4PZOA

Crystal structure of phc3 sam l967r
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKRGPALKIARINSLKESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyhomeotic-like protein 3
publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 70
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pzoA00
1SGGA 1B0XA 1OXJA 2QKQA 1COKA 1DXSA 3TADA 3KKAA 2F3NA 2KSOB 3H8MA 2F8KA 3HILA 2FE9A 1V38A 2EAPA 1SXDA 1PK1A 2F44A 5J8YC 2Y9UA 3BS5B 5JU5A 2KE7A 2EANA 2EAMA 1SXEA 2LPEA 1LKYB 2E8PA 1SV0C 1V85A 1KW4A 5JRTA 4IS7A 4NL9C 2Y9TA 2QARB 3BQ7A 2EAOA 2GLEA 2K60A 3IDWA 3TACB 4PZNA 4NJ8A 3TADC 3KKAC 2D8CA 2KSOA 1X9XA 1F0MA 5J8YA 2L5YA 1WWVA 3SEIA 2QB0A 4RQNA 2E8MA 4RQMA 5L1MA 1RG6A 1PK3A 2DL0A 1JI7A 2K4PA 2E8NA 1SV0A 2ESEA 2KMDA 2YTUA 5KNIA 2ES6A 2B6GA 2LMRA 1PK1B 4PZOA 2QARA 1X66A 2DKZA 2QB1A 5JTIA 1X40A 2KG5A 1UCVA 3BS7A 3SENA 2D3DA 1B4FA 1SV4A 2JV3A 2DKXA 3BS5A 1Z1VA 1OW5A 1UQVA 2E8OA 2QB0B 1WWUA 4MHVA 4NL9A 3K1RB 1LKYA 2KIVA 5F3XB
chains in the Genus database with same CATH superfamily
4RQ1A 4TURA 2W3RA 8ICCA 3UMCA 4RQ5A 1PVPA 2YMMA 1BVSA 3O0FA 5AI8A 3KKAA 3PSIA 5AIBA 2BCQA 2OH2A 1X9SA 3ALRA 4Y2PA 1RQLA 2KKPA 5CRXA 2ISPA 1FEZA 4Y2VA 1KDHA 4DSJA 3EYZA 1F44A 2P66A 2MRLA 5KFLA 4F91B 3M6ZA 4OD0A 9ICUA 2JRZA 3C2KA 1SV0C 1V85A 1KW4A 3QU5A 4UATA 1JXLA 4AYBC 4PGXA 2IOFK 5J0XA 5CEHA 3NVZA 1VDVA 2W55A 2LYHA 3RB4A 2K4HA 2NRTA 1GO3F 4DOCA 4HYKA 4NM1A 2KHVA 9ICBA 4EEYA 3N28A 3RH6A 2ZTDA 1SV0A 2BDPA 2O6KA 4YCXA 4ICAA 3I1YA 4Z6DA 1QSLA 2JZBB 3AU2A 5KFMA 4GIBA 2ZJ8A 5KFFA 2HVHA 4UB6U 1NJZA 1S0NA 1B4FA 2FMSA 3BQTA 3UMGA 5AKEA 2MSNA 4KMOB 2PFOA 4I2FA 5AM4A 3KZIU 4M2YA 4M9HA 2KJ9A 1K1QA 1O08A 4DL3A 3UMBA 3J81j 3WKCA 5F3XB 5KT4A 4CGZA 1SGGA 3RJHA 5J2CA 4F93B 4Z6CA 2J6SA 3LVVA 4QIWC 3HRDD 3H0RB 2W8LA 2XC9A 2BPGA 4PL2A 4X5VA 9ICOA 5AI5A 4F4ZA 5KTQA 3SI8A 3MR3A 2IOHA 4P0QB 3BS5B 2KE7A 2W3SA 4EYIB 4QZIA 8ICRA 8ICTA 5DQIA 3EPGA 3H8JA 3M1YA 5EWFA 3AQEA 1SXEA 2Q4TA 3N7RC 3PW0A 1SKWA 1NK0A 1U45A 4G3IA 3CNHA 5AKYA 3V72A 2JEIA 3M9NB 2G5IB 9ICCA 4KX5A 3B0YA 3TACB 4F4KA 3RJKA 2G06A 2VIXA 5AI0A 4AYBF 1UT5A 2W54A 4YXMA 5G5GA 4ED7A 2DF4B 1WUDA 3ONNA 3Q8SB 1S8OA 4RQNA 5CB1A 4M9JA 1IG6A 4F72A 4UW9A 2A1JA 4GXKA 4QZAA 2AGPA 2XIDA 1L6NA 4RNOA 5DLFA 2H3IA 5KFWA 2C2RA 3LDAA 4M0AA 1BPBA 2GWSA 4O3MA 3MC1A 2AU0A 1DK2A 1PUZA 3RRHA 9ICNA 1YZ6A 1X66A 5AM1A 4Q43A 4KLQA 5ALEA 1MA7A 1MQ2A 3RR8A 4EBCA 4USAA 3FC4A 5ALKA 2J6UA 2D3DA 1SV4A 3SYZA 2HDOA 4MFCA 4LZDA 5ALJA 4I2DA 4ECVA 5AI6A 4P4OA 3C28A 8ICOA 2JMGA 2NYVA 9ICAA 4I2BA 4NV0A 4GFJA 3OGUA 4UAUA 1B0XA 4J03A 4Z6EA 4EZ6A 2WHEA 4KLHA 1DXSA 3C23A 4CRXA 2F3NA 1Z19A 4Q44A 1T8EA 3M9OB 3WKAA 3SQIA 1BNPA 4QIWF 5J2KA 3M8RA 4KLMA 4I2GA 4OO1J 2A1JB 4K4GA 1ZD3A 3NVWA 4DWIA 4NLKA 3EPIA 7ICSA 4DFKA 1QTMA 2WB1C 1ZJNA 5KG6A 5AKJA 4M9LA 1HUZA 4NL9C 4IQUA 1Z1BA 3BQ7A 7ICQA 3MR6A 4US8A 2GLEA 1HEKA 1JN3A 1L3UA 2OEHA 1B43A 1S5LU 4KTQA 4DEZA 1A76A 3C2MA 3H4DA 3OHBA 4QJFB 2VJ4A 2D8CA 2YB4A 4P4PA 3V7JA 3BDPA 5DKWA 2R8GA 1RYUA 4ECSA 2E8MA 3IG5A 2KJ8A 2A1AA 1A6SA 2LBOA 1YZ7A 4NLBA 4QWAA 5BOLA 4IRCA 1Z00A 4F2RA 4R63A 2ESEA 4OJLA 4DF8A 4OJPA 3AL0B 2HCFA 4QZ9A 2LKYA 3NS1A 2B6GA 2KVCA 2OYYA 3AM9A 4P0PA 3ZDDA 5DLGA 5HP4A 1BPZA 4O3SA 5IIMA 5AM2A 4KLGA 5KG2A 4RQ7A 3GIJA 1RYSA 1ZQZA 2JV3A 1YT3A 4TQSA 8ICAA 3OTQA 4KLTA 5E79U 4UARA 2WFAA 9ICVA 4RU9A 1NOMA 1LKYA 4XRHA 2OXOA 1PVQA 1ZQNA 3K4GA 4R8UB 3RH4A 4O3QA 3OHAA 4KLJA 4I2HA 3M9MB 8ICLA 3HILA 2ZTCA 4F4XA 4ED1A 2EAPA 5AK5A 4A8EA 4NY8A 2R8KA 1Z00B 4PL1A 4P4MA 3E58A 1S0MA 3BZKA 5KAIU 3RR7A 5KFRA 4JK1A 5GTIU 7ICPA 1ZQGA 2OWOA 3WKDA 1AROP 3PY8A 3M8SA 2KK0A 4QZEA 1L7NA 1TK0A 3IDWA 4NLGA 1X2IA 3TADC 3ETRA 4UAZA 4UB3A 3WK8A 3TAQA 1C20A 4M04A 4OJ6A 3SD7A 1A0PA 2EZZA 2OCEA 5AM3A 5HNKA 1ZRMA 3GV7B 4UB2A 1NKCA 5DGBA 3FAHA 5KNIA 2PFPA 2LM1A 4GLXA 4PHAA 1SZPA 1AQ6A 2CXYA 4EBDA 3UQ0A 1UA0A 1ZQPA 3ED5A 3QX7A 2E1FA 4DOAA 5ALMA 4Q45A 3TKAA 3SV4A 5G5HA 5DGAA 4UQGA 1S76D 2Y1IA 5AKXA 4BWMA 2DFLA 3QUTA 4KITB 3HPOA 2PMZF 4ED8A 4ECYA 5KFHA 4I2JA 3UXOA 4BUGA 1S10A 2GO7A 4O9MA 