4PZNA

Crystal structure of phc3 sam l971e
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPAEKICARINSLKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyhomeotic-like protein 3
publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 70
sequence length 70
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pznA00
1B0XA 2LPEA 1PK3A 1WWUA 3H8MA 4RQMA 1UCVA 2EANA 2DKXA 5L1MA 1PK1B 2D3DA 2E8PA 3SENA 2KMDA 2YTUA 3BS5A 5F3XB 1RG6A 3BQ7A 2Y9UA 1JI7A 3HILA 2F8KA 2K60A 2E8MA 2KE7A 2DKZA 3IDWA 1KW4A 2F44A 2QB1A 3KKAC 3KKAA 2GLEA 3BS7A 2E8NA 1UQVA 1PK1A 4IS7A 1WWVA 1X40A 1COKA 1B4FA 2KSOB 3TADA 3TADC 1X9XA 2ES6A 2Y9TA 1V38A 1SXDA 5JRTA 2EAPA 2QARB 2DL0A 1SXEA 2K4PA 3K1RB 2QB0B 2LMRA 2F3NA 2JV3A 2L5YA 4RQNA 1OXJA 1V85A 5JU5A 2D8CA 1LKYB 5KNIA 2KIVA 4PZNA 3SEIA 1F0MA 2E8OA 1DXSA 2KSOA 2EAMA 1SV4A 1SV0A 1SV0C 2EAOA 3TACB 2QARA 2KG5A 2QKQA 1X66A 1Z1VA 2QB0A 5J8YA 5J8YC 3BS5B 5JTIA 4PZOA 2FE9A 1OW5A 2ESEA 4NL9A 4NJ8A 4NL9C 4MHVA 1LKYA 1SGGA 2B6GA
chains in the Genus database with same CATH superfamily
2F1HA 3AL0B 5KFBA 3C21A 1XO1A 5DB9A 3I28A 3TFRA 2HHWA 1F44A 2KNJA 4M9LA 1NI3A 2EANA 3Q8KA 2ISPA 1IV8A 4CF3A 4RQ2A 2XCPA 8ICRA 9ICTA 2F77X 2YB1A 2G5HB 4RQ5A 4MFAA 4RZRA 2K8CB 4DLEA 3C23A 3HILA 2OHFA 3EYZA 1S0VA 3KTQA 4NLZA 2R8KA 2VA8A 4JV1A 4AYBF 4DO9A 4ACOA 4R66A 8ICTA 2AXTU 3WK5A 5IIIA 1ZQYA 3GDXA 4BWJA 2Y0SF 1V38A 4JWMA 1JXLA 3ISDA 2NV3A 5J2IA 2WF9A 5KAIU 5L1KA 3K1RB 3C2LA 4ECTA 3QUQA 3MGIA 1ZETA 4O3PA 4X5VA 3TI0A 2WAQF 3AU6A 1U4BA 1NKCA 5ALWA 4DEZA 1L7MA 2HI0A 5AKEA 4ZH4A 3KBBA 2J6UA 4DFDA 2HBKA 2JH1A 8ICIA 4DQRA 2H3VA 3LDAA 4MF2A 3NRZA 1SV4A 2KJ9A 2QLTA 4RQ0A 1L3UA 5ALVA 7ICEA 9ICBA 2XC9A 1SKSA 8ICCA 2MA1A 1J97A 3JPRA 4KX3A 1D9DA 5HR6A 3RAQA 1ZJNA 1N60A 5ALOA 3HT3A 1JN3A 3H0RB 1B43A 3SAGA 2WF6A 4G9BA 1ZD2P 3RBDA 4UBCA 4KLUA 5J2BA 4F5QA 4J9RA 3TANA 2KP7A 4ED6A 4DS5A 5BPCA 1N56A 8ICVA 4LJXA 5J2DA 5J2AA 4OJ5A 1ZQJA 3J81j 3PX6A 1NK7A 2HOIA 3RF9A 4TURA 1QLNA 2GLEA 4KLLA 3F2CA 1D9FA 4RQ6A 3UXOA 2KZMA 4QIWC 7ICLA 3AMZA 4YG2A 1ZQIA 3BQTA 5JRTA 2W55A 1X6IA 4DSLA 5KG4A 4OO1J 5A0LA 5DB7A 2HCFA 4Q8EA 5J2GA 4M2YA 1Z00A 2BCUA 3KHGA 3LWMA 3JPQA 4ECRA 3PW4A 5AK4A 3SR6A 1SKRA 4RU9A 3V7JA 3GZFA 5DG7A 1NJZA 2AQ4A 2UVWA 2DF4B 5AM1A 5HHHA 4TUQA 2W8LA 9ICMA 4KMOB 1UA0A 2R8HA 4J03A 3IP4B 4ED8A 2ESEA 3N28A 3T5JA 3PZPA 1QQ7A 1DGJA 3F5EA 4Y2PA 4PHEA 5KT4A 1QTMA 4I29A 4ECSA 2KIWA 4UASA 5KFQA 1Q8KA 3A0BU 2KKVA 5CJ7A 3RJEA 1LVHA 3K4GA 3N7PD 4G3IA 2DKXA 2WB1C 4UATA 5KFZA 1TK5A 4EELA 4QZBA 4ECUA 3QEAZ 4DF4A 4DS4A 2C2DA 3WKAA 2B21A 3JPNA 2W9CA 3KHHA 4NLNA 5AKIA 3T5KA 3CYMA 2W9MA 2WTFA 4YFKA 3NRWA 2VANA 2RRDA 8ICGA 1ZQ1C 3IDWA 1L7OA 4B9UA 4F2SA 2V4QA 4UAYA 2HBJA 7ICGA 5L1LA 3WKBA 3F2DA 4QZ8A 5HHIA 3ZDAA 2A19A 2QB0B 2Z7JA 1X2IA 3AN1A 4UB8U 5CA7A 4RNNA 4FZLA 5F9LA 2G09A 1NK5A 1N2XA 3IV6A 3IHQB 2HVHA 4Y2XA 1RQNA 5HP4A 2KJ8A 2E8OA 4C7YA 4F5NA 2LYAA 5KFVA 3OPXA 1T3QA 1VDVA 3PMLA 4NLBA 1YZ6A 2JEGA 4YMMA 3D6JA 4DQQA 2VA3A 4UW9A 2RP5A 4NXZA 2J6SA 3V7LA 1IG6A 4P2HA 3AU2A 5KFEA 2LHTA 1NK8A 4PGYA 5KFIA 2ALZA 1L5UA 1ZQBA 8ICMA 4C80A 8ICNA 1ZQKA 5KG7A 5ALGA 5KAFU 5DG8A 5HR7A 4RQ7A 4C4SA 3OSNA 2HHVA 4USAA 4QZCA 1BVSA 3M9NB 4P0PA 5AM3A 1QSSA 8ICLA 3QZ8A 4JK1A 4Q44A 2DUYA 9ICQA 3KZXA 3H7IA 5AK3A 4EBCA 4C8OA 4K4HA 3KKAC 3UM9A 3RTVA 2Y1JA 2JR5A 1KFTA 1NK0A 4IS7A 1ZQOA 7ICFA 4DFKA 1TK8A 3SI8A 2WHEA 2HHUA 4KLHA 1KEJA 5DLGA 8ICPA 3LWLA 2JZBB 3ZD9A 4QZ9A 3HRDD 3K1ZA 4RQNA 2HHXA 3HKZF 1BPXA 2Y1IA 2HW3A 1QH9A 3ALRA 1D8LA 2YB4A 2JXJA 1DXSA 4FBUA 7ICHA 5CEHA 4M0AA 3OJUA 4DFJA 1FFUA 3DEEA 4RQ1A 3EPIA 3MABA 1QCKA 2ZG6A 2ZIXA 4UAVA 4UB3A 4OJ6A 5HNKA 3E58A 4UB2A 4NL9C 3SV4A 1XC9A 2W04A 1HUZA 1SGGA 1SB3C 1Z19A 1VJ5A 8ICHA 2LPEA 1DK2A 1NK9A 3SAFA 2BPFA 4A8EA 2R8JA 2K4EA 4JV2A 3PR5B 1ZQFA 4YN4A 4NLKA 5ALXA 3ETLA 5EWGA 1X6JA 2OCEA 3BQ2A 4DQIA 3OJSA 3AUOA 9ICEA 1PVRA 3IG8A 2ODGA 4CDGA 1JIHA 4CNQA 1K5OA 3ICXA 3A0HU 4B9NA 1BGXT 4GC7A 3F53A 2ZIUB 5F9NA 3M8SA 4C8NA 1ZQHA 1TK0A 5ALSA 4UARA 3GIJA 1S77D 2Y9TA 2KTQA 2H3ZA 4C4RA 4UQGA 3IN5A 4MFFA 