4PZNA

Crystal structure of phc3 sam l971e
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPAEKICARINSLKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 3
total genus 24
structure length 70
sequence length 70
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pznA00
2E8NA 3BQ7A 1OXJA 3H8MA 1RG6A 2FE9A 2EAMA 2KIVA 3TACB 1SV0A 1SV0C 1UQVA 1WWUA 3K1RB 1SXDA 2DKXA 5JRTA 2L5YA 2JV3A 4NL9A 5KNIA 2QB0A 2K60A 5JU5A 2D8CA 5JTIA 4RQMA 2QB0B 3SEIA 1LKYB 2E8MA 4NJ8A 2QARA 1SGGA 3TADA 2F8KA 2KE7A 2Y9TA 1Z1VA 2F44A 2KMDA 2DL0A 2EAPA 2E8OA 2DKZA 2KSOB 4IS7A 2D3DA 1V38A 2QB1A 1F0MA 1JI7A 1V85A 1SXEA 4NL9C 3BS7A 2GLEA 1LKYA 5J8YC 1PK1A 4RQNA 3SENA 5L1MA 3KKAC 1B4FA 1OW5A 3KKAA 2QARB 2EAOA 2LMRA 1SV4A 5J8YA 1DXSA 2YTUA 2E8PA 2ES6A 1X9XA 5F3XB 3IDWA 1X66A 1PK3A 3HILA 1COKA 1WWVA 3TADC 1UCVA 2K4PA 2QKQA 4PZOA 2F3NA 1B0XA 1PK1B 3BS5A 2Y9UA 2B6GA 1X40A 2KSOA 2EANA 3BS5B 2ESEA 2LPEA 2KG5A 4MHVA 4PZNA 1KW4A
chains in the Genus database with same CATH superfamily
2GOLA 1CI4A 1A6SA 2KHVA 3KHHA 3B9JA 1L7OA 2EZZA 2A1AA 5KTQA 4YR2A 2KIVA 2P35A 3F2DA 4ZOHC 2JH7A 5AKLA 1FFVA 4Q43A 5L1IA 3OJUA 7ICTA 2MRLA 2R8GA 3PV8A 3PMNA 5B66U 2W3SA 4DL2A 2JR5A 2WAQC 1F5SA 3RJHA 1N61A 2R8KA 5AKHA 2P66A 2E8MA 2BDPA 3VC8A 1S0OA 4UB4A 5CA7A 2PFPA 3I28A 4DSEA 3ISDA 5KFCA 5CEHA 5J0YA 4YP3A 3THVA 1SZHA 4MFFA 2JEGA 2RLTA 2JZBA 1EXNA 3U26A 4KITB 4YMMA 2BQRA 4BXOA 4C7ZA 3LYSA 1JX4A 2FMQA 1K1QA 5KFGA 3PSPA 5J8YC 4F92B 4RQ0A 4OJ5A 1X6JA 2FJ6A 5KFUA 3S6JA 1OW5A 2W04A 1TVAA 3RR8A 7ICRA 1CRXA 2BDUA 1V9PA 2HBKA 3TKAA 3GDXA 2HCFA 9ICIA 5FP0A 4FS2A 4CE6A 5IIJA 3L3FX 1X9WA 2KJ9A 5HNKA 4MEYA 1WWVA 2Q4TA 9ICSA 4F4KA 2QKQA 4P0PA 1KFTA 1ZQIA 2F77X 4TURA 2Y0SF 5J0SA 3FDSA 9ICEA 7ICSA 2W7PA 2KNJA 4JK1A 2G5HB 3F5AA 3ONNA 4YG2A 2XICA 1L3VA 3V72A 4ED0A 2W8LA 1SV0C 1UQVA 5AICA 5ALVA 1L5UA 3F2BA 4QZIA 1A0PA 1KQQA 5KG6A 4J9OA 4KLFA 5DGBA 3PW7A 2D8CA 3L4PA 5KFKA 3PW2A 1Z3EB 4US8A 5EWGA 2J6SA 9ICPA 2ZUCA 1SWWA 4LVSA 2KTQA 4I2IA 5ALGA 1UPHA 3E2EA 4LZGA 5KFIA 1KL9A 1TE2A 3V7JA 3V6JA 2D3DA 5ALSA 2HHXA 1F0MA 4B9TA 3RJGA 3NS1A 4B9NA 2GLEA 1PK1A 3M7DA 4O3PA 5L1MA 4K4HA 4GXJA 1B4FA 5A0LA 2QARB 4RNMA 4JV0A 1ZD4A 1SV4A 3FC4A 4OO1J 3ZDAA 3N4MB 2Q0ZX 8ICPA 1PZNA 2H3QA 2IMWP 4FBTA 2KKPA 5HR6A 5BOMA 3RAXA 4EYHB 4R65A 4BGDA 1UCVA 1ZRNA 2KOBA 4F50A 4UAYA 3FAHA 7ICOA 3H7IA 2GH1A 5AKXA 4RQ2A 4R8UA 4NXZA 1H38A 5IIKA 2XY7A 3UM9A 2FDRA 4IQTA 2M9NA 3IM1A 2OH2A 3GZFA 3NRZA 3M9OB 5DQIA 3WKEA 1HUZA 1B43A 4K4IA 5CP2A 1BNOA 1ZQVA 4A8EA 2I5HA 3BQ1A 4Z6CA 2E3TA 4ECQA 3T5KA 2AQ0A 2XGPA 4ECYA 2PMZC 4PL1A 2J6UA 3QU4A 5JU5A 3V6HA 3QU2A 4GXIA 2F1IA 3WKCA 4DCCA 2YX8A 1WCLA 1MSWD 3TADA 3EW9A 1BVSA 4QWBA 1N60A 1N5WA 1ZQZA 4KTQA 4PGYA 5J2CA 2KZMA 4UARA 2W9CA 1XSLA 1ZJNA 1KTQA 5ALKA 3H0LB 2LI6A 5J0TA 2LYAA 1V85A 5EOZA 4G9BA 4DL7A 1LKYA 2MSNA 2XI9A 5KFPA 3RB4A 5ALYA 4DL6A 2AXTU 4ACOA 4JUZA 3NGDA 1ZQGA 4J9KA 4DSIA 1ZQHA 4J9LA 4USAA 3AQFA 3C29A 3HILA 5D46A 2DWQA 5KFQA 8ICUA 4M9JA 4RPYA 9ICGA 3BZKA 5J2AA 4DF8A 4KLUA 5KG1A 2W9CB 1XC9A 3ISBA 3AU6A 2LM1A 1SIJA 2KK0A 2WF9A 3CNHA 3K4GA 3LVWA 1N62A 9ICJA 1SWVA 2XGQA 5DDMA 3C2LA 5KT5A 3DDHA 4P0QA 2ZIWB 3SAFA 4RZRA 4F5RA 4HAIA 2AQ4A 3QX7A 3H4BA 2FMPA 3OHBA 3RRHA 5C0YA 2DKXA 4CNQA 7ICNA 3RAQA 4RQ3A 1MN8A 1T3QA 4F5NA 3SEIA 3G6VA 4FZMA 1S76D 1BPEA 3QUCA 2KZ3A 5L9XA 4KX5A 3OJSA 3PW5A 2HVIA 5AM5A 2HVHA 2G08A 3GILA 1TK5A 4RT3A 4QW9A 5AI0A 3ZDBA 4GLXA 4RNNA 7ICQA 4B9SA 1KBUA 1QSYA 3ZDEA 2OEHA 2BCRA 4ELTA 5EWFA 3H40A 4M6WA 2V4QA 3H8WA 4KN4A 1D9DA 2VJ5A 1PVPA 4UBBA 2YN4A 3MR2A 1TK8A 4X5VA 5K4LA 3GIMA 5KG5A 1COKA 2ZUDA 4GFJA 3MFHA 3GIKA 5E79U 4FZNA 2HOFA 2MA1A 1OUQA 2Y1IA 3T79A 1VLBA 3AUOA 2WF8A 4U6PA 3KBBA 4QW8A 2F1HA 1KRPA 5AI9A 9ICOA 3PO5A 4R8UB 3KTQA 4Y2SA 4B9LA 5CB1A 3NASA 8ICNA 7ICJA 3TFRA 3TARA 3TACB 3TFSA 4CCHA 1KFDA 5KG2A 2B21A 2FLNA 4EBEA 3MR3A 2KFZA 2JXJA 4F4ZA 2G0AA 1N5XA 4DOBA 5J0RA 1ZQDA 2C22A 4EX6A 5J2JA 5KG4A 5KT2A 2ZIUB 4J9NA 2QARA 1L8OA 2F8KA 5H2FU 4Y2XA 2KE7A 4ZH4A 8ICRA 1Z1VA 1TFRA 1ZD3A 4I2HA 1UT8A 7ICMA 4F8RA 2DKZA 