3TFSA 4EBEA 1NK7A 3IRUA 3Q8KA 1NJWA 4O3RA 4C4TA 2BHNA 3N7SC 3OJSA 3GFKB 5KFVA 3LK9A 1OUQA 2LYAA 2BCRA 2DGZA 4CNQA 1X6IA 2Z7JA 5AKKA 5DG7A 2W9AA 3V7KA 4KLDA 1NI3A 2NO5A 3FM9A 2KKVA 3VCBA 8ICGA 1JUDA 4YN4A 4AP9A 3OSPA 1EXNA 3AQFA 4BXOA 4EZ9A 2BCSA 3NTUA 5EWGA 4DQRA 7ICRA 1JIHA 1JMSA 1X9XA 3G6VA 4DL5A 2ZIXA 3AUOA 1UPHA 3F5AA 1QLNA 3PMNA 1COOA 1Q3VA 1NJYA 1FFUA 1Y88A 1SL1A 1Z3EB 3H8SA 4F5RA 5IIOA 2FPLA 4F4YA 3NVYA 3GIMA 5J2DA 5L1KA 4I29A 4XQ8A 2I9GA 2KG5A 1ZQMA 3BS7A 4J9KA 3RB0A 2KZMA 2E3TA 3C2LA 1KFTA 3UPQA 2CN1A 4F2SA 4OCZA 5B5EU 4KLFA 4RQ4A 2EZYA 3QNMA 3DEEA 1ZQHA 5DBAA 1KEJA 2ASDA 1U9LA 5KFQA 4F5NA 2PI5A 2KEYA 2FE9A 1S0OA 4PJ0U 2ZIXB 1WCLA 2XY5A 1XNSA 5CHGA 8ICIA 1ZQOA 4FFDA 1DGSA 3L3FX 2NRWA 3T5KA 3PW7A 4FBTA 4DSKA 3C5GA 3WK9A 1KL9A 2W9BB 2XY6A 5D49A 4BWJA 3RBDA 2NRVA 1HJPA 4QZCA 4B9LA 4RPZA 1D9DA 7ICFA 1XS9D 8ICHA 4MF2A 2JZBA 4R65A 5T14A 4TUSA 2UVUA 1ZQEA 2WAQF 4Y2XA 3T3FA 2L5YA 1SB3C 1A77A 1D8LA 2W43A 7ICIA 1BPEA 5H2FU 1WCNA 2E8NA 5J0PA 4B9SA 5CP2A 5AHXA 3KHRA 2IA6A 3RTVA 4YP3A 2BQ3A 2BGWA 4U7CA 4FBUA 1ZQFA 1RM6C 3D2SA 3ZD8A 3ZDAA 3KZXA 5J2FA 2MA1A 1TK8A 4PPXA 2NRZA 4RPYA 1U47A 8ICWA 4P0QA 1NZPA 3BS5A 3IG8A 1Z1VA 5ALVA 2E8OA 5ALOA 4YMOA 4M9NA 2FLLA 3F2BA 2FLNA 3RBEA 2BPFA 7ICHA 1N63A 4DS4A 3PR5B 2KZZA 2ATLA 4KX3A 2ZXIA 1J2NA 2EQYA 4JV1A 2EZXA 4Y2SA 5F9LA 2I5HA 4Y2YA 3C29A 5KFPA 2OM6A 1ZXIA 2XGPA 1U4BA 1KSPA 3D2QA 5L9XA 2PI4A 1ZQXA 5DQGA 2BCVA 1XWLA 5KT6A 3UXPA 3TARA 3WKEA 4ED0A 3QE9Y 1MN8A 3RAXA 1ZQLA 3MGVA 2XICA 5KFEA 1QQ5A 2WF9A 2KZ3A 8ICUA 1ED1A 1KFSA 5KG1A 4FO6A 9ICSA 1F5SA 1PZNA 1SZHA 3T5JA 1TAUA 3SAFA 4ZOHC 4O3OA 3N7PD 1WWVA 4O3NA 1L7PA 3SEIA 3PVXA 2H3FA 1NK4A 1PVRA 3WK7A 2YMPA 7ICJA 2YX8A 1C7YA 4Y2QA 1ZQKA 5DDMA 3E0FA 4J9MA 4K4IA 5EE1A 4CF5A 3IM1A 4J9PA 5B66U 2PFQA 4FZLA 4F4WA 3C5FA 3ISDA 5ALXA 2WTFA 1TFRA 3KHLA 2F8LA 4DQPA 3ZDEA 2HMXA 1K1SA 4NWIA 3RJIA 1FIQA 2KFZA 5KFXA 5IILA 1X40A 4NXZA 2BZFA 1UCVA 2F1JA 2W8KA 2IBKA 9ICMA 2V4QA 4O0IA 4FZMA 4GXIA 3PO5A 2MAXA 4DO9A 2HBMA 1UA1A 2JH7A 3JPPA 3HW8A 2PXIA 4MHVA 3GU3A 2LYBA 2FDRA 2KV2A 3QYPA 2DPIA 5KG4A 4B6JA 1FO4A 3JPSA 2E1EA 5AI9A 5KFUA 8ICJA 3AU6A 4IR9A 5ALPA 3MGIA 2ZG6A 2R8JA 5AKIA 2A3VA 2UVVA 4P2HA 5EE9A 4YD1A 2KICA 5AKLA 4UAYA 2KP7A 2IMWP 2PKEA 1JXEA 5AK6A 5DBCA 1CI4A 1KLNA 2AHOB 4MEYA 3MDCA 3KD3A 3PR4A 4J9SA 3GZFA 2YN4A 3GQCA 2YQEA 2E5SA 2H5XA 5KG3A 1NK6A 2W7OA 2ZJ5A 4JMUA 3Q8LA 4DQSA 1TKDA 3A0HU 1LV5A 1QQ6A 3QZ8A 4I2CA 1X42A 2YB1A 3L4PA 2R8HA 3ISBA 9ICFA 5AI4A 1NK9A 4IL6U 5C0YA 8ICBA 2KJ5A 1F0MA 5DDYA 2HHQA 2G09A 1LVHA 5IINA 1JI7A 3IV6A 1N2XA 7ICKA 2ODGA 1T3NA 4M47A 4U6PA 1L5UA 7ICMA 4R8UA 1V9PA 1QSSA 4EYHB 3NASA 4QWBA 1QCKA 3R9KA 3GIIA 2P6RA 5JTIA 3RRGA 2ZTEA 3I28A 3SENA 1T4GA 5J0SA 4DCCA 2QB0B 3RJEA 1JALA 2K4IA 2H3ZA 3DDHA 4NL9A 5J2EA 4TQRA 3RB6A 4DL6A 5KFYA 4Q8FA 3HP6A 5AM0A 4TUPA 4IR1A 3WU2U 1JX4A 1COKA 3B0XA 2RQ5A 2DUYA 3GV5B 4ELVA 1Q8KA 3QU4A 2RRDA 7ICTA 2ZIVA 2F44A 5AICA 5J8YC 5ALIA 5DG9A 5CJ7A 4UB4A 4O5CA 1N5WA 2JEGA 4NLCA 4DF4A 8ICKA 2E8PA 4QWCA 4J9OA 2LM4A 1U49A 1NKEA 3JPTA 4RQ8A 1BGXT 3DV9A 2JR5A 3M6KA 9ICRA 4PZNA 4EENA 2QLTA 1ZQCA 4KLLA 2AQ0A 1NNLA 4DFDA 2FI1A 3D2NA 3JPQA 4PH5A 5J8YA 5DB9A 1KTQA 3PX4A 2P6UA 3KHHA 4C8LA 8ICQA 1T3QA 2HHWA 2WB1F 4FZNA 1BPXA 3EW9A 1KQQA 2W11A 3HKZC 4J9RA 3C1ZA 1L3SA 3IN5A 4FS2A 4RT3A 2UVRA 2I1QA 2ZIVB 3U26A 2RDJA 2HOQA 9ICWA 9ICTA 1N5XA 2CRXA 9ICKA 4QW8A 4GC6A 4NM2A 2F1HA 1ECWA 5ALNA 2XY7A 1NZBA 2FJ6A 3V6HA 4ED3A 2BDUA 2JH1A 7ICGA 3SMVA 3PZPA 2H3QA 3K1RB 5KFIA 1H38A 4MF8A 3M7DA 2JHDA 2HHXA 5KG7A 3HT3A 1XSLA 5JUMA 2KN7A 2MU2A 1CRXA 4YR2A 3TADA 1N56A 1RQNA 5EOZA 2AGOA 2BR0A 3SZ2A 3S6JA 4ZH4A 2W03A 2K8AA 4JV0A 3UQ2A 8ICYA 2NRXA 2VANA 2LPEA 5EWEA 3WK6A 2F76X 8ICXA 4F92B 1CEZA 1S9FA 3LYSA 3V6KA 3ZI4A 4ECTA 7ICNA 4J9LA 4UB8U 4NJ8A 3KHGA 1ZQQA 1XO1A 5CWRA 2XCAA 5AKZA 1HUOA 4UB1A 1P7DA 1SL0A 1UHUA 4PGYA 3MFHA 3PW5A 3RJFA 2JXJA 1WG8A 3OPXA 2ZIWA 3I76A 4IQVA 2ISOA 1VJ5A 9ICHA 1K5OA 1N61A 3NVVA 2ZIUB 5J0QA 2ES6A 4F5PA 1DRGA 4RZRA 3PX6A 3HKZF 1ZQSA 4RUCA 3TANA 1V97A 5J2GA 4F3OA 