1SXEA 3H4BA 3NVZA 1XNSA 4F93B 4US9A 1ZQQA 5CHGA 4DQPA 5DG9A 4BXOB 1LKYB 2ZJ5A 5KNIA 4I2AA 2JEFA 4IQWA 5KFJA 4UAZA 1RM6C 1RZTA 3H0LB 3C1YA 3UQ2A 1ED1A 5KL8B 4J9NA 2I5HA 4DL4A 2BQUA 2NO4A 3PO4A 2F1JA 5KFUA 4R8UB 1FEZA 4I2BA 4ECXA 1L7NA 3ETRA 2ZIVB 4IC9A 5G5HA 2I1QA 2BCQA 4WJ3B 4M9HA 4OD0A 4P0QB 1WYGA 4C7ZA 1L8OA 1L7PA 4HYKA 4FS1A 3ORYA 2K4IA 4IRDA 3G6YA 1S0OA 2KMDA 1SZHA 2ISOA 5J0TA 1ZQZA 3LYSA 4DFPA 2FMPA 2KZ3A 5KG3A 5FP0A 5J2HA 5IILA 1PVQA 1CRXA 1NJWA 3M9MB 2CXYA 4F91B 1CUKA 5DQHA 1LV5A 3M7DA 3TFSA 4JWNA 2ZTDA 2IBKA 1JUDA 2ZTEA 1S97A 3Q8QB 2W3RA 4P4PA 4Y2JA 5DQGA 3Q8MA 5EE9A 8ICZA 3O0FA 3C2KA 2PMZF 4PH5A 5KFWA 2BQ3A 2J6TA 2ASDA 1N63A 2K8AA 3WK7A 2RQ5A 1ZQPA 4J9SA 3UMGA 2IOFA 4ECWA 2W7OA 4KX5A 1BNPA 2XVTA 3EW9A 1BNOA 4J9PA 2F2AB 3THVA 3JPSA 4UAUA 1S10A 1RQLA 3IRUA 1KN5A 3WK9A 1SWVA 4UBBA 1SV0A 1T4GA 3D2NA 2VJ4A 2MRLA 4DSJA 4QWCA 4U7CA 3V6KA 3D2SA 1NNLA 1NZPA 5J8YC 5C5JA 4RT2A 1KSPA 3TAQA 4K4GA 3KD3A 3N7SC 5J2FA 3QZ7A 3RB6A 1X9MA 4NLCA 1HIWA 2AGOA 5AI5A 4J9KA 3PSFA 9ICOA 1URJA 5ALNA 2K89A 4YR3A 3BQ1A 1KKXA 5E79U 5G5GA 2FDRA 2ZTCA 2FI1A 4BDPA 2BZFA 1TFRA 9ICPA 4ECQA 2G08A 2KV2A 4QWAA 3EPGA 4F50A 3L3FX 4KLQA 3TARA 1ZD3A 3BZCA 1C20A 1BPBA 3GQCA 4GXKA 3QE9Y 4BGDA 1JRPA 2FPLA 4KLSA 5KL1B 3NTUA 3GIKA 3RR8A 5L1IA 5AKJA 1ZQWA 5KG0A 1PK1A 1DRGA 2AH5A 3FYHA 1S0MA 3PVXA 4E0DA 8ICQA 1ZOLA 1ZQGA 3TKAA 7ICTA 5J2CA 2F1IA 2W11A 1KRPA 1SIJA 5IINA 2ZUDA 2JV3A 3CRXA 3CW2C 3UXPA 3MR2A 4FE3A 1ZQVA 2VA2A 3HP6A 1B22A 4I2HA 4O5CA 8ICEA 4ECZA 5ALYA 9ICRA 2AGQA 4YD2A 4DSIA 2BKEA 5EE3A 4YCXA 5J0RA 3Q8RB 2JMGA 3BZKA 2DPJA 3SMVA 4DQSA 2A1JA 5J0UA 1KFSA 1IM4A 4ED0A 2VJ5A 5TZVA 4XA5A 1A6SA 5TISU 3WU2U 1K1SA 3SD7A 4PZOA 7ICMA 4GLXA 4DWIA 1S0NA 4O5KA 4MEXA 3PR4A 2E1FA 4O5EA 1O03A 2N1RA 4I2JA 4ICAA 2C2RA 2WF8A 4J9LA 4IRCA 4QWDA 4EYIB 1QQ6A 3ZD8A 4RQMA 2PFQA 2JH7A 3MFHA 3HPOA 2FMQA 5ALHA 3VC8A 3GILA 2E3TA 4QWBA 1N61A 2HDOA 2H3IA 3QU7A 4DLGA 2YN4A 5H2FU 1VLBA 4ED1A 4F3OA 2BDPA 3RFAA 5AM5A 4QWEA 4EEYA 2IA6A 3AEVA 1ZD5A 2H5XA 2KEYA 1X42A 7ICVA 1N48A 3ISCA 3RRGA 3PO5A 1PZNA 1V9PA 2BHNA 3C2MA 3MC1A 4CRXA 4AYBC 2ES6A 2NYVA 1PVPA 4PL1A 2EZYA 1ZXIA 2UVRA 2H3FA 4LZDA 4QZGA 3HJEA 4JUZA 5IIKA 1N62A 2Y0SC 1ZQLA 2JHDA 5AKKA 5D4BA 5DB8A 5AHXA 3PX4A 4O3QA 5KT2A 2ZXIA 5KFYA 2WAQC 3PW5A 5K4LA 2KJ5A 2NRZA 5AI0A 3SAHA 3B9JA 4Z6CA 3RR7A 2XICA 9ICSA 2QKQA 4B6JA 3NGDA 3T5LA 3H8JA 3CNHA 4R64A 1OW5A 2P6RA 4KLJA 3ZDEA 8ICJA 1YT3A 1CI4A 3FC4A 1ZQNA 4QZHA 3FAHA 5CR0A 1UPHA 3EZ5A 3MR6A 3PSIA 1HEKA 3N7RC 1XSLA 2LKYA 4OJLA 5AM0A 5CP2A 4ECYA 1SL0A 5AKHA 4KLMA 2D3DA 2KD1A 2Q4TA 3GV8B 1O08A 2YTUA 1ZQCA 4F4KA 4M9JA 1RG6A 4ELUA 4US8A 5KFNA 3SV3A 2RHFA 4P4OA 3QEBZ 3G6XA 3H8WA 1UT8A 3L4PA 3PX0A 3GIIA 9ICJA 3FDSA 2MUTB 3K75D 2F44A 2M0NA 7ICRA 1TAQA 3MBYA 1WUDA 9ICAA 4DFMA 2AHOB 1WWVA 1X40A 1L3VA 5J2JA 4QZFA 1COKA 3TADC 1J2NA 3WKEA 5DDMA 4UB1A 5AKZA 1KFDA 2LMRA 8ICBA 2W3SA 1NOMA 2L5YA 3LK9A 2IMWP 1V85A 4KLDA 4PJ0U 8ICUA 2FLPA 2ZIWB 3T3FA 2K8BB 2KVSA 4I2FA 3MR3A 1XS9D 4B9SA 3SEIA 4DOBA 2P35A 4GFJA 4M6WB 1S8OA 4Q8FA 5ALKA 1TAMA 1KTQA 2JEIA 4KLOA 2KSOA 2VIXA 1KLNA 3U26A 5KT3A 2XY5A 2B0CA 1ZRNA 4CF5A 3RB4A 1S5LU 2YMLA 2H3QA 5JTIA 4ZOHC 4P0PB 3NVVA 4KMUA 4NJ8A 4PL2A 4KLTA 9ICIA 5AIAA 5KG6A 2XCAA 5AKYA 5J0SA 4C0ZA 4RUAA 1NJXA 4B9LA 2W54A 5DBCA 3QU5A 1ZQEA 3WK4A 4CGZA 4DSKA 9ICNA 4Y2QA 1LB2B 2YMQA 3V6HA 3SENA 4O3NA 1N5WA 2EZZA 5EOZA 3ZDCA 3BQ7A 2F76X 5J0YA 1DK3A 4XUSA 1NZBA 3LVVA 3WK6A 4OJPA 3HWTA 4CE6A 5AKGA 2KHVA 2DFLA 2E1EA 4Y2UA 3C1ZA 2A1AA 2ZIUA 2JEJA 2KN7A 1A76A 5CB1A 2ATLA 4QZIA 4PGXA 4DL2A 2AGPA 2XO7A 4ED2A 1L8LA 4I27A 1ZQXA 1M6YA 4YXMA 1QQ5A 2MAXA 2OYYA 4ECVA 1FIQA 2K4PA 4K4IA 3PW2A 2OWOA 5HMLA 4EYHB 8ICXA 9ICHA 2FPKA 1SZPA 2LM1A 2DWQA 3PSPA 3I1YA 5B5EU 4XRHA 5AIBA 3T5HA 3QNMA 4PZNA 2ASJA 1ZQMA 2DPIA 3KHLA 4NY8A 2UVUA 2KKPA 4KLIA 2EAOA 3BJYA 5KT5A 2QARA 9ICKA 2KICA 3AQFA 2R8IA 2G07A 7ICUA 3MR5A 4R8UA 4BUGA 5DLFA 1ZQUA 2AU0A 3RJGA 2W9BB 1Z3EB 2ZIVA 3ZI4A 1A0PA 4ELTA 2NO5A 1RPLA 4QJFB 1PK3A 2NRWA 2ZXHA 4P0QA 1FO4A 4YR0A 7ICPA 1ZQAA 4I2IA 4DSFA 