3QU5A 2FMSA 2AU0A 5KFSA 5ALUA 2BQ3A 1HUOA 4CDGA 5F9LA 5CHGA 1WCNA 1U49A 1N48A 3PSIA 4QZBA 1KSPA 1KEJA 1J2NA 5EE9A 4NY8A 4FS1A 4WJ3B 3MDCA 2M0NA 3QUTA 5KT3A 1ZQMA 1QQ6A 2IHMA 4CGZA 5HHIA 2IBKA 2I6XA 2YTUA 1L7PA 3AN1A 3ZD8A 3GIJA 2KV2A 1JROA 1PK3A 2K8AA 2XO7A 4ED6A 4I2DA 2R18A 5GTIU 4UB1A 4PL2A 2K4PA 4JV1A 4PZOA 5AIAA 4O3SA 1IM4A 1B0XA 2KKVA 5AI4A 4RNOA 3SZ2A 3V7KA 3I76A 1ZQWA 2F76X 1RYUA 1NK4A 3BS5B 4UAWA 4XA5A 4YMOA 4PZNA 4R66A 2CXYA 3TAPA 4ECWA 2HDOA 7ICVA 5ALMA 3FM9A 1SB3C 3SD7A 4F2SA 2Z7JA 3V6KA 1RPLA 1PVRA 2W55A 3GV7B 5AK3A 1XU4A 4ECRA 5CWRA 2ISOA 1ZQBA 4O5KA 4QIWC 4BWJA 4OJLA 2QB0A 1RYRA 1TK0A 2K60A 4IRKA 3UXPA 2PKEA 1L7MA 3M6ZA 2LYHA 4C8OA 4IR9A 4U7CA 1ZQOA 4DSKA 8ICJA 3C2MA 3JPSA 3H8SA 4I2AA 1S0MA 3FYHA 4CRXA 2A1JA 9ICVA 2JEFA 4IS7A 1U4BA 3EUB2 3UMCA 4AYBC 1JI7A 5AKYA 3UPQA 2D6FC 2N1RA 3PVXA 2ASLA 3ALRA 5AKIA 1YZ7A 5KAIU 4DOCA 1T3NA 4I29A 2R8IA 2ZTDA 1HJPA 4QZDA 4J03A 1NK5A 4I27A 3F5EA 2ISPA 4UQGA 2VJ4A 4ELVA 2ZIWA 4ED1A 4NLNA 3RJFA 1X9MA 3GFKB 5EE1A 4KLSA 1YZ6A 4I28A 1BPBA 1ZXIA 5BPCA 3BS5A 2Y9UA 2VA2A 2JH1A 1UT5A 3SAHA 9ICFA 4DL4A 2RHFA 2CRXA 5DBCA 2HBMA 1C20A 5ALHA 2UVWA 3BQ7A 2MUTB 3SV4A 1X42A 4Q8EA 4MEXA 2BCVA 3KHLA 4Y2YA 2DFLA 4TQSA 4LZDA 4F4YA 3PX0A 5J2HA 3PW4A 4Q44A 3QEAZ 2H3VA 3SQIA 1RYSA 5DGAA 3F53A 3ZDCA 5D49A 3T5HA 4I2JA 4DWIA 4F2RA 1ECWA 4R64A 4YR0A 3SYZA 8ICHA 5KL8B 3V7LA 2OCEA 1Q8KA 1T94A 2AGPA 5ALEA 2XY6A 5J2IA 3K1ZA 4PJ0U 1FEZA 4ED2A 1ZD2P 1V97A 5KFTA 2V4RA 3KHGA 2ZJAA 4B9VA 2NRXA 3PSTA 3D2SA 1AROP 4RUCA 3KOOA 1ZQKA 2K4IA 2EZYA 3T5LA 1ZQFA 5DBBA 2WHEA 1UHUA 1QQ7A 4QZGA 2XVTA 2YY6A 4C80A 1Z1BA 4M0AA 3WK8A 2BGWA 1KN5A 1HIWA 2B0CA 2XC9A 2W43A 4KMUA 4NLZA 4UB5A 7ICLA 3RTVA 3D2QA 2ASDA 9ICTA 2VA8A 3T3FA 4LJXA 3HP6A 7ICEA 5F3XB 8ICLA 4C8NA 2IOFK 4UB2A 2E1EA 2OXOA 2XIDA 3H4DA 4BXOB 4DQPA 3RJEA 3TADC 1MC8A 3KHRA 9ICHA 3JPPA 5AM0A 2ATLA 1L7NA 5KG7A 5KFDA 4ECUA 5AI6A 2W9BB 4OJOA 1NZPA 5J0QA 4DS5A 3LVVA 1GO3F 4RQ4A 3QNMA 8ICMA 1SL1A 1FFUA 2OYYA 4NM1A 4NM2A 1B22A 1L8LA 4O9MA 3B0XA 1DOQA 4JWMA 2BHNA 3UQ2A 4J9SA 1S0NA 3ZD9A 1T4GA 3KZIU 4K4GA 4J9PA 5IINA 4EBCA 4BX9C 2WF5A 4YXJA 3LWLA 2Y0SC 5AM1A 3M6KA 4TQRA 1A77A 1RQLA 5C5JA 9ICRA 4QWCA 5IIMA 2W9BA 1NK6A 1MQ2A 2FLPA 3WK6A 4KLJA 2MAXA 3RR7A 3RBEA 1KFSA 5CJ7A 3TQ1A 3QZ8A 5KFZA 2XCPA 5AKZA 1S97A 3TANA 1ZRMA 5ALPA 4QWEA 4QZEA 2ZXHA 4DOAA 1WG8A 3UXNA 3N7PD 4AP9A 4M6WB 5TZVA 3JPRA 3Q8RB 1NKBA 2LYBA 1D8BA 4J9MA 2C28A 1P7DA 9ICLA 5ALQA 4YCXA 3PSFA 5ALJA 5AIBA 5KT7A 2XY5A 3UXOA 2YMLA 4FFDA 4BWMA 4DQIA 8ICEA 3IN5A 5DG7A 2KSOA 2RDIA 1NK8A 2DPIA 7ICKA 2K8BB 2NO4A 3RH4A 3EPIA 1PUZA 4UB8U 3SI8A 2WAQF 3DEEA 3Q8LA 3RB3A 2KICA 2F8LA 9ICWA 5B5EU 1RXWA 4P4PA 3RJKA 5KFBA 5DLFA 4EELA 1IG6A 4F72A 2BQUA 2W11A 1SV0A 3NVVA 5AKJA 4F4XA 1U9LA 1DRGA 2KZZA 3VCBA 5J0OA 3C5GA 1BNPA 4YN4A 2F2AB 2YQEA 2G5IB 5J2KA 2BKEA 4IQWA 3QUQA 4C7YA 3KZXA 1FIQA 4DFPA 2W03A 2QB0B 4DFKA 1NI3A 4Y2QA 1Z00A 2P6UA 4NLCA 4I2GA 2F44A 4TUPA 4FBUA 3PMLA 4YXMA 3O0FA 5HMMA 5ALLA 3UMBA 4UW9A 3J81j 1SL0A 4YMNA 2K4EA 1JXEA 5J2BA 2KFNA 4EENA 5KG3A 3QYPA 2DGZA 1N63A 4NLGA 4ED7A 5IIOA 3RH5A 5AK5A 1DGJA 8ICSA 4ED8A 3QUBA 1SKWA 1DXSA 9ICBA 4Z6DA 4QZ8A 2VA3A 5KFRA 2UVUA 2ES6A 5D4BA 3KD3A 2HOIA 2FLLA 4BDPA 1DGSA 3PNCA 4PGQA 2UVVA 4NWIA 3TAQA 9ICUA 4YR3A 3ICXA 4JWNA 4DL3A 8ICBA 1DK2A 3EYZA 5J29A 4RT2A 5DLGA 2EANA 2LM4A 4EEKA 1JRPA 2PFNA 1BGXT 4JMUA 4DO9A 4M04A 3H8MA 2EAMA 5ALZA 2IA6A 1NNLA 3AL0B 4DSJA 5AI5A 5AM3A 3OTQA 3K1RB 1L6NA 4ECTA 2OWOA 2HHQA 2JV3A 2XCAA 7ICIA 2W9AA 1SZPA 3IHQB 4P4MA 9ICAA 1N56A 8ICYA 3OPXA 4UB6U 2J6TA 5ALNA 1LB2B 3CW2C 9ICKA 4QWDA 5AKGA 5ALRA 1UA1A 2KMDA 3PY8A 1X6IA 4JB3A 4ECZA 3HX0A 5KFHA 4UAUA 2VIXA 4F3OA 4P2HA 4F5OA 1Y88A 4QZHA 1LVHA 4RQ8A 1NK7A 3JPQA 3MGVA 3PX6A 4QJFB 1O08A 3BQ2A 4C4TA 2RDJA 5DQGA 2JHDA 4OD0A 2WB1C 4MF8A 5ALDA 8ICGA 1IXRA 4ECXA 1M6YA 2C2DA 3GV8B 3ZDDA 1N2XA 3IP4B 2JEIA 2I1QA 3IRUA 1F44A 1S10A 2RP5A 7ICGA 2JMGA 5DKWA 1X66A 1O03A 3RFAA 1RQNA 2NRWA 3WK4A 2WFAA 3R9KA 4DF4A 2W54A 3RB0A 3JPOA 4QZ9A 2VKQA 2W8KA 2HHWA 2A3VA 2BPFA 4ELUA 