4PZOA

Crystal structure of phc3 sam l967r
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKRGPALKIARINSLKESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 3
total genus 20
structure length 70
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pzoA00
2E8PA 5JRTA 1DXSA 2DKZA 2QB0B 5J8YA 1B4FA 3BS5A 3KKAA 2EAOA 2KMDA 1SV0C 2DKXA 1KW4A 3SENA 2D8CA 3K1RB 1B0XA 4MHVA 5KNIA 1PK1B 3TADA 1V38A 3BS5B 2QB1A 1PK3A 2EAPA 2K60A 2Y9TA 2KSOB 4RQNA 2Y9UA 3TACB 1COKA 2QARB 1SGGA 1PK1A 4NL9C 4PZNA 1OW5A 4NJ8A 3BS7A 4RQMA 5JTIA 1UQVA 2ESEA 3HILA 2L5YA 1WWUA 2KE7A 1OXJA 2QB0A 1V85A 2DL0A 1X40A 2E8OA 1SXEA 2E8MA 1RG6A 1SV0A 2F8KA 1F0MA 3H8MA 2KSOA 1SV4A 2FE9A 5F3XB 2K4PA 1WWVA 2EANA 1Z1VA 1X9XA 2E8NA 3IDWA 1LKYB 3BQ7A 1SXDA 2EAMA 4IS7A 2LPEA 1LKYA 2F44A 3SEIA 2JV3A 2B6GA 5JU5A 5J8YC 2D3DA 2GLEA 2QARA 3KKAC 1X66A 2QKQA 4PZOA 4NL9A 2KG5A 2YTUA 2ES6A 1JI7A 2LMRA 5L1MA 2KIVA 2F3NA 1UCVA 3TADC
chains in the Genus database with same CATH superfamily
1TAUA 1KBUA 4J9KA 4GXJA 1VLBA 2AJQA 2BPCA 2KJ5A 5J8YA 4M47A 1FIQA 2JMGA 1X9SA 4IRDA 5DG7A 5KT4A 5AM5A 2W9AA 4O5CA 4DFMA 2NO4A 4PGQA 5KNIA 4QWEA 1ZQHA 1HJPA 4J9QA 4LVSA 1ZRMA 1CUKA 1NJYA 4F4XA 4GXKA 2OEHA 5AK3A 2H5XA 3LDAA 4EBEA 3LK9A 4P0QB 4DSJA 7ICRA 4MEYA 1ZQFA 1D8YA 4UARA 2HI0A 3OSPA 3MC1A 2HHTA 4B9LA 2PXIA 3RAXA 5G5GA 4TURA 3KZXA 3DEEA 4IC9A 4UAYA 1SL2A 5CEHA 3D2NA 2VA8A 2DBYA 3B0XA 1X6JA 3ETRA 4K4GA 1ZQLA 4Z6DA 2E8NA 3AN1A 3BQ2A 2RP5A 3PMLA 3DV9A 2ALZA 4DFDA 2LHTA 2F1HA 3PV8A 1O03A 5EE9A 1NOMA 3WKEA 2V4RA 2W04A 5DB7A 5J2CA 3N28A 5J8YC 1QLNA 4IL6U 2G09A 5J29A 2GLEA 2QKQA 5IIJA 3M8RA 4DOAA 5KFMA 2IHNA 5DGBA 4K4HA 4CF5A 4NWIA 8ICHA 1JI7A 4QZAA 2LM1A 2VIXA 2FLPA 3Q8QB 5ALQA 4LJXA 2XVTA 4EX6A 4ECXA 3HJEA 4J9SA 4K4IA 2DWQA 4UAVA 4KITB 1TE2A 8ICVA 1NK0A 1QSSA 4P4PA 2W7OA 2A1JB 4Y2SA 1PVQA 1RYRA 1QTMA 4GFJA 4KN7A 5AK5A 3BDPA 4DL3A 1KLNA 1Z4OA 2OM6A 4MEXA 4CF3A 1Z3EB 4M9LA 3C1ZA 2Y9UA 1KL9A 3MFIA 4DSLA 1X42A 3RJEA 4I29A 