4PZNA

Crystal structure of phc3 sam l971e
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
b'TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPAEKICARINSLKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyhomeotic-like protein 3
publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 70
sequence length 70
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pznA00
2E8PA 4PZNA 3KKAC 1X40A 2Y9UA 5JTIA 2ES6A 2E8NA 1SXEA 2QARB 2B6GA 2QARA 1RG6A 3BQ7A 1PK3A 3HILA 5J8YC 1X9XA 1F0MA 1SGGA 5KNIA 1SXDA 2YTUA 2E8OA 2KMDA 1X66A 4NL9C 5JU5A 1V85A 4RQNA 2GLEA 3IDWA 2QB1A 1COKA 1WWUA 3TADA 1OW5A 2F3NA 2L5YA 5L1MA 3BS7A 4MHVA 2FE9A 3K1RB 2LMRA 1PK1B 2KG5A 1PK1A 1WWVA 2KE7A 1SV0A 2EANA 2Y9TA 3TACB 1JI7A 3SENA 5JRTA 2KSOB 3KKAA 2EAOA 2KSOA 1UQVA 2QKQA 1DXSA 2K4PA 2D3DA 3SEIA 1B0XA 5J8YA 2DKZA 2F44A 2QB0B 1KW4A 2QB0A 3BS5B 3BS5A 1B4FA 4NL9A 3TADC 2LPEA 2D8CA 4NJ8A 3H8MA 2JV3A 2KIVA 2DKXA 1V38A 5F3XB 2EAPA 1SV4A 2DL0A 1SV0C 4IS7A 1UCVA 1Z1VA 2EAMA 1LKYB 2K60A 2E8MA 1LKYA 4PZOA 4RQMA 1OXJA 2F8KA 2ESEA
chains in the Genus database with same CATH superfamily
2LYAA 3IM1A 2Z7JA 2FPKA 4YMMA 1ED1A 1L7OA 1SZPA 3UMCA 3D6JA 3MR6A 4RUAA 3U26A 3RBDA 1U48A 5ALXA 2W11A 3SAGA 3HILA 3RB6A 2F2AB 5CRXA 4OJLA 3HPOA 9ICFA 5H2FU 4FBUA 1N60A 1PUZA 4TUPA 3N4MB 5JU5A 3HW8A 1S97A 3M8RA 4RQ1A 5DLGA 3PR5B 2JEGA 2ODGA 4PGXA 4C4RA 4HYKA 1SWWA 2UVRA 3AU6A 1ZRMA 5KG7A 3THVA 3J81j 4UBBA 3E58A 1ZQXA 2HHVA 3PW4A 4C8NA 4UQGA 1BGXT 4GXKA 2KNJA 4DWIA 5DQIA 2V4RA 1IG6A 5EWFA 4U7CA 3LVWA 4EX6A 4J9OA 4G9BA 5EE1A 1ZQYA 4IQVA 2W7PA 2H3FA 3RR7A 3WK5A 2OEHA 3JPOA 4MEXA 9ICMA 4MFCA 2JR5A 4DLGA 3GQCA 5KFNA 3QZ7A 2NYVA 4P0PA 4IQTA 4RT2A 4C8LA 3KTQA 2LHTA 1KSPA 5EWGA 1JMSA 4BUGA 4Y2XA 2BCRA 8ICJA 1HUZA 5KFFA 1O08A 3IHQB 3LVVA 4QWDA 3RJIA 2HHXA 4US9A 3QEAZ 1A6SA 1DK3A 2ATLA 1JXEA 1T7PA 1X40A 3C2LA 2XC9A 4Y2SA 5KT6A 4NLBA 4BJQA 4IRDA 4I27A 3N7RC 1HIWA 5J8YC 4YR3A 1RYRA 4BDPA 1VLBA 2WB1F 2NV3A 3KZXA 2ISOA 8ICHA 2R18A 2BHNA 5ALLA 8ICFA 2RDIA 3OJUA 4OO1J 4GC7A 2W55A 2WF7A 3UPQA 9ICOA 1VJ5A 3MC1A 2HCFA 5ALRA 5ALHA 2JH1A 4J9SA 5L1MA 2KHVA 3PVXA 4OJ6A 2WF6A 5KFRA 2KZMA 5CHGA 3F5AA 4QZIA 2LYBA 1NKCA 4EX7A 2XICA 2P6RA 1NK9A 4CDGA 4QWEA 1ZQRA 4ED2A 2DBYA 2KEYA 3JPNA 2F1IA 3SEIA 3WK9A 1ZQBA 4GIBA 3RTVA 4KLSA 3KHLA 4FO6A 3WKBA 2MSNA 3A0BU 5K4LA 3NVZA 4NL9A 3TADC 1RM6C 4P0PB 2BCUA 4OJ5A 2DFLA 1BPYA 4EBEA 4IQUA 1NK7A 1J2NA 3L4PA 5CEHA 4TUSA 2N1RA 4B9LA 7ICNA 3JPRA 7ICUA 2JZBA 5DGBA 1L3VA 3GV5B 1ZETA 5AIBA 2W7OA 2M9NA 1Q3UA 4PZOA 2YMMA 5DDMA 2G0AA 7ICLA 3M6KA 2B6GA 4GXIA 1XSPA 1COOA 2JRZA 3BQ0A 1X9XA 5AICA 3H4BA 2MRLA 5HMLA 5DG9A 4QWCA 4B9NA 3RJHA 2GLEA 3QE9Y 2MU2A 3GFKB 2RDJA 3OSNA 1SIJA 4CGZA 3HRDD 5KL1B 5ALIA 4QZHA 2ZJ8A 3T5HA 2K4HA 3JPQA 4DL3A 4CF3A 3ZDAA 1T94A 1AQ6A 1GO3F 4KLMA 2FE9A 8ICOA 4AYBF 1DGJA 3TFSA 1X9MA 1ZQHA 9ICRA 4C4SA 1LVHA 2AQ4A 4P4MA 3PV8A 8ICSA 4O3SA 1SKWA 1S76D 2KSOA 3H8SA 1KTQA 4DL7A 2HBLA 1X6IA 4UAWA 2ASDA 2UVUA 4DSIA 4KLFA 4LZGA 2D3DA 1ZQKA 2K4IA 5B66U 2GO7A 2DKZA 5HHIA 1A0PA 2DWQA 1T8EA 1QCKA 5DLFA 3C1ZA 3PSPA 1L6NA 1CI4A 1T3QA 3SZ2A 3KD3A 1DRGA 2BCQA 4KLLA 5DQGA 2G5HB 1UT8A 3M1YA 1NK4A 2JZBB 4A8EA 3ALRA 5J0TA 4M2YA 1Z1VA 4GFJA 2RRDA 3D2NA 1OXJA 2BQRA 2G08A 3C5FA 1NJYA 4F71A 4R63A 5ALFA 2XO7A 2JHDA 4JK1A 3LDAA 2WAQF 5J0OA 2BPGA 3WKEA 4CCHA 5J2CA 1D8LA 2BDUA 3CRXA 4K4IA 1TK8A 1WCNA 4RQ0A 2EH9A 9ICPA 1SKRA 4YFKA 5GTHU 2HOIA 1ZXIA 1V85A 1QQ5A 4ECZA 1ZQ1C 3RFAA 3RH5A 9ICNA 4J03A 4MF2A 2JGAA 1ZQDA 5AKJA 2PMZC 1RQLA 2PFOA 2IOFK 4RUCA 2WF8A 1L3TA 2Y1JA 4ECVA 1JX4A 4M9NA 5D4BA 3TQ1A 4P0QA 4B6JA 3K1RB 1BNPA 5J2DA 4UATA 1PK1A 3PY8A 2I9GA 1TAQA 3M6ZA 5KT2A 4DFPA 2HW3A 1N48A 4ICAA 2KSOB 3ETLA 4FFDA 1MQ3A 3KBBA 5KT5A 2DPJA 2Y0SC 3SMVA 1T3NA 4QZCA 1JALA 2ASLA 4UAZA 1KKXA 2GH1A 2R8HA 2A1JA 4CE6A 3GZFA 4J9QA 1HEKA 4KMOB 1S77D 3BS5A 4QZEA 1N61A 1U47A 1KFTA 2DGZA 1H38A 1XO0A 9ICAA 3L5KA 4KMUA 5KFJA 4BWJA 2FMQA 5F3XB 2IBKA 1FFVA 5F9LA 1IM4A 5AK4A 4JWMA 4O5KA 1DK2A 1RQNA 5KFEA 4IRKA 1PVRA 1N62A 3T5JA 1QTMA 4DOCA 3TKAA 3Q8RB 2PI5A 4KX3A 