3BDPA 1U48A 2KHQA 1HJPA 3C5GA 3BS5A 3RB3A 5AK5A 2C2EA 1DGSA 4I28A 5AKLA 1ZQTA 4RPZA 2E8MA 5DBAA 5ALUA 2DKZA 4QIWF 3I76A 2BDUA 3KKAA 3NVYA 2D6FC 4J9OA 2E8NA 3G6VA 4QW9A 2FLLA 2IOHA 1U45A 4YQWA 2DGZA 1SL1A 1T7PA 5ALIA 5ALLA 4QW8A 2KK0A 3M8RA 2HSZA 1IIPA 1Q46A 3V7KA 4O3MA 2XGPA 4YR2A 3MGVA 4MFCA 1QSYA 4F72A 1DOQA 1A77A 3RAXA 1RYUA 5JU5A 2XY7A 3KOOA 2C22A 5GTHU 9ICFA 3NVWA 1ZQDA 2YY6A 1OUQA 2ZJ8A 3HKZC 1Z1BA 5J0PA 2NRTA 1TV9A 4KLEA 4Y2YA 4NM1A 1CEZA 4F8RA 2W7PA 3QUTA 4DL3A 1ZD4A 2MU2A 1S9FA 2NRVA 5KFLA 2EDUA 4M47A 1ECWA 3RH5A 4I2EA 2HOQA 4NL9A 8ICKA 4MHVA 5ALDA 4ED7A 4U6PA 4RPYA 4MEYA 4PHAA 4LVSA 1BPEA 2HBLA 2WB1F 5C0YA 3H0MB 2M9NA 4O3OA 1WWUA 5KFKA 3H8MA 2GOLA 1J2MA 4EZ6A 4Y2RA 4EX7A 3WK8A 4O3RA 4JB3A 3M9OB 4Y2VA 5KFPA 2W43A 4I2GA 5AICA 3UMBA 2EH9A 2KE7A 5AI8A 5ALPA 4O0IA 3R9KA 4DOCA 3MDCA 1MC8A 3QXGA 2EZXA 4BWMA 2Q0ZX 1UA1A 2ZJAA 3EWAA 9ICLA 1TE2A 1UQVA 3IG5A 3T79A 4YMOA 5ALMA 4OCZA 3JPPA 1MSWD 3L5KA 1MN8A 1X9XA 4F4YA 2O6KA 2LYBA 4CCHA 2KZZA 1WCLA 1UHUA 5AK6A 9ICCA 3RH4A 1NK6A 3QUCA 1IXRA 3PMNA 2KFNA 5DB6A 2I6XA 4IQVA 5IIOA 1T3NA 5KFHA 2IHNA 3JPOA 4RT3A 5AM4A 4FS2A 5KT7A 4M9GA 4F4XA 4DSEA 3PSTA 4Q43A 4DL6A 4F4WA 1RYRA 4RPXA 3NUQA 5J2KA 2R18A 1X66A 1Z1VA 5ALZA 3OTQA 3MFIA 9ICGA 4C8KA 4C8MA 3NASA 1EXNA 4RNMA 4RNOA 1B0XA 3DDHA 4CF4A 1JROA 4TQRA 1SWWA 4F4ZA 4NWIA 2BCVA 3QU2A 5J29A 4I2DA 1PK1B 1P7DA 4RQ4A 3PNCA 2E8PA 4C4TA 3RJJA 1Z4OA 2MSNA 3GFKB 3H40A 1JALA 1U9LA 3WKCA 4KN7A 3M1YA 4PHDA 5EE0A 1QSLA 1BPZA 3RH6A 1X9WA 2FMSA 4IQUA 1KDHA 3QU9A 3PV8A 2P6UA 3B0XA 3EUB2 8ICSA 1N5XA 4LZGA 1XSPA 2A1JB 2W03A 4YMNA 1S76D 1Y88A 5D49A 4YVZA 4RQ3A 2ASLA 4IL6U 1XO0A 1GO3F 3E2EA 2OH2A 5BOLA 1Z00B 3N97B 1ZYQA 1KBUA 2PI4A 5AI6A 2PMZC 4KLGA 2HVIA 2IOFK 2I9GA 9ICWA 2LM4A 2HMXA 4DL7A 2YX8A 3OGUA 5L9XA 1F0MA 1T94A 3MGHA 4HAIA 1JXEA 4R65A 4BX9C 1Q3VA 5J0OA 1BPDA 3ZDBA 4FZNA 4M04A 2BQRA 1AROP 3N4MB 1KL9A 3PY8A 5CWRA 4ELVA 2QB0A 1YZ7A 2AQ0A 5J8YA 4F71A 2BR0A 2HBMA 4YP3A 3KFUF 4UB5A 2F8LA 3AM9A 5J0XA 4YXJA 2AJQA 3H8SA 4Q45A 4RQ8A 3UXNA 3PW7A 4PGQA 1TAUA 9ICVA 1XWLA 5KTQA 3UMCA 5IIMA 3Q8SB 1L3SA 3KHRA 1UCVA 1FFVA 3JPTA 5L1MA 3Q8PB 3ONNA 3M6ZA 5KT6A 1MA7A 3VCBA 3RRHA 1ZRMA 5EE1A 4DCCA 4Y2TA 7ICIA 5ALTA 2W9CB 5J0QA 1JI7A 1RDFA 2YMMA 3RBEA 2E5SA 4I2CA 1KW4A 2V9WA 8ICWA 2MUTA 5KFMA 1NKEA 8ICOA 1NK4A 4QZDA 1B4FA 5HMMA 5CRXA 2VKQA 2EAPA 4GXIA 4M9NA 2XIDA 1K1QA 1D8YA 5AI9A 2HHQA 1OXJA 2YMPA 2BPGA 4OJOA 2C28A 2LBOA 3HW8A 4IR9A 5KFTA 2KIVA 4EZ9A 1RXWA 3KZIU 3TQ1A 2WF5A 2ZIWA 2PFNA 4QZEA 1MQ3A 3SQIA 2WF7A 2CN1A 3C29A 4M6WA 1COOA 3C5FA 4KLFA 2UVVA 4C8LA 1SKWA 3RJFA 5ALEA 2G06A 1T8EA 1BPYA 2JZBA 3C28A 2KG5A 1V97A 8ICFA 4B9TA 3GIMA 5EWFA 1D8BA 2A3VA 2XI9A 5KFAA 9ICUA 2B6GA 3BQ0A 2K4HA 2KOBA 8ICAA 4QZAA 2KFZA 4Z6EA 2PXIA 3ISBA 1NKBA 3ED5A 4Y2SA 1XSNA 3OHAA 3OHBA 4FBTA 1AQ6A 4Z6FA 3PW0A 3RB0A 3WKDA 5KFRA 4DF8A 5F3XB 2OM6A 3SYZA 2LI6A 5AKXA 4DOAA 4TUSA 4NLGA 4BJQA 5AI4A 2EQYA 5ALQA 5KFDA 4J9QA 3NS1A 5KFSA 3QYPA 3RJIA 2PI5A 5KFXA 2QB1A 1WCNA 2ZUCA 3IM1A 1JX4A 1KQQA 4JMUA 2G5IB 2KSOB 5J2EA 1F5SA 3E0FA 4O3SA 1SXDA 2R8GA 4TUPA 3CP8A 2KVCA 4O9MA 1UT5A 3QU4A 3HX0A 5KG1A 1NJYA 1ZJMA 2F3NA 4Z6DA 4GC6A 3GV5B 1ZQSA 5D46A 1C7YA 3F5AA 4XQ8A 2D8CA 5KG5A 1ZQRA 3QX7A 3V6JA 2FJ6A 5KG2A 1WG8A 3DV9A 4ED3A 2PFOA 2BCRA 4QNLA 4F2RA 2FLNA 5KFOA 2HOFA 2G0AA 4FZMA 8ICYA 4B9MA 7ICOA 2ZUBA 2IHMA 2CPRA 4KTQA 2EAMA 5DGAA 2JRZA 1SV0C 2ZIXB 1U49A 4PHPA 3B0YA 2JGAA 3V72A 7ICKA 2OXOA 2DQNB 2FE9A 1L6NA 2FPMA 4AP9A 4BXOA 1LKYA 4GXJA 3OSPA 2HHSA 4IRKA 3S6JA 2GH1A 1TKDA 2W9BA 7ICNA 4MF8A 4FFDA 5B66U 4UAWA 2BPCA 1Q3UA 2BGWA 7ICJA 5DQIA 3UQ0A 4IR1A 3SZ2A 1L3TA 1JMSA 3Q8LA 3ZDDA 2P66A 7ICSA 5KFFA 2Y9UA 4P4MA 5ALJA 2F8KA 2K60A 5ALRA 4IQTA 5J0WA 7ICQA 2XGQA 5ALFA 1H38A 4EBEA 2YQEA 5DKWA 3QUBA 2PKEA 2RDIA 1XU4A 4PPXA 1U47A 4UB6U 3BS7A 1Z4NA 2GWSA 5JUMA 4F5OA 2DBYA 3GU3A 2NRXA 1RYSA 2XY6A 3TADA 5L1JA 1RXVA 2BCSA 9ICXA 4EBDA 4FO6A 5KFGA 3H4DA 2QARB 2DL0A 4EEKA 4NM2A 4KN4A 4NV0A 2RDJA 4DL5A 3GV7B 4F92B 4F5PA 3TAPA 5DBBA 4F5RA 5EWEA 5AM2A 3AQEA 2W8KA 1TVAA 5BOMA 2W9AA 5KFCA 2V4RA 2WFAA 2HHTA 3M6KA 4GIBA 3D2QA 4RUCA 5IIJA 2PFPA 2RLTA 3UPQA 4KITB 2LYHA 3FM9A 4JV0A 4R63A 3RJHA 4UB4A 5DGBA 3TACB 5DDYA 3LVWA 1X9SA 2GO7A 5T14A 4TQSA 4EENA 4YD1A 3BS5B 4J9MA 4B9VA 1PUZA 4EX6A 1MQ2A 5GTIU 2OEHA 2CRXA 3F2BA 3RJKA 1SL2A 3MDAA 1HUOA
