;  2KMD A;  1V9P A;  4YR0 A;  3TFS A;  2LBO A;  4Y2J A;  1DOQ A;  2DQN B;  3IG8 A;  2W54 A;  2IOH A;  1F0M A;  4ECU A;  2UVU A;  3BJY A;  4GXI A;  2OM6 A;  5KFY A;  3UMB A;  3PR5 B;  2G09 A;  2NV3 A;  3T5H A;  1ZQS A;  2VJ4 A;  4R64 A;  2G06 A;  3PW5 A;  1ZQH A;  1WWV A;  3MC1 A;  4DEZ A;  1VLB A;  3FYH A;  3PO4 A;  1XNS A;  3N28 A;  5EWG A;  4Y2R A;  2KZM A;  4NL9 A;  3B0X A;  3WKE A;  1NJX A;  5ALH A;  3EW9 A;  3IHQ B;  4IRD A;  2XO7 A;  4I28 A;  2CN1 A;  3IDW A;  3VC8 A;  2LYA A;  4KLJ A;  9ICL A;  1UA1 A;  5G5H A;  3L4P A;  4GXJ A;  2H3Z A;  2ZUC A;  3ORY A;  3M8S A;  1X9X A;  3Q8R B;  4IQT A;  7ICU A;  2ZTE A;  2E8M A;  4F4K A;  1KFT A;  1CRX A;  1L3V A;  3EUB 2;  4YVZ A;  3TAR A;  4I2H A;  1MN8 A;  3GV8 B;  2BCQ A;  4QZB A;  5L1J A;  4NWI A;  8ICF A;  2BKE A;  4IL6 U;  4QNL A;  2LI6 A;  3RB6 A;  1ZD5 A;  2PFO A;  2R18 A;  5KFP A;  2NRW A;  2P35 A;  2AGP A;  4ECW A;  3U26 A;  3RJE A;  2XID A;  4F5R A;  3SZ2 A;  3PVX A;  2AGQ A;  4I2C A;  2YB1 A;  5DLG A;  4B6J A;  2VIX A;  1SKS A;  4EX7 A;  5KFW A;  2W9C B;  3V6H A;  5AKY A;  5EE3 A;  3RJI A;  2KFZ A;  5T14 A;  3F2C A;  3GZF A;  2B6G A;  1X9W A;  4ED7 A;  4EBC A;  3UXO A;  5DB7 A;  4BWJ A;  4F91 B;  5AK4 A;  3BQ7 A;  3A0H U;  4ACO A;  2Q0Z X;  5L1K A;  5F9N A;  1Z4N A;  4DSK A;  1ZQI A;  2F2A B;  3BS7 A;  3WK5 A;  2EZY A;  4QZ9 A;  1A76 A;  4Q8E A;  1ZQJ A;  2ZXH A;  3RTV A;  1SXD A;  2MU2 A;  3PSF A;  2E3T A;  4P2H A;  1BGX T;  4RQ2 A;  1M6Y A;  2BDU A;  5ALQ A;  1A77 A;  1QSS A;  5AM0 A;  5ALG A;  9ICB A;  2ZJ5 A;  4E0D A;  4NLC A;  2ASD A;  3QX7 A;  1T94 A;  1XSP A;  4I2I A;  2H5X A;  3QU5 A;  2BHN A;  2HSZ A;  4LZG A;  2KSO A;  5J0Y A;  2Y9T A;  2Y0S F;  5IIM A;  2J6U A;  1HIW A;  2F1I A;  2DPI A;  1BVS A;  1WG8 A;  4F72 A;  3GU3 A;  2UVR A;  2GWS A;  2EQY A;  1T7P A;  2NRZ A;  3KHL A;  4C8L A;  4AP9 A;  1UHU A;  1ZJN A;  4RNN A;  3Q8M A;  4RT2 A;  4QWE A;  5KFL A;  3H4B A;  2WF8 A;  1Z4O A;  3EPI A;  1S9F A;  2XCA A;  5KFB A;  3AN1 A;  3CRX A;  3UMG A;  3AQF A;  5KFA A;  1LKY B;  4OJP A;  4ED3 A;  3DEE A;  1DRG A;  5III A;  5KAI U;  1T8E A;  5KFT A;  1NK7 A;  2DKX A;  1JXE A;  2H3Q A;  3PML A;  8ICE A;  5KG6 A;  3Q8K A;  3SR6 A;  4KLF A;  3V6K A;  2LMR A;  1SWW A;  1SL0 A;  4C8N A;  2DUY A;  4P4O A;  3ISC A;  2H3V A;  3JPT A;  4P4P A;  8ICI A;  1KN5 A;  3ISD A;  2XGQ A;  4B9M A;  7ICN A;  1MQ3 A;  1KEJ A;  3ZD8 A;  4PGQ A;  4M2Y A;  4KLS A;  2L5Y A;  4OJ5 A;  5BOL A;  2CPR A;  2R8I A;  1QSL A;  2K8C B;  2W11 A;  2WHE