2AJQA 3ORYA 1X9MA 4ECXA 5GTHU 3CP8A 3PSPA 4B9TA 1M6YA 4IRKA 4RUAA 1L7MA 2EDUA 3RB3A 3PMLA 3PX0A 4GC7A 1X9WA 3QU2A 5AKHA 2VA2A 4ECQA 3MR2A 2W9BA 1RDFA 1S0VA 2V9WA 1NK8A 3SV3A 3QUCA 2PFNA 4J9QA 1OXJA 4C8OA 4QNLA 5HHIA 2BCUA 4ECUA 1T7PA 3PSTA 2F8KA 4B9MA 4IQTA 9ICIA 5HHHA 4DQIA 2HI0A 3CYMA 3CRXA 2K8BB 3A0BU 5J0OA 3H40A 2VA3A 4QZFA 5ALGA 3WK4A 3T5LA 2ZIWB 3QU7A 3C1YA 4ELUA 2F77X 4FS1A 3RFAA 1X6JA 4LJXA 4DSEA 2CPRA 1Q46A 4ACOA 5L1JA 1ZQIA 3SR6A 2ZUCA 3LVWA 3KKAC 5C5JA 3G6XA 2M0NA 5TISU 2ZXHA 2M9NA 4C0ZA 5J2BA 1XO0A 5KFSA 2YY6A 4DSFA 4B9NA 7ICOA 4PHPA 2KVSA 1PK3A 3KBBA 1KRPA 5FP0A 5J2JA 4M6WA 3HWTA 9ICJA 3JPRA 4NLZA 4LVSA 3B9JA 4BDPA 2XGQA 2MUTB 2KFNA 3CW2C 2VJ5A 2QB1A 2BQRA 4ECWA 3PW2A 3AMZA 2AH5A 3MFIA 5J0RA 2YMQA 3IP4B 5BPCA 3RJGA 3HX0A 1NKBA 4KLOA 1N62A 4F5QA 3NGDA 3QUQA 3SAHA 3SAGA 1ZETA 4US9A 4C8KA 2QKQA 3KTQA 2A19A 2HBJA 4CE6A 1L3VA 1ZQBA 2IHMA 1SL2A 3LWLA 1J97A 2VKQA 3QZ7A 5ALRA 4XUSA 3RAQA 2C22A 3MDAA 4KN7A 4I2AA 3V7LA 2ALZA 2Y9UA 3MABA 5KFZA 1BPYA 5J2HA 4ED2A 2JEFA 4KLIA 2EANA 1NK5A 4M6WB 4YXJA 3Q8RB 3T5HA 3V6JA 3FDSA 2HOFA 5JRTA 4MFFA 1L8OA 7ICVA 5AK4A 4DQQA 2I6XA 3KFUF 4EX7A 2NO4A 2WF8A 4QZBA 4MEXA 8ICZA 5CA7A 3Q8MA 4RQ3A 3N97B 5ALYA 5HMMA 5DBBA 1D8BA 5L1MA 4RQMA 1QSYA 1ZD4A 1TK5A 4JV2A 5IIKA 3TAPA 2FPKA 5DB8A 2HSZA 2HOIA 1ZRNA 4HAIA 2Y0SC 4PHEA 1U48A 2RLTA 4C80A 3H4BA 4FE3A 4K4HA 2W7PA 5J0TA 4RQ0A 9ICLA 3F2DA 2RDIA 4QW9A 5DQHA 1RPLA 2QARA 2WF7A 5EE0A 4Y2RA 2FLPA 2W04A 1SKSA 3GIKA 3RH5A 2BPCA 4R66A 5ALDA 4IC9A 5J2AA 4O5EA 2P35A 5DB7A 9ICEA 2JEJA 3C21A 2W9MA 3H0MB 4I2IA 3K1ZA 4JWMA 4GXJA 5IIJA 2G0AA 4BX9C 3KOOA 5KFDA 3JPNA 3HJEA 3QUBA 1S97A 5AIAA 4YMNA 4EX6A 2N1RA 4F50A 2H3VA 1PK1A 1Z4NA 2ASJA 5JU5A 5DG8A 9ICXA 2HW3A 3H8WA 1MQ3A 4PHDA 2UVWA 2EAMA 2LI6A 4RQ6A 4CCHA 2R18A 1FFVA 1MSWD 4IS7A 5KFOA 2G07A 1LB2B 4O5KA 4IQWA 2QARB 2EAOA 7ICLA 4UAWA 2K60A 2HHVA 3GV8B 1KBUA 3GILA 1T94A 4KMUA 2V4RA 3T79A 2GH1A 8ICNA 1QH9A 5TZVA 3OSNA 1TV9A 2RHFA 4C7ZA 5ALSA 4F71A 3D6JA 3F2CA 2QB0A 1ZQDA 4DFMA 4JB3A 2DL0A 3AEVA 4EELA 3PV8A 3THVA 2KMDA 1IM4A 1TE2A 3QEAZ 2HHUA 4DFJA 3K75D 5A0LA 3TQ1A 4KLSA 2Y0SF 1PK1B 1SWWA 3WK5A 2HBLA 3BQ0A 9ICGA 5KL1B 1VLBA 4YFKA 2DKXA 8ICSA 2C2DA 1ZD5A 1ZQYA 4QZGA 5KFGA 1ZD2P 5ALFA 4JWNA 4BJQA 4I28A 4C8MA 1BNOA 4NLNA 1ZJMA 8ICEA 1ZQTA 3MR5A 4ECZA 5K4LA 2IOFA 3BJYA 4M9GA 5HMLA 2KTQA 4CDGA 4OJ5A 5KFNA 1N60A 5J0WA 4I2EA 4LZGA 3QXGA 4DL2A 5ALLA 4C4RA 4UBCA 5ALWA 2AXTU 1ZQAA 2W9CA 3MGHA 3BZCA 2K89A 4F5OA 2HHTA 5ALUA 5AK3A 5L1IA 5KFBA 4CF3A 3BQ1A 3Q8PB 2K8CB 1JROA 4YQWA 3TFRA 4UB5A 2DWQA 4C8NA 2FMQA 2KSOA 5D46A 3G6YA 2Q0ZX 4Y2TA 2PMZC 3ZDBA 4YR0A 1RG6A 3FYHA 4PGQA 4DL4A 5KT2A 2XCPA 3L5KA 1BPDA 3PNCA 2DPJA 3VC8A 2IHNA 2KNJA 4KN4A 1RXWA 5HR7A 2LMRA 4ED6A 3OJUA 4PZOA 1TAQA 2B21A 1RYRA 5ALTA 3NRWA 1QQ7A 1XC9A 2ASLA 4B9UA 1UQVA 4OJOA 2W9CB 4G9BA 5HR6A 4Z6FA 1N48A 3ICXA 3RJJA 1DGJA 5ALZA 2XO7A 1L3TA 1SWVA 4YMMA 8ICPA 2ZUDA 1B22A 3EZ5A 2B0CA 8ICMA 4DL7A 5CR0A 4J9NA 3PO4A 4P0PB 1Q3UA 2OHFA 2KSOB 3H8MA 3IHQB 4I27A 4Y2JA 5KL8B 4B9VA 4CF4A 1NJXA 1SXDA 2FMPA 4QZ8A 2GOLA 4RT2A 3RF9A 5EE3A 2HVIA 5KFTA 1XSNA 1ZQVA 3ZDCA 1L8LA 1L7OA 1LKYB 4RNNA 3H7IA 4O3PA 1ZOLA 3EUB2 2ZJAA 4UASA 3PSFA 5KT5A 3NUQA 5J2IA 3F53A 2ZIUA 5IIIA 3TI0A 2D6FC 7ICUA 4QZDA 2XI9A 3H0LB 4C4SA 1RZTA 2RP5A 5BOMA 5F9NA 3ISCA 4WJ3B 2C28A 3UXNA 1IIPA 3WKBA 4XA5A 1ZQRA 3QU9A 3MBYA 1ZQWA 1ZYQA 2HHSA 5KFJA 2JGAA 4IRDA 2ZUBA 5ALHA 5KAFU 7ICEA 4EEKA 2YTUA 4C7YA 3ETLA 2FPMA 2YMLA 3UM9A 4MFAA 5J29A 2AQ4A 3EWAA 2DKZA 1SIJA 5ALQA 2BKEA 1DOQA 1WYGA 5J0UA 1XU4A 1ZQ1C 1TAMA 1OW5A 4DFPA 1XSPA 4DSLA 4Q8EA 1URJA 1SKRA 1ZQUA 3NRZA 4DSIA 3LWMA 2KIVA 4DLGA 2EH9A 4QWEA 2AGQA 2WF5A 4YVZA 1ZQJA 5DB6A 2XVTA 5KFKA 8ICFA 2LHTA 1V38A 5L1LA 4QWDA 2DBYA 4RQ2A 4ELTA 3QEBZ 2KD1A 3ZD9A 2WAQC 2VA8A 3GDXA 9ICPA 3PW4A 1Z4OA 1KN5A 3N4MB 3JPOA 5D4BA 4JUZA 4RNMA 5KFCA 1CUKA 5KG0A 2R8IA 4DS5A 3E2EA 1MC8A 2Y9TA 4UAVA 1RXVA 5AKGA 3BQ2A 1JRPA 1DK3A 1D8YA 5KT7A 2NV3A 4BGDA 4KLEA 2MUTA 1O03A 2BQUA 4Y2UA 4UBBA 2F1IA 4YG2A 9ICQA 5KFAA 5J0YA 1UT8A 2K4PA 2KHQA 2G5HB 1KKXA 1HIWA 2K4EA 1TVAA 3Q8QB 1IXRA 2C2EA 4BXOB 4YR3A 4ECRA 4E0DA 1J2MA 2KIWA 8ICVA 5KT3A 3F5EA 1D9FA 4RPXA 2WF6A 2G08A 4R64A 1WWUA 4DOBA 1KFDA 2DQNB 2KOBA 4QZHA 1S77D 2Y1JA 1IV8A 4F8RA 5AM5A 4YD2A 4TUQA 4KLUA 2F2AB 4DLEA 5KG5A 2HBKA 3AN1A 2J6TA