5J2EA 8ICXA 2G07A 4PH5A 2BPCA 1D9FA 2WB1F 4XQ8A 1TAQA 4KX3A 4UAVA 2HI0A 2EZXA 4EZ6A 1L3SA 3MFIA 1ED1A 1ZQSA 4E0DA 5KL1B 3WKDA 3D6JA 5G5HA 5DB8A 1BPDA 3WK7A 1AQ6A 7ICFA 4P0PB 1U45A 1ZQTA 5KAFU 4O3MA 3RH6A 1ZQYA 3QU7A 1Q3VA 3ED5A 1ZQUA 5JTIA 1BPXA 1LKYB 1Z4NA 8ICOA 1URJA 1CEZA 5IILA 1D8LA 5J2FA 2K4HA 4ED3A 3E0FA 4DLEA 2ZXIA 5KG0A 5AM4A 2YB4A 3BQ0A 2E8OA 4IL6U 3DV9A 8ICIA 4C4RA 2HBJA 2IOFA 4C0ZA 2JGAA 4DLGA 4FO6A 2KEYA 2HBLA 3SMVA 4KLTA 2QB1A 2LHTA 3BDPA 2C2RA 3HWTA 2E5SA 4RPZA 3AU2A 2G09A 8ICZA 5J0XA 1JUDA 4R63A 4J9RA 1UA0A 1XSPA 3RF9A 1KKXA 2E8PA 4QZAA 4TUQA 4ECSA 2G06A 4GXKA 4C4SA 4UB3A 5J0PA 5ALOA 2HOQA 4RPXA 2JEJA 4Y2TA 4F5PA 2H5XA 4PGXA 4XUSA 2YMQA 5T14A 4Y2VA 4ECVA 1JALA 3QZ7A 1T8EA 1PK1B 5KFAA 2B6GA 1X40A 1ZOLA 1K1SA 5AHXA 5DBAA 1NJXA 4CF3A 4KMOB 3LWMA 5DG9A 4OCZA 1Z00B 9ICNA 5KFNA 1MQ3A 4IR1A 4MFAA 1JXLA 1BPYA 1WWUA 2A1JB 3K75D 2ZTEA 5AKKA 2KIWA 3JPNA 4B6JA 4NLBA 3Q8SB 3LDAA 2KN7A 2GO7A 3PR5B 1U48A 1SXDA 2A19A 1QTMA 3ISCA 3NVWA 4YVZA 1Q3UA 3E58A 2BPGA 5HHHA 4FE3A 2YMMA 3H0RB 3LK9A 4JV2A 3ETLA 1QH9A 2EAPA 4KLQA 3ETRA 2KSOB 4EX7A 4UBCA 5DB9A 3PX4A 1V38A 3RJJA 4DQRA 4FZLA 5AK6A 3MR5A 1QCKA 2DBYA 3G6YA 1SXEA 3IG8A 2OHFA 5EE0A 2RRDA 3BJYA 5DG8A 3G6XA 2ZJ8A 8ICQA 2EAOA 2NRZA 4CF5A 2LMRA 2ZJ5A 4DFDA 3HPOA 4EBDA 1ZETA 2HHTA 5BOLA 2CN1A 4KLEA 7ICPA 3TI0A 5GTHU 1XSNA 4C8LA 1JMSA 2CPRA 3C1YA 1QLNA 4Q8FA 3PZPA 2ZIXA 4RUAA 4GIBA 2FI1A 5ALTA 2EQYA 3PW0A 2Y1JA 5J0WA 4YFKA 5CR0A 1L3TA 3HT3A 2LPEA 3AEVA 4F4WA 5AK4A 1DK3A 4KLLA 2ASJA 2FPKA 1X9SA 3RJIA 2HHSA 1RG6A 3WKBA 4OJ6A 3Q8QB 3M9NB 2R8JA 1S8OA 3HJEA 4YD2A 2PXIA 5CRXA 2IOHA 3MBYA 4F93B 1D8YA 4O3OA 4DFMA 2BCQA 4NL9A 4CF4A 3BZCA 4IC9A 1WYGA 5AI8A 4P4OA 1TAMA 1ZQCA 2P6RA 1J2MA 2Y9TA 1BPZA 2BR0A 2FPMA 2YB1A 4EZ9A 4P0QB 2KJ8A 3WKAA 2W3RA 4IQUA 1L3UA 2LKYA 2YMPA 5KFWA 3RBDA 1NKEA 2JRZA 5ALXA 5KFJA 2V9WA 2ZTCA 3CRXA 4QIWF 2AGQA 2VANA 3SENA 3GIIA 1YT3A 5KFYA 5KFEA 3EZ5A 4F5QA 1RZTA 1SL2A 4O5CA 2KJ5A 5J0UA 2FPLA 1TV9A 2ZG6A 2OM6A 3ZI4A 3RRGA 3AM9A 1NK0A 5DDYA 1JN3A 3MC1A 3MABA 2KHQA 4BUGA 2K89A 3HKZF 2HW3A 1MA7A 1RM6C 1KDHA 1RXVA 4QNLA 4C8KA 5G5GA 3H8JA 4KN7A 5L1KA 4I2EA 1XWLA 4DS4A 1ZQ1C 3HKZC 4IQVA 4OJPA 3I1YA 1A76A 4Y2PA 1C7YA 2KVCA 3RB6A 2NO5A 3ORYA 2H3ZA 5ALIA 1XS9D 4NLKA 3HRDD 3BQTA 5ALFA 4F71A 1J97A 1TKDA 3IV6A 4MFCA 5KT6A 3SAGA 4RU9A 2PI4A 4G3IA 5DB7A 5KFMA 4RQMA 2GWSA 2H3FA 3N97B 3M9MB 1PVQA 4B9UA 1Q46A 4DQQA 2H3IA 5KFLA 1ZQAA 4QWAA 2O6KA 3IG5A 2DL0A 2UVRA 2PFOA 4I2CA 4DSFA 2JZBB 3M1YA 4PHEA 3OSPA 4TUSA 5L1JA 7ICUA 4RQ7A 3AQEA 4DFJA 8ICCA 1NZBA 3A0HU 3N28A 4NL9C 3BS7A 5AKEA 8ICKA 4RQNA 1S5LU 4F91B 1NKCA 8ICFA 3KKAC 5KFFA 2C2EA 3MR6A 2HMXA 1K5OA 2KP7A 2ZIUA 3PR4A 2AHOB 2LBOA 4Q45A 9ICMA 5EE3A 1ZQNA 4ICAA 1NJYA 4Z6FA 1XO1A 2WF7A 4M9NA 5JUMA 4DEZA 2PI5A 1NOMA 4M47A 3F2CA 1X9XA 3NTUA 3NVZA 3C5FA 2DUYA 1ZQPA 4EEYA 3Q8MA 1S9FA 1NK9A 2F3NA 5F9NA 4DL5A 3M8RA 2WF6A 3KFUF 2AGOA 2IHNA 3B0YA 1FO4A 3NRWA 1CUKA 4Z6EA 2AJQA 3MDAA 2ESEA 2ALZA 2KG5A 2F1JA 8ICVA 2ZIVB 4UAZA 5HMLA 5KFOA 5AM2A 9ICQA 3JPTA 3WK9A 2FE9A 1HEKA 4Y2RA 2EH9A 5L1LA 1QSSA 4I2BA 2AH5A 4AYBF 3C1ZA 4PHAA 3C23A 2L5YA 4DQSA 1LV5A 5KNIA 3WU2U 3MGHA 4M9GA 4NV0A 2ODGA 3HW8A 2E1FA 1NJWA 4UASA 4NJ8A 1ZYQA 4MF2A 7ICHA 1JIHA 4DSLA 4RQ1A 8ICWA 2HHUA 1ZD5A 2HHVA 4O3QA 2QLTA 2DQNB 2KD1A 9ICXA 5IIIA 4YD1A 1SKSA 9ICCA 5ALWA 2DPJA 1ZQEA 2MU2A 1ZQXA 1ZQJA 8ICTA 1S77D 1XNSA 2ZIXB 1XO0A 5TISU 4XRHA 5J2DA 1TAUA 3KKAA 5J8YA 2BCUA 4O5EA 1RDFA 4O3NA 2NYVA 4IRDA 4Y2UA 1VJ5A 2BZFA 5EWEA 3Q8KA 1KLNA 3IDWA 3OSNA 1ZQRA 3UMGA 1SKRA 4M9LA 3M8SA 1X2IA 4PHPA 3QU9A 1NJZA 4BJQA 4US9A 3SR6A 8ICAA 3NVYA 1ZJMA 1VDVA 3PO4A 4KLMA 2ZIVA 1Z19A 2WTFA 4MHVA 4O0IA 2E8NA 4M9HA 1OXJA 1QQ5A 1COOA 4QZFA 3D2NA 3OHAA 1S0VA 3GQCA 5KFXA 3GV5B 2W9MA 3C28A 4KLOA 3C21A 3UQ0A 2DF4B 2NRTA 5HP4A 1T7PA 4RQ5A 5J2GA 4KLIA 5JRTA 5KT4A 3C2KA 4RQ6A 3H0MB 3WK5A 2R8HA 3A0BU 4KLDA 4O3RA 1U47A 3QE9Y 1SGGA 2KVSA 3QXGA 2I9GA 1ZQQA 4J9QA 3CYMA 3EWAA 3SV3A 2NV3A 4PPXA 4HYKA 2HSZA 2NRVA 1ZQLA 4QZCA 4IRCA 4UATA 5KFVA 2PMZF 3AMZA 3N7SC 2PFQA 2K8CB 1IIPA 3Q8PB 3CP8A 1IV8A 3OGUA 4KLHA 3QEBZ 2W7OA 4M2YA 3GU3A 1WUDA 1QSLA 4KLGA 4GC6A 4GC7A 4I2FA 2ZUBA 4YQWA 4PHDA 4B9MA 3EPGA 5DQHA 2RQ5A 5HR7A 3N7RC 2BCSA 3NUQA 4EYIB 3T5JA 2MUTA 4Y2JA 1Z4OA 4C8MA 3L5KA 5DB6A 3MGIA 2EDUA 1KW4A