2FPLA 3GDXA 4BWMA 2XVTA 1RXWA 1PK3A 4YR2A 3ICXA 3Q8QB 1KFDA 5ALSA 1ZJNA 5DB9A 2OH2A 2W3RA 4J9MA 2LI6A 3PW5A 1WG8A 2ALZA 2BR0A 1A77A 8ICGA 3H40A 3VC8A 4KLDA 3CW2C 3KHGA 2KOBA 3WK6A 3RB4A 5KFTA 3ZDCA 1ZQFA 4F2RA 3WK4A 4Y2PA 5ALVA 4B9TA 2HHTA 1PK1B 1S0NA 2ZJAA 1U49A 3WKCA 3S6JA 2H3ZA 2E1EA 9ICVA 4M9LA 4I29A 3AL0B 3NRWA 1CUKA 3CNHA 4DQQA 1P7DA 2HOQA 2O6KA 5AKKA 1IV8A 2A1JB 1JIHA 5ALQA 1M6YA 3BS5B 3QNMA 2AQ0A 8ICWA 3GILA 1J2MA 2IHMA 1C7YA 3SAFA 2V9WA 4EBCA 4BX9C 5AM2A 1ZRNA 1S10A 4M9JA 1ZQZA 1ZQAA 4UAYA 2W3SA 1LKYA 4E0DA 2H5XA 2CPRA 2AGPA 8ICTA 4PH5A 3VCBA 2ZXIA 4YQWA 2AGOA 8ICBA 2YMLA 1SXEA 2E5SA 2HOFA 4CNQA 2JEJA 3UXPA 2PXIA 2WB1C 5KFIA 7ICOA 3C1YA 4K4HA 1IXRA 5IIKA 5AIAA 3R9KA 3T5KA 2W54A 3H8JA 5KFUA 4I2JA 4PHEA 3O0FA 5IIMA 4UB1A 3JPSA 5C5JA 1S0OA 2W9MA 3M7DA 1S0MA 1OW5A 4C7ZA 2R8KA 4YR0A 2I5HA 1UPHA 2LM1A 3G6VA 1XSNA 3EW9A 1RDFA 2W9AA 4P4PA 1ZQTA 4UB8U 2VIXA 5KFLA 4DFJA 4DCCA 5BOLA 5AKXA 4BGDA 4TQRA 5AI0A 5KTQA 4RQ3A 3LWLA 4IQWA 3SV3A 2KHQA 4ELUA 2CN1A 4M6WA 4I2FA 1B0XA 4DO9A 5J8YA 4JV2A 2HI0A 1K1SA 7ICSA 4BXOA 4R66A 4PPXA 4KN7A 4I2BA 4AP9A 3GIKA 4PJ0U 3MDCA 5HHHA 5DB7A 2DUYA 2KIVA 2KZZA 3PMLA 5J0SA 4DLEA 3DV9A 1TK5A 1ZQWA 1SV0C 2IOFA 1PVPA 5HR7A 4I2AA 1LKYB 5F9NA 8ICUA 3UXOA 3PX4A 3AM9A 5KG1A 3M9MB 5DBAA 2KZ3A 4RZRA 5J2GA 1RPLA 3H0RB 5JTIA 4DSJA 4R8UA 3MFHA 5AKGA 3F2CA 2QARA 4DOAA 4MF8A 4O3RA 2XCAA 5KG3A 2BDPA 4Y2RA 4DQSA 1F0MA 5KFQA 2JXJA 2ZG6A 2FLNA 1L5UA 4KLTA 3AUOA 2KMDA 4JV1A 2HVIA 2K8AA 3HKZF 1KLNA 1UA0A 3QEBZ 2EQYA 1ZQSA 1BPEA 2NRZA 9ICUA 1RXVA 7ICKA 4NWIA 3KZIU 3TADA 4U6PA 4KLEA 3N7SC 4DQIA 2OCEA 3B9JA 4B9VA 4AYBC 1ZQQA 3OTQA 2W03A 3DEEA 4NM2A 2XCPA 4KLHA 1KFSA 1F5SA 5KFWA 1QSLA 2IHNA 1QLNA 3FDSA 2Y9TA 1ZQGA 3CYMA 1MA7A 4YD1A 4ELVA 1S9FA 2W04A 5DGAA 5KFXA 5KT7A 3G6XA 2GWSA 3SV4A 3SAHA 2V4QA 1CRXA 1NK5A 2D6FC 1AROP 2K4PA 4FZNA 4M6WB 4EEYA 1ECWA 5AM4A 4RT3A 5ALUA 4UARA 4RQ8A 2J6SA 8ICPA 7ICPA 4OJOA 3RJJA 5KFZA 2A3VA 4BXOB 1KW4A 1Y88A 5AI6A 2D8CA 8ICVA 4TUQA 1XNSA 2VKQA 1SB3C 5IIJA 1V38A 4DS5A 2KVCA 5L1JA 3KOOA 5B5EU 4R65A 4RQ5A 2ZTCA 2E8MA 2JEFA 2HBJA 2WAQC 3FAHA 5HNKA 5FP0A 4UB6U 3RAXA 4R8UB 5EE0A 1QH9A 5J2AA 3BZKA 2ZTEA 2QARB 2ZXHA 4RNNA 1Q46A 1RG6A 3BQ7A 2M0NA 4I2GA 3MDAA 2FMSA 4YMOA 2FJ6A 4NXZA 2ZIVA 1YT3A 2YB1A 4O3OA 3UMBA 4USAA 3D2QA 5AKLA 2BPFA 2HHQA 4YXMA 5ALOA 5KG6A 2I6XA 3DDHA 1NJXA 3NUQA 5C0YA 3JPTA 4ZH4A 5EE9A 3WK7A 8ICCA 1ZQJA 4M9GA 8ICIA 2P6UA 7ICMA 1XWLA 4DFMA 3GIIA 1ZQMA 3SI8A 3C28A 4F50A 2FI1A 2EANA 2WF9A 4IRCA 5KFBA 2XY7A 5CJ7A 4KLQA 3TI0A 1NKBA 4FS2A 4KTQA 3H0LB 4C80A 1N5WA 3AEVA 2ASJA 8ICZA 4C8OA 5AKIA 2G07A 2E3TA 3V7JA 3UMGA 3OPXA 4O3QA 3QUTA 3GU3A 1J97A 4UASA 4I2HA 4I2EA 2OWOA 3EUB2 4Z6CA 5J2BA 1ZQNA 3TAQA 1FFUA 4PHDA 2VA8A 4WJ3B 4I28A 3C29A 4YXJA 1ZD3A 1L7NA 1L3UA 2PKEA 1C20A 1B43A 8ICLA 1UHUA 3NS1A 2ZTDA 1UT5A 3OJSA 2RLTA 1CEZA 3QUCA 5ALYA 4DQRA 3UM9A 5DB6A 4QWBA 9ICXA 4O5CA 5A0LA 3GIJA 4EYIB 4F92B 2VJ4A 3TARA 5ALMA 2EDUA 3KKAC 1MC8A 1S5LU 3QU2A 2B0CA 3ISCA 2YB4A 2FMPA 4QZ8A 2KJ8A 3HX0A 3RBEA 3QYPA 4GXJA 2VJ5A 4M47A 2ZIVB 2C2RA 4GC6A 4JUZA 4YVZA 4TURA 5GTIU 2WF5A 4QW8A 1ZD2P 1TFRA 2AHOB 5AHXA 1KEJA 1VDVA 3TANA 1X9WA 2OYYA 4QNLA 4DL6A 2NO5A 4RNOA 3BJYA 3TAPA 3OHBA 5DG7A 3PO4A 4F5PA 3Q8PB 5J2KA 4JB3A 3LK9A 4ED8A 2VANA 4DSLA 1MQ2A 1Z19A 4OD0A 4DFKA 3OSPA 5ALJA 2DQNB 3ED5A 4ECYA 1LV5A 4DL2A 5G5GA 3EZ5A 4PGQA 1ZQLA 4F5RA 2KFNA 3PSFA 5CA7A 4Y2QA 1TAUA 3WU2U 1ZQCA 4KLUA 4K4GA 5KAIU 4O5EA 4UB4A 3MR5A 2P35A 4IC9A 1BVSA 2EZXA 4QWAA 7ICIA 5DBBA 1NJWA 2JEIA 1N2XA 3MGIA 4LVSA 5KFYA 3H8WA 2KICA 1Z00A 4ECRA 1SL0A 3EYZA 5DBCA 3AQEA 1L3SA 2VA3A 1YZ7A 4XRHA 3V7LA 5AI9A 4NLZA 5AK5A 4F5OA 4PZNA 1A76A 2YMPA 4I2CA 4DQPA 5KFAA 4F93B 3UQ0A 4DOBA 1JUDA 5AM1A 2LBOA 1NK6A 2KIWA 5TZVA 2CRXA 3B0YA 3IG5A 5KFDA 1Q3VA 1N63A 4UB5A 4US8A 4M0AA 5BOMA 3B0XA 1COKA 9ICBA 5ALPA 1JRPA 1WWUA 3C2MA 1QSYA 5DG8A 2K8BB 2F3NA 2LKYA 4UAVA 3PSTA 3EPIA 9ICQA 4ECSA 3BQ2A 1ZQPA 2KG5A 1URJA 1QQ6A 4B9SA 4O3PA 3HT3A 5DKWA 1JI7A 4QJFB 3NVYA 1ZD4A 4J9KA 3QX7A 4FE3A 2QKQA 8ICAA 3F53A 9ICWA 3KHRA 3M9OB 