chains in the Genus database with same CATH topology
1SGGA 1B0XA 1OXJA 2QKQA 1COKA 1DXSA 3TADA 3KKAA 2F3NA 2KSOB 3H8MA 2F8KA 3HILA 2FE9A 1V38A 2EAPA 1SXDA 1PK1A 2F44A 5J8YC 2Y9UA 3BS5B 5JU5A 2KE7A 2EANA 2EAMA 1SXEA 2LPEA 1LKYB 2E8PA 1SV0C 1V85A 1KW4A 5JRTA 4IS7A 4NL9C 2Y9TA 2QARB 3BQ7A 2EAOA 2GLEA 2K60A 3IDWA 3TACB 4PZNA 4NJ8A 3TADC 3KKAC 2D8CA 2KSOA 1X9XA 1F0MA 5J8YA 2L5YA 1WWVA 3SEIA 2QB0A 4RQNA 2E8MA 4RQMA 5L1MA 1RG6A 1PK3A 2DL0A 1JI7A 2K4PA 2E8NA 1SV0A 2ESEA 2KMDA 2YTUA 5KNIA 2ES6A 2B6GA 2LMRA 1PK1B 4PZOA 2QARA 1X66A 2DKZA 2QB1A 5JTIA 1X40A 2KG5A 1UCVA 3BS7A 3SENA 2D3DA 1B4FA 1SV4A 2JV3A 2DKXA 3BS5A 1Z1VA 1OW5A 1UQVA 2E8OA 2QB0B 1WWUA 4MHVA 4NL9A 3K1RB 1LKYA 2KIVA 5F3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGG A;  1B0X A;  1OXJ A;  2QKQ A;  1COK A;  1DXS A;  3TAD A;  3KKA A;  2F3N A;  2KSO B;  3H8M A;  2F8K A;  3HIL A;  2FE9 A;  1V38 A;  2EAP A;  1SXD A;  1PK1 A;  2F44 A;  5J8Y C;  2Y9U A;  3BS5 B;  5JU5 A;  2KE7 A;  2EAN A;  2EAM A;  1SXE A;  2LPE A;  1LKY B;  2E8P A;  1SV0 C;  1V85 A;  1KW4 A;  5JRT A;  4IS7 A;  4NL9 C;  2Y9T A;  2QAR B;  3BQ7 A;  2EAO A;  2GLE A;  2K60 A;  3IDW A;  3TAC B;  4PZN A;  4NJ8 A;  3TAD C;  3KKA C;  2D8C A;  2KSO A;  1X9X A;  1F0M A;  5J8Y A;  2L5Y A;  1WWV A;  3SEI A;  2QB0 A;  4RQN A;  2E8M A;  4RQM A;  5L1M A;  1RG6 A;  1PK3 A;  2DL0 A;  1JI7 A;  2K4P A;  2E8N A;  1SV0 A;  2ESE A;  2KMD A;  2YTU A;  5KNI A;  2ES6 A;  2B6G A;  2LMR A;  1PK1 B;  4PZO A;  2QAR A;  1X66 A;  2DKZ A;  2QB1 A;  5JTI A;  1X40 A;  2KG5 A;  1UCV A;  3BS7 A;  3SEN A;  2D3D A;  1B4F A;  1SV4 A;  2JV3 A;  2DKX A;  3BS5 A;  1Z1V A;  1OW5 A;  1UQV A;  2E8O A;  2QB0 B;  1WWU A;  4MHV A;  4NL9 A;  3K1R B;  1LKY A;  2KIV A;  5F3X B; 
#chains in the Genus database with same CATH topology
 4RQ1 A;  4TUR A;  2W3R A;  8ICC A;  3UMC A;  4RQ5 A;  1PVP A;  2YMM A;  1BVS A;  3O0F A;  5AI8 A;  3KKA A;  3PSI A;  5AIB A;  2BCQ A;  2OH2 A;  1X9S A;  3ALR A;  4Y2P A;  1RQL A;  2KKP A;  5CRX A;  2ISP A;  1FEZ A;  4Y2V A;  1KDH A;  4DSJ A;  3EYZ A;  1F44 A;  2P66 A;  2MRL A;  5KFL A;  4F91 B;  3M6Z A;  4OD0 A;  9ICU A;  2JRZ A;  3C2K A;  1SV0 C;  1V85 A;  1KW4 A;  3QU5 A;  4UAT A;  1JXL A;  4AYB C;  4PGX A;  2IOF K;  5J0X A;  5CEH A;  3NVZ A;  1VDV A;  2W55 A;  2LYH A;  3RB4 A;  2K4H A;  2NRT A;  1GO3 F;  4DOC A;  4HYK A;  4NM1 A;  2KHV A;  9ICB A;  4EEY A;  3N28 A;  3RH6 A;  2ZTD A;  1SV0 A;  2BDP A;  2O6K A;  4YCX A;  4ICA A;  3I1Y A;  4Z6D A;  1QSL A;  2JZB B;  3AU2 A;  5KFM A;  4GIB A;  2ZJ8 A;  5KFF A;  2HVH A;  4UB6 U;  1NJZ A;  1S0N A;  1B4F A;  2FMS A;  3BQT A;  3UMG A;  5AKE A;  2MSN A;  4KMO B;  2PFO A;  4I2F A;  5AM4 A;  3KZI U;  4M2Y A;  4M9H A;  2KJ9 A;  1K1Q A;  1O08 A;  4DL3 A;  3UMB A;  3J81 j;  3WKC A;  5F3X B;  5KT4 A;  4CGZ A;  1SGG A;  3RJH A;  5J2C A;  4F93 B;  4Z6C A;  2J6S A;  3LVV A;  4QIW C;  3HRD D;  3H0R B;  2W8L A;  2XC9 A;  2BPG A;  4PL2 A;  4X5V A;  9ICO A;  5AI5 A;  4F4Z A;  5KTQ A;  3SI8 A;  3MR3 A;  2IOH A;  4P0Q B;  3BS5 B;  2KE7 A;  2W3S A;  4EYI B;  4QZI A;  8ICR A;  8ICT A;  5DQI A;  3EPG A;  3H8J A;  3M1Y A;  5EWF A;  3AQE A;  1SXE A;  2Q4T A;  3N7R C;  3PW0 A;  1SKW A;  1NK0 A;  1U45 A;  4G3I A;  3CNH A;  5AKY A;  3V72 A;  2JEI A;  3M9N B;  2G5I B;  9ICC A;  4KX5 A;  3B0Y A;  3TAC B;  4F4K A;  3RJK A;  2G06 A;  2VIX A;  5AI0 A;  4AYB F;  1UT5 A;  2W54 A;  4YXM A;  5G5G A;  4ED7 A;  2DF4 B;  1WUD A;  3ONN A;  3Q8S B;  1S8O A;  4RQN A;  5CB1 A;  4M9J A;  1IG6 A;  4F72 A;  4UW9 A;  2A1J A;  4GXK A;  4QZA A;  2AGP A;  2XID A;  1L6N A;  4RNO A;  5DLF A;  2H3I A;  5KFW A;  2C2R A;  3LDA A;  4M0A A;  1BPB A;  2GWS A;  4O3M A;  3MC1 A;  2AU0 A;  1DK2 A;  1PUZ A;  3RRH A;  9ICN A;  1YZ6 A;  