4PZNA

Crystal structure of phc3 sam l971e
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPAEKICARINSLKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 3
total genus 24
structure length 70
sequence length 70
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pznA00
3BS7A 4MHVA 2EAMA 2GLEA 1WWVA 5KNIA 1JI7A 3K1RB 5F3XB 3TADC 4NL9C 2QKQA 1F0MA 1COKA 2EANA 2K60A 2KMDA 3BS5B 2E8MA 2E8OA 5JU5A 1OXJA 4PZNA 1Z1VA 1UCVA 2QB0A 3BS5A 1SV0C 2EAOA 1LKYB 3KKAC 2DL0A 1PK1B 2FE9A 2LPEA 5J8YC 1X40A 4IS7A 5JTIA 3H8MA 4RQNA 2KG5A 1V38A 3IDWA 2F3NA 2ES6A 2ESEA 1X9XA 2QARA 2B6GA 1SXEA 2K4PA 2JV3A 4NJ8A 1SGGA 4NL9A 3SENA 2KSOB 2QB1A 3TADA 2Y9TA 2F8KA 1V85A 3BQ7A 1OW5A 2E8NA 1KW4A 2L5YA 2KE7A 1PK1A 2F44A 1LKYA 1SXDA 2DKZA 5J8YA 2QARB 3SEIA 2Y9UA 2D8CA 1X66A 3TACB 1B0XA 2YTUA 1RG6A 1SV0A 2DKXA 2KSOA 2LMRA 3HILA 3KKAA 2QB0B 4RQMA 2D3DA 1SV4A 1DXSA 2KIVA 5JRTA 1UQVA 2EAPA 2E8PA 4PZOA 1WWUA 1PK3A 1B4FA 5L1MA
chains in the Genus database with same CATH superfamily
3EPIA 5BOLA 4RQ2A 3T5KA 4I2FA 1AROP 2FMQA 4Y2PA 3VC8A 1F0MA 2R8KA 2OYYA 3BS5B 3V6KA 1S8OA 5KT3A 4GXIA 1K1SA 1ZD3A 3UMBA 3BQ0A 4J03A 1MN8A 5J2HA 3ICXA 3ISBA 3UMGA 1KEJA 5IIJA 4Y2RA 2ESEA 4UB4A 4P0PB 4NLBA 3LWLA 1QSSA 1ZQSA 4TQSA 2VA3A 3NVWA 3GIMA 1XO0A 4AYBF 3FC4A 4RQ5A 1HUOA 4RNMA 4PPXA 3GV5B 1DRGA 5CHGA 5AM1A 4PGXA 5KFMA 5KG1A 4XA5A 2DWQA 5AM3A 2W11A 2KVSA 3PX0A 4CGZA 4F3OA 2WB1C 3LWMA 3OTQA 3QYPA 8ICCA 3V6JA 4CRXA 2A1JB 3CW2C 1H38A 1F5SA 3HWTA 2QB0B 9ICHA 3PW4A 2OWOA 1JN3A 2ZXIA 4PHPA 1KKXA 5CP2A 3KZIU 4MEYA 2IMWP 5DDYA 5AHXA 1KRPA 2IBKA 3NTUA 1KLNA 2A3VA 1BPDA 1A77A 5EE0A 5L1MA 1XNSA 7ICJA 2LYAA 2R8HA 3TQ1A 2ZXHA 4CF3A 3QUQA 3RJEA 2K60A 2KMDA 4IQWA 2KOBA 1S0VA 4PHAA 9ICFA 4Z6DA 5J29A 2K8BB 1UCVA 2V4RA 3PMNA 5AIAA 3FAHA 4QIWC 1PK1B 1XO1A 4DL6A 2LPEA 2ZJ5A 5KAFU 3QU9A 3OSPA 4EX7A 2KG5A 4M04A 2XI9A 3G6VA 3C1ZA 4R66A 1Q3UA 2HOIA 2ISPA 3UXNA 1NJYA 2PFQA 4KLSA 4QZGA 4KITB 2GOLA 5J2IA 4M47A 3I1YA 5ALZA 4TQRA 3M8RA 3H0MB 5KFRA 5ALOA 1N56A 1FFVA 1ZQZA 1RM6C 2H3VA 4ED8A 3RJIA 3CRXA 4C8KA 2HW3A 2HHWA 3LK9A 2UVUA 2DUYA 2KZMA 3DEEA 4IQUA 3TKAA 4KX5A 3C5GA 4JK1A 4F5NA 4RQ3A 2YQEA 2RDJA 4DWIA 2KIWA 3EUB2 3M1YA 3IN5A 5KFCA 4QZCA 4UATA 1NJXA 1XC9A 1S10A 2BPFA 4IC9A 2EDUA 5AKHA 2JZBB 4YR2A 2PMZF 5J0SA 4DFDA 3RAQA 5KFPA 4J9MA 3RH5A 2JEFA 1QCKA 3WU2U 4P4MA 2J6TA 1URJA 2HHSA 2MUTB 1ZXIA 2VA2A 3C2LA 3AQEA 5DG9A 1S97A 7ICHA 8ICYA 3S6JA 2AGPA 3Q8KA 2VANA 5J0QA 3SI8A 1QTMA 9ICGA 4O3RA 5G5HA 1ZQRA 4B9SA 4YFKA 5HR6A 1Q8KA 4M9HA 2NRZA 1OXJA 1ZQIA 3H0LB 4Z6CA 4JB3A 1BPZA 4QZ9A 4F93B 3HT3A 2EAOA 1ZQDA 7ICUA 3OHAA 4DL5A 3THVA 2WAQC 2OH2A 2D6FC 3UXOA 2ZIXA 2W8KA 3ZDEA 3NASA 1SKWA 3G6XA 1X9WA 4UASA 2JH7A 1KQQA 8ICXA 2H3ZA 1QSLA 4ED3A 4FZLA 3OGUA 1NKCA 3PR5B 9ICBA 1FFUA 1SB3C 2MA1A 2K4PA 5DB9A 8ICPA 4M0AA 3SENA 3DV9A 3AUOA 3PMLA 1KL9A 1TAQA 2JR5A 1TK5A 4B9VA 2GH1A 5KFWA 4IR9A 1TE2A 2XO7A 4BXOA 2DBYA 5DB8A 1LKYA 4OJOA 5ALRA 5HNKA 3MDCA 1CI4A 1LVHA 3D2SA 3JPOA 1SWWA 1B0XA 5EWGA 1ZQYA 4QWEA 3V72A 3ISDA 3ONNA 2G06A 1ZQJA 8ICLA 4UAYA 2KKVA 5ALUA 4ELVA 2HBJA 2D3DA 1F44A 2JEIA 1A6SA 4IL6U 3J81j 4US8A 5AI5A 1NK0A 3AU2A 3HJEA 5KFNA 4PH5A 4I28A 5HMLA 1B4FA 4EEKA 4ECUA 5J2FA 4F4WA 1C20A 4DF4A 3T5JA 1QQ6A 2V9WA 4JMUA 4Y2QA 3PX6A 4B9TA 4FFDA 3HPOA 1X6IA 5J0UA 5JU5A 1AQ6A 4F91B 4PGQA 5KG6A 2WTFA 2ZG6A 5KG7A 4U7CA 1SV0C 3C23A 4ECQA 1ZQ1C 2FLNA 2FLPA 2LHTA 4UAUA 4QW9A 3GILA 1IIPA 1ZQNA 1PVPA 2EQYA 5C0YA 3Q8PB 2KJ9A 2C2DA 3WKCA 4PHEA 3RBDA 4F4ZA 2MSNA 4DQQA 7ICVA 2P35A 2NV3A 1S0NA 4QZEA 1L7OA 3GDXA 3TAQA 5IIIA 4FE3A 2KSOB 1TK0A 2B0CA 3LVVA 2NO4A 4RU9A 2VJ5A 2FMSA 2L5YA 2KFNA 9ICPA 4ED0A 4FZNA 1MC8A 1SXDA 2DKZA 5JUMA 4QZHA 5ALWA 4GLXA 2HI0A 4O5EA 2AXTU 1ZJNA 2ATLA 2YTUA 2HSZA 4EZ6A 1JXLA 4JV0A 1N48A 7ICNA 3PY8A 2J6UA 1T7PA 1WG8A 2RHFA 4I2CA 1ZQMA 4CE6A 2ALZA 5AM4A 1KSPA 9ICJA 2LYHA 4UAZA 2GO7A 1RDFA 2F1HA 4R63A 3F2DA 5J2EA 3MDAA 3TADA 1IXRA 1NJZA 4MHVA 4JUZA 2G09A 4YMNA 4F5PA 4RNOA 4P2HA 3NGDA 3K1RB 2K8CB 4QNLA 2N1RA 3ETLA 4KMUA 5HMMA 4I29A 3PV8A 3I76A 4PJ0U 3SZ2A 