chains in the Genus database with same CATH topology
1B0XA 2LPEA 1PK3A 1WWUA 3H8MA 4RQMA 1UCVA 2EANA 2DKXA 5L1MA 1PK1B 2D3DA 2E8PA 3SENA 2KMDA 2YTUA 3BS5A 5F3XB 1RG6A 3BQ7A 2Y9UA 1JI7A 3HILA 2F8KA 2K60A 2E8MA 2KE7A 2DKZA 3IDWA 1KW4A 2F44A 2QB1A 3KKAC 3KKAA 2GLEA 3BS7A 2E8NA 1UQVA 1PK1A 4IS7A 1WWVA 1X40A 1COKA 1B4FA 2KSOB 3TADA 3TADC 1X9XA 2ES6A 2Y9TA 1V38A 1SXDA 5JRTA 2EAPA 2QARB 2DL0A 1SXEA 2K4PA 3K1RB 2QB0B 2LMRA 2F3NA 2JV3A 2L5YA 4RQNA 1OXJA 1V85A 5JU5A 2D8CA 1LKYB 5KNIA 2KIVA 4PZNA 3SEIA 1F0MA 2E8OA 1DXSA 2KSOA 2EAMA 1SV4A 1SV0A 1SV0C 2EAOA 3TACB 2QARA 2KG5A 2QKQA 1X66A 1Z1VA 2QB0A 5J8YA 5J8YC 3BS5B 5JTIA 4PZOA 2FE9A 1OW5A 2ESEA 4NL9A 4NJ8A 4NL9C 4MHVA 1LKYA 1SGGA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0X A;  2LPE A;  1PK3 A;  1WWU A;  3H8M A;  4RQM A;  1UCV A;  2EAN A;  2DKX A;  5L1M A;  1PK1 B;  2D3D A;  2E8P A;  3SEN A;  2KMD A;  2YTU A;  3BS5 A;  5F3X B;  1RG6 A;  3BQ7 A;  2Y9U A;  1JI7 A;  3HIL A;  2F8K A;  2K60 A;  2E8M A;  2KE7 A;  2DKZ A;  3IDW A;  1KW4 A;  2F44 A;  2QB1 A;  3KKA C;  3KKA A;  2GLE A;  3BS7 A;  2E8N A;  1UQV A;  1PK1 A;  4IS7 A;  1WWV A;  1X40 A;  1COK A;  1B4F A;  2KSO B;  3TAD A;  3TAD C;  1X9X A;  2ES6 A;  2Y9T A;  1V38 A;  1SXD A;  5JRT A;  2EAP A;  2QAR B;  2DL0 A;  1SXE A;  2K4P A;  3K1R B;  2QB0 B;  2LMR A;  2F3N A;  2JV3 A;  2L5Y A;  4RQN A;  1OXJ A;  1V85 A;  5JU5 A;  2D8C A;  1LKY B;  5KNI A;  2KIV A;  4PZN A;  3SEI A;  1F0M A;  2E8O A;  1DXS A;  2KSO A;  2EAM A;  1SV4 A;  1SV0 A;  1SV0 C;  2EAO A;  3TAC B;  2QAR A;  2KG5 A;  2QKQ A;  1X66 A;  1Z1V A;  2QB0 A;  5J8Y A;  5J8Y C;  3BS5 B;  5JTI A;  4PZO A;  2FE9 A;  1OW5 A;  2ESE A;  4NL9 A;  4NJ8 A;  4NL9 C;  4MHV A;  1LKY A;  1SGG A;  2B6G A; 
#chains in the Genus database with same CATH topology
 2F1H A;  3AL0 B;  5KFB A;  3C21 A;  1XO1 A;  5DB9 A;  3I28 A;  3TFR A;  2HHW A;  1F44 A;  2KNJ A;  4M9L A;  1NI3 A;  2EAN A;  3Q8K A;  2ISP A;  1IV8 A;  4CF3 A;  4RQ2 A;  2XCP A;  8ICR A;  9ICT A;  2F77 X;  2YB1 A;  2G5H B;  4RQ5 A;  4MFA A;  4RZR A;  2K8C B;  4DLE A;  3C23 A;  3HIL A;  2OHF A;  3EYZ A;  1S0V A;  3KTQ A;  4NLZ A;  2R8K A;  2VA8 A;  4JV1 A;  4AYB F;  4DO9 A;  4ACO A;  4R66 A;  8ICT A;  2AXT U;  3WK5 A;  5III A;  1ZQY A;  3GDX A;  4BWJ A;  2Y0S F;  1V38 A;  4JWM A;  1JXL A;  3ISD A;  2NV3 A;  5J2I A;  2WF9 A;  5KAI U;  5L1K A;  3K1R B;  3C2L A;  4ECT A;  3QUQ A;  3MGI A;  1ZET A;  4O3P A;  4X5V A;  3TI0 A;  2WAQ F;  3AU6 A;  1U4B A;  1NKC A;  5ALW A;  4DEZ A;  1L7M A;  2HI0 A;  5AKE A;  4ZH4 A;  3KBB A;  2J6U A;  4DFD A;  2HBK A;  2JH1 A;  8ICI A;  4DQR A;  2H3V A;  3LDA A;  4MF2 A;  3NRZ A;  1SV4 A;  2KJ9 A;  2QLT A;  4RQ0 A;  1L3U A;  5ALV A;  7ICE A;  9ICB A;  2XC9 A;  1SKS A;  8ICC A;  2MA1 A;  1J97 A;  3JPR A;  4KX3 A;  1D9D A;  5HR6 A;  3RAQ A;  1ZJN A;  1N60 A;  5ALO A;  3HT3 A;  1JN3 A;  3H0R B;  1B43 A;  3SAG A;  2WF6 A;  4G9B A;  1ZD2 P;  3RBD A;  4UBC A;  4KLU A;  5J2B A;  4F5Q A;  4J9R A;  3TAN A;  2KP7 A;  4ED6 A;  4DS5 A;  5BPC A;  1N56 A;  8ICV A;  4LJX A;  5J2D A;  5J2A A;  4OJ5 A;  1ZQJ A;  3J81 j;  3PX6 A;  1NK7 A;  2HOI A;  3RF9 A;  4TUR A;  1QLN A;  2GLE A;  4KLL A;  3F2C A;  1D9F A;  4RQ6 A;  3UXO A;  2KZM A;  4QIW C;  7ICL A;  3AMZ A;  4YG2 A;  1ZQI A;  3BQT A;  5JRT A;  2W55 A;  1X6I A;  4DSL A;  5KG4 A;  4OO1 J;  5A0L A;  5DB7 A;  2HCF A;  4Q8E A;  5J2G A;  4M2Y A;  1Z00 A;  2BCU A;  3KHG A;  3LWM A;  3JPQ A;  4ECR A;  3PW4 A;  5AK4 A;  3SR6 A;  1SKR A;  4RU9 A;  3V7J A;  3GZF A;  5DG7 A;  1NJZ A;  2AQ4 A;  2UVW A;  2DF4 B;  5AM1 A;  5HHH A;  4TUQ A;  2W8L A;  9ICM A;  4KMO B;  1UA0 A;  2R8H A;  4J03 A;  3IP4 B;  4ED8 A;  2ESE A;  3N28 A;  3T5J A;  3PZP A;  1QQ7 A;  1DGJ A;  