4P0QB 3L3FX 4X5VA 3PZPA 3K1ZA 1N56A 2YX8A 3H7IA 5HMMA 4YN4A 2QB0A 4Y2TA 4RPXA 4DSEA 9ICSA 4F4WA 3GV7B 3N7PD 4NJ8A 5ALWA 3H8MA 3H0MB 2DKXA 4YCXA 4ED7A 2HVHA 1Z00B 3PNCA 5AKZA 3Q8SB 4J9NA 1QSSA 1S8OA 1UCVA 3QU7A 2FLLA 2IA6A 2LM4A 2BQ3A 2A19A 4DSFA 3T5LA 5AM0A 2ES6A 4ECTA 5KAFU 3F2DA 2ZJ5A 4DL4A 3GV8B 4ZOHC 1JROA 1KQQA 3F5EA 3QUQA 4YMNA 4QW9A 5KNIA 3HKZC 4Q45A 4LZDA 2E8OA 4J9LA 2KTQA 3QU4A 4UAUA 4F4XA 3IDWA 5KFCA 1DGSA 5E79U 5AI4A 3ETRA 1WCLA 4ECXA 2WFAA 4KLOA 1BPDA 3BS7A 2KN7A 4QZAA 4RU9A 2ZUCA 1RYSA 2HSZA 2Q0ZX 4DF8A 4IR1A 5KFOA 4ELTA 3QZ8A 1SV0A 4KLGA 4DSKA 4EZ9A 3PW0A 1ZYQA 4UBCA 1O03A 1D9DA 2MUTA 2F1HA 3GIMA 2F77X 2DPIA 5KG0A 1UA1A 3V6HA 1ZD5A 9ICKA 7ICVA 1FEZA 4B9UA 1IIPA 3ONNA 4Q8EA 3NVWA 1XS9D 4QZGA 2F44A 2W8LA 7ICJA 4RQ2A 2QB0B 5D46A 5AK6A 5J2EA 4F8RA 2LPEA 4F3OA 2C28A 4PL1A 2HMXA 2YY6A 2RHFA 2KD1A 1ZJMA 5J0RA 1SL1A 1ZQUA 2RP5A 2K89A 4GLXA 1QQ7A 2F8LA 1BPXA 7ICEA 4R64A 5KFSA 3WKAA 1WYGA 4NLGA 4PHPA 4O0IA 2ESEA 1F44A 3RF9A 3M9NB 2Y9UA 3ISDA 3QXGA 4DF4A 3C23A 3RB3A 5HR6A 2OXOA 2HBMA 2H3IA 4O9MA 5KG5A 5J0YA 5ALNA 4Q43A 1X6JA 4OCZA 4C7YA 2PFPA 1TAMA 4YG2A 4NLNA 1NZBA 4NLCA 4YP3A 4FZMA 4RPYA 4LJXA 4FBTA 4F72A 7ICFA 2GOLA 5BPCA 1L8OA 1X42A 5J0PA 5ALTA 1NNLA 9ICEA 5IIIA 3AMZA 1XU4A 4JMUA 4XA5A 4TQSA 3FC4A 3SENA 2AH5A 3MR3A 8ICXA 7ICGA 2MUTB 4UB2A 9ICGA 3JPPA 4MEYA 4RPZA 5J0UA 9ICLA 4FS1A 2BZFA 4IR9A 2ZIXA 4G3IA 2XIDA 2FPMA 2BQUA 3V6JA 2G09A 2YMQA 1U9LA 2KJ9A 1L7MA 9ICTA 4ED0A 2R8GA 2W43A 3BDPA 4O3MA 2PI4A 5ALZA 4F91B 4Y2VA 2K8CB 1PZNA 4C8MA 3PR4A 4DL5A 5KG4A 3Q8LA 2AXTU 4IL6U 3A0HU 8ICRA 3UQ2A 3PSIA 4IS7A 4C0ZA 3LYSA 1TVAA 3K4GA 4EENA 3QU5A 2AJQA 1Q8KA 1X9SA 2WHEA 5J2IA 9ICIA 4NLKA 1N5XA 3AN1A 4ECWA 4Y2YA 5KFMA 2JH7A 1B22A 3E2EA 2YTUA 5AKEA 3FM9A 3V7KA 1U4BA 4CF4A 3PX6A 3RH4A 4XUSA 1OUQA 3IP4B 2IOHA 2EZZA 4MFAA 4P4OA 5JUMA 5AM3A 3Q8MA 2AGQA 2XI9A 4QZBA 3FYHA 4F4YA 4Y2JA 2H3VA 3MABA 3KKAA 1NK8A 2A1AA 1JN3A 4C8KA 1X2IA 2H3QA 4Q44A 2ZIXB 1FIQA 1TV9A 4RNMA 3OGUA 3T3FA 1PVQA 1SWVA 1ZQVA 5CB1A 3MGHA 1HUOA 5KFGA 2NO4A 2NRXA 2XGPA 4PL2A 3BQTA 4ACOA 2KFZA 2EZYA 5EWEA 3TFRA 4NM1A 2NRVA 5J0XA 5KG2A 5AI5A 5ALGA 4KX5A 5EE3A 4FZLA 5G5HA 2F1JA 3RRHA 1K1QA 4EYHB 1SV4A 4F5QA 1NJZA 4O3NA 2ZUBA 7ICRA 1BNOA 5KFVA 4J9RA 2K60A 3NRZA 2F8KA 8ICMA 3AU2A 3MR2A 2E8PA 5IILA 2KKPA 3IRUA 4EEKA 1S0VA 5HP4A 8ICYA 1YZ6A 3NVVA 2R8IA 5IINA 3MGVA 3H4DA 4KITB 2C2EA 4OJPA 3K75D 4CRXA 4Z6EA 5L9XA 1X66A 2KP7A 4NL9C 5DB8A 3WKDA 1L8LA 3RJKA 1XC9A 3E0FA 4Y2UA 3RJEA 4RQNA 2KV2A 4QIWC 5KFHA 1TK0A 5KL8B 2Q4TA 5D49A 5J0QA 3ZD9A 4ECQA 8ICNA 2NRTA 5AM5A 2R8JA 8ICKA 2BGWA 2FLPA 3ZDEA 2L5YA 4DS4A 2W9BA 1XSLA 1D9FA 4Z6DA 3PX0A 2IMWP 3I76A 2ISPA 2ZIWA 2G5IB 4M9HA 9ICCA 4HAIA 3V72A 1SZHA 3SQIA 2HHUA 4DFDA 4EELA 3HWTA 4I2DA 7ICHA 2EAOA 5J2JA 2PFNA 5KT4A 2HBKA 5AK3A 5IIOA 3N97B 2YN4A 3IG8A 1ZQOA 3ZDDA 4MFFA 1V9PA 1U45A 2P66A 3F2BA 2JMGA 1B4FA 3PW7A 2W9CA 2C22A 2Y1IA 5J2FA 3KHHA 4F4ZA 3SR6A 3BQ1A 4EBDA 5ALKA 2W8KA 2QLTA 2ZUDA 3C21A 1EXNA 2VA2A 3RH6A 5CWRA 5L1IA 2DL0A 3UXNA 4YD2A 5AKHA 2EAMA 1Z1BA 1JXLA 3RJFA 3V6KA 4M04A 1HJPA 2FDRA 2ZIUA 1FO4A 2E8NA 3ZI4A 1L7PA 1KL9A 2KKVA 2J6UA 3SD7A 3ORYA 2HDOA 3AQFA 3LWMA 1T4GA 2XGQA 3EPGA 3I28A 8ICQA 1SGGA 1MSWD 1XO1A 3IN5A 5T14A 1SXDA 2KJ5A 4KLIA 3OHAA 2HHWA 2BKEA 3D2SA 2F76X 2XY6A 1DOQA 3N28A 2KK0A 4ED3A 4KN4A 2AU0A 3HJEA 3Q8KA 2UVWA 2W9BB 1D8BA 4MHVA 1TKDA 3PW2A 1RZTA 2DF4B 3QUBA 2LMRA 4UW9A 2CXYA 1ZOLA 4J9PA 2KE7A 4RQ7A 5J0WA 3G6YA 1KRPA 2ZIWB 5KFKA 4QZ9A 3TACB 4PGYA 2PFQA 3RR8A 3MFIA 4JV0A 5JRTA 1SKSA 1ZQIA 1WUDA 3PMNA 1MN8A 9ICHA 4QIWF 4QZFA 5L1KA 5J2HA 3M8SA 3RRGA 1NZPA 1DXSA 5CR0A 3RB0A 3ZDBA 3EWAA 1KBUA 1BPBA 1K5OA 4XQ8A 3MBYA 4RQ6A 1KN5A 7ICQA 2W9CB 1TE2A 3IV6A 2BCSA 2KVSA 3NTUA 4ED6A 2JV3A 5CP2A 4NV0A 5KFPA 2EAPA 4ED1A 4F5NA 2BCVA 5J29A 4PHAA 4F4KA 1NI3A 2C2DA 4UB3A 4QZDA 2ZIUB 1Z3EB 2MAXA 3PO5A 5EOZA 5L1LA 8ICEA 9ICJA 2OM6A 1SL2A 4P2HA 3T79A 3KFUF 2UVVA 5AI8A 3HP6A 1V97A 4C4TA 3I1YA 2NRWA 2J6TA 4DEZA 2OHFA 2G06A 2QB1A 4Z6FA 3WK8A 2I1QA 4NY8A 2PMZF 2E1FA 4Q8FA 3NASA 2WTFA 4F2SA 5KT3A 5TISU 3RJGA 1Z4NA 2B21A 3C5GA 1NK0A 1WWVA 2MA1A 4B9MA 4CF5A 5ALDA 4KLJA 3ZD8A 7ICTA 3RAQA 3SYZA 1UQVA 4JWNA 5DQHA 4RQ4A 5DDYA 1NKEA 2Y0SF 2BPCA 2K4EA 4I2IA 2HHSA 3QU9A 2RQ5A 3ISBA 3C2KA 2YQEA 5ALEA 1LB2B 1RYUA 3BZCA 1NOMA 4ECUA 3NGDA 4EZ6A 2XY5A 5AKYA 1ZQEA 1D8YA 3CP8A 1BPZA 1Z4OA 1KDHA 2LYHA 4RQMA