3KHGA 1NKEA 2A1JA 3BJYA 4M9NA 1JIHA 3EZ5A 4F92B 2Z7JA 4XRHA 3SR6A 3IRUA 4NLNA 2BR0A 2C28A 2FE9A 4RPZA 4JV1A 4QZAA 8ICZA 4K4IA 2YY6A 2DGZA 2ASJA 9ICWA 3QEBZ 3HKZC 3MFIA 4MFCA 1U4BA 2XGPA 3QU7A 5K4LA 2RRDA 1K5OA 2QARA 8ICBA 1D8BA 2B6GA 4IQTA 2ASDA 4NJ8A 2AH5A 3PNCA 2H3QA 1ZQXA 5KFGA 2HHTA 2NRTA 4PHDA 3SD7A 3M9NB 1L8OA 3QUTA 4FBUA 1IV8A 1ZQAA 4RQ8A 1NK4A 4ELTA 1RYRA 3FYHA 1NK7A 3WK9A 2ZTEA 2YX8A 1B43A 5KFBA 5AICA 4M9JA 2KFZA 5ALLA 2LM1A 3SAGA 4I27A 4NY8A 5DQIA 3ETRA 1L3UA 2ZIUA 4O3SA 2F8KA 2WFAA 3RR8A 4OCZA 3RBEA 5CJ7A 4O3OA 1B22A 3QZ8A 4M6WB 5DBCA 3MBYA 1T94A 2QB0A 1ZQVA 9ICUA 1RYUA 1TAUA 3U26A 4K4HA 2OHFA 2EH9A 4XQ8A 2JHDA 4BJQA 4R64A 4IR1A 2W7OA 1DOQA 2UVWA 4KLMA 2AU0A 3AEVA 4I2AA 1UA0A 7ICLA 2K8AA 4EELA 3MC1A 4F5QA 4Q45A 2KJ8A 4YR3A 1BGXT 2F3NA 2ES6A 1D9FA 8ICEA 4UB1A 2M9NA 4FO6A 3A0HU 2KKPA 3ALRA 2IHNA 3KTQA 2IHMA 3JPQA 2FPMA 2YB4A 3H4DA 8ICSA 3C21A 4P0PA 4TUPA 4ZH4A 5DKWA 5AKJA 7ICGA 5EWFA 1V85A 4A8EA 1OW5A 5EWEA 4B9LA 5AK4A 1BPXA 2F1IA 2NYVA 2NO5A 4DL2A 1U48A 2YMMA 1RPLA 3N28A 3TACB 4B9MA 5DLGA 4U6PA 4EBCA 4P0QB 3F5AA 2ZTDA 3IG8A 1QQ7A 3WKEA 3IV6A 4EYHB 4RPXA 5AKLA 4RUCA 3ZD8A 4DO9A 3PO4A 1UHUA 3PVXA 4OO1J 2XCPA 5IIOA 3UM9A 2RP5A 4ELUA 1COKA 1L3TA 4I2DA 2AGQA 2PFNA 4DFJA 2HHQA 4I2EA 4NM2A 2A19A 1S5LU 4YD1A 5AI9A 7ICSA 1NI3A 3MR2A 1Z3EB 2MRLA 4YVZA 1LB2B 4DQSA 3RH4A 3UQ2A 8ICUA 3JPNA 3FDSA 5CR0A 2KP7A 1BPBA 1QLNA 2W54A 3ISCA 4RQ0A 3N4MB 5KFKA 4RQNA 4UB5A 1V38A 2CRXA 2BDPA 2KJ5A 5C5JA 5DBAA 3RB4A 3LYSA 5CA7A 3GIIA 3F5EA 4LZDA 3KHHA 2PFPA 3IP4B 2ASLA 2ZIWA 4QWCA 3H4BA 5J2DA 2ZUDA 3B9JA 5KFEA 4QZBA 5KG2A 2K4HA 5GTHU 5E79U 7ICEA 4F5OA 5ALMA 1KFDA 1SL1A 1ZD5A 5AK3A 4YXMA 3T3FA 2KHQA 2ZIXB 2LYBA 1XWLA 2W9AA 3Q8SB 2DQNB 1QH9A 1BNPA 2LI6A 5ALDA 2D8CA 5AKIA 1FO4A 4DFKA 2HHVA 2WB1F 4MF8A 4M9LA 2KICA 3K4GA 2WF7A 5KFAA 4RQ7A 3QEAZ 3AN1A 4DLGA 2PXIA 2H5XA 2F76X 5AKKA 1NZPA 2B21A 1S77D 2UVRA 3MFHA 4YXJA 2EZYA 1SIJA 2EAPA 2Y1JA 2E8PA 2HMXA 4YMOA 5KFFA 2OXOA 3ED5A 8ICRA 2MUTA 3QU4A 9ICNA 4UB2A 2FPKA 5KG0A 2YB1A 2BZFA 4DFMA 2EANA 4ECTA 2IA6A 4EBEA 4O5CA 4US9A 4CF5A 4KLLA 4OJLA 4ZOHC 2BQRA 9ICTA 1RYSA 3RH6A 4DSLA 5KAIU 3I28A 2R18A 3ORYA 4DEZA 3SV3A 2MAXA 3AMZA 5ALVA 5KFSA 2OEHA 3WKDA 5KG3A 4ED2A 4FS1A 2KVCA 4C4SA 5KT4A 4F72A 2HOFA 5J2JA 4F8RA 4F4YA 1NJWA 1K1QA 5AK5A 3PW0A 1T8EA 3RJGA 4DQRA 3AM9A 3PSPA 2BCUA 2F2AB 3E0FA 2QB1A 9ICIA 4QZFA 5D4BA 4QJFB 4IRCA 5CEHA 3RJJA 2Y0SC 2W3RA 3OHBA 4BGDA 1L5UA 1YZ7A 3V7KA 3PW5A 1A76A 2KN7A 3IG5A 5KT6A 1PVQA 1J2MA 4IRKA 5AM5A 1RQLA 3SEIA 2W9CB 2Y9UA 1JALA 1UA1A 1RG6A 2DKXA 5AI8A 5T14A 1Z1BA 4DCCA 2LBOA 3RJFA 5AM0A 2DPIA 4DL4A 2A1AA 3C2MA 1KFSA 1DXSA 4P4OA 5JRTA 1UQVA 3RJHA 4USAA 7ICKA 1L7PA 1PK3A 1CEZA 3L5KA 3CYMA 2ZUCA 4MF2A 4GC6A 1RQNA 2XC9A 1JI7A 1NOMA 1Q46A 3T5LA 1L3SA 4JV2A 1L6NA 3N7RC 2CXYA 4FS2A 5KG4A 2G5HB 5ALPA 2BCQA 5ALNA 3UXPA 5L1KA 2KV2A 3WK5A 5HHIA 1ZQKA 5KFLA 4DQIA 4UB3A 3N7SC 5B5EU 1C7YA 4RZRA 3AL0B 2AQ0A 3M7DA 3NVVA 4FZMA 5JTIA 5DB7A 2AGOA 2W9BB 2KNJA 2O6KA 2ISOA 3TARA 3OJUA 3PW7A 4DQPA 3ZD9A 1VJ5A 4F2SA 2W9BA 2HVHA 1XS9D 3BZKA 5KL8B 4KN4A 1V97A 1KW4A 4M2YA 1X9MA 3SV4A 2NRXA 2F44A 4C8OA 2F8LA 1XU4A 4DL3A 8ICOA 3QU5A 3A0BU 2XY6A 1NKBA 1CUKA 4BX9C 5KFYA 5TISU 2ODGA 4J9QA 2VKQA 4HAIA 1X6JA 1KBUA 2JMGA 4EZ9A 2W03A 5KFZA 5J2GA 4GXJA 4UB6U 1MSWD 3E2EA 4C80A 1SL0A 4BXOB 3GQCA 3SMVA 5KT5A 4HYKA 4RUAA 3TANA 3C2KA 9ICQA 2XVTA 4J9PA 5CRXA 3MR6A 3QU2A 9ICVA 1D8YA 5B66U 5L9XA 4ECVA 1VDVA 2IOFA 9ICKA 1SWVA 5KFHA 2E8MA 3SAFA 4TUSA 5ALKA 1PUZA 5DDMA 9ICAA 4G9BA 4GFJA 2BCVA 7ICRA 5EOZA 1LKYB 4O0IA 3Q8QB 2RDIA 1IG6A 5KFXA 1JROA 1S9FA 2HOQA 4NLCA 2IOFK 1XSPA 5DGBA 4RPYA 4J9RA 4UW9A 7ICTA 3HRDD 4F4XA 3H8MA 4C4TA 7ICIA 3IDWA 5KFVA 1TK8A 4O3PA 3EW9A 5L1IA 1WUDA 4DS5A 5KG5A 2LM4A 2C2RA 3JPTA 5J0OA 4KLHA 2Y1IA 5J0RA 1SGGA 1ZQCA 2JXJA 2KEYA 3H7IA 4P0QA 4O3QA 1KTQA 2KD1A 2IOHA 4C0ZA 4YP3A 2E8NA 2YMQA 3BQTA 2ZJ8A 3K75D 3F2CA 4C8NA 4J9OA 3EWAA 4TUQA 4ECWA 1X42A 4ACOA 4DOBA 1SV0A 4LVSA 3VCBA 4EYIB 3KKAA 4Y2TA 2ZIUB 1Z00B 2WF8A 3B0XA 3KBBA 4J9LA 3PSTA 1BNOA 