A;  5IIK A;  2NRV A;  5DB8 A;  4KLI A;  4QZF A;  4I2A A;  5AKL A;  3K1Z A;  2XCP A;  2KJ9 A;  8ICA A;  5ALJ A;  1RG6 A;  3G6V A;  2JZB A;  1AQ6 A;  5J0R A;  5J0X A;  2BDP A;  3OHA A;  4I2D A;  2GOL A;  1SZH A;  2H3I A;  2JH1 A;  5DBC A;  4M47 A;  4F5Q A;  1SV0 C;  4M9L A;  3L5K A;  3MGH A;  4ECV A;  3RJF A;  1WWU A;  9ICT A;  1OXJ A;  5JRT A;  3L3F X;  5ALL A;  4B9U A;  4GIB A;  3ZDD A;  2XI9 A;  4QW9 A;  4M9G A;  3QU2 A;  2W7P A;  5KL1 B;  8ICS A;  2JV3 A;  5DB6 A;  2WF9 A;  4C8M A;  2KIC A;  5KFK A;  2B21 A;  1RDF A;  5CR0 A;  3JPR A;  2BQU A;  1NOM A;  3KOO A;  1UCV A;  4F8R A;  3TAD A;  5ALF A;  4KLE A;  3K75 D;  2K4P A;  3LWL A;  8ICW A;  5DB9 A;  1ZQE A;  5KNI A;  2BCR A;  5KFE A;  1ZQ1 C;  5AKK A;  4UAT A;  3TAN A;  5FP0 A;  4IQW A;  5EE0 A;  1L7O A;  1MQ2 A;  2D3D A;  4NV0 A;  3D2Q A;  3BZC A;  4EBD A;  5D4B A;  1JUD A;  2OCE A;  2A3V A;  2Z7J A;  4M9J A;  4ZH4 A;  2P6U A;  4YN4 A;  2D6F C;  2ODG A;  5AIA A;  4CF4 A;  3PST A;  4PJ0 U;  4KLU A;  2R8G A;  4EBE A;  4CRX A;  3M9M B;  3E2E A;  1N60 A;  1D9F A;  1JX4 A;  5KG5 A;  2F44 A;  1SV4 A;  3ZD9 A;  5CWR A;  3SV4 A;  2HBM A;  3PO5 A;  3H8J A;  2KHV A;  2AHO B;  2W9B A;  1IM4 A;  2ZTC A;  4C8O A;  2JEI A;  2F1J A;  2XIC A;  2HBL A;  1B43 A;  3OPX A;  3RR7 A;  3MDC A;  1SIJ A;  4JMU A;  1FFV A;  1C7Y A;  3PR4 A;  4QIW F;  3JPS A;  3AUO A;  2B0C A;  1U4B A;  3QUT A;  2QLT A;  2E8P A;  1LVH A; 
#chains in the Genus database with same CATH homology
 1V38 A;  2EAP A;  5JTI A;  1COK A;  2JV3 A;  5L1M A;  1V85 A;  4IS7 A;  3K1R B;  2KMD A;  4RQM A;  2QAR B;  1UCV A;  3TAD A;  2QB0 B;  1LKY B;  2EAM A;  1F0M A;  2YTU A;  3SEN A;  1PK1 A;  2ESE A;  2K4P A;  2QKQ A;  2QB1 A;  5KNI A;  2KE7 A;  5F3X B;  1X66 A;  2DKX A;  3BS5 B;  2B6G A;  4PZN A;  2E8O A;  2EAO A;  2F3N A;  2LMR A;  3BQ7 A;  2D3D A;  2EAN A;  3KKA A;  3BS7 A;  3TAD C;  1LKY A;  4RQN A;  1Z1V A;  2DL0 A;  1KW4 A;  1SXD A;  1WWV A;  5JU5 A;  1SXE A;  2DKZ A;  2K60 A;  2ES6 A;  4PZO A;  1JI7 A;  4NL9 A;  2KG5 A;  2FE9 A;  2L5Y A;  2F44 A;  4NJ8 A;  1SV4 A;  3IDW A;  2KIV A;  2F8K A;  1DXS A;  4MHV A;  2KSO A;  1OW5 A;  1B0X A;  2Y9T A;  1RG6 A;  3H8M A;  1B4F A;  1SGG A;  2E8N A;  2GLE A;  1X9X A;  2Y9U A;  3SEI A;  1PK1 B;  2E8M A;  2LPE A;  3TAC B;  1SV0 A;  1X40 A;  1SV0 C;  3BS5 A;  2D8C A;  5J8Y A;  4NL9 C;  1PK3 A;  1WWU A;  3HIL A;  2QAR A;  1OXJ A;  2KSO B;  5JRT A;  1UQV A;  5J8Y C;  2E8P A;  3KKA C;  2QB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...