chains in the Genus database with same CATH topology
2E8PA 4PZNA 3KKAC 1X40A 2Y9UA 5JTIA 2ES6A 2E8NA 1SXEA 2QARB 2B6GA 2QARA 1RG6A 3BQ7A 1PK3A 3HILA 5J8YC 1X9XA 1F0MA 1SGGA 5KNIA 1SXDA 2YTUA 2E8OA 2KMDA 1X66A 4NL9C 5JU5A 1V85A 4RQNA 2GLEA 3IDWA 2QB1A 1COKA 1WWUA 3TADA 1OW5A 2F3NA 2L5YA 5L1MA 3BS7A 4MHVA 2FE9A 3K1RB 2LMRA 1PK1B 2KG5A 1PK1A 1WWVA 2KE7A 1SV0A 2EANA 2Y9TA 3TACB 1JI7A 3SENA 5JRTA 2KSOB 3KKAA 2EAOA 2KSOA 1UQVA 2QKQA 1DXSA 2K4PA 2D3DA 3SEIA 1B0XA 5J8YA 2DKZA 2F44A 2QB0B 1KW4A 2QB0A 3BS5B 3BS5A 1B4FA 4NL9A 3TADC 2LPEA 2D8CA 4NJ8A 3H8MA 2JV3A 2KIVA 2DKXA 1V38A 5F3XB 2EAPA 1SV4A 2DL0A 1SV0C 4IS7A 1UCVA 1Z1VA 2EAMA 1LKYB 2K60A 2E8MA 1LKYA 4PZOA 4RQMA 1OXJA 2F8KA 2ESEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  4PZN A;  3KKA C;  1X40 A;  2Y9U A;  5JTI A;  2ES6 A;  2E8N A;  1SXE A;  2QAR B;  2B6G A;  2QAR A;  1RG6 A;  3BQ7 A;  1PK3 A;  3HIL A;  5J8Y C;  1X9X A;  1F0M A;  1SGG A;  5KNI A;  1SXD A;  2YTU A;  2E8O A;  2KMD A;  1X66 A;  4NL9 C;  5JU5 A;  1V85 A;  4RQN A;  2GLE A;  3IDW A;  2QB1 A;  1COK A;  1WWU A;  3TAD A;  1OW5 A;  2F3N A;  2L5Y A;  5L1M A;  3BS7 A;  4MHV A;  2FE9 A;  3K1R B;  2LMR A;  1PK1 B;  2KG5 A;  1PK1 A;  1WWV A;  2KE7 A;  1SV0 A;  2EAN A;  2Y9T A;  3TAC B;  1JI7 A;  3SEN A;  5JRT A;  2KSO B;  3KKA A;  2EAO A;  2KSO A;  1UQV A;  2QKQ A;  1DXS A;  2K4P A;  2D3D A;  3SEI A;  1B0X A;  5J8Y A;  2DKZ A;  2F44 A;  2QB0 B;  1KW4 A;  2QB0 A;  3BS5 B;  3BS5 A;  1B4F A;  4NL9 A;  3TAD C;  2LPE A;  2D8C A;  4NJ8 A;  3H8M A;  2JV3 A;  2KIV A;  2DKX A;  1V38 A;  5F3X B;  2EAP A;  1SV4 A;  2DL0 A;  1SV0 C;  4IS7 A;  1UCV A;  1Z1V A;  2EAM A;  1LKY B;  2K60 A;  2E8M A;  1LKY A;  4PZO A;  4RQM A;  1OXJ A;  2F8K A;  2ESE A; 
#chains in the Genus database with same CATH topology
 2LYA A;  3IM1 A;  2Z7J A;  2FPK A;  4YMM A;  1ED1 A;  1L7O A;  1SZP A;  3UMC A;  3D6J A;  3MR6 A;  4RUA A;  3U26 A;  3RBD A;  1U48 A;  5ALX A;  2W11 A;  3SAG A;  3HIL A;  3RB6 A;  2F2A B;  5CRX A;  4OJL A;  3HPO A;  9ICF A;  5H2F U;  4FBU A;  1N60 A;  1PUZ A;  4TUP A;  3N4M B;  5JU5 A;  3HW8 A;  1S97 A;  3M8R A;  4RQ1 A;  5DLG A;  3PR5 B;  2JEG A;  2ODG A;  4PGX A;  4C4R A;  4HYK A;  1SWW A;  2UVR A;  3AU6 A;  1ZRM A;  5KG7 A;  3THV A;  3J81 j;  4UBB A;  3E58 A;  1ZQX A;  2HHV A;  3PW4 A;  4C8N A;  4UQG A;  1BGX T;  4GXK A;  2KNJ A;  4DWI A;  5DQI A;  2V4R A;  1IG6 A;  5EWF A;  4U7C A;  3LVW A;  4EX6 A;  4J9O A;  4G9B A;  5EE1 A;  1ZQY A;  4IQV A;  2W7P A;  2H3F A;  3RR7 A;  3WK5 A;  2OEH A;  3JPO A;  4MEX A;  9ICM A;  4MFC A;  2JR5 A;  4DLG A;  3GQC A;  5KFN A;  3QZ7 A;  2NYV A;  4P0P A;  4IQT A;  4RT2 A;  4C8L A;  3KTQ A;  2LHT A;  1KSP A;  5EWG A;  1JMS A;  4BUG A;  4Y2X A;  2BCR A;  8ICJ A;  1HUZ A;  5KFF A;  1O08 A;  3IHQ B;  3LVV A;  4QWD A;  3RJI A;  2HHX A;  4US9 A;  3QEA Z;  1A6S A;  1DK3 A;  2ATL A;  1JXE A;  1T7P A;  1X40 A;  3C2L A;  2XC9 A;  4Y2S A;  5KT6 A;  4NLB A;  4BJQ A;  4IRD A;  4I27 A;  3N7R C;  1HIW A;  5J8Y C;  4YR3 A;  1RYR A;  4BDP A;  1VLB A;  2WB1 F;  2NV3 A;  3KZX A;  2ISO A;  8ICH A;  2R18 A;  2BHN A;  5ALL A;  8ICF A;  2RDI A;  3OJU A;  4OO1 J;  4GC7 A;  2W55 A;  2WF7 A;  3UPQ A;  9ICO A;  1VJ5 A;  3MC1 A;  2HCF A;  5ALR A;  5ALH A;  2JH1 A;  4J9S A;  5L1M A;  2KHV A;  3PVX A;  4OJ6 A;  2WF6 A;  5KFR A;  2KZM A;  5CHG A;  3F5A A;  4QZI A;  2LYB A;  1NKC A;  4EX7 A;  2XIC A;  2P6R A;  1NK9 A;  4CDG A;  4QWE A;  1ZQR A;  4ED2 A;  2DBY A;  2KEY A;  3JPN A;  2F1I A;  3SEI A;  3WK9 A;  1ZQB A;  4GIB A;  3RTV A;  4KLS A;  3KHL A;  4FO6 A;  3WKB A;  2MSN A;  3A0B U;  5K4L A;  3NVZ A;  4NL9 A;  3TAD C;  1RM6 C;  4P0P B;  2BCU A;  4OJ5 A;  2DFL A;  1BPY A;  4EBE A;  