4IRDA 4BDPA 2VIXA 2I6XA 1ZQTA 3NRZA 3M9MB 1GO3F 1WCLA 5KFIA 5ALEA 3BQ2A 3NRWA 1T3QA 3RB0A 3BS7A 4F2RA 5A0LA 1KFTA 4QW8A 5ALTA 1L8LA 3MABA 3GFKB 3D2NA 5ALFA 5DB6A 1VLBA 2H3FA 3EPGA 4RQ1A 1N62A 1SKSA 2E8OA 5BOMA 3K1ZA 4GXKA 8ICHA 5KFJA 3TI0A 2Q0ZX 3GIJA 3PZPA 8ICAA 4NWIA 2PMZC 3KZXA 4JWMA 3AU6A 1UT5A 3MGHA 3V7JA 2HDOA 4F4KA 2MU2A 5KT2A 9ICMA 3NUQA 5H2FU 1S0OA 3HKZF 2W04A 4YD2A 4KMOB 3LDAA 3QZ7A 2F77X 2WHEA 4GC7A 4C8MA 1ZOLA 3DDHA 4BUGA 2BQ3A 4Z6EA 4TURA 1KDHA 1HUZA 9ICRA 5KFOA 2Y9TA 4UAVA 4ED1A 2OCEA 2RLTA 3BZCA 5DQHA 4EX6A 1SZPA 3GU3A 5J8YA 4KLUA 4EEYA 1X9SA 2QARB 2J6SA 1ECWA 9ICSA 2E3TA 5AKGA 4E0DA 2DFLA 4IQVA 4NV0A 4I2HA 1NK9A 4I2JA 4RQ6A 4XUSA 3RFAA 4RQMA 4YMMA 2KIVA 1NK6A 4NM1A 5AKEA 2K89A 2HBMA 4NXZA 2P6RA 1TV9A 2F1JA 4YCXA 1DK3A 2JEGA 4OJ6A 2WF5A 3MGIA 7ICOA 4J9SA 3N97B 1NK8A 2G08A 4Q43A 3TADC 4NL9C 4QZIA 1N61A 3M8SA 5BPCA 2QKQA 7ICQA 2YMPA 3QX7A 4UAWA 3TFSA 4PZNA 4R8UA 1Z1VA 3RRGA 2XICA 3GV8B 5DGAA 4BWJA 2YMLA 2RQ5A 2QLTA 4ICAA 3QUBA 2G5IB 4QIWF 1QSYA 1NNLA 3CP8A 3OSNA 3KFUF 7ICPA 4B9NA 2WAQF 3ZDDA 3CNHA 4Y2SA 5HHHA 1Z00A 4F50A 2V4QA 1JUDA 3SAHA 1N2XA 2W3SA 4RT2A 3RF9A 3MR3A 3GV7B 5AKZA 2E5SA 1Q3VA 1BPEA 4KLEA 1HIWA 2KTQA 3ZDAA 2W43A 2YN4A 3RJKA 5J0XA 1L7MA 5F9LA 4UBCA 2P6UA 4ECZA 1DGSA 3SQIA 1V9PA 1N5XA 1S0MA 4PGYA 3TFRA 1RZTA 1ZD2P 1YT3A 3C5FA 1ZJMA 5AM2A 4MFFA 2LMRA 1UPHA 8ICGA 5CB1A 1CRXA 4O3NA 3C29A 1OUQA 3HX0A 3Q8MA 2HHXA 1ZYQA 4ED6A 9ICXA 4KTQA 3ZDCA 3KHRA 1U45A 3RAXA 5IIMA 8ICMA 4AYBC 1D9DA 4ECRA 5DLFA 5IILA 4PL1A 5F3XB 4LZGA 3PW2A 4KLFA 1MA7A 5KT7A 2E1FA 2Y0SF 4QWDA 4LJXA 2BKEA 2JGAA 4X5VA 1DGJA 9ICLA 1NK5A 5AIBA 2KZ3A 1PZNA 5ALSA 2ZJAA 4ECSA 3H40A 4MFAA 2HBLA 4NLGA 3KHLA 3RRHA 2NRWA 2EZZA 2HVIA 3RB6A 3G6YA 1QQ5A 5J8YC 4KX3A 2ZUBA 5FP0A 4C7ZA 5ALIA 5GTIU 1ZRMA 3WKAA 1ZQPA 3QNMA 8ICIA 5EE1A 3EYZA 5J0WA 3WK8A 2WF9A 4C8LA 2I5HA 4QWBA 2W9CA 4JWNA 5J2BA 2FJ6A 1RXWA 2KE7A 2JRZA 2BCRA 3WKBA 2BPGA 2BGWA 4DSKA 1U47A 2HHUA 3NVYA 1X66A 5AKXA 2M0NA 5AI6A 2KK0A 4DOCA 2XY5A 3PR4A 4KLIA 3HILA 1WCNA 3PSIA 1FIQA 5HR7A 2P66A 3WK7A 4M6WA 2H3IA 1SV4A 5ALQA 2R8GA 4Y2VA 5L1JA 3IM1A 4P4PA 4ED7A 3GZFA 2K4EA 1L7NA 3JPPA 3NVZA 2KZZA 2WF6A 2GLEA 3V7LA 3T5HA 2CPRA 5IIKA 4CCHA 4C4RA 5L1LA 4OJPA 5IINA 4RQ4A 1HEKA 1O08A 2XGQA 3GIKA 1L3VA 1RXVA 8ICFA 4Y2UA 3N7PD 3KD3A 3MR5A 4YQWA 2W7PA 2CN1A 1SL2A 2BPCA 2BCSA 3H0RB 3KKAC 3D2QA 5J0TA 2VJ4A 2FI1A 5CWRA 4DL7A 3F2BA 2LKYA 1BPYA 4IS7A 5D49A 4M9GA 1ZQWA 8ICQA 2FDRA 2GWSA 5DQGA 4J9KA 1T3NA 4O3MA 5ALYA 4GIBA 1Z4OA 1JMSA 1X9XA 4KLDA 4K4GA 2VA8A 1BVSA 2PI4A 2JV3A 1UT8A 2JH1A 2NRVA 4B9UA 1D8LA 5ALGA 4KLOA 2E1EA 4QZ8A 3BQ7A 3ZDBA 1MQ3A 4KLJA 3QE9Y 2XCAA 1ZQEA 2PFOA 3M6KA 1ZQQA 3NS1A 2ZTCA 3QUCA 2BQUA 2ZIVB 2PKEA 1N60A 1X2IA 2AJQA 3HP6A 1XSNA 4DSFA 4R8UB 3OPXA 4KN7A 5J2AA 1S76D 2ZIWB 1HJPA 1MQ2A 4QWAA 2R8JA 4F5RA 1ZQGA 2W55A 3M6ZA 1KN5A 5EE9A 2W9MA 1ZQLA 4O5KA 2HCFA 4QZDA 4Z6FA 2FMPA 1Z4NA 1WWVA 5KNIA 1YZ6A 4UARA 2XIDA 5KTQA 4YR0A 4ECYA 1PVRA 4CNQA 8ICWA 1SZHA 4G3IA 4NLZA 3UQ0A 5J0YA 1J2NA 1ZETA 4PL2A 4I2BA 5KFQA 4OD0A 3M9OB 1FEZA 2AHOB 4OJ5A 1IM4A 4I2IA 3PO5A 5F9NA 2I9GA 4UQGA 5KFDA 5AI0A 4UBBA 5ALJA 2PI5A 8ICTA 1JRPA 1Z19A 4C7YA 1X40A 4EENA 4AP9A 2EZXA 4J9NA 3JPSA 3BQ1A 2JZBA 1P7DA 3Q8RB 3JPRA 3R9KA 5KFUA 9ICEA 4KLTA 1SXEA 2W8LA 3LVWA 4DS4A 5DBBA 4NL9A 5AKYA 5KL1B 1JX4A 8ICKA 2FPLA 4RT3A 3D6JA 3PSFA 8ICNA 1PK1A 4Q44A 5J2CA 1EXNA 7ICFA 3E58A 3RTVA 4DSEA 1WYGA 4NLKA 1J97A 2AQ4A 2JEJA 1DK2A 1COOA 3UMCA 2BHNA 3PX4A 2XY7A 1A0PA 3RR7A 4B6JA 3AQFA 5ALXA 5TZVA 1N63A 7ICMA 3C1YA 5EE3A 5D46A 1SKRA 4PZOA 1WWUA 4YG2A 5DG8A 8ICVA 2C2EA 1U9LA 1N5WA 2EAMA 5G5GA 2HBKA 3L3FX 4KLGA 3T79A 4DF8A 3SYZA 4I2GA 1ZRNA 1ZD4A 5AK6A 3F53A 4Y2XA 4KLQA 4Y2JA 1TVAA 3BS5A 4Q8EA 9ICCA 1XSLA 2ZIVA 5ALHA 2Q4TA 2DL0A 3BDPA 4YN4A 5J0PA 2DF4B 5DG7A 4CDGA 4Y2YA 3WK6A 3HW8A 8ICJA 4DLEA 4BWMA 5J2KA 5KFTA 4Q8FA 3H8JA 3V6HA 1ZQFA 3Q8LA 2KHVA 2K4IA 3UPQA 4R65A 5AI4A 3C28A 2G07A 3H8SA 2C22A 4F71A 1JXEA 2BDUA 3QXGA 3RB3A 4O9MA 3FM9A 1Y88A 1M6YA 1T4GA 1TAMA 4FBTA 3ZI4A 4DFPA 3H8WA 5HP4A 1TFRA 4DSIA 3OJSA 3L4PA 2OM6A 4EBDA 4MEXA 1ZQOA 4DSJA 4ECXA 1ZQUA 2KSOA 4CF4A 1ZQHA 3IHQB 1ZQBA 2R8IA 2I1QA 1NZBA 4DOAA 4UB8U 1U49A 1TKDA 3TAPA 9ICOA 2FLLA 2DPJA 1LV5A 4RNNA 2G0AA 3B0YA 4WJ3B 2UVVA 1O03A 3WK4A 3KOOA 1ED1A 3O0FA 3MGVA