1X66 A;  5AM1 A;  4Q43 A;  4KLQ A;  5ALE A;  1MA7 A;  1MQ2 A;  3RR8 A;  4EBC A;  4USA A;  3FC4 A;  5ALK A;  2J6U A;  2D3D A;  1SV4 A;  3SYZ A;  2HDO A;  4MFC A;  4LZD A;  5ALJ A;  4I2D A;  4ECV A;  5AI6 A;  4P4O A;  3C28 A;  8ICO A;  2JMG A;  2NYV A;  9ICA A;  4I2B A;  4NV0 A;  4GFJ A;  3OGU A;  4UAU A;  1B0X A;  4J03 A;  4Z6E A;  4EZ6 A;  2WHE A;  4KLH A;  1DXS A;  3C23 A;  4CRX A;  2F3N A;  1Z19 A;  4Q44 A;  1T8E A;  3M9O B;  3WKA A;  3SQI A;  1BNP A;  4QIW F;  5J2K A;  3M8R A;  4KLM A;  4I2G A;  4OO1 J;  2A1J B;  4K4G A;  1ZD3 A;  3NVW A;  4DWI A;  4NLK A;  3EPI A;  7ICS A;  4DFK A;  1QTM A;  2WB1 C;  1ZJN A;  5KG6 A;  5AKJ A;  4M9L A;  1HUZ A;  4NL9 C;  4IQU A;  1Z1B A;  3BQ7 A;  7ICQ A;  3MR6 A;  4US8 A;  2GLE A;  1HEK A;  1JN3 A;  1L3U A;  2OEH A;  1B43 A;  1S5L U;  4KTQ A;  4DEZ A;  1A76 A;  3C2M A;  3H4D A;  3OHB A;  4QJF B;  2VJ4 A;  2D8C A;  2YB4 A;  4P4P A;  3V7J A;  3BDP A;  5DKW A;  2R8G A;  1RYU A;  4ECS A;  2E8M A;  3IG5 A;  2KJ8 A;  2A1A A;  1A6S A;  2LBO A;  1YZ7 A;  4NLB A;  4QWA A;  5BOL A;  4IRC A;  1Z00 A;  4F2R A;  4R63 A;  2ESE A;  4OJL A;  4DF8 A;  4OJP A;  3AL0 B;  2HCF A;  4QZ9 A;  2LKY A;  3NS1 A;  2B6G A;  2KVC A;  2OYY A;  3AM9 A;  4P0P A;  3ZDD A;  5DLG A;  5HP4 A;  1BPZ A;  4O3S A;  5IIM A;  5AM2 A;  4KLG A;  5KG2 A;  4RQ7 A;  3GIJ A;  1RYS A;  1ZQZ A;  2JV3 A;  1YT3 A;  4TQS A;  8ICA A;  3OTQ A;  4KLT A;  5E79 U;  4UAR A;  2WFA A;  9ICV A;  4RU9 A;  1NOM A;  1LKY A;  4XRH A;  2OXO A;  1PVQ A;  1ZQN A;  3K4G A;  4R8U B;  3RH4 A;  4O3Q A;  3OHA A;  4KLJ A;  4I2H A;  3M9M B;  8ICL A;  3HIL A;  2ZTC A;  4F4X A;  4ED1 A;  2EAP A;  5AK5 A;  4A8E A;  4NY8 A;  2R8K A;  1Z00 B;  4PL1 A;  4P4M A;  3E58 A;  1S0M A;  3BZK A;  5KAI U;  3RR7 A;  5KFR A;  4JK1 A;  5GTI U;  7ICP A;  1ZQG A;  2OWO A;  3WKD A;  1ARO P;  3PY8 A;  3M8S A;  2KK0 A;  4QZE A;  1L7N A;  1TK0 A;  3IDW A;  4NLG A;  1X2I A;  3TAD C;  3ETR A;  4UAZ A;  4UB3 A;  3WK8 A;  3TAQ A;  1C20 A;  4M04 A;  4OJ6 A;  3SD7 A;  1A0P A;  2EZZ A;  2OCE A;  5AM3 A;  5HNK A;  1ZRM A;  3GV7 B;  4UB2 A;  1NKC A;  5DGB A;  3FAH A;  5KNI A;  2PFP A;  2LM1 A;  4GLX A;  4PHA A;  1SZP A;  1AQ6 A;  2CXY A;  4EBD A;  3UQ0 A;  1UA0 A;  1ZQP A;  3ED5 A;  3QX7 A;  2E1F A;  4DOA A;  5ALM A;  4Q45 A;  3TKA A;  3SV4 A;  5G5H A;  5DGA A;  4UQG A;  1S76 D;  2Y1I A;  5AKX A;  4BWM A;  2DFL A;  3QUT A;  4KIT B;  3HPO A;  2PMZ F;  4ED8 A;  4ECY A;  5KFH A;  4I2J A;  3UXO A;  4BUG A;  1S10 A;  2GO7 A;  4O9M A;  3TFS A;  4EBE A;  1NK7 A;  3IRU A;  3Q8K A;  1NJW A;  4O3R A;  4C4T A;  2BHN A;  3N7S C;  3OJS A;  3GFK B;  5KFV A;  3LK9 A;  1OUQ A;  2LYA A;  2BCR A;  2DGZ A;  4CNQ A;  1X6I A;  2Z7J A;  5AKK A;  5DG7 A;  2W9A A;  3V7K A;  4KLD A;  1NI3 A;  2NO5 A;  3FM9 A;  2KKV A;  3VCB A;  8ICG A;  1JUD A;  4YN4 A;  4AP9 A;  3OSP A;  1EXN A;  3AQF A;  4BXO A;  4EZ9 A;  2BCS A;  3NTU A;  5EWG A;  4DQR A;  7ICR A;  1JIH A;  1JMS A;  1X9X A;  3G6V A;  4DL5 A;  2ZIX A;  3AUO A;  1UPH A;  3F5A A;  1QLN A;  3PMN A;  1COO A;  1Q3V A;  1NJY A;  1FFU A;  1Y88 A;  1SL1 A;  1Z3E B;  3H8S A;  4F5R A;  5IIO A;  2FPL A;  4F4Y A;  3NVY A;  3GIM A;  5J2D A;  5L1K A;  4I29 A;  4XQ8 A;  2I9G A;  2KG5 A;  1ZQM A;  3BS7 A;  4J9K A;  3RB0 A;  2KZM A;  2E3T A;  3C2L A;  1KFT A;  3UPQ A;  2CN1 A;  4F2S A;  4OCZ A;  5B5E U;  4KLF A;  4RQ4 A;  2EZY A;  3QNM A;  3DEE A;  1ZQH A;  5DBA A;  1KEJ A;  2ASD A;  1U9L A;  5KFQ A;  4F5N A;  2PI5 A;  2KEY A;  2FE9 A;  1S0O A;  4PJ0 U;  2ZIX B;  1WCL A;  2XY5 A;  1XNS A;  5CHG A;  8ICI A;  1ZQO A;  4FFD A;  1DGS A;  3L3F X;  2NRW A;  3T5K A;  3PW7 A;  4FBT A;  4DSK A;  3C5G A;  3WK9 A;  1KL9 A;  2W9B B;  2XY6 A;  5D49 A;  4BWJ A;  3RBD A;  2NRV A;  1HJP A;  4QZC A;  4B9L A;  4RPZ A;  1D9D A;  7ICF A;  1XS9 D;  8ICH A;  4MF2 A;  2JZB A;  4R65 A;  5T14 A;  4TUS A;  2UVU A;  1ZQE A;  2WAQ F;  4Y2X A;  3T3F A;  2L5Y A;  1SB3 C;  1A77 A;  1D8L A;  2W43 A;  7ICI A;  1BPE A;  5H2F U;  1WCN A;  2E8N A;  5J0P A;  4B9S