chains in the Genus database with same CATH topology
2E8NA 3BQ7A 1OXJA 3H8MA 1RG6A 2FE9A 2EAMA 2KIVA 3TACB 1SV0A 1SV0C 1UQVA 1WWUA 3K1RB 1SXDA 2DKXA 5JRTA 2L5YA 2JV3A 4NL9A 5KNIA 2QB0A 2K60A 5JU5A 2D8CA 5JTIA 4RQMA 2QB0B 3SEIA 1LKYB 2E8MA 4NJ8A 2QARA 1SGGA 3TADA 2F8KA 2KE7A 2Y9TA 1Z1VA 2F44A 2KMDA 2DL0A 2EAPA 2E8OA 2DKZA 2KSOB 4IS7A 2D3DA 1V38A 2QB1A 1F0MA 1JI7A 1V85A 1SXEA 4NL9C 3BS7A 2GLEA 1LKYA 5J8YC 1PK1A 4RQNA 3SENA 5L1MA 3KKAC 1B4FA 1OW5A 3KKAA 2QARB 2EAOA 2LMRA 1SV4A 5J8YA 1DXSA 2YTUA 2E8PA 2ES6A 1X9XA 5F3XB 3IDWA 1X66A 1PK3A 3HILA 1COKA 1WWVA 3TADC 1UCVA 2K4PA 2QKQA 4PZOA 2F3NA 1B0XA 1PK1B 3BS5A 2Y9UA 2B6GA 1X40A 2KSOA 2EANA 3BS5B 2ESEA 2LPEA 2KG5A 4MHVA 4PZNA 1KW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8N A;  3BQ7 A;  1OXJ A;  3H8M A;  1RG6 A;  2FE9 A;  2EAM A;  2KIV A;  3TAC B;  1SV0 A;  1SV0 C;  1UQV A;  1WWU A;  3K1R B;  1SXD A;  2DKX A;  5JRT A;  2L5Y A;  2JV3 A;  4NL9 A;  5KNI A;  2QB0 A;  2K60 A;  5JU5 A;  2D8C A;  5JTI A;  4RQM A;  2QB0 B;  3SEI A;  1LKY B;  2E8M A;  4NJ8 A;  2QAR A;  1SGG A;  3TAD A;  2F8K A;  2KE7 A;  2Y9T A;  1Z1V A;  2F44 A;  2KMD A;  2DL0 A;  2EAP A;  2E8O A;  2DKZ A;  2KSO B;  4IS7 A;  2D3D A;  1V38 A;  2QB1 A;  1F0M A;  1JI7 A;  1V85 A;  1SXE A;  4NL9 C;  3BS7 A;  2GLE A;  1LKY A;  5J8Y C;  1PK1 A;  4RQN A;  3SEN A;  5L1M A;  3KKA C;  1B4F A;  1OW5 A;  3KKA A;  2QAR B;  2EAO A;  2LMR A;  1SV4 A;  5J8Y A;  1DXS A;  2YTU A;  2E8P A;  2ES6 A;  1X9X A;  5F3X B;  3IDW A;  1X66 A;  1PK3 A;  3HIL A;  1COK A;  1WWV A;  3TAD C;  1UCV A;  2K4P A;  2QKQ A;  4PZO A;  2F3N A;  1B0X A;  1PK1 B;  3BS5 A;  2Y9U A;  2B6G A;  1X40 A;  2KSO A;  2EAN A;  3BS5 B;  2ESE A;  2LPE A;  2KG5 A;  4MHV A;  4PZN A;  1KW4 A; 
#chains in the Genus database with same CATH topology
 2GOL A;  1CI4 A;  1A6S A;  2KHV A;  3KHH A;  3B9J A;  1L7O A;  2EZZ A;  2A1A A;  5KTQ A;  4YR2 A;  2KIV A;  2P35 A;  3F2D A;  4ZOH C;  2JH7 A;  5AKL A;  1FFV A;  4Q43 A;  5L1I A;  3OJU A;  7ICT A;  2MRL A;  2R8G A;  3PV8 A;  3PMN A;  5B66 U;  2W3S A;  4DL2 A;  2JR5 A;  2WAQ C;  1F5S A;  3RJH A;  1N61 A;  2R8K A;  5AKH A;  2P66 A;  2E8M A;  2BDP A;  3VC8 A;  1S0O A;  4UB4 A;  5CA7 A;  2PFP A;  3I28 A;  4DSE A;  3ISD A;  5KFC A;  5CEH A;  5J0Y A;  4YP3 A;  3THV A;  1SZH A;  4MFF A;  2JEG A;  2RLT A;  2JZB A;  1EXN A;  3U26 A;  4KIT B;  4YMM A;  2BQR A;  4BXO A;  4C7Z A;  3LYS A;  1JX4 A;  2FMQ A;  1K1Q A;  5KFG A;  3PSP A;  5J8Y C;  4F92 B;  4RQ0 A;  4OJ5 A;  1X6J A;  2FJ6 A;  5KFU A;  3S6J A;  1OW5 A;  2W04 A;  1TVA A;  3RR8 A;  7ICR A;  1CRX A;  2BDU A;  1V9P A;  2HBK A;  3TKA A;  3GDX A;  2HCF A;  9ICI A;  5FP0 A;  4FS2 A;  4CE6 A;  5IIJ A;  3L3F X;  1X9W A;  2KJ9 A;  5HNK A;  4MEY A;  1WWV A;  2Q4T A;  9ICS A;  4F4K A;  2QKQ A;  4P0P A;  1KFT A;  1ZQI A;  2F77 X;  4TUR A;  2Y0S F;  5J0S A;  3FDS A;  9ICE A;  7ICS A;  2W7P A;  2KNJ A;  4JK1 A;  2G5H B;  3F5A A;  3ONN A;  4YG2 A;  2XIC A;  1L3V A;  3V72 A;  4ED0 A;  2W8L A;  1SV0 C;  1UQV A;  5AIC A;  5ALV A;  1L5U A;  3F2B A;  4QZI A;  1A0P A;  1KQQ A;  5KG6 A;  4J9O A;  4KLF A;  5DGB A;  3PW7 A;  2D8C A;  3L4P A;  5KFK A;  3PW2 A;  1Z3E B;  4US8 A;  5EWG A;  2J6S A;  9ICP A;  2ZUC A;  1SWW A;  4LVS A;  2KTQ A;  4I2I A;  5ALG A;  1UPH A;  3E2E A;  4LZG A;  5KFI A;  1KL9 A;  1TE2 A;  3V7J A;  3V6J A;  2D3D A;  5ALS A;  2HHX A;  1F0M A;  4B9T A;  3RJG A;  3NS1 A;  4B9N A;  2GLE A;  1PK1 A;  3M7D A;  4O3P A;  5L1M A;  4K4H A;  4GXJ A;  1B4F A;  5A0L A;  2QAR B;  4RNM A;  4JV0 A;  1ZD4 A;  1SV4 A;  3FC4 A;  4OO1 J;  3ZDA A;  3N4M B;  2Q0Z X;  8ICP A;  1PZN A;  2H3Q A;  2IMW P;  4FBT A;  2KKP A;  5HR6 A;  5BOM A;  3RAX A;  4EYH B;  4R65 A;  4BGD A;  1UCV A;  1ZRN A;  2KOB A;  4F50 A;  4UAY