chains in the Genus database with same CATH topology
3BS7A 4MHVA 2EAMA 2GLEA 1WWVA 5KNIA 1JI7A 3K1RB 5F3XB 3TADC 4NL9C 2QKQA 1F0MA 1COKA 2EANA 2K60A 2KMDA 3BS5B 2E8MA 2E8OA 5JU5A 1OXJA 4PZNA 1Z1VA 1UCVA 2QB0A 3BS5A 1SV0C 2EAOA 1LKYB 3KKAC 2DL0A 1PK1B 2FE9A 2LPEA 5J8YC 1X40A 4IS7A 5JTIA 3H8MA 4RQNA 2KG5A 1V38A 3IDWA 2F3NA 2ES6A 2ESEA 1X9XA 2QARA 2B6GA 1SXEA 2K4PA 2JV3A 4NJ8A 1SGGA 4NL9A 3SENA 2KSOB 2QB1A 3TADA 2Y9TA 2F8KA 1V85A 3BQ7A 1OW5A 2E8NA 1KW4A 2L5YA 2KE7A 1PK1A 2F44A 1LKYA 1SXDA 2DKZA 5J8YA 2QARB 3SEIA 2Y9UA 2D8CA 1X66A 3TACB 1B0XA 2YTUA 1RG6A 1SV0A 2DKXA 2KSOA 2LMRA 3HILA 3KKAA 2QB0B 4RQMA 2D3DA 1SV4A 1DXSA 2KIVA 5JRTA 1UQVA 2EAPA 2E8PA 4PZOA 1WWUA 1PK3A 1B4FA 5L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS7 A;  4MHV A;  2EAM A;  2GLE A;  1WWV A;  5KNI A;  1JI7 A;  3K1R B;  5F3X B;  3TAD C;  4NL9 C;  2QKQ A;  1F0M A;  1COK A;  2EAN A;  2K60 A;  2KMD A;  3BS5 B;  2E8M A;  2E8O A;  5JU5 A;  1OXJ A;  4PZN A;  1Z1V A;  1UCV A;  2QB0 A;  3BS5 A;  1SV0 C;  2EAO A;  1LKY B;  3KKA C;  2DL0 A;  1PK1 B;  2FE9 A;  2LPE A;  5J8Y C;  1X40 A;  4IS7 A;  5JTI A;  3H8M A;  4RQN A;  2KG5 A;  1V38 A;  3IDW A;  2F3N A;  2ES6 A;  2ESE A;  1X9X A;  2QAR A;  2B6G A;  1SXE A;  2K4P A;  2JV3 A;  4NJ8 A;  1SGG A;  4NL9 A;  3SEN A;  2KSO B;  2QB1 A;  3TAD A;  2Y9T A;  2F8K A;  1V85 A;  3BQ7 A;  1OW5 A;  2E8N A;  1KW4 A;  2L5Y A;  2KE7 A;  1PK1 A;  2F44 A;  1LKY A;  1SXD A;  2DKZ A;  5J8Y A;  2QAR B;  3SEI A;  2Y9U A;  2D8C A;  1X66 A;  3TAC B;  1B0X A;  2YTU A;  1RG6 A;  1SV0 A;  2DKX A;  2KSO A;  2LMR A;  3HIL A;  3KKA A;  2QB0 B;  4RQM A;  2D3D A;  1SV4 A;  1DXS A;  2KIV A;  5JRT A;  1UQV A;  2EAP A;  2E8P A;  4PZO A;  1WWU A;  1PK3 A;  1B4F A;  5L1M A; 
#chains in the Genus database with same CATH topology
 3EPI A;  5BOL A;  4RQ2 A;  3T5K A;  4I2F A;  1ARO P;  2FMQ A;  4Y2P A;  3VC8 A;  1F0M A;  2R8K A;  2OYY A;  3BS5 B;  3V6K A;  1S8O A;  5KT3 A;  4GXI A;  1K1S A;  1ZD3 A;  3UMB A;  3BQ0 A;  4J03 A;  1MN8 A;  5J2H A;  3ICX A;  3ISB A;  3UMG A;  1KEJ A;  5IIJ A;  4Y2R A;  2ESE A;  4UB4 A;  4P0P B;  4NLB A;  3LWL A;  1QSS A;  1ZQS A;  4TQS A;  2VA3 A;  3NVW A;  3GIM A;  1XO0 A;  4AYB F;  3FC4 A;  4RQ5 A;  1HUO A;  4RNM A;  4PPX A;  3GV5 B;  1DRG A;  5CHG A;  5AM1 A;  4PGX A;  5KFM A;  5KG1 A;  4XA5 A;  2DWQ A;  5AM3 A;  2W11 A;  2KVS A;  3PX0 A;  4CGZ A;  4F3O A;  2WB1 C;  3LWM A;  3OTQ A;  3QYP A;  8ICC A;  3V6J A;  4CRX A;  2A1J B;  3CW2 C;  1H38 A;  1F5S A;  3HWT A;  2QB0 B;  9ICH A;  3PW4 A;  2OWO A;  1JN3 A;  2ZXI A;  4PHP A;  1KKX A;  5CP2 A;  3KZI U;  4MEY A;  2IMW P;  5DDY A;  5AHX A;  1KRP A;  2IBK A;  3NTU A;  1KLN A;  2A3V A;  1BPD A;  1A77 A;  5EE0 A;  5L1M A;  1XNS A;  7ICJ A;  2LYA A;  2R8H A;  3TQ1 A;  2ZXH A;  4CF3 A;  3QUQ A;  3RJE A;  2K60 A;  2KMD A;  4IQW A;  2KOB A;  1S0V A;  4PHA A;  9ICF A;  4Z6D A;  5J29 A;  2K8B B;  1UCV A;  2V4R A;  3PMN A;  5AIA A;  3FAH A;  4QIW C;  1PK1 B;  1XO1 A;  4DL6 A;  2LPE A;  2ZJ5 A;  5KAF U;  3QU9 A;  3OSP A;  4EX7 A;  2KG5 A;  4M04 A;  2XI9 A;  3G6V A;  3C1Z A;  4R66 A;  1Q3U A;  2HOI A;  2ISP A;  3UXN A;  1NJY A;  2PFQ A;  4KLS A;  4QZG A;  4KIT B;  2GOL A;  5J2I A;  4M47 A;  3I1Y A;  5ALZ A;  4TQR A;  3M8R A;  3H0M B;  5KFR A;  5ALO A;  1N56 A;  1FFV A;  1ZQZ A;  1RM6 C;  2H3V A;  4ED8 A;  3RJI A;  3CRX A;  4C8K A;  2HW3 A;  2HHW A;  3LK9 A;  2UVU A;  2DUY A;  2KZM A;  3DEE A;  4IQU A;  3TKA A;  4KX5 A;  3C5G A;  4JK1 A;  4F5N A;  4RQ3 A;  2YQE A;  2RDJ A;  4DWI A;  2KIW A;  3EUB 2;  3M1Y A;  3IN5 A;  5KFC A;  4QZC A;  4UAT A;  1NJX A;  1XC9 A;  1S10 A;  2BPF A;  4IC9 A;  2EDU A;  5AKH A;  2JZB B;  4YR2 A;  2PMZ F;  5J0S A;  4DFD A;  3RAQ A;  5KFP A;  4J9M A;  3RH5 A;  2JEF A;  1QCK