A;  5CP2 A;  5AHX A;  3KHR A;  2IA6 A;  3RTV A;  4YP3 A;  2BQ3 A;  2BGW A;  4U7C A;  4FBU A;  1ZQF A;  1RM6 C;  3D2S A;  3ZD8 A;  3ZDA A;  3KZX A;  5J2F A;  2MA1 A;  1TK8 A;  4PPX A;  2NRZ A;  4RPY A;  1U47 A;  8ICW A;  4P0Q A;  1NZP A;  3BS5 A;  3IG8 A;  1Z1V A;  5ALV A;  2E8O A;  5ALO A;  4YMO A;  4M9N A;  2FLL A;  3F2B A;  2FLN A;  3RBE A;  2BPF A;  7ICH A;  1N63 A;  4DS4 A;  3PR5 B;  2KZZ A;  2ATL A;  4KX3 A;  2ZXI A;  1J2N A;  2EQY A;  4JV1 A;  2EZX A;  4Y2S A;  5F9L A;  2I5H A;  4Y2Y A;  3C29 A;  5KFP A;  2OM6 A;  1ZXI A;  2XGP A;  1U4B A;  1KSP A;  3D2Q A;  5L9X A;  2PI4 A;  1ZQX A;  5DQG A;  2BCV A;  1XWL A;  5KT6 A;  3UXP A;  3TAR A;  3WKE A;  4ED0 A;  3QE9 Y;  1MN8 A;  3RAX A;  1ZQL A;  3MGV A;  2XIC A;  5KFE A;  1QQ5 A;  2WF9 A;  2KZ3 A;  8ICU A;  1ED1 A;  1KFS A;  5KG1 A;  4FO6 A;  9ICS A;  1F5S A;  1PZN A;  1SZH A;  3T5J A;  1TAU A;  3SAF A;  4ZOH C;  4O3O A;  3N7P D;  1WWV A;  4O3N A;  1L7P A;  3SEI A;  3PVX A;  2H3F A;  1NK4 A;  1PVR A;  3WK7 A;  2YMP A;  7ICJ A;  2YX8 A;  1C7Y A;  4Y2Q A;  1ZQK A;  5DDM A;  3E0F A;  4J9M A;  4K4I A;  5EE1 A;  4CF5 A;  3IM1 A;  4J9P A;  5B66 U;  2PFQ A;  4FZL A;  4F4W A;  3C5F A;  3ISD A;  5ALX A;  2WTF A;  1TFR A;  3KHL A;  2F8L A;  4DQP A;  3ZDE A;  2HMX A;  1K1S A;  4NWI A;  3RJI A;  1FIQ A;  2KFZ A;  5KFX A;  5IIL A;  1X40 A;  4NXZ A;  2BZF A;  1UCV A;  2F1J A;  2W8K A;  2IBK A;  9ICM A;  2V4Q A;  4O0I A;  4FZM A;  4GXI A;  3PO5 A;  2MAX A;  4DO9 A;  2HBM A;  1UA1 A;  2JH7 A;  3JPP A;  3HW8 A;  2PXI A;  4MHV A;  3GU3 A;  2LYB A;  2FDR A;  2KV2 A;  3QYP A;  2DPI A;  5KG4 A;  4B6J A;  1FO4 A;  3JPS A;  2E1E A;  5AI9 A;  5KFU A;  8ICJ A;  3AU6 A;  4IR9 A;  5ALP A;  3MGI A;  2ZG6 A;  2R8J A;  5AKI A;  2A3V A;  2UVV A;  4P2H A;  5EE9 A;  4YD1 A;  2KIC A;  5AKL A;  4UAY A;  2KP7 A;  2IMW P;  2PKE A;  1JXE A;  5AK6 A;  5DBC A;  1CI4 A;  1KLN A;  2AHO B;  4MEY A;  3MDC A;  3KD3 A;  3PR4 A;  4J9S A;  3GZF A;  2YN4 A;  3GQC A;  2YQE A;  2E5S A;  2H5X A;  5KG3 A;  1NK6 A;  2W7O A;  2ZJ5 A;  4JMU A;  3Q8L A;  4DQS A;  1TKD A;  3A0H U;  1LV5 A;  1QQ6 A;  3QZ8 A;  4I2C A;  1X42 A;  2YB1 A;  3L4P A;  2R8H A;  3ISB A;  9ICF A;  5AI4 A;  1NK9 A;  4IL6 U;  5C0Y A;  8ICB A;  2KJ5 A;  1F0M A;  5DDY A;  2HHQ A;  2G09 A;  1LVH A;  5IIN A;  1JI7 A;  3IV6 A;  1N2X A;  7ICK A;  2ODG A;  1T3N A;  4M47 A;  4U6P A;  1L5U A;  7ICM A;  4R8U A;  1V9P A;  1QSS A;  4EYH B;  3NAS A;  4QWB A;  1QCK A;  3R9K A;  3GII A;  2P6R A;  5JTI A;  3RRG A;  2ZTE A;  3I28 A;  3SEN A;  1T4G A;  5J0S A;  4DCC A;  2QB0 B;  3RJE A;  1JAL A;  2K4I A;  2H3Z A;  3DDH A;  4NL9 A;  5J2E A;  4TQR A;  3RB6 A;  4DL6 A;  5KFY A;  4Q8F A;  3HP6 A;  5AM0 A;  4TUP A;  4IR1 A;  3WU2 U;  1JX4 A;  1COK A;  3B0X A;  2RQ5 A;  2DUY A;  3GV5 B;  4ELV A;  1Q8K A;  3QU4 A;  2RRD A;  7ICT A;  2ZIV A;  2F44 A;  5AIC A;  5J8Y C;  5ALI A;  5DG9 A;  5CJ7 A;  4UB4 A;  4O5C A;  1N5W A;  2JEG A;  4NLC A;  4DF4 A;  8ICK A;  2E8P A;  4QWC A;  4J9O A;  2LM4 A;  1U49 A;  1NKE A;  3JPT A;  4RQ8 A;  1BGX T;  3DV9 A;  2JR5 A;  3M6K A;  9ICR A;  4PZN A;  4EEN A;  2QLT A;  1ZQC A;  4KLL A;  2AQ0 A;  1NNL A;  4DFD A;  2FI1 A;  3D2N A;  3JPQ A;  4PH5 A;  5J8Y A;  5DB9 A;  1KTQ A;  3PX4 A;  2P6U A;  3KHH A;  4C8L A;  8ICQ A;  1T3Q A;  2HHW A;  2WB1 F;  4FZN A;  1BPX A;  3EW9 A;  1KQQ A;  2W11 A;  3HKZ C;  4J9R A;  3C1Z A;  1L3S A;  3IN5 A;  4FS2 A;  4RT3 A;  2UVR A;  2I1Q A;  2ZIV B;  3U26 A;  2RDJ A;  2HOQ A;  9ICW A;  9ICT A;  1N5X A;  2CRX A;  9ICK A;  4QW8 A;  4GC6 A;  4NM2 A;  2F1H A;  1ECW A;  5ALN A;  2XY7 A;  1NZB A;  2FJ6 A;  3V6H A;  4ED3 A;  2BDU A;  2JH1 A;  7ICG A;  3SMV A;  3PZP A;  2H3Q A;  3K1R B;  5KFI A;  1H38 A;  4MF8 A;  3M7D A;  2JHD A;  2HHX A;  5KG7 A;  3HT3 A;  1XSL A;  5JUM A;  2KN7 A;  2MU2 A;  1CRX A;  4YR2 A;  3TAD A;  1N56 A;  1RQN A;  5EOZ A;  2AGO A;  2BR0 A;  3SZ2 A;  3S6J A;  4ZH4 A;  2W03 A;  2K8A A;  4JV0 A;  3UQ2 A;  8ICY A;  2NRX A;  2VAN A;  2LPE A;  5EWE A;  3WK6 