A;  3FAH A;  7ICO A;  3H7I A;  2GH1 A;  5AKX A;  4RQ2 A;  4R8U A;  4NXZ A;  1H38 A;  5IIK A;  2XY7 A;  3UM9 A;  2FDR A;  4IQT A;  2M9N A;  3IM1 A;  2OH2 A;  3GZF A;  3NRZ A;  3M9O B;  5DQI A;  3WKE A;  1HUZ A;  1B43 A;  4K4I A;  5CP2 A;  1BNO A;  1ZQV A;  4A8E A;  2I5H A;  3BQ1 A;  4Z6C A;  2E3T A;  4ECQ A;  3T5K A;  2AQ0 A;  2XGP A;  4ECY A;  2PMZ C;  4PL1 A;  2J6U A;  3QU4 A;  5JU5 A;  3V6H A;  3QU2 A;  4GXI A;  2F1I A;  3WKC A;  4DCC A;  2YX8 A;  1WCL A;  1MSW D;  3TAD A;  3EW9 A;  1BVS A;  4QWB A;  1N60 A;  1N5W A;  1ZQZ A;  4KTQ A;  4PGY A;  5J2C A;  2KZM A;  4UAR A;  2W9C A;  1XSL A;  1ZJN A;  1KTQ A;  5ALK A;  3H0L B;  2LI6 A;  5J0T A;  2LYA A;  1V85 A;  5EOZ A;  4G9B A;  4DL7 A;  1LKY A;  2MSN A;  2XI9 A;  5KFP A;  3RB4 A;  5ALY A;  4DL6 A;  2AXT U;  4ACO A;  4JUZ A;  3NGD A;  1ZQG A;  4J9K A;  4DSI A;  1ZQH A;  4J9L A;  4USA A;  3AQF A;  3C29 A;  3HIL A;  5D46 A;  2DWQ A;  5KFQ A;  8ICU A;  4M9J A;  4RPY A;  9ICG A;  3BZK A;  5J2A A;  4DF8 A;  4KLU A;  5KG1 A;  2W9C B;  1XC9 A;  3ISB A;  3AU6 A;  2LM1 A;  1SIJ A;  2KK0 A;  2WF9 A;  3CNH A;  3K4G A;  3LVW A;  1N62 A;  9ICJ A;  1SWV A;  2XGQ A;  5DDM A;  3C2L A;  5KT5 A;  3DDH A;  4P0Q A;  2ZIW B;  3SAF A;  4RZR A;  4F5R A;  4HAI A;  2AQ4 A;  3QX7 A;  3H4B A;  2FMP A;  3OHB A;  3RRH A;  5C0Y A;  2DKX A;  4CNQ A;  7ICN A;  3RAQ A;  4RQ3 A;  1MN8 A;  1T3Q A;  4F5N A;  3SEI A;  3G6V A;  4FZM A;  1S76 D;  1BPE A;  3QUC A;  2KZ3 A;  5L9X A;  4KX5 A;  3OJS A;  3PW5 A;  2HVI A;  5AM5 A;  2HVH A;  2G08 A;  3GIL A;  1TK5 A;  4RT3 A;  4QW9 A;  5AI0 A;  3ZDB A;  4GLX A;  4RNN A;  7ICQ A;  4B9S A;  1KBU A;  1QSY A;  3ZDE A;  2OEH A;  2BCR A;  4ELT A;  5EWF A;  3H40 A;  4M6W A;  2V4Q A;  3H8W A;  4KN4 A;  1D9D A;  2VJ5 A;  1PVP A;  4UBB A;  2YN4 A;  3MR2 A;  1TK8 A;  4X5V A;  5K4L A;  3GIM A;  5KG5 A;  1COK A;  2ZUD A;  4GFJ A;  3MFH A;  3GIK A;  5E79 U;  4FZN A;  2HOF A;  2MA1 A;  1OUQ A;  2Y1I A;  3T79 A;  1VLB A;  3AUO A;  2WF8 A;  4U6P A;  3KBB A;  4QW8 A;  2F1H A;  1KRP A;  5AI9 A;  9ICO A;  3PO5 A;  4R8U B;  3KTQ A;  4Y2S A;  4B9L A;  5CB1 A;  3NAS A;  8ICN A;  7ICJ A;  3TFR A;  3TAR A;  3TAC B;  3TFS A;  4CCH A;  1KFD A;  5KG2 A;  2B21 A;  2FLN A;  4EBE A;  3MR3 A;  2KFZ A;  2JXJ A;  4F4Z A;  2G0A A;  1N5X A;  4DOB A;  5J0R A;  1ZQD A;  2C22 A;  4EX6 A;  5J2J A;  5KG4 A;  5KT2 A;  2ZIU B;  4J9N A;  2QAR A;  1L8O A;  2F8K A;  5H2F U;  4Y2X A;  2KE7 A;  4ZH4 A;  8ICR A;  1Z1V A;  1TFR A;  1ZD3 A;  4I2H A;  1UT8 A;  7ICM A;  4F8R A;  2DKZ A;  3QU5 A;  2FMS A;  2AU0 A;  5KFS A;  5ALU A;  2BQ3 A;  1HUO A;  4CDG A;  5F9L A;  5CHG A;  1WCN A;  1U49 A;  1N48 A;  3PSI A;  4QZB A;  1KSP A;  1KEJ A;  1J2N A;  5EE9 A;  4NY8 A;  4FS1 A;  4WJ3 B;  3MDC A;  2M0N A;  3QUT A;  5KT3 A;  1ZQM A;  1QQ6 A;  2IHM A;  4CGZ A;  5HHI A;  2IBK A;  2I6X A;  2YTU A;  1L7P A;  3AN1 A;  3ZD8 A;  3GIJ A;  2KV2 A;  1JRO A;  1PK3 A;  2K8A A;  2XO7 A;  4ED6 A;  4I2D A;  2R18 A;  5GTI U;  4UB1 A;  4PL2 A;  2K4P A;  4JV1 A;  4PZO A;  5AIA A;  4O3S A;  1IM4 A;  1B0X A;  2KKV A;  5AI4 A;  4RNO A;  3SZ2 A;  3V7K A;  3I76 A;  1ZQW A;  2F76 X;  1RYU A;  1NK4 A;  3BS5 B;  4UAW A;  4XA5 A;  4YMO A;  4PZN A;  4R66 A;  2CXY A;  3TAP A;  4ECW A;  2HDO A;  7ICV A;  5ALM A;  3FM9 A;  1SB3 C;  3SD7 A;  4F2S A;  2Z7J A;  3V6K A;  1RPL A;  1PVR A;  2W55 A;  3GV7 B;  5AK3 A;  1XU4 A;  4ECR A;  5CWR A;  2ISO A;  1ZQB A;  4O5K A;  4QIW C;  4BWJ A;  4OJL A;  2QB0 A;  1RYR A;  1TK0 A;  2K60 A;  4IRK A;  3UXP A;  2PKE A;  1L7M A;  3M6Z A;  2LYH A;  4C8O A;  4IR9 A;  4U7C A;  1ZQO A;  4DSK A;  8ICJ A;  3C2M A;  3JPS A;  3H8S A;  4I2A A;  1S0M A;  3FYH A;  4CRX A;  2A1J A;  9ICV A;  2JEF A;  4IS7 A;  1U4B A;  3EUB 2;  3UMC A;  4AYB C;  1JI7 A;  5AKY A;  3UPQ A;  2D6F C;  2N1R A;  3PVX A;  2ASL A;  3ALR A;  5AKI A;  1YZ7 A;  5KAI U;  4DOC A;  1T3N A;  4I29 A;  2R8I A;  2ZTD A;  1HJP A;  4QZD A;  4J03 A;  1NK5 A;  4I27 A;  3F5E A;  2ISP A;  4UQG A;  2VJ4 A;  4ELV A;  2ZIW