A;  3WU2 U;  4P4M A;  2J6T A;  1URJ A;  2HHS A;  2MUT B;  1ZXI A;  2VA2 A;  3C2L A;  3AQE A;  5DG9 A;  1S97 A;  7ICH A;  8ICY A;  3S6J A;  2AGP A;  3Q8K A;  2VAN A;  5J0Q A;  3SI8 A;  1QTM A;  9ICG A;  4O3R A;  5G5H A;  1ZQR A;  4B9S A;  4YFK A;  5HR6 A;  1Q8K A;  4M9H A;  2NRZ A;  1OXJ A;  1ZQI A;  3H0L B;  4Z6C A;  4JB3 A;  1BPZ A;  4QZ9 A;  4F93 B;  3HT3 A;  2EAO A;  1ZQD A;  7ICU A;  3OHA A;  4DL5 A;  3THV A;  2WAQ C;  2OH2 A;  2D6F C;  3UXO A;  2ZIX A;  2W8K A;  3ZDE A;  3NAS A;  1SKW A;  3G6X A;  1X9W A;  4UAS A;  2JH7 A;  1KQQ A;  8ICX A;  2H3Z A;  1QSL A;  4ED3 A;  4FZL A;  3OGU A;  1NKC A;  3PR5 B;  9ICB A;  1FFU A;  1SB3 C;  2MA1 A;  2K4P A;  5DB9 A;  8ICP A;  4M0A A;  3SEN A;  3DV9 A;  3AUO A;  3PML A;  1KL9 A;  1TAQ A;  2JR5 A;  1TK5 A;  4B9V A;  2GH1 A;  5KFW A;  4IR9 A;  1TE2 A;  2XO7 A;  4BXO A;  2DBY A;  5DB8 A;  1LKY A;  4OJO A;  5ALR A;  5HNK A;  3MDC A;  1CI4 A;  1LVH A;  3D2S A;  3JPO A;  1SWW A;  1B0X A;  5EWG A;  1ZQY A;  4QWE A;  3V72 A;  3ISD A;  3ONN A;  2G06 A;  1ZQJ A;  8ICL A;  4UAY A;  2KKV A;  5ALU A;  4ELV A;  2HBJ A;  2D3D A;  1F44 A;  2JEI A;  1A6S A;  4IL6 U;  3J81 j;  4US8 A;  5AI5 A;  1NK0 A;  3AU2 A;  3HJE A;  5KFN A;  4PH5 A;  4I28 A;  5HML A;  1B4F A;  4EEK A;  4ECU A;  5J2F A;  4F4W A;  1C20 A;  4DF4 A;  3T5J A;  1QQ6 A;  2V9W A;  4JMU A;  4Y2Q A;  3PX6 A;  4B9T A;  4FFD A;  3HPO A;  1X6I A;  5J0U A;  5JU5 A;  1AQ6 A;  4F91 B;  4PGQ A;  5KG6 A;  2WTF A;  2ZG6 A;  5KG7 A;  4U7C A;  1SV0 C;  3C23 A;  4ECQ A;  1ZQ1 C;  2FLN A;  2FLP A;  2LHT A;  4UAU A;  4QW9 A;  3GIL A;  1IIP A;  1ZQN A;  1PVP A;  2EQY A;  5C0Y A;  3Q8P B;  2KJ9 A;  2C2D A;  3WKC A;  4PHE A;  3RBD A;  4F4Z A;  2MSN A;  4DQQ A;  7ICV A;  2P35 A;  2NV3 A;  1S0N A;  4QZE A;  1L7O A;  3GDX A;  3TAQ A;  5III A;  4FE3 A;  2KSO B;  1TK0 A;  2B0C A;  3LVV A;  2NO4 A;  4RU9 A;  2VJ5 A;  2FMS A;  2L5Y A;  2KFN A;  9ICP A;  4ED0 A;  4FZN A;  1MC8 A;  1SXD A;  2DKZ A;  5JUM A;  4QZH A;  5ALW A;  4GLX A;  2HI0 A;  4O5E A;  2AXT U;  1ZJN A;  2ATL A;  2YTU A;  2HSZ A;  4EZ6 A;  1JXL A;  4JV0 A;  1N48 A;  7ICN A;  3PY8 A;  2J6U A;  1T7P A;  1WG8 A;  2RHF A;  4I2C A;  1ZQM A;  4CE6 A;  2ALZ A;  5AM4 A;  1KSP A;  9ICJ A;  2LYH A;  4UAZ A;  2GO7 A;  1RDF A;  2F1H A;  4R63 A;  3F2D A;  5J2E A;  3MDA A;  3TAD A;  1IXR A;  1NJZ A;  4MHV A;  4JUZ A;  2G09 A;  4YMN A;  4F5P A;  4RNO A;  4P2H A;  3NGD A;  3K1R B;  2K8C B;  4QNL A;  2N1R A;  3ETL A;  4KMU A;  5HMM A;  4I29 A;  3PV8 A;  3I76 A;  4PJ0 U;  3SZ2 A;  3KHG A;  1NKE A;  2A1J A;  3BJY A;  4M9N A;  1JIH A;  3EZ5 A;  4F92 B;  2Z7J A;  4XRH A;  3SR6 A;  3IRU A;  4NLN A;  2BR0 A;  2C28 A;  2FE9 A;  4RPZ A;  4JV1 A;  4QZA A;  8ICZ A;  4K4I A;  2YY6 A;  2DGZ A;  2ASJ A;  9ICW A;  3QEB Z;  3HKZ C;  3MFI A;  4MFC A;  1U4B A;  2XGP A;  3QU7 A;  5K4L A;  2RRD A;  1K5O A;  2QAR A;  8ICB A;  1D8B A;  2B6G A;  4IQT A;  2ASD A;  4NJ8 A;  2AH5 A;  3PNC A;  2H3Q A;  1ZQX A;  5KFG A;  2HHT A;  2NRT A;  4PHD A;  3SD7 A;  3M9N B;  1L8O A;  3QUT A;  4FBU A;  1IV8 A;  1ZQA A;  4RQ8 A;  1NK4 A;  4ELT A;  1RYR A;  3FYH A;  1NK7 A;  3WK9 A;  2ZTE A;  2YX8 A;  1B43 A;  5KFB A;  5AIC A;  4M9J A;  2KFZ A;  5ALL A;  2LM1 A;  3SAG A;  4I27 A;  4NY8 A;  5DQI A;  3ETR A;  1L3U A;  2ZIU A;  4O3S A;  2F8K A;  2WFA A;  3RR8 A;  4OCZ A;  3RBE A;  5CJ7 A;  4O3O A;  1B22 A;  3QZ8 A;  4M6W B;  5DBC A;  3MBY A;  1T94 A;  2QB0 A;  1ZQV A;  9ICU A;  1RYU A;  1TAU A;  3U26 A;  4K4H A;  2OHF A;  2EH9 A;  4XQ8 A;  2JHD A;  4BJQ A;  4R64 A;  4IR1 A;  2W7O A;  1DOQ A;  2UVW A;  4KLM A;  2AU0 A;  3AEV A;  4I2A A;  1UA0 A;  7ICL A;  2K8A A;  4EEL A;  3MC1 A;  4F5Q A;  4Q45 A;  2KJ8 A;  4YR3 A;  1BGX T;  2F3N A;  2ES6 A;  1D9F A;  8ICE A;  4UB1 A;  2M9N A;  4FO6 A;  3A0H U;  2KKP A;  3ALR A;  2IHN A;  3KTQ A;  2IHM A;  3JPQ A;  2FPM A;  2YB4 A;  3H4D A;  8ICS A;  3C21 A;  4P0P A;  4TUP A;  4ZH4 A;  5DKW A;  5AKJ A;  7ICG A;  5EWF A;  1V85 A;  4A8E A;  1OW5 A;  5EWE A;  4B9L