4IQU A;  1NK7 A;  1J2N A;  3L4P A;  5CEH A;  4TUS A;  2N1R A;  4B9L A;  7ICN A;  3JPR A;  7ICU A;  2JZB A;  5DGB A;  1L3V A;  3GV5 B;  1ZET A;  5AIB A;  2W7O A;  2M9N A;  1Q3U A;  4PZO A;  2YMM A;  5DDM A;  2G0A A;  7ICL A;  3M6K A;  2B6G A;  4GXI A;  1XSP A;  1COO A;  2JRZ A;  3BQ0 A;  1X9X A;  5AIC A;  3H4B A;  2MRL A;  5HML A;  5DG9 A;  4QWC A;  4B9N A;  3RJH A;  2GLE A;  3QE9 Y;  2MU2 A;  3GFK B;  2RDJ A;  3OSN A;  1SIJ A;  4CGZ A;  3HRD D;  5KL1 B;  5ALI A;  4QZH A;  2ZJ8 A;  3T5H A;  2K4H A;  3JPQ A;  4DL3 A;  4CF3 A;  3ZDA A;  1T94 A;  1AQ6 A;  1GO3 F;  4KLM A;  2FE9 A;  8ICO A;  4AYB F;  1DGJ A;  3TFS A;  1X9M A;  1ZQH A;  9ICR A;  4C4S A;  1LVH A;  2AQ4 A;  4P4M A;  3PV8 A;  8ICS A;  4O3S A;  1SKW A;  1S76 D;  2KSO A;  3H8S A;  1KTQ A;  4DL7 A;  2HBL A;  1X6I A;  4UAW A;  2ASD A;  2UVU A;  4DSI A;  4KLF A;  4LZG A;  2D3D A;  1ZQK A;  2K4I A;  5B66 U;  2GO7 A;  2DKZ A;  5HHI A;  1A0P A;  2DWQ A;  1T8E A;  1QCK A;  5DLF A;  3C1Z A;  3PSP A;  1L6N A;  1CI4 A;  1T3Q A;  3SZ2 A;  3KD3 A;  1DRG A;  2BCQ A;  4KLL A;  5DQG A;  2G5H B;  1UT8 A;  3M1Y A;  1NK4 A;  2JZB B;  4A8E A;  3ALR A;  5J0T A;  4M2Y A;  1Z1V A;  4GFJ A;  2RRD A;  3D2N A;  1OXJ A;  2BQR A;  2G08 A;  3C5F A;  1NJY A;  4F71 A;  4R63 A;  5ALF A;  2XO7 A;  2JHD A;  4JK1 A;  3LDA A;  2WAQ F;  5J0O A;  2BPG A;  3WKE A;  4CCH A;  5J2C A;  1D8L A;  2BDU A;  3CRX A;  4K4I A;  1TK8 A;  1WCN A;  4RQ0 A;  2EH9 A;  9ICP A;  1SKR A;  4YFK A;  5GTH U;  2HOI A;  1ZXI A;  1V85 A;  1QQ5 A;  4ECZ A;  1ZQ1 C;  3RFA A;  3RH5 A;  9ICN A;  4J03 A;  4MF2 A;  2JGA A;  1ZQD A;  5AKJ A;  2PMZ C;  1RQL A;  2PFO A;  2IOF K;  4RUC A;  2WF8 A;  1L3T A;  2Y1J A;  4ECV A;  1JX4 A;  4M9N A;  5D4B A;  3TQ1 A;  4P0Q A;  4B6J A;  3K1R B;  1BNP A;  5J2D A;  4UAT A;  1PK1 A;  3PY8 A;  2I9G A;  1TAQ A;  3M6Z A;  5KT2 A;  4DFP A;  2HW3 A;  1N48 A;  4ICA A;  2KSO B;  3ETL A;  4FFD A;  1MQ3 A;  3KBB A;  5KT5 A;  2DPJ A;  2Y0S C;  3SMV A;  1T3N A;  4QZC A;  1JAL A;  2ASL A;  4UAZ A;  1KKX A;  2GH1 A;  2R8H A;  2A1J A;  4CE6 A;  3GZF A;  4J9Q A;  1HEK A;  4KMO B;  1S77 D;  3BS5 A;  4QZE A;  1N61 A;  1U47 A;  1KFT A;  2DGZ A;  1H38 A;  1XO0 A;  9ICA A;  3L5K A;  4KMU A;  5KFJ A;  4BWJ A;  2FMQ A;  5F3X B;  2IBK A;  1FFV A;  5F9L A;  1IM4 A;  5AK4 A;  4JWM A;  4O5K A;  1DK2 A;  1RQN A;  5KFE A;  4IRK A;  1PVR A;  1N62 A;  3T5J A;  1QTM A;  4DOC A;  3TKA A;  3Q8R B;  2PI5 A;  4KX3 A;  2FPL A;  3GDX A;  4BWM A;  2XVT A;  1RXW A;  1PK3 A;  4YR2 A;  3ICX A;  3Q8Q B;  1KFD A;  5ALS A;  1ZJN A;  5DB9 A;  2OH2 A;  2W3R A;  4J9M A;  2LI6 A;  3PW5 A;  1WG8 A;  2ALZ A;  2BR0 A;  1A77 A;  8ICG A;  3H40 A;  3VC8 A;  4KLD A;  3CW2 C;  3KHG A;  2KOB A;  3WK6 A;  3RB4 A;  5KFT A;  3ZDC A;  1ZQF A;  4F2R A;  3WK4 A;  4Y2P A;  5ALV A;  4B9T A;  2HHT A;  1PK1 B;  1S0N A;  2ZJA A;  1U49 A;  3WKC A;  3S6J A;  2H3Z A;  2E1E A;  9ICV A;  4M9L A;  4I29 A;  3AL0 B;  3NRW A;  1CUK A;  3CNH A;  4DQQ A;  1P7D A;  2HOQ A;  2O6K A;  5AKK A;  1IV8 A;  2A1J B;  1JIH A;  5ALQ A;  1M6Y A;  3BS5 B;  3QNM A;  2AQ0 A;  8ICW A;  3GIL A;  1J2M A;  2IHM A;  1C7Y A;  3SAF A;  2V9W A;  4EBC A;  4BX9 C;  5AM2 A;  1ZRN A;  1S10 A;  4M9J A;  1ZQZ A;  1ZQA A;  4UAY A;  2W3S A;  1LKY A;  4E0D A;  2H5X A;  2CPR A;  2AGP A;  8ICT A;  4PH5 A;  3VCB A;  2ZXI A;  4YQW A;  2AGO A;  8ICB A;  2YML A;  1SXE A;  2E5S A;  2HOF A;  4CNQ A;  2JEJ A;  3UXP A;  2PXI A;  2WB1 C;  5KFI A;  7ICO A;  3C1Y A;  4K4H A;  1IXR A;  5IIK A;  5AIA A;  3R9K A;  3T5K A;  2W54 A;  3H8J A;  5KFU A;  4I2J A;  4PHE A;  3O0F A;  5IIM A;  4UB1 A;  3JPS A;  5C5J A;  1S0O A;  2W9M A;  3M7D A;  1S0M A;  1OW5 A;  4C7Z A;  2R8K A;  4YR0 A;  2I5H A;  1UPH A;  2LM1 A;  3G6V A;  1XSN A;  3EW9 A;  1RDF A;  2W9A A;  4P4P A;  1ZQT A;  4UB8 U;  2VIX A;  5KFL A;  4DFJ A;  4DCC A;  5BOL A;  5AKX A;  4BGD A;  4TQR A;  5AI0 A;  5KTQ A;  4RQ3 A;  3LWL A;  4IQW A;  3SV3 A;  2KHQ A;  4ELU A;  2CN1 A;  4M6W A;  4I2F A;  1B0X A;  4DO9 A;  5J8Y A;  4JV2 