3F5E A;  4Y2P A;  4PHE A;  5KT4 A;  1QTM A;  4I29 A;  4ECS A;  2KIW A;  4UAS A;  5KFQ A;  1Q8K A;  3A0B U;  2KKV A;  5CJ7 A;  3RJE A;  1LVH A;  3K4G A;  3N7P D;  4G3I A;  2DKX A;  2WB1 C;  4UAT A;  5KFZ A;  1TK5 A;  4EEL A;  4QZB A;  4ECU A;  3QEA Z;  4DF4 A;  4DS4 A;  2C2D A;  3WKA A;  2B21 A;  3JPN A;  2W9C A;  3KHH A;  4NLN A;  5AKI A;  3T5K A;  3CYM A;  2W9M A;  2WTF A;  4YFK A;  3NRW A;  2VAN A;  2RRD A;  8ICG A;  1ZQ1 C;  3IDW A;  1L7O A;  4B9U A;  4F2S A;  2V4Q A;  4UAY A;  2HBJ A;  7ICG A;  5L1L A;  3WKB A;  3F2D A;  4QZ8 A;  5HHI A;  3ZDA A;  2A19 A;  2QB0 B;  2Z7J A;  1X2I A;  3AN1 A;  4UB8 U;  5CA7 A;  4RNN A;  4FZL A;  5F9L A;  2G09 A;  1NK5 A;  1N2X A;  3IV6 A;  3IHQ B;  2HVH A;  4Y2X A;  1RQN A;  5HP4 A;  2KJ8 A;  2E8O A;  4C7Y A;  4F5N A;  2LYA A;  5KFV A;  3OPX A;  1T3Q A;  1VDV A;  3PML A;  4NLB A;  1YZ6 A;  2JEG A;  4YMM A;  3D6J A;  4DQQ A;  2VA3 A;  4UW9 A;  2RP5 A;  4NXZ A;  2J6S A;  3V7L A;  1IG6 A;  4P2H A;  3AU2 A;  5KFE A;  2LHT A;  1NK8 A;  4PGY A;  5KFI A;  2ALZ A;  1L5U A;  1ZQB A;  8ICM A;  4C80 A;  8ICN A;  1ZQK A;  5KG7 A;  5ALG A;  5KAF U;  5DG8 A;  5HR7 A;  4RQ7 A;  4C4S A;  3OSN A;  2HHV A;  4USA A;  4QZC A;  1BVS A;  3M9N B;  4P0P A;  5AM3 A;  1QSS A;  8ICL A;  3QZ8 A;  4JK1 A;  4Q44 A;  2DUY A;  9ICQ A;  3KZX A;  3H7I A;  5AK3 A;  4EBC A;  4C8O A;  4K4H A;  3KKA C;  3UM9 A;  3RTV A;  2Y1J A;  2JR5 A;  1KFT A;  1NK0 A;  4IS7 A;  1ZQO A;  7ICF A;  4DFK A;  1TK8 A;  3SI8 A;  2WHE A;  2HHU A;  4KLH A;  1KEJ A;  5DLG A;  8ICP A;  3LWL A;  2JZB B;  3ZD9 A;  4QZ9 A;  3HRD D;  3K1Z A;  4RQN A;  2HHX A;  3HKZ F;  1BPX A;  2Y1I A;  2HW3 A;  1QH9 A;  3ALR A;  1D8L A;  2YB4 A;  2JXJ A;  1DXS A;  4FBU A;  7ICH A;  5CEH A;  4M0A A;  3OJU A;  4DFJ A;  1FFU A;  3DEE A;  4RQ1 A;  3EPI A;  3MAB A;  1QCK A;  2ZG6 A;  2ZIX A;  4UAV A;  4UB3 A;  4OJ6 A;  5HNK A;  3E58 A;  4UB2 A;  4NL9 C;  3SV4 A;  1XC9 A;  2W04 A;  1HUZ A;  1SGG A;  1SB3 C;  1Z19 A;  1VJ5 A;  8ICH A;  2LPE A;  1DK2 A;  1NK9 A;  3SAF A;  2BPF A;  4A8E A;  2R8J A;  2K4E A;  4JV2 A;  3PR5 B;  1ZQF A;  4YN4 A;  4NLK A;  5ALX A;  3ETL A;  5EWG A;  1X6J A;  2OCE A;  3BQ2 A;  4DQI A;  3OJS A;  3AUO A;  9ICE A;  1PVR A;  3IG8 A;  2ODG A;  4CDG A;  1JIH A;  4CNQ A;  1K5O A;  3ICX A;  3A0H U;  4B9N A;  1BGX T;  4GC7 A;  3F53 A;  2ZIU B;  5F9N A;  3M8S A;  4C8N A;  1ZQH A;  1TK0 A;  5ALS A;  4UAR A;  3GIJ A;  1S77 D;  2Y9T A;  2KTQ A;  2H3Z A;  4C4R A;  4UQG A;  3IN5 A;  4MFF A;  1SXE A;  3H4B A;  3NVZ A;  1XNS A;  4F93 B;  4US9 A;  1ZQQ A;  5CHG A;  4DQP A;  5DG9 A;  4BXO B;  1LKY B;  2ZJ5 A;  5KNI A;  4I2A A;  2JEF A;  4IQW A;  5KFJ A;  4UAZ A;  1RM6 C;  1RZT A;  3H0L B;  3C1Y A;  3UQ2 A;  1ED1 A;  5KL8 B;  4J9N A;  2I5H A;  4DL4 A;  2BQU A;  2NO4 A;  3PO4 A;  2F1J A;  5KFU A;  4R8U B;  1FEZ A;  4I2B A;  4ECX A;  1L7N A;  3ETR A;  2ZIV B;  4IC9 A;  5G5H A;  2I1Q A;  2BCQ A;  4WJ3 B;  4M9H A;  4OD0 A;  4P0Q B;  1WYG A;  4C7Z A;  1L8O A;  1L7P A;  4HYK A;  4FS1 A;  3ORY A;  2K4I A;  4IRD A;  3G6Y A;  1S0O A;  2KMD A;  1SZH A;  2ISO A;  5J0T A;  1ZQZ A;  3LYS A;  4DFP A;  2FMP A;  2KZ3 A;  5KG3 A;  5FP0 A;  5J2H A;  5IIL A;  1PVQ A;  1CRX A;  1NJW A;  3M9M B;  2CXY A;  4F91 B;  1CUK A;  5DQH A;  1LV5 A;  3M7D A;  3TFS A;  4JWN A;  2ZTD A;  2IBK A;  1JUD A;  2ZTE A;  1S97 A;  3Q8Q B;  2W3R A;  4P4P A;  4Y2J A;  5DQG A;  3Q8M A;  5EE9 A;  8ICZ A;  3O0F A;  3C2K A;  2PMZ F;  4PH5 A;  5KFW A;  2BQ3 A;  2J6T A;  2ASD A;  1N63 A;  2K8A A;  3WK7 A;  2RQ5 A;  1ZQP A;  4J9S A;  3UMG A;  2IOF A;  4ECW A;  2W7O A;  4KX5 A;  1BNP A;  2XVT A;  3EW9 A;  1BNO A;  4J9P A;  2F2A B;  3THV A;  3JPS A;  4UAU A;  1S10 A;  1RQL A;  3IRU A;  1KN5 A;  3WK9 A;  1SWV A;  4UBB A;  1SV0 A;  1T4G A;  3D2N A;  2VJ4 A;  2MRL A;  4DSJ A;  4QWC A;  4U7C A;  3V6K A;  3D2S A;  1NNL A;  1NZP A;  5J8Y C;  5C5J A;  4RT2 A;  1KSP A;  3TAQ A;  4K4G A;  3KD3 A;  3N7S C;  5J2F A;  3QZ7 A;  3RB6 A;  1X9M A;  4NLC A;  1HIW A;  2AGO A;  5AI5 