4FO6A 3RH6A 4BJQA 2HHUA 5DB9A 2ZIVB 2QB0A 4O5EA 2E8MA 2WFAA 1S5LU 4J9LA 2EZYA 1F0MA 2WF5A 1RYUA 3FYHA 4TUQA 2W54A 3RJKA 1WWVA 4UB6U 3IRUA 1CRXA 2ZJ5A 1TK5A 3BQ7A 1NJWA 3E2EA 3MR3A 9ICUA 4PHPA 2ASLA 4US8A 2KN7A 2UVUA 2BCVA 9ICRA 1ZQXA 3FC4A 4UBCA 2JEFA 1ZJNA 2WF6A 5AI5A 3L3FX 2KIVA 4IQUA 3DDHA 2XI9A 4RT2A 2ODGA 1S8OA 3K75D 3GV5B 4FZNA 8ICBA 3RB3A 5KTQA 1RPLA 3H0RB 5ALMA 1XU4A 2KZMA 4KX3A 3RR8A 5KFDA 4RNMA 5ALJA 2AXTU 4I2IA 2WTFA 5AKYA 5D4BA 1C7YA 4OO1J 3KBBA 2EAPA 4B9UA 4A8EA 3HRDD 5CB1A 2KKVA 5KFNA 1L7MA 2XCAA 4CRXA 2N1RA 5J0QA 3G6YA 3IG8A 4F3OA 2ZTEA 3TACB 2BPGA 3IN5A 4RNNA 3BQ1A 4YP3A 1L3UA 5J2DA 3TAQA 2ESEA 3KHGA 5KFYA 7ICUA 5AKLA 3D6JA 4RUAA 1V85A 2R8HA 1L7OA 2ZJAA 3TKAA 1U45A 1NZPA 3N7SC 3MDCA 1JRPA 5IILA 1UA0A 2HBKA 3PW2A 4DQIA 2KD1A 2BQRA 1S0MA 4ECQA 3ISBA 5DGAA 4B6JA 4NLZA 3HT3A 3EZ5A 5KFCA 3QE9Y 3V7LA 4EBCA 3T5KA 3L5KA 4QJFB 2B6GA 4UBBA 3I1YA 2M0NA 1FFUA 3UXOA 4F5OA 1Q3UA 2I5HA 1AQ6A 1ZQBA 4KLTA 7ICNA 4TUPA 3NUQA 4QWBA 1IV8A 4DO9A 2PMZC 1BPYA 2E8PA 4NM1A 3KHRA 1WCNA 1ZQMA 4O5KA 5DB6A 2QB0B 2KK0A 5JUMA 3OHAA 3PW5A 2KMDA 1DRGA 3F2CA 3PW4A 4QZHA 8ICUA 3AQFA 5DDMA 4F72A 3NASA 3PO4A 2H3IA 3I28A 5HHHA 1N61A 5AI4A 1SKSA 4P0QA 5KFRA 7ICMA 1NK4A 3TI0A 3M8SA 5C0YA 2CPRA 5KFWA 2F77X 2HDOA 1SGGA 1SWWA 3J81j 4I28A 5AKGA 2XICA 4Y2PA 5KFFA 1YT3A 4DWIA 3NRZA 7ICFA 2JRZA 4RQ5A 2R8IA 1RM6C 3C28A 2K4IA 2YY6A 4F5QA 3KOOA 2BDUA 3SV4A 3QU2A 2GWSA 4C8OA 1IIPA 2ZIXB 2G08A 1T8EA 4Y2TA 1ZQTA 3MBYA 1B43A 1QH9A 2W11A 5ALEA 4X5VA 3MFHA 4CGZA 5CA7A 1X9MA 4Q8FA 2KHVA 4F2RA 2OXOA 3QX7A 1VJ5A 1KFDA 8ICRA 3F2BA 4HAIA 1LB2B 3RBDA 1EXNA 3NVVA 4M9GA 4C8LA 4M04A 5TISU 1ZQEA 2JR5A 2ISOA 4ECUA 5IIMA 7ICGA 1NJZA 1TVAA 8ICFA 2V9WA 3RH5A 3AMZA 3LWMA 2HHVA 3MR5A 2BDPA 4RQ6A 9ICVA 3PR4A 5KL8B 1ZQWA 5DQHA 2ZUDA 2GO7A 4P4OA 3FAHA 5ALUA 1RDFA 3UMGA 4J9NA 3RJGA 3H0LB 2A1JA 5EWGA 1KW4A 9ICEA 4Y2JA 5KFKA 2JH1A 5G5HA 3OHBA 4OJPA 5ALXA 3SAGA 3HKZC 2OH2A 3QZ8A 3SMVA 4CDGA 5J2BA 1V38A 4UATA 