A;  2F76 X;  8ICX A;  4F92 B;  1CEZ A;  1S9F A;  3LYS A;  3V6K A;  3ZI4 A;  4ECT A;  7ICN A;  4J9L A;  4UB8 U;  4NJ8 A;  3KHG A;  1ZQQ A;  1XO1 A;  5CWR A;  2XCA A;  5AKZ A;  1HUO A;  4UB1 A;  1P7D A;  1SL0 A;  1UHU A;  4PGY A;  3MFH A;  3PW5 A;  3RJF A;  2JXJ A;  1WG8 A;  3OPX A;  2ZIW A;  3I76 A;  4IQV A;  2ISO A;  1VJ5 A;  9ICH A;  1K5O A;  1N61 A;  3NVV A;  2ZIU B;  5J0Q A;  2ES6 A;  4F5P A;  1DRG A;  4RZR A;  3PX6 A;  3HKZ F;  1ZQS A;  4RUC A;  3TAN A;  1V97 A;  5J2G A;  4F3O A;  2AJQ A;  3ORY A;  1X9M A;  4ECX A;  5GTH U;  3CP8 A;  3PSP A;  4B9T A;  1M6Y A;  4IRK A;  4RUA A;  1L7M A;  2EDU A;  3RB3 A;  3PML A;  3PX0 A;  4GC7 A;  1X9W A;  3QU2 A;  5AKH A;  2VA2 A;  4ECQ A;  3MR2 A;  2W9B A;  1RDF A;  1S0V A;  2V9W A;  1NK8 A;  3SV3 A;  3QUC A;  2PFN A;  4J9Q A;  1OXJ A;  4C8O A;  4QNL A;  5HHI A;  2BCU A;  4ECU A;  1T7P A;  3PST A;  2F8K A;  4B9M A;  4IQT A;  9ICI A;  5HHH A;  4DQI A;  2HI0 A;  3CYM A;  3CRX A;  2K8B B;  3A0B U;  5J0O A;  3H40 A;  2VA3 A;  4QZF A;  5ALG A;  3WK4 A;  3T5L A;  2ZIW B;  3QU7 A;  3C1Y A;  4ELU A;  2F77 X;  4FS1 A;  3RFA A;  1X6J A;  4LJX A;  4DSE A;  2CPR A;  1Q46 A;  4ACO A;  5L1J A;  1ZQI A;  3SR6 A;  2ZUC A;  3LVW A;  3KKA C;  5C5J A;  3G6X A;  2M0N A;  5TIS U;  2ZXH A;  2M9N A;  4C0Z A;  5J2B A;  1XO0 A;  5KFS A;  2YY6 A;  4DSF A;  4B9N A;  7ICO A;  4PHP A;  2KVS A;  1PK3 A;  3KBB A;  1KRP A;  5FP0 A;  5J2J A;  4M6W A;  3HWT A;  9ICJ A;  3JPR A;  4NLZ A;  4LVS A;  3B9J A;  4BDP A;  2XGQ A;  2MUT B;  2KFN A;  3CW2 C;  2VJ5 A;  2QB1 A;  2BQR A;  4ECW A;  3PW2 A;  3AMZ A;  2AH5 A;  3MFI A;  5J0R A;  2YMQ A;  3IP4 B;  5BPC A;  3RJG A;  3HX0 A;  1NKB A;  4KLO A;  1N62 A;  4F5Q A;  3NGD A;  3QUQ A;  3SAH A;  3SAG A;  1ZET A;  4US9 A;  4C8K A;  2QKQ A;  3KTQ A;  2A19 A;  2HBJ A;  4CE6 A;  1L3V A;  1ZQB A;  2IHM A;  1SL2 A;  3LWL A;  1J97 A;  2VKQ A;  3QZ7 A;  5ALR A;  4XUS A;  3RAQ A;  2C22 A;  3MDA A;  4KN7 A;  4I2A A;  3V7L A;  2ALZ A;  2Y9U A;  3MAB A;  5KFZ A;  1BPY A;  5J2H A;  4ED2 A;  2JEF A;  4KLI A;  2EAN A;  1NK5 A;  4M6W B;  4YXJ A;  3Q8R B;  3T5H A;  3V6J A;  3FDS A;  2HOF A;  5JRT A;  4MFF A;  1L8O A;  7ICV A;  5AK4 A;  4DQQ A;  2I6X A;  3KFU F;  4EX7 A;  2NO4 A;  2WF8 A;  4QZB A;  4MEX A;  8ICZ A;  5CA7 A;  3Q8M A;  4RQ3 A;  3N97 B;  5ALY A;  5HMM A;  5DBB A;  1D8B A;  5L1M A;  4RQM A;  1QSY A;  1ZD4 A;  1TK5 A;  4JV2 A;  5IIK A;  3TAP A;  2FPK A;  5DB8 A;  2HSZ A;  2HOI A;  1ZRN A;  4HAI A;  2Y0S C;  4PHE A;  1U48 A;  2RLT A;  4C80 A;  3H4B A;  4FE3 A;  4K4H A;  2W7P A;  5J0T A;  4RQ0 A;  9ICL A;  3F2D A;  2RDI A;  4QW9 A;  5DQH A;  1RPL A;  2QAR A;  2WF7 A;  5EE0 A;  4Y2R A;  2FLP A;  2W04 A;  1SKS A;  3GIK A;  3RH5 A;  2BPC A;  4R66 A;  5ALD A;  4IC9 A;  5J2A A;  4O5E A;  2P35 A;  5DB7 A;  9ICE A;  2JEJ A;  3C21 A;  2W9M A;  3H0M B;  4I2I A;  3K1Z A;  4JWM A;  4GXJ A;  5IIJ A;  2G0A A;  4BX9 C;  3KOO A;  5KFD A;  3JPN A;  3HJE A;  3QUB A;  1S97 A;  5AIA A;  4YMN A;  4EX6 A;  2N1R A;  4F50 A;  2H3V A;  1PK1 A;  1Z4N A;  2ASJ A;  5JU5 A;  5DG8 A;  9ICX A;  2HW3 A;  3H8W A;  1MQ3 A;  4PHD A;  2UVW A;  2EAM A;  2LI6 A;  4RQ6 A;  4CCH A;  2R18 A;  1FFV A;  1MSW D;  4IS7 A;  5KFO A;  2G07 A;  1LB2 B;  4O5K A;  4IQW A;  2QAR B;  2EAO A;  7ICL A;  4UAW A;  2K60 A;  2HHV A;  3GV8 B;  1KBU A;  3GIL A;  1T94 A;  4KMU A;  2V4R A;  3T79 A;  2GH1 A;  8ICN A;  1QH9 A;  5TZV A;  3OSN A;  1TV9 A;  2RHF A;  4C7Z A;  5ALS A;  4F71 A;  3D6J A;  3F2C A;  2QB0 A;  1ZQD A;  4DFM A;  4JB3 A;  2DL0 A;  3AEV A;  4EEL A;  3PV8 A;  3THV A;  2KMD A;  1IM4 A;  1TE2 A;  3QEA Z;  2HHU A;  4DFJ A;  3K75 D;  5A0L A;  3TQ1 A;  4KLS A;  2Y0S F;  1PK1 B;  1SWW A;  3WK5 A;  2HBL A;  3BQ0 A;  9ICG A;  5KL1 B;  1VLB A;  4YFK A;  2DKX A;  8ICS A;  2C2D A;  1ZD5 A;  1ZQY A;  4QZG A;  5KFG A;  1ZD2 P;  5ALF A;  4JWN A;  4BJQ A;  4I28 A;  4C8M A;  1BNO A;  4NLN A;  1ZJM A;  8ICE A;  1ZQT A;  3MR5 A;  4ECZ A;  5K4L A;  2IOF A;  3BJY A;  4M9G A;  5HML A;  2KTQ A;  