A;  2HI0 A;  1K1S A;  7ICS A;  4BXO A;  4R66 A;  4PPX A;  4KN7 A;  4I2B A;  4AP9 A;  3GIK A;  4PJ0 U;  3MDC A;  5HHH A;  5DB7 A;  2DUY A;  2KIV A;  2KZZ A;  3PML A;  5J0S A;  4DLE A;  3DV9 A;  1TK5 A;  1ZQW A;  1SV0 C;  2IOF A;  1PVP A;  5HR7 A;  4I2A A;  1LKY B;  5F9N A;  8ICU A;  3UXO A;  3PX4 A;  3AM9 A;  5KG1 A;  3M9M B;  5DBA A;  2KZ3 A;  4RZR A;  5J2G A;  1RPL A;  3H0R B;  5JTI A;  4DSJ A;  4R8U A;  3MFH A;  5AKG A;  3F2C A;  2QAR A;  4DOA A;  4MF8 A;  4O3R A;  2XCA A;  5KG3 A;  2BDP A;  4Y2R A;  4DQS A;  1F0M A;  5KFQ A;  2JXJ A;  2ZG6 A;  2FLN A;  1L5U A;  4KLT A;  3AUO A;  2KMD A;  4JV1 A;  2HVI A;  2K8A A;  3HKZ F;  1KLN A;  1UA0 A;  3QEB Z;  2EQY A;  1ZQS A;  1BPE A;  2NRZ A;  9ICU A;  1RXV A;  7ICK A;  4NWI A;  3KZI U;  3TAD A;  4U6P A;  4KLE A;  3N7S C;  4DQI A;  2OCE A;  3B9J A;  4B9V A;  4AYB C;  1ZQQ A;  3OTQ A;  2W03 A;  3DEE A;  4NM2 A;  2XCP A;  4KLH A;  1KFS A;  1F5S A;  5KFW A;  1QSL A;  2IHN A;  1QLN A;  3FDS A;  2Y9T A;  1ZQG A;  3CYM A;  1MA7 A;  4YD1 A;  4ELV A;  1S9F A;  2W04 A;  5DGA A;  5KFX A;  5KT7 A;  3G6X A;  2GWS A;  3SV4 A;  3SAH A;  2V4Q A;  1CRX A;  1NK5 A;  2D6F C;  1ARO P;  2K4P A;  4FZN A;  4M6W B;  4EEY A;  1ECW A;  5AM4 A;  4RT3 A;  5ALU A;  4UAR A;  4RQ8 A;  2J6S A;  8ICP A;  7ICP A;  4OJO A;  3RJJ A;  5KFZ A;  2A3V A;  4BXO B;  1KW4 A;  1Y88 A;  5AI6 A;  2D8C A;  8ICV A;  4TUQ A;  1XNS A;  2VKQ A;  1SB3 C;  5IIJ A;  1V38 A;  4DS5 A;  2KVC A;  5L1J A;  3KOO A;  5B5E U;  4R65 A;  4RQ5 A;  2ZTC A;  2E8M A;  2JEF A;  2HBJ A;  2WAQ C;  3FAH A;  5HNK A;  5FP0 A;  4UB6 U;  3RAX A;  4R8U B;  5EE0 A;  1QH9 A;  5J2A A;  3BZK A;  2ZTE A;  2QAR B;  2ZXH A;  4RNN A;  1Q46 A;  1RG6 A;  3BQ7 A;  2M0N A;  4I2G A;  3MDA A;  2FMS A;  4YMO A;  2FJ6 A;  4NXZ A;  2ZIV A;  1YT3 A;  2YB1 A;  4O3O A;  3UMB A;  4USA A;  3D2Q A;  5AKL A;  2BPF A;  2HHQ A;  4YXM A;  5ALO A;  5KG6 A;  2I6X A;  3DDH A;  1NJX A;  3NUQ A;  5C0Y A;  3JPT A;  4ZH4 A;  5EE9 A;  3WK7 A;  8ICC A;  1ZQJ A;  4M9G A;  8ICI A;  2P6U A;  7ICM A;  1XWL A;  4DFM A;  3GII A;  1ZQM A;  3SI8 A;  3C28 A;  4F50 A;  2FI1 A;  2EAN A;  2WF9 A;  4IRC A;  5KFB A;  2XY7 A;  5CJ7 A;  4KLQ A;  3TI0 A;  1NKB A;  4FS2 A;  4KTQ A;  3H0L B;  4C80 A;  1N5W A;  3AEV A;  2ASJ A;  8ICZ A;  4C8O A;  5AKI A;  2G07 A;  2E3T A;  3V7J A;  3UMG A;  3OPX A;  4O3Q A;  3QUT A;  3GU3 A;  1J97 A;  4UAS A;  4I2H A;  4I2E A;  2OWO A;  3EUB 2;  4Z6C A;  5J2B A;  1ZQN A;  3TAQ A;  1FFU A;  4PHD A;  2VA8 A;  4WJ3 B;  4I28 A;  3C29 A;  4YXJ A;  1ZD3 A;  1L7N A;  1L3U A;  2PKE A;  1C20 A;  1B43 A;  8ICL A;  1UHU A;  3NS1 A;  2ZTD A;  1UT5 A;  3OJS A;  2RLT A;  1CEZ A;  3QUC A;  5ALY A;  4DQR A;  3UM9 A;  5DB6 A;  4QWB A;  9ICX A;  4O5C A;  5A0L A;  3GIJ A;  4EYI B;  4F92 B;  2VJ4 A;  3TAR A;  5ALM A;  2EDU A;  3KKA C;  1MC8 A;  1S5L U;  3QU2 A;  2B0C A;  3ISC A;  2YB4 A;  2FMP A;  4QZ8 A;  2KJ8 A;  3HX0 A;  3RBE A;  3QYP A;  4GXJ A;  2VJ5 A;  4M47 A;  2ZIV B;  2C2R A;  4GC6 A;  4JUZ A;  4YVZ A;  4TUR A;  5GTI U;  2WF5 A;  4QW8 A;  1ZD2 P;  1TFR A;  2AHO B;  5AHX A;  1KEJ A;  1VDV A;  3TAN A;  1X9W A;  2OYY A;  4QNL A;  4DL6 A;  2NO5 A;  4RNO A;  3BJY A;  3TAP A;  3OHB A;  5DG7 A;  3PO4 A;  4F5P A;  3Q8P B;  5J2K A;  4JB3 A;  3LK9 A;  4ED8 A;  2VAN A;  4DSL A;  1MQ2 A;  1Z19 A;  4OD0 A;  4DFK A;  3OSP A;  5ALJ A;  2DQN B;  3ED5 A;  4ECY A;  1LV5 A;  4DL2 A;  5G5G A;  3EZ5 A;  4PGQ A;  1ZQL A;  4F5R A;  2KFN A;  3PSF A;  5CA7 A;  4Y2Q A;  1TAU A;  3WU2 U;  1ZQC A;  4KLU A;  4K4G A;  5KAI U;  4O5E A;  4UB4 A;  3MR5 A;  2P35 A;  4IC9 A;  1BVS A;  2EZX A;  4QWA A;  7ICI A;  5DBB A;  1NJW A;  2JEI A;  1N2X A;  3MGI A;  4LVS A;  5KFY A;  3H8W A;  2KIC A;  1Z00 A;  4ECR A;  1SL0 A;  3EYZ A;  5DBC A;  3AQE A;  1L3S A;  2VA3 A;  1YZ7 A;  4XRH A;  3V7L A;  5AI9 A;  4NLZ A;  5AK5 A;  4F5O A;  4PZN A;  1A76 A;  2YMP A;  4I2C A;  4DQP A;  5KFA A;  4F93 B;  3UQ0 A;  4DOB A;  1JUD A;  5AM1 A;  2LBO A;  1NK6 A;  2KIW A;  5TZV A;  2CRX A;  3B0Y A;  