A;  5AK4 A;  1BPX A;  2F1I A;  2NYV A;  2NO5 A;  4DL2 A;  1U48 A;  2YMM A;  1RPL A;  3N28 A;  3TAC B;  4B9M A;  5DLG A;  4U6P A;  4EBC A;  4P0Q B;  3F5A A;  2ZTD A;  3IG8 A;  1QQ7 A;  3WKE A;  3IV6 A;  4EYH B;  4RPX A;  5AKL A;  4RUC A;  3ZD8 A;  4DO9 A;  3PO4 A;  1UHU A;  3PVX A;  4OO1 J;  2XCP A;  5IIO A;  3UM9 A;  2RP5 A;  4ELU A;  1COK A;  1L3T A;  4I2D A;  2AGQ A;  2PFN A;  4DFJ A;  2HHQ A;  4I2E A;  4NM2 A;  2A19 A;  1S5L U;  4YD1 A;  5AI9 A;  7ICS A;  1NI3 A;  3MR2 A;  1Z3E B;  2MRL A;  4YVZ A;  1LB2 B;  4DQS A;  3RH4 A;  3UQ2 A;  8ICU A;  3JPN A;  3FDS A;  5CR0 A;  2KP7 A;  1BPB A;  1QLN A;  2W54 A;  3ISC A;  4RQ0 A;  3N4M B;  5KFK A;  4RQN A;  4UB5 A;  1V38 A;  2CRX A;  2BDP A;  2KJ5 A;  5C5J A;  5DBA A;  3RB4 A;  3LYS A;  5CA7 A;  3GII A;  3F5E A;  4LZD A;  3KHH A;  2PFP A;  3IP4 B;  2ASL A;  2ZIW A;  4QWC A;  3H4B A;  5J2D A;  2ZUD A;  3B9J A;  5KFE A;  4QZB A;  5KG2 A;  2K4H A;  5GTH U;  5E79 U;  7ICE A;  4F5O A;  5ALM A;  1KFD A;  1SL1 A;  1ZD5 A;  5AK3 A;  4YXM A;  3T3F A;  2KHQ A;  2ZIX B;  2LYB A;  1XWL A;  2W9A A;  3Q8S B;  2DQN B;  1QH9 A;  1BNP A;  2LI6 A;  5ALD A;  2D8C A;  5AKI A;  1FO4 A;  4DFK A;  2HHV A;  2WB1 F;  4MF8 A;  4M9L A;  2KIC A;  3K4G A;  2WF7 A;  5KFA A;  4RQ7 A;  3QEA Z;  3AN1 A;  4DLG A;  2PXI A;  2H5X A;  2F76 X;  5AKK A;  1NZP A;  2B21 A;  1S77 D;  2UVR A;  3MFH A;  4YXJ A;  2EZY A;  1SIJ A;  2EAP A;  2Y1J A;  2E8P A;  2HMX A;  4YMO A;  5KFF A;  2OXO A;  3ED5 A;  8ICR A;  2MUT A;  3QU4 A;  9ICN A;  4UB2 A;  2FPK A;  5KG0 A;  2YB1 A;  2BZF A;  4DFM A;  2EAN A;  4ECT A;  2IA6 A;  4EBE A;  4O5C A;  4US9 A;  4CF5 A;  4KLL A;  4OJL A;  4ZOH C;  2BQR A;  9ICT A;  1RYS A;  3RH6 A;  4DSL A;  5KAI U;  3I28 A;  2R18 A;  3ORY A;  4DEZ A;  3SV3 A;  2MAX A;  3AMZ A;  5ALV A;  5KFS A;  2OEH A;  3WKD A;  5KG3 A;  4ED2 A;  4FS1 A;  2KVC A;  4C4S A;  5KT4 A;  4F72 A;  2HOF A;  5J2J A;  4F8R A;  4F4Y A;  1NJW A;  1K1Q A;  5AK5 A;  3PW0 A;  1T8E A;  3RJG A;  4DQR A;  3AM9 A;  3PSP A;  2BCU A;  2F2A B;  3E0F A;  2QB1 A;  9ICI A;  4QZF A;  5D4B A;  4QJF B;  4IRC A;  5CEH A;  3RJJ A;  2Y0S C;  2W3R A;  3OHB A;  4BGD A;  1L5U A;  1YZ7 A;  3V7K A;  3PW5 A;  1A76 A;  2KN7 A;  3IG5 A;  5KT6 A;  1PVQ A;  1J2M A;  4IRK A;  5AM5 A;  1RQL A;  3SEI A;  2W9C B;  2Y9U A;  1JAL A;  1UA1 A;  1RG6 A;  2DKX A;  5AI8 A;  5T14 A;  1Z1B A;  4DCC A;  2LBO A;  3RJF A;  5AM0 A;  2DPI A;  4DL4 A;  2A1A A;  3C2M A;  1KFS A;  1DXS A;  4P4O A;  5JRT A;  1UQV A;  3RJH A;  4USA A;  7ICK A;  1L7P A;  1PK3 A;  1CEZ A;  3L5K A;  3CYM A;  2ZUC A;  4MF2 A;  4GC6 A;  1RQN A;  2XC9 A;  1JI7 A;  1NOM A;  1Q46 A;  3T5L A;  1L3S A;  4JV2 A;  1L6N A;  3N7R C;  2CXY A;  4FS2 A;  5KG4 A;  2G5H B;  5ALP A;  2BCQ A;  5ALN A;  3UXP A;  5L1K A;  2KV2 A;  3WK5 A;  5HHI A;  1ZQK A;  5KFL A;  4DQI A;  4UB3 A;  3N7S C;  5B5E U;  1C7Y A;  4RZR A;  3AL0 B;  2AQ0 A;  3M7D A;  3NVV A;  4FZM A;  5JTI A;  5DB7 A;  2AGO A;  2W9B B;  2KNJ A;  2O6K A;  2ISO A;  3TAR A;  3OJU A;  3PW7 A;  4DQP A;  3ZD9 A;  1VJ5 A;  4F2S A;  2W9B A;  2HVH A;  1XS9 D;  3BZK A;  5KL8 B;  4KN4 A;  1V97 A;  1KW4 A;  4M2Y A;  1X9M A;  3SV4 A;  2NRX A;  2F44 A;  4C8O A;  2F8L A;  1XU4 A;  4DL3 A;  8ICO A;  3QU5 A;  3A0B U;  2XY6 A;  1NKB A;  1CUK A;  4BX9 C;  5KFY A;  5TIS U;  2ODG A;  4J9Q A;  2VKQ A;  4HAI A;  1X6J A;  1KBU A;  2JMG A;  4EZ9 A;  2W03 A;  5KFZ A;  5J2G A;  4GXJ A;  4UB6 U;  1MSW D;  3E2E A;  4C80 A;  1SL0 A;  4BXO B;  3GQC A;  3SMV A;  5KT5 A;  4HYK A;  4RUA A;  3TAN A;  3C2K A;  9ICQ A;  2XVT A;  4J9P A;  5CRX A;  3MR6 A;  3QU2 A;  9ICV A;  1D8Y A;  5B66 U;  5L9X A;  4ECV A;  1VDV A;  2IOF A;  9ICK A;  1SWV A;  5KFH A;  2E8M A;  3SAF A;  4TUS A;  5ALK A;  1PUZ A;  5DDM A;  9ICA A;  4G9B A;  4GFJ A;  2BCV A;  7ICR A;  5EOZ A;  1LKY B;  4O0I A;  3Q8Q B;  2RDI A;  1IG6 A;  5KFX A;  1JRO A;  1S9F A;  2HOQ A;  4NLC A;  2IOF K;  1XSP A;  5DGB A;  4RPY A;  4J9R A;  4UW9 A;  7ICT A;  3HRD D;  4F4X A;  3H8M A;  4C4T