A;  4ED1 A;  4NLN A;  3RJF A;  1X9M A;  3GFK B;  5EE1 A;  4KLS A;  1YZ6 A;  4I28 A;  1BPB A;  1ZXI A;  5BPC A;  3BS5 A;  2Y9U A;  2VA2 A;  2JH1 A;  1UT5 A;  3SAH A;  9ICF A;  4DL4 A;  2RHF A;  2CRX A;  5DBC A;  2HBM A;  1C20 A;  5ALH A;  2UVW A;  3BQ7 A;  2MUT B;  3SV4 A;  1X42 A;  4Q8E A;  4MEX A;  2BCV A;  3KHL A;  4Y2Y A;  2DFL A;  4TQS A;  4LZD A;  4F4Y A;  3PX0 A;  5J2H A;  3PW4 A;  4Q44 A;  3QEA Z;  2H3V A;  3SQI A;  1RYS A;  5DGA A;  3F53 A;  3ZDC A;  5D49 A;  3T5H A;  4I2J A;  4DWI A;  4F2R A;  1ECW A;  4R64 A;  4YR0 A;  3SYZ A;  8ICH A;  5KL8 B;  3V7L A;  2OCE A;  1Q8K A;  1T94 A;  2AGP A;  5ALE A;  2XY6 A;  5J2I A;  3K1Z A;  4PJ0 U;  1FEZ A;  4ED2 A;  1ZD2 P;  1V97 A;  5KFT A;  2V4R A;  3KHG A;  2ZJA A;  4B9V A;  2NRX A;  3PST A;  3D2S A;  1ARO P;  4RUC A;  3KOO A;  1ZQK A;  2K4I A;  2EZY A;  3T5L A;  1ZQF A;  5DBB A;  2WHE A;  1UHU A;  1QQ7 A;  4QZG A;  2XVT A;  2YY6 A;  4C80 A;  1Z1B A;  4M0A A;  3WK8 A;  2BGW A;  1KN5 A;  1HIW A;  2B0C A;  2XC9 A;  2W43 A;  4KMU A;  4NLZ A;  4UB5 A;  7ICL A;  3RTV A;  3D2Q A;  2ASD A;  9ICT A;  2VA8 A;  3T3F A;  4LJX A;  3HP6 A;  7ICE A;  5F3X B;  8ICL A;  4C8N A;  2IOF K;  4UB2 A;  2E1E A;  2OXO A;  2XID A;  3H4D A;  4BXO B;  4DQP A;  3RJE A;  3TAD C;  1MC8 A;  3KHR A;  9ICH A;  3JPP A;  5AM0 A;  2ATL A;  1L7N A;  5KG7 A;  5KFD A;  4ECU A;  5AI6 A;  2W9B B;  4OJO A;  1NZP A;  5J0Q A;  4DS5 A;  3LVV A;  1GO3 F;  4RQ4 A;  3QNM A;  8ICM A;  1SL1 A;  1FFU A;  2OYY A;  4NM1 A;  4NM2 A;  1B22 A;  1L8L A;  4O9M A;  3B0X A;  1DOQ A;  4JWM A;  2BHN A;  3UQ2 A;  4J9S A;  1S0N A;  3ZD9 A;  1T4G A;  3KZI U;  4K4G A;  4J9P A;  5IIN A;  4EBC A;  4BX9 C;  2WF5 A;  4YXJ A;  3LWL A;  2Y0S C;  5AM1 A;  3M6K A;  4TQR A;  1A77 A;  1RQL A;  5C5J A;  9ICR A;  4QWC A;  5IIM A;  2W9B A;  1NK6 A;  1MQ2 A;  2FLP A;  3WK6 A;  4KLJ A;  2MAX A;  3RR7 A;  3RBE A;  1KFS A;  5CJ7 A;  3TQ1 A;  3QZ8 A;  5KFZ A;  2XCP A;  5AKZ A;  1S97 A;  3TAN A;  1ZRM A;  5ALP A;  4QWE A;  4QZE A;  2ZXH A;  4DOA A;  1WG8 A;  3UXN A;  3N7P D;  4AP9 A;  4M6W B;  5TZV A;  3JPR A;  3Q8R B;  1NKB A;  2LYB A;  1D8B A;  4J9M A;  2C28 A;  1P7D A;  9ICL A;  5ALQ A;  4YCX A;  3PSF A;  5ALJ A;  5AIB A;  5KT7 A;  2XY5 A;  3UXO A;  2YML A;  4FFD A;  4BWM A;  4DQI A;  8ICE A;  3IN5 A;  5DG7 A;  2KSO A;  2RDI A;  1NK8 A;  2DPI A;  7ICK A;  2K8B B;  2NO4 A;  3RH4 A;  3EPI A;  1PUZ A;  4UB8 U;  3SI8 A;  2WAQ F;  3DEE A;  3Q8L A;  3RB3 A;  2KIC A;  2F8L A;  9ICW A;  5B5E U;  1RXW A;  4P4P A;  3RJK A;  5KFB A;  5DLF A;  4EEL A;  1IG6 A;  4F72 A;  2BQU A;  2W11 A;  1SV0 A;  3NVV A;  5AKJ A;  4F4X A;  1U9L A;  1DRG A;  2KZZ A;  3VCB A;  5J0O A;  3C5G A;  1BNP A;  4YN4 A;  2F2A B;  2YQE A;  2G5I B;  5J2K A;  2BKE A;  4IQW A;  3QUQ A;  4C7Y A;  3KZX A;  1FIQ A;  4DFP A;  2W03 A;  2QB0 B;  4DFK A;  1NI3 A;  4Y2Q A;  1Z00 A;  2P6U A;  4NLC A;  4I2G A;  2F44 A;  4TUP A;  4FBU A;  3PML A;  4YXM A;  3O0F A;  5HMM A;  5ALL A;  3UMB A;  4UW9 A;  3J81 j;  1SL0 A;  4YMN A;  2K4E A;  1JXE A;  5J2B A;  2KFN A;  4EEN A;  5KG3 A;  3QYP A;  2DGZ A;  1N63 A;  4NLG A;  4ED7 A;  5IIO A;  3RH5 A;  5AK5 A;  1DGJ A;  8ICS A;  4ED8 A;  3QUB A;  1SKW A;  1DXS A;  9ICB A;  4Z6D A;  4QZ8 A;  2VA3 A;  5KFR A;  2UVU A;  2ES6 A;  5D4B A;  3KD3 A;  2HOI A;  2FLL A;  4BDP A;  1DGS A;  3PNC A;  4PGQ A;  2UVV A;  4NWI A;  3TAQ A;  9ICU A;  4YR3 A;  3ICX A;  4JWN A;  4DL3 A;  8ICB A;  1DK2 A;  3EYZ A;  5J29 A;  4RT2 A;  5DLG A;  2EAN A;  2LM4 A;  4EEK A;  1JRP A;  2PFN A;  1BGX T;  4JMU A;  4DO9 A;  4M04 A;  3H8M A;  2EAM A;  5ALZ A;  2IA6 A;  1NNL A;  3AL0 B;  4DSJ A;  5AI5 A;  5AM3 A;  3OTQ A;  3K1R B;  1L6N A;  4ECT A;  2OWO A;  2HHQ A;  2JV3 A;  2XCA A;  7ICI A;  2W9A A;  1SZP A;  3IHQ B;  4P4M A;  9ICA A;  1N56 A;  8ICY A;  3OPX A;  4UB6 U;  2J6T A;  5ALN A;  1LB2 B;  3CW2 C;  9ICK A;  4QWD A;  5AKG A;  5ALR A;  1UA1 A;  2KMD A;  3PY8 A;  1X6I A;  4JB3 A;  4ECZ A;  3HX0 A;  5KFH A;  4UAU A;  2VIX A;  4F3O A;  4P2H