A;  4J9K A;  3PSF A;  9ICO A;  1URJ A;  5ALN A;  2K89 A;  4YR3 A;  3BQ1 A;  1KKX A;  5E79 U;  5G5G A;  2FDR A;  2ZTC A;  2FI1 A;  4BDP A;  2BZF A;  1TFR A;  9ICP A;  4ECQ A;  2G08 A;  2KV2 A;  4QWA A;  3EPG A;  4F50 A;  3L3F X;  4KLQ A;  3TAR A;  1ZD3 A;  3BZC A;  1C20 A;  1BPB A;  3GQC A;  4GXK A;  3QE9 Y;  4BGD A;  1JRP A;  2FPL A;  4KLS A;  5KL1 B;  3NTU A;  3GIK A;  3RR8 A;  5L1I A;  5AKJ A;  1ZQW A;  5KG0 A;  1PK1 A;  1DRG A;  2AH5 A;  3FYH A;  1S0M A;  3PVX A;  4E0D A;  8ICQ A;  1ZOL A;  1ZQG A;  3TKA A;  7ICT A;  5J2C A;  2F1I A;  2W11 A;  1KRP A;  1SIJ A;  5IIN A;  2ZUD A;  2JV3 A;  3CRX A;  3CW2 C;  3UXP A;  3MR2 A;  4FE3 A;  1ZQV A;  2VA2 A;  3HP6 A;  1B22 A;  4I2H A;  4O5C A;  8ICE A;  4ECZ A;  5ALY A;  9ICR A;  2AGQ A;  4YD2 A;  4DSI A;  2BKE A;  5EE3 A;  4YCX A;  5J0R A;  3Q8R B;  2JMG A;  3BZK A;  2DPJ A;  3SMV A;  4DQS A;  2A1J A;  5J0U A;  1KFS A;  1IM4 A;  4ED0 A;  2VJ5 A;  5TZV A;  4XA5 A;  1A6S A;  5TIS U;  3WU2 U;  1K1S A;  3SD7 A;  4PZO A;  7ICM A;  4GLX A;  4DWI A;  1S0N A;  4O5K A;  4MEX A;  3PR4 A;  2E1F A;  4O5E A;  1O03 A;  2N1R A;  4I2J A;  4ICA A;  2C2R A;  2WF8 A;  4J9L A;  4IRC A;  4QWD A;  4EYI B;  1QQ6 A;  3ZD8 A;  4RQM A;  2PFQ A;  2JH7 A;  3MFH A;  3HPO A;  2FMQ A;  5ALH A;  3VC8 A;  3GIL A;  2E3T A;  4QWB A;  1N61 A;  2HDO A;  2H3I A;  3QU7 A;  4DLG A;  2YN4 A;  5H2F U;  1VLB A;  4ED1 A;  4F3O A;  2BDP A;  3RFA A;  5AM5 A;  4QWE A;  4EEY A;  2IA6 A;  3AEV A;  1ZD5 A;  2H5X A;  2KEY A;  1X42 A;  7ICV A;  1N48 A;  3ISC A;  3RRG A;  3PO5 A;  1PZN A;  1V9P A;  2BHN A;  3C2M A;  3MC1 A;  4CRX A;  4AYB C;  2ES6 A;  2NYV A;  1PVP A;  4PL1 A;  2EZY A;  1ZXI A;  2UVR A;  2H3F A;  4LZD A;  4QZG A;  3HJE A;  4JUZ A;  5IIK A;  1N62 A;  2Y0S C;  1ZQL A;  2JHD A;  5AKK A;  5D4B A;  5DB8 A;  5AHX A;  3PX4 A;  4O3Q A;  5KT2 A;  2ZXI A;  5KFY A;  2WAQ C;  3PW5 A;  5K4L A;  2KJ5 A;  2NRZ A;  5AI0 A;  3SAH A;  3B9J A;  4Z6C A;  3RR7 A;  2XIC A;  9ICS A;  2QKQ A;  4B6J A;  3NGD A;  3T5L A;  3H8J A;  3CNH A;  4R64 A;  1OW5 A;  2P6R A;  4KLJ A;  3ZDE A;  8ICJ A;  1YT3 A;  1CI4 A;  3FC4 A;  1ZQN A;  4QZH A;  3FAH A;  5CR0 A;  1UPH A;  3EZ5 A;  3MR6 A;  3PSI A;  1HEK A;  3N7R C;  1XSL A;  2LKY A;  4OJL A;  5AM0 A;  5CP2 A;  4ECY A;  1SL0 A;  5AKH A;  4KLM A;  2D3D A;  2KD1 A;  2Q4T A;  3GV8 B;  1O08 A;  2YTU A;  1ZQC A;  4F4K A;  4M9J A;  1RG6 A;  4ELU A;  4US8 A;  5KFN A;  3SV3 A;  2RHF A;  4P4O A;  3QEB Z;  3G6X A;  3H8W A;  1UT8 A;  3L4P A;  3PX0 A;  3GII A;  9ICJ A;  3FDS A;  2MUT B;  3K75 D;  2F44 A;  2M0N A;  7ICR A;  1TAQ A;  3MBY A;  1WUD A;  9ICA A;  4DFM A;  2AHO B;  1WWV A;  1X40 A;  1L3V A;  5J2J A;  4QZF A;  1COK A;  3TAD C;  1J2N A;  3WKE A;  5DDM A;  4UB1 A;  5AKZ A;  1KFD A;  2LMR A;  8ICB A;  2W3S A;  1NOM A;  2L5Y A;  3LK9 A;  2IMW P;  1V85 A;  4KLD A;  4PJ0 U;  8ICU A;  2FLP A;  2ZIW B;  3T3F A;  2K8B B;  2KVS A;  4I2F A;  3MR3 A;  1XS9 D;  4B9S A;  3SEI A;  4DOB A;  2P35 A;  4GFJ A;  4M6W B;  1S8O A;  4Q8F A;  5ALK A;  1TAM A;  1KTQ A;  2JEI A;  4KLO A;  2KSO A;  2VIX A;  1KLN A;  3U26 A;  5KT3 A;  2XY5 A;  2B0C A;  1ZRN A;  4CF5 A;  3RB4 A;  1S5L U;  2YML A;  2H3Q A;  5JTI A;  4ZOH C;  4P0P B;  3NVV A;  4KMU A;  4NJ8 A;  4PL2 A;  4KLT A;  9ICI A;  5AIA A;  5KG6 A;  2XCA A;  5AKY A;  5J0S A;  4C0Z A;  4RUA A;  1NJX A;  4B9L A;  2W54 A;  5DBC A;  3QU5 A;  1ZQE A;  3WK4 A;  4CGZ A;  4DSK A;  9ICN A;  4Y2Q A;  1LB2 B;  2YMQ A;  3V6H A;  3SEN A;  4O3N A;  1N5W A;  2EZZ A;  5EOZ A;  3ZDC A;  3BQ7 A;  2F76 X;  5J0Y A;  1DK3 A;  4XUS A;  1NZB A;  3LVV A;  3WK6 A;  4OJP A;  3HWT A;  4CE6 A;  5AKG A;  2KHV A;  2DFL A;  2E1E A;  4Y2U A;  3C1Z A;  2A1A A;  2ZIU A;  2JEJ A;  2KN7 A;  1A76 A;  5CB1 A;  2ATL A;  4QZI A;  4PGX A;  4DL2 A;  2AGP A;  2XO7 A;  4ED2 A;  1L8L A;  4I27 A;  1ZQX A;  1M6Y A;  4YXM A;  1QQ5 A;  2MAX A;  2OYY A;  4ECV A;  1FIQ A;  2K4P A;  4K4I A;  3PW2 A;  2OWO A;  5HML A;  4EYH B;  8ICX A;  9ICH A;  2FPK A;  1SZP A;  2LM1 A;  