A;  7ICI A;  3IDW A;  5KFV A;  1TK8 A;  4O3P A;  3EW9 A;  5L1I A;  1WUD A;  4DS5 A;  5KG5 A;  2LM4 A;  2C2R A;  3JPT A;  5J0O A;  4KLH A;  2Y1I A;  5J0R A;  1SGG A;  1ZQC A;  2JXJ A;  2KEY A;  3H7I A;  4P0Q A;  4O3Q A;  1KTQ A;  2KD1 A;  2IOH A;  4C0Z A;  4YP3 A;  2E8N A;  2YMQ A;  3BQT A;  2ZJ8 A;  3K75 D;  3F2C A;  4C8N A;  4J9O A;  3EWA A;  4TUQ A;  4ECW A;  1X42 A;  4ACO A;  4DOB A;  1SV0 A;  4LVS A;  3VCB A;  4EYI B;  3KKA A;  4Y2T A;  2ZIU B;  1Z00 B;  2WF8 A;  3B0X A;  3KBB A;  4J9L A;  3PST A;  1BNO A;  4IRD A;  4BDP A;  2VIX A;  2I6X A;  1ZQT A;  3NRZ A;  3M9M B;  1GO3 F;  1WCL A;  5KFI A;  5ALE A;  3BQ2 A;  3NRW A;  1T3Q A;  3RB0 A;  3BS7 A;  4F2R A;  5A0L A;  1KFT A;  4QW8 A;  5ALT A;  1L8L A;  3MAB A;  3GFK B;  3D2N A;  5ALF A;  5DB6 A;  1VLB A;  2H3F A;  3EPG A;  4RQ1 A;  1N62 A;  1SKS A;  2E8O A;  5BOM A;  3K1Z A;  4GXK A;  8ICH A;  5KFJ A;  3TI0 A;  2Q0Z X;  3GIJ A;  3PZP A;  8ICA A;  4NWI A;  2PMZ C;  3KZX A;  4JWM A;  3AU6 A;  1UT5 A;  3MGH A;  3V7J A;  2HDO A;  4F4K A;  2MU2 A;  5KT2 A;  9ICM A;  3NUQ A;  5H2F U;  1S0O A;  3HKZ F;  2W04 A;  4YD2 A;  4KMO B;  3LDA A;  3QZ7 A;  2F77 X;  2WHE A;  4GC7 A;  4C8M A;  1ZOL A;  3DDH A;  4BUG A;  2BQ3 A;  4Z6E A;  4TUR A;  1KDH A;  1HUZ A;  9ICR A;  5KFO A;  2Y9T A;  4UAV A;  4ED1 A;  2OCE A;  2RLT A;  3BZC A;  5DQH A;  4EX6 A;  1SZP A;  3GU3 A;  5J8Y A;  4KLU A;  4EEY A;  1X9S A;  2QAR B;  2J6S A;  1ECW A;  9ICS A;  2E3T A;  5AKG A;  4E0D A;  2DFL A;  4IQV A;  4NV0 A;  4I2H A;  1NK9 A;  4I2J A;  4RQ6 A;  4XUS A;  3RFA A;  4RQM A;  4YMM A;  2KIV A;  1NK6 A;  4NM1 A;  5AKE A;  2K89 A;  2HBM A;  4NXZ A;  2P6R A;  1TV9 A;  2F1J A;  4YCX A;  1DK3 A;  2JEG A;  4OJ6 A;  2WF5 A;  3MGI A;  7ICO A;  4J9S A;  3N97 B;  1NK8 A;  2G08 A;  4Q43 A;  3TAD C;  4NL9 C;  4QZI A;  1N61 A;  3M8S A;  5BPC A;  2QKQ A;  7ICQ A;  2YMP A;  3QX7 A;  4UAW A;  3TFS A;  4PZN A;  4R8U A;  1Z1V A;  3RRG A;  2XIC A;  3GV8 B;  5DGA A;  4BWJ A;  2YML A;  2RQ5 A;  2QLT A;  4ICA A;  3QUB A;  2G5I B;  4QIW F;  1QSY A;  1NNL A;  3CP8 A;  3OSN A;  3KFU F;  7ICP A;  4B9N A;  2WAQ F;  3ZDD A;  3CNH A;  4Y2S A;  5HHH A;  1Z00 A;  4F50 A;  2V4Q A;  1JUD A;  3SAH A;  1N2X A;  2W3S A;  4RT2 A;  3RF9 A;  3MR3 A;  3GV7 B;  5AKZ A;  2E5S A;  1Q3V A;  1BPE A;  4KLE A;  1HIW A;  2KTQ A;  3ZDA A;  2W43 A;  2YN4 A;  3RJK A;  5J0X A;  1L7M A;  5F9L A;  4UBC A;  2P6U A;  4ECZ A;  1DGS A;  3SQI A;  1V9P A;  1N5X A;  1S0M A;  4PGY A;  3TFR A;  1RZT A;  1ZD2 P;  1YT3 A;  3C5F A;  1ZJM A;  5AM2 A;  4MFF A;  2LMR A;  1UPH A;  8ICG A;  5CB1 A;  1CRX A;  4O3N A;  3C29 A;  1OUQ A;  3HX0 A;  3Q8M A;  2HHX A;  1ZYQ A;  4ED6 A;  9ICX A;  4KTQ A;  3ZDC A;  3KHR A;  1U45 A;  3RAX A;  5IIM A;  8ICM A;  4AYB C;  1D9D A;  4ECR A;  5DLF A;  5IIL A;  4PL1 A;  5F3X B;  4LZG A;  3PW2 A;  4KLF A;  1MA7 A;  5KT7 A;  2E1F A;  2Y0S F;  4QWD A;  4LJX A;  2BKE A;  2JGA A;  4X5V A;  1DGJ A;  9ICL A;  1NK5 A;  5AIB A;  2KZ3 A;  1PZN A;  5ALS A;  2ZJA A;  4ECS A;  3H40 A;  4MFA A;  2HBL A;  4NLG A;  3KHL A;  3RRH A;  2NRW A;  2EZZ A;  2HVI A;  3RB6 A;  3G6Y A;  1QQ5 A;  5J8Y C;  4KX3 A;  2ZUB A;  5FP0 A;  4C7Z A;  5ALI A;  5GTI U;  1ZRM A;  3WKA A;  1ZQP A;  3QNM A;  8ICI A;  5EE1 A;  3EYZ A;  5J0W A;  3WK8 A;  2WF9 A;  4C8L A;  2I5H A;  4QWB A;  2W9C A;  4JWN A;  5J2B A;  2FJ6 A;  1RXW A;  2KE7 A;  2JRZ A;  2BCR A;  3WKB A;  2BPG A;  2BGW A;  4DSK A;  1U47 A;  2HHU A;  3NVY A;  1X66 A;  5AKX A;  2M0N A;  5AI6 A;  2KK0 A;  4DOC A;  2XY5 A;  3PR4 A;  4KLI A;  3HIL A;  1WCN A;  3PSI A;  1FIQ A;  5HR7 A;  2P66 A;  3WK7 A;  4M6W A;  2H3I A;  1SV4 A;  5ALQ A;  2R8G A;  4Y2V A;  5L1J A;  3IM1 A;  4P4P A;  4ED7 A;  3GZF A;  2K4E A;  1L7N A;  3JPP A;  3NVZ A;  2KZZ A;  2WF6 A;  2GLE A;  3V7L A;  3T5H A;  2CPR A;  5IIK A;  4CCH A;  4C4R A;  5L1L A;  4OJP A;  5IIN A;  4RQ4 A;  1HEK A;  1O08 A;  2XGQ A;  3GIK A;  1L3V A;  1RXV A;  8ICF A;  4Y2U A;  3N7P D;  3KD3 A;  3MR5 A;  4YQW A;  2W7P A;  2CN1 