4CDG A;  4OJ5 A;  5KFN A;  1N60 A;  5J0W A;  4I2E A;  4LZG A;  3QXG A;  4DL2 A;  5ALL A;  4C4R A;  4UBC A;  5ALW A;  2AXT U;  1ZQA A;  2W9C A;  3MGH A;  3BZC A;  2K89 A;  4F5O A;  2HHT A;  5ALU A;  5AK3 A;  5L1I A;  5KFB A;  4CF3 A;  3BQ1 A;  3Q8P B;  2K8C B;  1JRO A;  4YQW A;  3TFR A;  4UB5 A;  2DWQ A;  4C8N A;  2FMQ A;  2KSO A;  5D46 A;  3G6Y A;  2Q0Z X;  4Y2T A;  2PMZ C;  3ZDB A;  4YR0 A;  1RG6 A;  3FYH A;  4PGQ A;  4DL4 A;  5KT2 A;  2XCP A;  3L5K A;  1BPD A;  3PNC A;  2DPJ A;  3VC8 A;  2IHN A;  2KNJ A;  4KN4 A;  1RXW A;  5HR7 A;  2LMR A;  4ED6 A;  3OJU A;  4PZO A;  1TAQ A;  2B21 A;  1RYR A;  5ALT A;  3NRW A;  1QQ7 A;  1XC9 A;  2ASL A;  4B9U A;  1UQV A;  4OJO A;  2W9C B;  4G9B A;  5HR6 A;  4Z6F A;  1N48 A;  3ICX A;  3RJJ A;  1DGJ A;  5ALZ A;  2XO7 A;  1L3T A;  1SWV A;  4YMM A;  8ICP A;  2ZUD A;  1B22 A;  3EZ5 A;  2B0C A;  8ICM A;  4DL7 A;  5CR0 A;  4J9N A;  3PO4 A;  4P0P B;  1Q3U A;  2OHF A;  2KSO B;  3H8M A;  3IHQ B;  4I27 A;  4Y2J A;  5KL8 B;  4B9V A;  4CF4 A;  1NJX A;  1SXD A;  2FMP A;  4QZ8 A;  2GOL A;  4RT2 A;  3RF9 A;  5EE3 A;  2HVI A;  5KFT A;  1XSN A;  1ZQV A;  3ZDC A;  1L8L A;  1L7O A;  1LKY B;  4RNN A;  3H7I A;  4O3P A;  1ZOL A;  3EUB 2;  2ZJA A;  4UAS A;  3PSF A;  5KT5 A;  3NUQ A;  5J2I A;  3F53 A;  2ZIU A;  5III A;  3TI0 A;  2D6F C;  7ICU A;  4QZD A;  2XI9 A;  3H0L B;  4C4S A;  1RZT A;  2RP5 A;  5BOM A;  5F9N A;  3ISC A;  4WJ3 B;  2C28 A;  3UXN A;  1IIP A;  3WKB A;  4XA5 A;  1ZQR A;  3QU9 A;  3MBY A;  1ZQW A;  1ZYQ A;  2HHS A;  5KFJ A;  2JGA A;  4IRD A;  2ZUB A;  5ALH A;  5KAF U;  7ICE A;  4EEK A;  2YTU A;  4C7Y A;  3ETL A;  2FPM A;  2YML A;  3UM9 A;  4MFA A;  5J29 A;  2AQ4 A;  3EWA A;  2DKZ A;  1SIJ A;  5ALQ A;  2BKE A;  1DOQ A;  1WYG A;  5J0U A;  1XU4 A;  1ZQ1 C;  1TAM A;  1OW5 A;  4DFP A;  1XSP A;  4DSL A;  4Q8E A;  1URJ A;  1SKR A;  1ZQU A;  3NRZ A;  4DSI A;  3LWM A;  2KIV A;  4DLG A;  2EH9 A;  4QWE A;  2AGQ A;  2WF5 A;  4YVZ A;  1ZQJ A;  5DB6 A;  2XVT A;  5KFK A;  8ICF A;  2LHT A;  1V38 A;  5L1L A;  4QWD A;  2DBY A;  4RQ2 A;  4ELT A;  3QEB Z;  2KD1 A;  3ZD9 A;  2WAQ C;  2VA8 A;  3GDX A;  9ICP A;  3PW4 A;  1Z4O A;  1KN5 A;  3N4M B;  3JPO A;  5D4B A;  4JUZ A;  4RNM A;  5KFC A;  1CUK A;  5KG0 A;  2R8I A;  4DS5 A;  3E2E A;  1MC8 A;  2Y9T A;  4UAV A;  1RXV A;  5AKG A;  3BQ2 A;  1JRP A;  1DK3 A;  1D8Y A;  5KT7 A;  2NV3 A;  4BGD A;  4KLE A;  2MUT A;  1O03 A;  2BQU A;  4Y2U A;  4UBB A;  2F1I A;  4YG2 A;  9ICQ A;  5KFA A;  5J0Y A;  1UT8 A;  2K4P A;  2KHQ A;  2G5H B;  1KKX A;  1HIW A;  2K4E A;  1TVA A;  3Q8Q B;  1IXR A;  2C2E A;  4BXO B;  4YR3 A;  4ECR A;  4E0D A;  1J2M A;  2KIW A;  8ICV A;  5KT3 A;  3F5E A;  1D9F A;  4RPX A;  2WF6 A;  2G08 A;  4R64 A;  1WWU A;  4DOB A;  1KFD A;  2DQN B;  2KOB A;  4QZH A;  1S77 D;  2Y1J A;  1IV8 A;  4F8R A;  5AM5 A;  4YD2 A;  4TUQ A;  4KLU A;  2F2A B;  4DLE A;  5KG5 A;  2HBK A;  3AN1 A;  2J6T A; 
#chains in the Genus database with same CATH homology
 1SGG A;  1B0X A;  1OXJ A;  2QKQ A;  1COK A;  1DXS A;  3TAD A;  3KKA A;  2F3N A;  2KSO B;  3H8M A;  2F8K A;  3HIL A;  2FE9 A;  1V38 A;  2EAP A;  1SXD A;  1PK1 A;  2F44 A;  5J8Y C;  2Y9U A;  3BS5 B;  5JU5 A;  2KE7 A;  2EAN A;  2EAM A;  1SXE A;  2LPE A;  1LKY B;  2E8P A;  1SV0 C;  1V85 A;  1KW4 A;  5JRT A;  4IS7 A;  4NL9 C;  2Y9T A;  2QAR B;  3BQ7 A;  2EAO A;  2GLE A;  2K60 A;  3IDW A;  3TAC B;  4PZN A;  4NJ8 A;  3TAD C;  3KKA C;  2D8C A;  2KSO A;  1X9X A;  1F0M A;  5J8Y A;  2L5Y A;  1WWV A;  3SEI A;  2QB0 A;  4RQN A;  2E8M A;  4RQM A;  5L1M A;  1RG6 A;  1PK3 A;  2DL0 A;  1JI7 A;  2K4P A;  2E8N A;  1SV0 A;  2ESE A;  2KMD A;  2YTU A;  5KNI A;  2ES6 A;  2B6G A;  2LMR A;  1PK1 B;  4PZO A;  2QAR A;  1X66 A;  2DKZ A;  2QB1 A;  5JTI A;  1X40 A;  2KG5 A;  1UCV A;  3BS7 A;  3SEN A;  2D3D A;  1B4F A;  1SV4 A;  2JV3 A;  2DKX A;  3BS5 A;  1Z1V A;  1OW5 A;  1UQV A;  2E8O A;  2QB0 B;  1WWU A;  4MHV A;  4NL9 A;  3K1R B;  1LKY A;  2KIV A;  5F3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...