2DWQ A;  3PSP A;  3I1Y A;  5B5E U;  4XRH A;  5AIB A;  3T5H A;  3QNM A;  4PZN A;  2ASJ A;  1ZQM A;  2DPI A;  3KHL A;  4NY8 A;  2UVU A;  2KKP A;  4KLI A;  2EAO A;  3BJY A;  5KT5 A;  2QAR A;  9ICK A;  2KIC A;  3AQF A;  2R8I A;  2G07 A;  7ICU A;  3MR5 A;  4R8U A;  4BUG A;  5DLF A;  1ZQU A;  2AU0 A;  3RJG A;  2W9B B;  1Z3E B;  2ZIV A;  3ZI4 A;  1A0P A;  4ELT A;  2NO5 A;  1RPL A;  4QJF B;  1PK3 A;  2NRW A;  2ZXH A;  4P0Q A;  1FO4 A;  4YR0 A;  7ICP A;  1ZQA A;  4I2I A;  4DSF A;  3BDP A;  1U48 A;  2KHQ A;  1HJP A;  3C5G A;  3BS5 A;  3RB3 A;  5AK5 A;  2C2E A;  1DGS A;  4I28 A;  5AKL A;  1ZQT A;  4RPZ A;  2E8M A;  5DBA A;  5ALU A;  2DKZ A;  4QIW F;  3I76 A;  2BDU A;  3KKA A;  3NVY A;  2D6F C;  4J9O A;  2E8N A;  3G6V A;  4QW9 A;  2FLL A;  2IOH A;  1U45 A;  4YQW A;  2DGZ A;  1SL1 A;  1T7P A;  5ALI A;  5ALL A;  4QW8 A;  2KK0 A;  3M8R A;  2HSZ A;  1IIP A;  1Q46 A;  3V7K A;  4O3M A;  2XGP A;  4YR2 A;  3MGV A;  4MFC A;  1QSY A;  4F72 A;  1DOQ A;  1A77 A;  3RAX A;  1RYU A;  5JU5 A;  2XY7 A;  3KOO A;  2C22 A;  5GTH U;  9ICF A;  3NVW A;  1ZQD A;  2YY6 A;  1OUQ A;  2ZJ8 A;  3HKZ C;  1Z1B A;  5J0P A;  2NRT A;  1TV9 A;  4KLE A;  4Y2Y A;  4NM1 A;  1CEZ A;  4F8R A;  2W7P A;  3QUT A;  4DL3 A;  1ZD4 A;  2MU2 A;  1S9F A;  2NRV A;  5KFL A;  2EDU A;  4M47 A;  1ECW A;  3RH5 A;  4I2E A;  2HOQ A;  4NL9 A;  8ICK A;  4MHV A;  5ALD A;  4ED7 A;  4U6P A;  4RPY A;  4MEY A;  4PHA A;  4LVS A;  1BPE A;  2HBL A;  2WB1 F;  5C0Y A;  3H0M B;  2M9N A;  4O3O A;  1WWU A;  5KFK A;  3H8M A;  2GOL A;  1J2M A;  4EZ6 A;  4Y2R A;  4EX7 A;  3WK8 A;  4O3R A;  4JB3 A;  3M9O B;  4Y2V A;  5KFP A;  2W43 A;  4I2G A;  5AIC A;  3UMB A;  2EH9 A;  2KE7 A;  5AI8 A;  5ALP A;  4O0I A;  3R9K A;  4DOC A;  3MDC A;  1MC8 A;  3QXG A;  2EZX A;  4BWM A;  2Q0Z X;  1UA1 A;  2ZJA A;  3EWA A;  9ICL A;  1TE2 A;  1UQV A;  3IG5 A;  3T79 A;  4YMO A;  5ALM A;  4OCZ A;  3JPP A;  1MSW D;  3L5K A;  1MN8 A;  1X9X A;  4F4Y A;  2O6K A;  2LYB A;  4CCH A;  2KZZ A;  1WCL A;  1UHU A;  5AK6 A;  9ICC A;  3RH4 A;  1NK6 A;  3QUC A;  1IXR A;  3PMN A;  2KFN A;  5DB6 A;  2I6X A;  4IQV A;  5IIO A;  1T3N A;  5KFH A;  2IHN A;  3JPO A;  4RT3 A;  5AM4 A;  4FS2 A;  5KT7 A;  4M9G A;  4F4X A;  4DSE A;  3PST A;  4Q43 A;  4DL6 A;  4F4W A;  1RYR A;  4RPX A;  3NUQ A;  5J2K A;  2R18 A;  1X66 A;  1Z1V A;  5ALZ A;  3OTQ A;  3MFI A;  9ICG A;  4C8K A;  4C8M A;  3NAS A;  1EXN A;  4RNM A;  4RNO A;  1B0X A;  3DDH A;  4CF4 A;  1JRO A;  4TQR A;  1SWW A;  4F4Z A;  4NWI A;  2BCV A;  3QU2 A;  5J29 A;  4I2D A;  1PK1 B;  1P7D A;  4RQ4 A;  3PNC A;  2E8P A;  4C4T A;  3RJJ A;  1Z4O A;  2MSN A;  3GFK B;  3H40 A;  1JAL A;  1U9L A;  3WKC A;  4KN7 A;  3M1Y A;  4PHD A;  5EE0 A;  1QSL A;  1BPZ A;  3RH6 A;  1X9W A;  2FMS A;  4IQU A;  1KDH A;  3QU9 A;  3PV8 A;  2P6U A;  3B0X A;  3EUB 2;  8ICS A;  1N5X A;  4LZG A;  1XSP A;  2A1J B;  2W03 A;  4YMN A;  1S76 D;  1Y88 A;  5D49 A;  4YVZ A;  4RQ3 A;  2ASL A;  4IL6 U;  1XO0 A;  1GO3 F;  3E2E A;  2OH2 A;  5BOL A;  1Z00 B;  3N97 B;  1ZYQ A;  1KBU A;  2PI4 A;  5AI6 A;  2PMZ C;  4KLG A;  2HVI A;  2IOF K;  2I9G A;  9ICW A;  2LM4 A;  2HMX A;  4DL7 A;  2YX8 A;  3OGU A;  5L9X A;  1F0M A;  1T94 A;  3MGH A;  4HAI A;  1JXE A;  4R65 A;  4BX9 C;  1Q3V A;  5J0O A;  1BPD A;  3ZDB A;  4FZN A;  4M04 A;  2BQR A;  1ARO P;  3N4M B;  1KL9 A;  3PY8 A;  5CWR A;  4ELV A;  2QB0 A;  1YZ7 A;  2AQ0 A;  5J8Y A;  4F71 A;  2BR0 A;  2HBM A;  4YP3 A;  3KFU F;  4UB5 A;  2F8L A;  3AM9 A;  5J0X A;  4YXJ A;  2AJQ A;  3H8S A;  4Q45 A;  4RQ8 A;  3UXN A;  3PW7 A;  4PGQ A;  1TAU A;  9ICV A;  1XWL A;  5KTQ A;  3UMC A;  5IIM A;  3Q8S B;  1L3S A;  3KHR A;  1UCV A;  1FFV A;  3JPT A;  5L1M A;  3Q8P B;  3ONN A;  3M6Z A;  5KT6 A;  1MA7 A;  3VCB A;  3RRH A;  1ZRM A;  5EE1 A;  4DCC A;  4Y2T A;  7ICI A;  5ALT A;  2W9C B;  5J0Q A;  1JI7 A;  1RDF A;  2YMM A;  3RBE A;  2E5S A;  4I2C A;  1KW4 A;  2V9W A;  8ICW A;  2MUT A;  5KFM A;  1NKE A;  8ICO A;  1NK4 A;  4QZD A;  1B4F A;  5HMM A;  5CRX A;  2VKQ A;  2EAP A;  4GXI