A;  1SL2 A;  2BPC A;  2BCS A;  3H0R B;  3KKA C;  3D2Q A;  5J0T A;  2VJ4 A;  2FI1 A;  5CWR A;  4DL7 A;  3F2B A;  2LKY A;  1BPY A;  4IS7 A;  5D49 A;  4M9G A;  1ZQW A;  8ICQ A;  2FDR A;  2GWS A;  5DQG A;  4J9K A;  1T3N A;  4O3M A;  5ALY A;  4GIB A;  1Z4O A;  1JMS A;  1X9X A;  4KLD A;  4K4G A;  2VA8 A;  1BVS A;  2PI4 A;  2JV3 A;  1UT8 A;  2JH1 A;  2NRV A;  4B9U A;  1D8L A;  5ALG A;  4KLO A;  2E1E A;  4QZ8 A;  3BQ7 A;  3ZDB A;  1MQ3 A;  4KLJ A;  3QE9 Y;  2XCA A;  1ZQE A;  2PFO A;  3M6K A;  1ZQQ A;  3NS1 A;  2ZTC A;  3QUC A;  2BQU A;  2ZIV B;  2PKE A;  1N60 A;  1X2I A;  2AJQ A;  3HP6 A;  1XSN A;  4DSF A;  4R8U B;  3OPX A;  4KN7 A;  5J2A A;  1S76 D;  2ZIW B;  1HJP A;  1MQ2 A;  4QWA A;  2R8J A;  4F5R A;  1ZQG A;  2W55 A;  3M6Z A;  1KN5 A;  5EE9 A;  2W9M A;  1ZQL A;  4O5K A;  2HCF A;  4QZD A;  4Z6F A;  2FMP A;  1Z4N A;  1WWV A;  5KNI A;  1YZ6 A;  4UAR A;  2XID A;  5KTQ A;  4YR0 A;  4ECY A;  1PVR A;  4CNQ A;  8ICW A;  1SZH A;  4G3I A;  4NLZ A;  3UQ0 A;  5J0Y A;  1J2N A;  1ZET A;  4PL2 A;  4I2B A;  5KFQ A;  4OD0 A;  3M9O B;  1FEZ A;  2AHO B;  4OJ5 A;  1IM4 A;  4I2I A;  3PO5 A;  5F9N A;  2I9G A;  4UQG A;  5KFD A;  5AI0 A;  4UBB A;  5ALJ A;  2PI5 A;  8ICT A;  1JRP A;  1Z19 A;  4C7Y A;  1X40 A;  4EEN A;  4AP9 A;  2EZX A;  4J9N A;  3JPS A;  3BQ1 A;  2JZB A;  1P7D A;  3Q8R B;  3JPR A;  3R9K A;  5KFU A;  9ICE A;  4KLT A;  1SXE A;  2W8L A;  3LVW A;  4DS4 A;  5DBB A;  4NL9 A;  5AKY A;  5KL1 B;  1JX4 A;  8ICK A;  2FPL A;  4RT3 A;  3D6J A;  3PSF A;  8ICN A;  1PK1 A;  4Q44 A;  5J2C A;  1EXN A;  7ICF A;  3E58 A;  3RTV A;  4DSE A;  1WYG A;  4NLK A;  1J97 A;  2AQ4 A;  2JEJ A;  1DK2 A;  1COO A;  3UMC A;  2BHN A;  3PX4 A;  2XY7 A;  1A0P A;  3RR7 A;  4B6J A;  3AQF A;  5ALX A;  5TZV A;  1N63 A;  7ICM A;  3C1Y A;  5EE3 A;  5D46 A;  1SKR A;  4PZO A;  1WWU A;  4YG2 A;  5DG8 A;  8ICV A;  2C2E A;  1U9L A;  1N5W A;  2EAM A;  5G5G A;  2HBK A;  3L3F X;  4KLG A;  3T79 A;  4DF8 A;  3SYZ A;  4I2G A;  1ZRN A;  1ZD4 A;  5AK6 A;  3F53 A;  4Y2X A;  4KLQ A;  4Y2J A;  1TVA A;  3BS5 A;  4Q8E A;  9ICC A;  1XSL A;  2ZIV A;  5ALH A;  2Q4T A;  2DL0 A;  3BDP A;  4YN4 A;  5J0P A;  2DF4 B;  5DG7 A;  4CDG A;  4Y2Y A;  3WK6 A;  3HW8 A;  8ICJ A;  4DLE A;  4BWM A;  5J2K A;  5KFT A;  4Q8F A;  3H8J A;  3V6H A;  1ZQF A;  3Q8L A;  2KHV A;  2K4I A;  3UPQ A;  4R65 A;  5AI4 A;  3C28 A;  2G07 A;  3H8S A;  2C22 A;  4F71 A;  1JXE A;  2BDU A;  3QXG A;  3RB3 A;  4O9M A;  3FM9 A;  1Y88 A;  1M6Y A;  1T4G A;  1TAM A;  4FBT A;  3ZI4 A;  4DFP A;  3H8W A;  5HP4 A;  1TFR A;  4DSI A;  3OJS A;  3L4P A;  2OM6 A;  4EBD A;  4MEX A;  1ZQO A;  4DSJ A;  4ECX A;  1ZQU A;  2KSO A;  4CF4 A;  1ZQH A;  3IHQ B;  1ZQB A;  2R8I A;  2I1Q A;  1NZB A;  4DOA A;  4UB8 U;  1U49 A;  1TKD A;  3TAP A;  9ICO A;  2FLL A;  2DPJ A;  1LV5 A;  4RNN A;  2G0A A;  3B0Y A;  4WJ3 B;  2UVV A;  1O03 A;  3WK4 A;  3KOO A;  1ED1 A;  3O0F A;  3MGV A; 
#chains in the Genus database with same CATH homology
 3BS7 A;  4MHV A;  2EAM A;  2GLE A;  1WWV A;  5KNI A;  1JI7 A;  3K1R B;  5F3X B;  3TAD C;  4NL9 C;  2QKQ A;  1F0M A;  1COK A;  2EAN A;  2K60 A;  2KMD A;  3BS5 B;  2E8M A;  2E8O A;  5JU5 A;  1OXJ A;  4PZN A;  1Z1V A;  1UCV A;  2QB0 A;  3BS5 A;  1SV0 C;  2EAO A;  1LKY B;  3KKA C;  2DL0 A;  1PK1 B;  2FE9 A;  2LPE A;  5J8Y C;  1X40 A;  4IS7 A;  5JTI A;  3H8M A;  4RQN A;  2KG5 A;  1V38 A;  3IDW A;  2F3N A;  2ES6 A;  2ESE A;  1X9X A;  2QAR A;  2B6G A;  1SXE A;  2K4P A;  2JV3 A;  4NJ8 A;  1SGG A;  4NL9 A;  3SEN A;  2KSO B;  2QB1 A;  3TAD A;  2Y9T A;  2F8K A;  1V85 A;  3BQ7 A;  1OW5 A;  2E8N A;  1KW4 A;  2L5Y A;  2KE7 A;  1PK1 A;  2F44 A;  1LKY A;  1SXD A;  2DKZ A;  5J8Y A;  2QAR B;  3SEI A;  2Y9U A;  2D8C A;  1X66 A;  3TAC B;  1B0X A;  2YTU A;  1RG6 A;  1SV0 A;  2DKX A;  2KSO A;  2LMR A;  3HIL A;  3KKA A;  2QB0 B;  4RQM A;  2D3D A;  1SV4 A;  1DXS A;  2KIV A;  5JRT A;  1UQV A;  2EAP A;  2E8P A;  4PZO A;  1WWU A;  1PK3 A;  1B4F A;  5L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...