A;  4F5O A;  1Y88 A;  4QZH A;  1LVH A;  4RQ8 A;  1NK7 A;  3JPQ A;  3MGV A;  3PX6 A;  4QJF B;  1O08 A;  3BQ2 A;  4C4T A;  2RDJ A;  5DQG A;  2JHD A;  4OD0 A;  2WB1 C;  4MF8 A;  5ALD A;  8ICG A;  1IXR A;  4ECX A;  1M6Y A;  2C2D A;  3GV8 B;  3ZDD A;  1N2X A;  3IP4 B;  2JEI A;  2I1Q A;  3IRU A;  1F44 A;  1S10 A;  2RP5 A;  7ICG A;  2JMG A;  5DKW A;  1X66 A;  1O03 A;  3RFA A;  1RQN A;  2NRW A;  3WK4 A;  2WFA A;  3R9K A;  4DF4 A;  2W54 A;  3RB0 A;  3JPO A;  4QZ9 A;  2VKQ A;  2W8K A;  2HHW A;  2A3V A;  2BPF A;  4ELU A;  5J2E A;  8ICX A;  2G07 A;  4PH5 A;  2BPC A;  1D9F A;  2WB1 F;  4XQ8 A;  1TAQ A;  4KX3 A;  4UAV A;  2HI0 A;  2EZX A;  4EZ6 A;  1L3S A;  3MFI A;  1ED1 A;  1ZQS A;  4E0D A;  5KL1 B;  3WKD A;  3D6J A;  5G5H A;  5DB8 A;  1BPD A;  3WK7 A;  1AQ6 A;  7ICF A;  4P0P B;  1U45 A;  1ZQT A;  5KAF U;  4O3M A;  3RH6 A;  1ZQY A;  3QU7 A;  1Q3V A;  3ED5 A;  1ZQU A;  5JTI A;  1BPX A;  1LKY B;  1Z4N A;  8ICO A;  1URJ A;  1CEZ A;  5IIL A;  1D8L A;  5J2F A;  2K4H A;  4ED3 A;  3E0F A;  4DLE A;  2ZXI A;  5KG0 A;  5AM4 A;  2YB4 A;  3BQ0 A;  2E8O A;  4IL6 U;  3DV9 A;  8ICI A;  4C4R A;  2HBJ A;  2IOF A;  4C0Z A;  2JGA A;  4DLG A;  4FO6 A;  2KEY A;  2HBL A;  3SMV A;  4KLT A;  2QB1 A;  2LHT A;  3BDP A;  2C2R A;  3HWT A;  2E5S A;  4RPZ A;  3AU2 A;  2G09 A;  8ICZ A;  5J0X A;  1JUD A;  4R63 A;  4J9R A;  1UA0 A;  1XSP A;  3RF9 A;  1KKX A;  2E8P A;  4QZA A;  4TUQ A;  4ECS A;  2G06 A;  4GXK A;  4C4S A;  4UB3 A;  5J0P A;  5ALO A;  2HOQ A;  4RPX A;  2JEJ A;  4Y2T A;  4F5P A;  2H5X A;  4PGX A;  4XUS A;  2YMQ A;  5T14 A;  4Y2V A;  4ECV A;  1JAL A;  3QZ7 A;  1T8E A;  1PK1 B;  5KFA A;  2B6G A;  1X40 A;  1ZOL A;  1K1S A;  5AHX A;  5DBA A;  1NJX A;  4CF3 A;  4KMO B;  3LWM A;  5DG9 A;  4OCZ A;  1Z00 B;  9ICN A;  5KFN A;  1MQ3 A;  4IR1 A;  4MFA A;  1JXL A;  1BPY A;  1WWU A;  2A1J B;  3K75 D;  2ZTE A;  5AKK A;  2KIW A;  3JPN A;  4B6J A;  4NLB A;  3Q8S B;  3LDA A;  2KN7 A;  2GO7 A;  3PR5 B;  1U48 A;  1SXD A;  2A19 A;  1QTM A;  3ISC A;  3NVW A;  4YVZ A;  1Q3U A;  3E58 A;  2BPG A;  5HHH A;  4FE3 A;  2YMM A;  3H0R B;  3LK9 A;  4JV2 A;  3ETL A;  1QH9 A;  2EAP A;  4KLQ A;  3ETR A;  2KSO B;  4EX7 A;  4UBC A;  5DB9 A;  3PX4 A;  1V38 A;  3RJJ A;  4DQR A;  4FZL A;  5AK6 A;  3MR5 A;  1QCK A;  2DBY A;  3G6Y A;  1SXE A;  3IG8 A;  2OHF A;  5EE0 A;  2RRD A;  3BJY A;  5DG8 A;  3G6X A;  2ZJ8 A;  8ICQ A;  2EAO A;  2NRZ A;  4CF5 A;  2LMR A;  2ZJ5 A;  4DFD A;  3HPO A;  4EBD A;  1ZET A;  2HHT A;  5BOL A;  2CN1 A;  4KLE A;  7ICP A;  3TI0 A;  5GTH U;  1XSN A;  4C8L A;  1JMS A;  2CPR A;  3C1Y A;  1QLN A;  4Q8F A;  3PZP A;  2ZIX A;  4RUA A;  4GIB A;  2FI1 A;  5ALT A;  2EQY A;  3PW0 A;  2Y1J A;  5J0W A;  4YFK A;  5CR0 A;  1L3T A;  3HT3 A;  2LPE A;  3AEV A;  4F4W A;  5AK4 A;  1DK3 A;  4KLL A;  2ASJ A;  2FPK A;  1X9S A;  3RJI A;  2HHS A;  1RG6 A;  3WKB A;  4OJ6 A;  3Q8Q B;  3M9N B;  2R8J A;  1S8O A;  3HJE A;  4YD2 A;  2PXI A;  5CRX A;  2IOH A;  3MBY A;  4F93 B;  1D8Y A;  4O3O A;  4DFM A;  2BCQ A;  4NL9 A;  4CF4 A;  3BZC A;  4IC9 A;  1WYG A;  5AI8 A;  4P4O A;  1TAM A;  1ZQC A;  2P6R A;  1J2M A;  2Y9T A;  1BPZ A;  2BR0 A;  2FPM A;  2YB1 A;  4EZ9 A;  4P0Q B;  2KJ8 A;  3WKA A;  2W3R A;  4IQU A;  1L3U A;  2LKY A;  2YMP A;  5KFW A;  3RBD A;  1NKE A;  2JRZ A;  5ALX A;  5KFJ A;  2V9W A;  2ZTC A;  3CRX A;  4QIW F;  2AGQ A;  2VAN A;  3SEN A;  3GII A;  1YT3 A;  5KFY A;  5KFE A;  3EZ5 A;  4F5Q A;  1RZT A;  1SL2 A;  4O5C A;  2KJ5 A;  5J0U A;  2FPL A;  1TV9 A;  2ZG6 A;  2OM6 A;  3ZI4 A;  3RRG A;  3AM9 A;  1NK0 A;  5DDY A;  1JN3 A;  3MC1 A;  3MAB A;  2KHQ A;  4BUG A;  2K89 A;  3HKZ F;  2HW3 A;  1MA7 A;  1RM6 C;  1KDH A;  1RXV A;  4QNL A;  4C8K A;  5G5G A;  3H8J A;  4KN7 A;  5L1K A;  4I2E A;  1XWL A;  4DS4 A;  1ZQ1 C;  3HKZ C;  4IQV A;  4OJP A;  3I1Y A;  1A76 A;  4Y2P A;  1C7Y A;  2KVC A;  3RB6 A;  2NO5 A;  3ORY A;  2H3Z A;  5ALI A;  1XS9 D;  4NLK A;  3HRD D;  3BQT A;  5ALF A;  4F71 A;  1J97 A;  1TKD A;  3IV6 A;  4MFC A;  5KT6 A;  3SAG A;  4RU9 