A;  4M9N A;  2XID A;  1K1Q A;  1D8Y A;  5AI9 A;  2HHQ A;  1OXJ A;  2YMP A;  2BPG A;  4OJO A;  2C28 A;  2LBO A;  3HW8 A;  4IR9 A;  5KFT A;  2KIV A;  4EZ9 A;  1RXW A;  3KZI U;  3TQ1 A;  2WF5 A;  2ZIW A;  2PFN A;  4QZE A;  1MQ3 A;  3SQI A;  2WF7 A;  2CN1 A;  3C29 A;  4M6W A;  1COO A;  3C5F A;  4KLF A;  2UVV A;  4C8L A;  1SKW A;  3RJF A;  5ALE A;  2G06 A;  1T8E A;  1BPY A;  2JZB A;  3C28 A;  2KG5 A;  1V97 A;  8ICF A;  4B9T A;  3GIM A;  5EWF A;  1D8B A;  2A3V A;  2XI9 A;  5KFA A;  9ICU A;  2B6G A;  3BQ0 A;  2K4H A;  2KOB A;  8ICA A;  4QZA A;  2KFZ A;  4Z6E A;  2PXI A;  3ISB A;  1NKB A;  3ED5 A;  4Y2S A;  1XSN A;  3OHA A;  3OHB A;  4FBT A;  1AQ6 A;  4Z6F A;  3PW0 A;  3RB0 A;  3WKD A;  5KFR A;  4DF8 A;  5F3X B;  2OM6 A;  3SYZ A;  2LI6 A;  5AKX A;  4DOA A;  4TUS A;  4NLG A;  4BJQ A;  5AI4 A;  2EQY A;  5ALQ A;  5KFD A;  4J9Q A;  3NS1 A;  5KFS A;  3QYP A;  3RJI A;  2PI5 A;  5KFX A;  2QB1 A;  1WCN A;  2ZUC A;  3IM1 A;  1JX4 A;  1KQQ A;  4JMU A;  2G5I B;  2KSO B;  5J2E A;  1F5S A;  3E0F A;  4O3S A;  1SXD A;  2R8G A;  4TUP A;  3CP8 A;  2KVC A;  4O9M A;  1UT5 A;  3QU4 A;  3HX0 A;  5KG1 A;  1NJY A;  1ZJM A;  2F3N A;  4Z6D A;  4GC6 A;  3GV5 B;  1ZQS A;  5D46 A;  1C7Y A;  3F5A A;  4XQ8 A;  2D8C A;  5KG5 A;  1ZQR A;  3QX7 A;  3V6J A;  2FJ6 A;  5KG2 A;  1WG8 A;  3DV9 A;  4ED3 A;  2PFO A;  2BCR A;  4QNL A;  4F2R A;  2FLN A;  5KFO A;  2HOF A;  2G0A A;  4FZM A;  8ICY A;  4B9M A;  7ICO A;  2ZUB A;  2IHM A;  2CPR A;  4KTQ A;  2EAM A;  5DGA A;  2JRZ A;  1SV0 C;  2ZIX B;  1U49 A;  4PHP A;  3B0Y A;  2JGA A;  3V72 A;  7ICK A;  2OXO A;  2DQN B;  2FE9 A;  1L6N A;  2FPM A;  4AP9 A;  4BXO A;  1LKY A;  4GXJ A;  3OSP A;  2HHS A;  4IRK A;  3S6J A;  2GH1 A;  1TKD A;  2W9B A;  7ICN A;  4MF8 A;  4FFD A;  5B66 U;  4UAW A;  2BPC A;  1Q3U A;  2BGW A;  7ICJ A;  5DQI A;  3UQ0 A;  4IR1 A;  3SZ2 A;  1L3T A;  1JMS A;  3Q8L A;  3ZDD A;  2P66 A;  7ICS A;  5KFF A;  2Y9U A;  4P4M A;  5ALJ A;  2F8K A;  2K60 A;  5ALR A;  4IQT A;  5J0W A;  7ICQ A;  2XGQ A;  5ALF A;  1H38 A;  4EBE A;  2YQE A;  5DKW A;  3QUB A;  2PKE A;  2RDI A;  1XU4 A;  4PPX A;  1U47 A;  4UB6 U;  3BS7 A;  1Z4N A;  2GWS A;  5JUM A;  4F5O A;  2DBY A;  3GU3 A;  2NRX A;  1RYS A;  2XY6 A;  3TAD A;  5L1J A;  1RXV A;  2BCS A;  9ICX A;  4EBD A;  4FO6 A;  5KFG A;  3H4D A;  2QAR B;  2DL0 A;  4EEK A;  4NM2 A;  4KN4 A;  4NV0 A;  2RDJ A;  4DL5 A;  3GV7 B;  4F92 B;  4F5P A;  3TAP A;  5DBB A;  4F5R A;  5EWE A;  5AM2 A;  3AQE A;  2W8K A;  1TVA A;  5BOM A;  2W9A A;  5KFC A;  2V4R A;  2WFA A;  2HHT A;  3M6K A;  4GIB A;  3D2Q A;  4RUC A;  5IIJ A;  2PFP A;  2RLT A;  3UPQ A;  4KIT B;  2LYH A;  3FM9 A;  4JV0 A;  4R63 A;  3RJH A;  4UB4 A;  5DGB A;  3TAC B;  5DDY A;  3LVW A;  1X9S A;  2GO7 A;  5T14 A;  4TQS A;  4EEN A;  4YD1 A;  3BS5 B;  4J9M A;  4B9V A;  1PUZ A;  4EX6 A;  1MQ2 A;  5GTI U;  2OEH A;  2CRX A;  3F2B A;  3RJK A;  1SL2 A;  3MDA A;  1HUO A; 
#chains in the Genus database with same CATH homology
 1B0X A;  2LPE A;  1PK3 A;  1WWU A;  3H8M A;  4RQM A;  1UCV A;  2EAN A;  2DKX A;  5L1M A;  1PK1 B;  2D3D A;  2E8P A;  3SEN A;  2KMD A;  2YTU A;  3BS5 A;  5F3X B;  1RG6 A;  3BQ7 A;  2Y9U A;  1JI7 A;  3HIL A;  2F8K A;  2K60 A;  2E8M A;  2KE7 A;  2DKZ A;  3IDW A;  1KW4 A;  2F44 A;  2QB1 A;  3KKA C;  3KKA A;  2GLE A;  3BS7 A;  2E8N A;  1UQV A;  1PK1 A;  4IS7 A;  1WWV A;  1X40 A;  1COK A;  1B4F A;  2KSO B;  3TAD A;  3TAD C;  1X9X A;  2ES6 A;  2Y9T A;  1V38 A;  1SXD A;  5JRT A;  2EAP A;  2QAR B;  2DL0 A;  1SXE A;  2K4P A;  3K1R B;  2QB0 B;  2LMR A;  2F3N A;  2JV3 A;  2L5Y A;  4RQN A;  1OXJ A;  1V85 A;  5JU5 A;  2D8C A;  1LKY B;  5KNI A;  2KIV A;  4PZN A;  3SEI A;  1F0M A;  2E8O A;  1DXS A;  2KSO A;  2EAM A;  1SV4 A;  1SV0 A;  1SV0 C;  2EAO A;  3TAC B;  2QAR A;  2KG5 A;  2QKQ A;  1X66 A;  1Z1V A;  2QB0 A;  5J8Y A;  5J8Y C;  3BS5 B;  5JTI A;  4PZO A;  2FE9 A;  1OW5 A;  2ESE A;  4NL9 A;  4NJ8 A;  4NL9 C;  4MHV A;  1LKY A;  1SGG A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...