3IG5 A;  5KFD A;  1Q3V A;  1N63 A;  4UB5 A;  4US8 A;  4M0A A;  5BOM A;  3B0X A;  1COK A;  9ICB A;  5ALP A;  1JRP A;  1WWU A;  3C2M A;  1QSY A;  5DG8 A;  2K8B B;  2F3N A;  2LKY A;  4UAV A;  3PST A;  3EPI A;  9ICQ A;  4ECS A;  3BQ2 A;  1ZQP A;  2KG5 A;  1URJ A;  1QQ6 A;  4B9S A;  4O3P A;  3HT3 A;  5DKW A;  1JI7 A;  4QJF B;  3NVY A;  1ZD4 A;  4J9K A;  3QX7 A;  4FE3 A;  2QKQ A;  8ICA A;  3F53 A;  9ICW A;  3KHR A;  3M9O B;  4P0Q B;  3L3F X;  4X5V A;  3PZP A;  3K1Z A;  1N56 A;  2YX8 A;  3H7I A;  5HMM A;  4YN4 A;  2QB0 A;  4Y2T A;  4RPX A;  4DSE A;  9ICS A;  4F4W A;  3GV7 B;  3N7P D;  4NJ8 A;  5ALW A;  3H8M A;  3H0M B;  2DKX A;  4YCX A;  4ED7 A;  2HVH A;  1Z00 B;  3PNC A;  5AKZ A;  3Q8S B;  4J9N A;  1QSS A;  1S8O A;  1UCV A;  3QU7 A;  2FLL A;  2IA6 A;  2LM4 A;  2BQ3 A;  2A19 A;  4DSF A;  3T5L A;  5AM0 A;  2ES6 A;  4ECT A;  5KAF U;  3F2D A;  2ZJ5 A;  4DL4 A;  3GV8 B;  4ZOH C;  1JRO A;  1KQQ A;  3F5E A;  3QUQ A;  4YMN A;  4QW9 A;  5KNI A;  3HKZ C;  4Q45 A;  4LZD A;  2E8O A;  4J9L A;  2KTQ A;  3QU4 A;  4UAU A;  4F4X A;  3IDW A;  5KFC A;  1DGS A;  5E79 U;  5AI4 A;  3ETR A;  1WCL A;  4ECX A;  2WFA A;  4KLO A;  1BPD A;  3BS7 A;  2KN7 A;  4QZA A;  4RU9 A;  2ZUC A;  1RYS A;  2HSZ A;  2Q0Z X;  4DF8 A;  4IR1 A;  5KFO A;  4ELT A;  3QZ8 A;  1SV0 A;  4KLG A;  4DSK A;  4EZ9 A;  3PW0 A;  1ZYQ A;  4UBC A;  1O03 A;  1D9D A;  2MUT A;  2F1H A;  3GIM A;  2F77 X;  2DPI A;  5KG0 A;  1UA1 A;  3V6H A;  1ZD5 A;  9ICK A;  7ICV A;  1FEZ A;  4B9U A;  1IIP A;  3ONN A;  4Q8E A;  3NVW A;  1XS9 D;  4QZG A;  2F44 A;  2W8L A;  7ICJ A;  4RQ2 A;  2QB0 B;  5D46 A;  5AK6 A;  5J2E A;  4F8R A;  2LPE A;  4F3O A;  2C28 A;  4PL1 A;  2HMX A;  2YY6 A;  2RHF A;  2KD1 A;  1ZJM A;  5J0R A;  1SL1 A;  1ZQU A;  2RP5 A;  2K89 A;  4GLX A;  1QQ7 A;  2F8L A;  1BPX A;  7ICE A;  4R64 A;  5KFS A;  3WKA A;  1WYG A;  4NLG A;  4PHP A;  4O0I A;  2ESE A;  1F44 A;  3RF9 A;  3M9N B;  2Y9U A;  3ISD A;  3QXG A;  4DF4 A;  3C23 A;  3RB3 A;  5HR6 A;  2OXO A;  2HBM A;  2H3I A;  4O9M A;  5KG5 A;  5J0Y A;  5ALN A;  4Q43 A;  1X6J A;  4OCZ A;  4C7Y A;  2PFP A;  1TAM A;  4YG2 A;  4NLN A;  1NZB A;  4NLC A;  4YP3 A;  4FZM A;  4RPY A;  4LJX A;  4FBT A;  4F72 A;  7ICF A;  2GOL A;  5BPC A;  1L8O A;  1X42 A;  5J0P A;  5ALT A;  1NNL A;  9ICE A;  5III A;  3AMZ A;  1XU4 A;  4JMU A;  4XA5 A;  4TQS A;  3FC4 A;  3SEN A;  2AH5 A;  3MR3 A;  8ICX A;  7ICG A;  2MUT B;  4UB2 A;  9ICG A;  3JPP A;  4MEY A;  4RPZ A;  5J0U A;  9ICL A;  4FS1 A;  2BZF A;  4IR9 A;  2ZIX A;  4G3I A;  2XID A;  2FPM A;  2BQU A;  3V6J A;  2G09 A;  2YMQ A;  1U9L A;  2KJ9 A;  1L7M A;  9ICT A;  4ED0 A;  2R8G A;  2W43 A;  3BDP A;  4O3M A;  2PI4 A;  5ALZ A;  4F91 B;  4Y2V A;  2K8C B;  1PZN A;  4C8M A;  3PR4 A;  4DL5 A;  5KG4 A;  3Q8L A;  2AXT U;  4IL6 U;  3A0H U;  8ICR A;  3UQ2 A;  3PSI A;  4IS7 A;  4C0Z A;  3LYS A;  1TVA A;  3K4G A;  4EEN A;  3QU5 A;  2AJQ A;  1Q8K A;  1X9S A;  2WHE A;  5J2I A;  9ICI A;  4NLK A;  1N5X A;  3AN1 A;  4ECW A;  4Y2Y A;  5KFM A;  2JH7 A;  1B22 A;  3E2E A;  2YTU A;  5AKE A;  3FM9 A;  3V7K A;  1U4B A;  4CF4 A;  3PX6 A;  3RH4 A;  4XUS A;  1OUQ A;  3IP4 B;  2IOH A;  2EZZ A;  4MFA A;  4P4O A;  5JUM A;  5AM3 A;  3Q8M A;  2AGQ A;  2XI9 A;  4QZB A;  3FYH A;  4F4Y A;  4Y2J A;  2H3V A;  3MAB A;  3KKA A;  1NK8 A;  2A1A A;  1JN3 A;  4C8K A;  1X2I A;  2H3Q A;  4Q44 A;  2ZIX B;  1FIQ A;  1TV9 A;  4RNM A;  3OGU A;  3T3F A;  1PVQ A;  1SWV A;  1ZQV A;  5CB1 A;  3MGH A;  1HUO A;  5KFG A;  2NO4 A;  2NRX A;  2XGP A;  4PL2 A;  3BQT A;  4ACO A;  2KFZ A;  2EZY A;  5EWE A;  3TFR A;  4NM1 A;  2NRV A;  5J0X A;  5KG2 A;  5AI5 A;  5ALG A;  4KX5 A;  5EE3 A;  4FZL A;  5G5H A;  2F1J A;  3RRH A;  1K1Q A;  4EYH B;  1SV4 A;  4F5Q A;  1NJZ A;  4O3N A;  2ZUB A;  7ICR A;  1BNO A;  5KFV A;  4J9R A;  2K60 A;  3NRZ A;  2F8K A;  8ICM A;  3AU2 A;  3MR2 A;  2E8P A;  5IIL A;  2KKP A;  3IRU A;  4EEK A;  1S0V A;  5HP4 A;  8ICY A;  1YZ6 A;  3NVV A;  2R8I A;  5IIN A;  3MGV A;  3H4D A;  4KIT B;  2C2E A;  4OJP A;  3K75 D;  4CRX