A;  2PI4 A;  4G3I A;  5DB7 A;  5KFM A;  4RQM A;  2GWS A;  2H3F A;  3N97 B;  3M9M B;  1PVQ A;  4B9U A;  1Q46 A;  4DQQ A;  2H3I A;  5KFL A;  1ZQA A;  4QWA A;  2O6K A;  3IG5 A;  2DL0 A;  2UVR A;  2PFO A;  4I2C A;  4DSF A;  2JZB B;  3M1Y A;  4PHE A;  3OSP A;  4TUS A;  5L1J A;  7ICU A;  4RQ7 A;  3AQE A;  4DFJ A;  8ICC A;  1NZB A;  3A0H U;  3N28 A;  4NL9 C;  3BS7 A;  5AKE A;  8ICK A;  4RQN A;  1S5L U;  4F91 B;  1NKC A;  8ICF A;  3KKA C;  5KFF A;  2C2E A;  3MR6 A;  2HMX A;  1K5O A;  2KP7 A;  2ZIU A;  3PR4 A;  2AHO B;  2LBO A;  4Q45 A;  9ICM A;  5EE3 A;  1ZQN A;  4ICA A;  1NJY A;  4Z6F A;  1XO1 A;  2WF7 A;  4M9N A;  5JUM A;  4DEZ A;  2PI5 A;  1NOM A;  4M47 A;  3F2C A;  1X9X A;  3NTU A;  3NVZ A;  3C5F A;  2DUY A;  1ZQP A;  4EEY A;  3Q8M A;  1S9F A;  1NK9 A;  2F3N A;  5F9N A;  4DL5 A;  3M8R A;  2WF6 A;  3KFU F;  2AGO A;  2IHN A;  3B0Y A;  1FO4 A;  3NRW A;  1CUK A;  4Z6E A;  2AJQ A;  3MDA A;  2ESE A;  2ALZ A;  2KG5 A;  2F1J A;  8ICV A;  2ZIV B;  4UAZ A;  5HML A;  5KFO A;  5AM2 A;  9ICQ A;  3JPT A;  3WK9 A;  2FE9 A;  1HEK A;  4Y2R A;  2EH9 A;  5L1L A;  1QSS A;  4I2B A;  2AH5 A;  4AYB F;  3C1Z A;  4PHA A;  3C23 A;  2L5Y A;  4DQS A;  1LV5 A;  5KNI A;  3WU2 U;  3MGH A;  4M9G A;  4NV0 A;  2ODG A;  3HW8 A;  2E1F A;  1NJW A;  4UAS A;  4NJ8 A;  1ZYQ A;  4MF2 A;  7ICH A;  1JIH A;  4DSL A;  4RQ1 A;  8ICW A;  2HHU A;  1ZD5 A;  2HHV A;  4O3Q A;  2QLT A;  2DQN B;  2KD1 A;  9ICX A;  5III A;  4YD1 A;  1SKS A;  9ICC A;  5ALW A;  2DPJ A;  1ZQE A;  2MU2 A;  1ZQX A;  1ZQJ A;  8ICT A;  1S77 D;  1XNS A;  2ZIX B;  1XO0 A;  5TIS U;  4XRH A;  5J2D A;  1TAU A;  3KKA A;  5J8Y A;  2BCU A;  4O5E A;  1RDF A;  4O3N A;  2NYV A;  4IRD A;  4Y2U A;  1VJ5 A;  2BZF A;  5EWE A;  3Q8K A;  1KLN A;  3IDW A;  3OSN A;  1ZQR A;  3UMG A;  1SKR A;  4M9L A;  3M8S A;  1X2I A;  4PHP A;  3QU9 A;  1NJZ A;  4BJQ A;  4US9 A;  3SR6 A;  8ICA A;  3NVY A;  1ZJM A;  1VDV A;  3PO4 A;  4KLM A;  2ZIV A;  1Z19 A;  2WTF A;  4MHV A;  4O0I A;  2E8N A;  4M9H A;  1OXJ A;  1QQ5 A;  1COO A;  4QZF A;  3D2N A;  3OHA A;  1S0V A;  3GQC A;  5KFX A;  3GV5 B;  2W9M A;  3C28 A;  4KLO A;  3C21 A;  3UQ0 A;  2DF4 B;  2NRT A;  5HP4 A;  1T7P A;  4RQ5 A;  5J2G A;  4KLI A;  5JRT A;  5KT4 A;  3C2K A;  4RQ6 A;  3H0M B;  3WK5 A;  2R8H A;  3A0B U;  4KLD A;  4O3R A;  1U47 A;  3QE9 Y;  1SGG A;  2KVS A;  3QXG A;  2I9G A;  1ZQQ A;  4J9Q A;  3CYM A;  3EWA A;  3SV3 A;  2NV3 A;  4PPX A;  4HYK A;  2HSZ A;  2NRV A;  1ZQL A;  4QZC A;  4IRC A;  4UAT A;  5KFV A;  2PMZ F;  3AMZ A;  3N7S C;  2PFQ A;  2K8C B;  1IIP A;  3Q8P B;  3CP8 A;  1IV8 A;  3OGU A;  4KLH A;  3QEB Z;  2W7O A;  4M2Y A;  3GU3 A;  1WUD A;  1QSL A;  4KLG A;  4GC6 A;  4GC7 A;  4I2F A;  2ZUB A;  4YQW A;  4PHD A;  4B9M A;  3EPG A;  5DQH A;  2RQ5 A;  5HR7 A;  3N7R C;  2BCS A;  3NUQ A;  4EYI B;  3T5J A;  2MUT A;  4Y2J A;  1Z4O A;  4C8M A;  3L5K A;  5DB6 A;  3MGI A;  2EDU A;  1KW4 A; 
#chains in the Genus database with same CATH homology
 2E8N A;  3BQ7 A;  1OXJ A;  3H8M A;  1RG6 A;  2FE9 A;  2EAM A;  2KIV A;  3TAC B;  1SV0 A;  1SV0 C;  1UQV A;  1WWU A;  3K1R B;  1SXD A;  2DKX A;  5JRT A;  2L5Y A;  2JV3 A;  4NL9 A;  5KNI A;  2QB0 A;  2K60 A;  5JU5 A;  2D8C A;  5JTI A;  4RQM A;  2QB0 B;  3SEI A;  1LKY B;  2E8M A;  4NJ8 A;  2QAR A;  1SGG A;  3TAD A;  2F8K A;  2KE7 A;  2Y9T A;  1Z1V A;  2F44 A;  2KMD A;  2DL0 A;  2EAP A;  2E8O A;  2DKZ A;  2KSO B;  4IS7 A;  2D3D A;  1V38 A;  2QB1 A;  1F0M A;  1JI7 A;  1V85 A;  1SXE A;  4NL9 C;  3BS7 A;  2GLE A;  1LKY A;  5J8Y C;  1PK1 A;  4RQN A;  3SEN A;  5L1M A;  3KKA C;  1B4F A;  1OW5 A;  3KKA A;  2QAR B;  2EAO A;  2LMR A;  1SV4 A;  5J8Y A;  1DXS A;  2YTU A;  2E8P A;  2ES6 A;  1X9X A;  5F3X B;  3IDW A;  1X66 A;  1PK3 A;  3HIL A;  1COK A;  1WWV A;  3TAD C;  1UCV A;  2K4P A;  2QKQ A;  4PZO A;  2F3N A;  1B0X A;  1PK1 B;  3BS5 A;  2Y9U A;  2B6G A;  1X40 A;  2KSO A;  2EAN A;  3BS5 B;  2ESE A;  2LPE A;  2KG5 A;  4MHV A;  4PZN A;  1KW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...