A;  4Z6E A;  5L9X A;  1X66 A;  2KP7 A;  4NL9 C;  5DB8 A;  3WKD A;  1L8L A;  3RJK A;  1XC9 A;  3E0F A;  4Y2U A;  3RJE A;  4RQN A;  2KV2 A;  4QIW C;  5KFH A;  1TK0 A;  5KL8 B;  2Q4T A;  5D49 A;  5J0Q A;  3ZD9 A;  4ECQ A;  8ICN A;  2NRT A;  5AM5 A;  2R8J A;  8ICK A;  2BGW A;  2FLP A;  3ZDE A;  2L5Y A;  4DS4 A;  2W9B A;  1XSL A;  1D9F A;  4Z6D A;  3PX0 A;  2IMW P;  3I76 A;  2ISP A;  2ZIW A;  2G5I B;  4M9H A;  9ICC A;  4HAI A;  3V72 A;  1SZH A;  3SQI A;  2HHU A;  4DFD A;  4EEL A;  3HWT A;  4I2D A;  7ICH A;  2EAO A;  5J2J A;  2PFN A;  5KT4 A;  2HBK A;  5AK3 A;  5IIO A;  3N97 B;  2YN4 A;  3IG8 A;  1ZQO A;  3ZDD A;  4MFF A;  1V9P A;  1U45 A;  2P66 A;  3F2B A;  2JMG A;  1B4F A;  3PW7 A;  2W9C A;  2C22 A;  2Y1I A;  5J2F A;  3KHH A;  4F4Z A;  3SR6 A;  3BQ1 A;  4EBD A;  5ALK A;  2W8K A;  2QLT A;  2ZUD A;  3C21 A;  1EXN A;  2VA2 A;  3RH6 A;  5CWR A;  5L1I A;  2DL0 A;  3UXN A;  4YD2 A;  5AKH A;  2EAM A;  1Z1B A;  1JXL A;  3RJF A;  3V6K A;  4M04 A;  1HJP A;  2FDR A;  2ZIU A;  1FO4 A;  2E8N A;  3ZI4 A;  1L7P A;  1KL9 A;  2KKV A;  2J6U A;  3SD7 A;  3ORY A;  2HDO A;  3AQF A;  3LWM A;  1T4G A;  2XGQ A;  3EPG A;  3I28 A;  8ICQ A;  1SGG A;  1MSW D;  1XO1 A;  3IN5 A;  5T14 A;  1SXD A;  2KJ5 A;  4KLI A;  3OHA A;  2HHW A;  2BKE A;  3D2S A;  2F76 X;  2XY6 A;  1DOQ A;  3N28 A;  2KK0 A;  4ED3 A;  4KN4 A;  2AU0 A;  3HJE A;  3Q8K A;  2UVW A;  2W9B B;  1D8B A;  4MHV A;  1TKD A;  3PW2 A;  1RZT A;  2DF4 B;  3QUB A;  2LMR A;  4UW9 A;  2CXY A;  1ZOL A;  4J9P A;  2KE7 A;  4RQ7 A;  5J0W A;  3G6Y A;  1KRP A;  2ZIW B;  5KFK A;  4QZ9 A;  3TAC B;  4PGY A;  2PFQ A;  3RR8 A;  3MFI A;  4JV0 A;  5JRT A;  1SKS A;  1ZQI A;  1WUD A;  3PMN A;  1MN8 A;  9ICH A;  4QIW F;  4QZF A;  5L1K A;  5J2H A;  3M8S A;  3RRG A;  1NZP A;  1DXS A;  5CR0 A;  3RB0 A;  3ZDB A;  3EWA A;  1KBU A;  1BPB A;  1K5O A;  4XQ8 A;  3MBY A;  4RQ6 A;  1KN5 A;  7ICQ A;  2W9C B;  1TE2 A;  3IV6 A;  2BCS A;  2KVS A;  3NTU A;  4ED6 A;  2JV3 A;  5CP2 A;  4NV0 A;  5KFP A;  2EAP A;  4ED1 A;  4F5N A;  2BCV A;  5J29 A;  4PHA A;  4F4K A;  1NI3 A;  2C2D A;  4UB3 A;  4QZD A;  2ZIU B;  1Z3E B;  2MAX A;  3PO5 A;  5EOZ A;  5L1L A;  8ICE A;  9ICJ A;  2OM6 A;  1SL2 A;  4P2H A;  3T79 A;  3KFU F;  2UVV A;  5AI8 A;  3HP6 A;  1V97 A;  4C4T A;  3I1Y A;  2NRW A;  2J6T A;  4DEZ A;  2OHF A;  2G06 A;  2QB1 A;  4Z6F A;  3WK8 A;  2I1Q A;  4NY8 A;  2PMZ F;  2E1F A;  4Q8F A;  3NAS A;  2WTF A;  4F2S A;  5KT3 A;  5TIS U;  3RJG A;  1Z4N A;  2B21 A;  3C5G A;  1NK0 A;  1WWV A;  2MA1 A;  4B9M A;  4CF5 A;  5ALD A;  4KLJ A;  3ZD8 A;  7ICT A;  3RAQ A;  3SYZ A;  1UQV A;  4JWN A;  5DQH A;  4RQ4 A;  5DDY A;  1NKE A;  2Y0S F;  2BPC A;  2K4E A;  4I2I A;  2HHS A;  3QU9 A;  2RQ5 A;  3ISB A;  3C2K A;  2YQE A;  5ALE A;  1LB2 B;  1RYU A;  3BZC A;  1NOM A;  4ECU A;  3NGD A;  4EZ6 A;  2XY5 A;  5AKY A;  1ZQE A;  1D8Y A;  3CP8 A;  1BPZ A;  1Z4O A;  1KDH A;  2LYH A;  4RQM A; 
#chains in the Genus database with same CATH homology
 2E8P A;  4PZN A;  3KKA C;  1X40 A;  2Y9U A;  5JTI A;  2ES6 A;  2E8N A;  1SXE A;  2QAR B;  2B6G A;  2QAR A;  1RG6 A;  3BQ7 A;  1PK3 A;  3HIL A;  5J8Y C;  1X9X A;  1F0M A;  1SGG A;  5KNI A;  1SXD A;  2YTU A;  2E8O A;  2KMD A;  1X66 A;  4NL9 C;  5JU5 A;  1V85 A;  4RQN A;  2GLE A;  3IDW A;  2QB1 A;  1COK A;  1WWU A;  3TAD A;  1OW5 A;  2F3N A;  2L5Y A;  5L1M A;  3BS7 A;  4MHV A;  2FE9 A;  3K1R B;  2LMR A;  1PK1 B;  2KG5 A;  1PK1 A;  1WWV A;  2KE7 A;  1SV0 A;  2EAN A;  2Y9T A;  3TAC B;  1JI7 A;  3SEN A;  5JRT A;  2KSO B;  3KKA A;  2EAO A;  2KSO A;  1UQV A;  2QKQ A;  1DXS A;  2K4P A;  2D3D A;  3SEI A;  1B0X A;  5J8Y A;  2DKZ A;  2F44 A;  2QB0 B;  1KW4 A;  2QB0 A;  3BS5 B;  3BS5 A;  1B4F A;  4NL9 A;  3TAD C;  2LPE A;  2D8C A;  4NJ8 A;  3H8M A;  2JV3 A;  2KIV A;  2DKX A;  1V38 A;  5F3X B;  2EAP A;  1SV4 A;  2DL0 A;  1SV0 C;  4IS7 A;  1UCV A;  1Z1V A;  2EAM A;  1LKY B;  2K60 A;  2E8M A;  1LKY A;  4PZO A;  4RQM A;  1OXJ A;  2F8K A;  2ESE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...