5ALHA 4RQ8A 5KT5A 2LYAA 4DQQA 2KZ3A 3ZD9A 4UASA 1BGXT 4RPYA 3V6JA 4RQNA 2EQYA 5AKXA 2J6TA 4B9TA 4MF8A 1J97A 4QW8A 2VA2A 2NRZA 3S6JA 2PFOA 5ALGA 3RBEA 4BXOA 4AP9A 1ZD3A 4UB8U 1UQVA 3PVXA 4QZ8A 1WG8A 3ORYA 3IV6A 4UW9A 3WKAA 3PW0A 4BWJA 4YQWA 5KFSA 2ZIUB 5GTHU 1D9FA 4JWMA 4USAA 3ICXA 1T3NA 5DB8A 5GTIU 5IIIA 3OJUA 4KLDA 1LKYB 3QXGA 4Q43A 5TZVA 2EAMA 2FLNA 1LKYA 4QZIA 4C7YA 2F44A 5AKIA 2W9BB 3B0YA 5B66U 1N48A 8ICJA 3WK7A 4F4ZA 4QZCA 2KHQA 2QARA 1UHUA 1N62A 4B9VA 1ZQVA 3JPRA 1ZQQA 3WKDA 4EX7A 2F2AB 3F2DA 1S0VA 1N2XA 4YXJA 3ZD8A 2KVSA 4OJ5A 1F44A 4E0DA 1JROA 3MABA 1NJXA 5A0LA 1KSPA 1B4FA 2QLTA 5AIAA 9ICKA 2F76X 4IRCA 3TAPA 1SV0C 4ZH4A 2KICA 3C21A 2ZJ8A 2OCEA 3JPSA 4ECSA 4JUZA 4QZBA 3E58A 4F5RA 1Q3VA 4O3MA 5EOZA 1ZQAA 3JPOA 3OPXA 4GC7A 2I6XA 3K4GA 1S77D 3RRGA 4XA5A 1WCLA 2OWOA 1L3VA 5HP4A 1JUDA 2LI6A 2P35A 1KKXA 4BUGA 5CHGA 5AICA 5EWFA 4QZFA 3GQCA 3RJJA 2KFNA 4QWDA 1NK7A 1ZXIA 5J2AA 1SZPA 8ICAA 2W8KA 2VANA 2E8OA 4KLGA 7ICIA 1NNLA 1K1QA 5ALTA 3AEVA 3JPPA 5DLFA 4DL6A 5DBAA 2DUYA 4GIBA 2FE9A 3HWTA 3MR6A 4KN4A 5EWEA 9ICWA 4DL4A 4RQ2A 1FO4A 1KFSA 3RJHA 1A77A 3M7DA 5KG2A 4I2CA 1JIHA 2K4HA 5L1LA 4DQSA 4ECZA 2WHEA 1JX4A 4ED3A 3LYSA 4JB3A 2DFLA 1ZQZA 2YTUA 3UQ2A 1XO0A 7ICOA 2ES6A 2F3NA 3JPNA 1KEJA 4TUSA 2UVRA 2FLLA 1DXSA 2FJ6A 4KLUA 3RF9A 4RQ1A 3KKAA 5KL1B 5J2FA 2EAOA 4PL2A 3GIIA 2NRVA 2DKXA 1RQLA 2B21A 3QYPA 2ASDA 1B0XA 2JHDA 3B9JA 4RQ0A 1RXVA 1PK1B 3TADA 9ICHA 2FPKA 4DOBA 3TARA 2I1QA 1PK3A 2NRTA 5CP2A 2I9GA 3RTVA 5KFGA 2B0CA 3RJFA 3CW2C 1ZQGA 5HR7A 1BPXA 3QU5A 1N63A 1IXRA 3F5EA 2W8LA 1PVRA 1V97A 1X40A 2W3RA 2AU0A 1NZBA 3H4DA 5HNKA 1S0OA 2K89A 4I2AA 2JEGA 1CEZA 2KSOA 1L3SA 5AI6A 7ICQA 2P6RA 5KFZA 2AGPA 4M6WA 3H4BA 2HMXA 4JMUA 4EEKA 1TAQA 3HW8A 4YFKA 1SIJA 4CF4A 1BNOA 3HX0A 5L1IA 4ECTA 4IS7A 4P0PA 2HCFA 4Q45A 2LM4A 1S0NA 4C8MA 2D3DA 9ICSA 2XGQA 3H0MB 3RFAA 4M9JA 1KQQA 1L7PA 5HR6A 4F4YA 4KLMA 9ICFA 2M9NA 4LZDA 5CJ7A 1UPHA 1N56A 8ICGA 3BQTA 2PKEA 3PX0A 5CR0A 1Z4NA 4BDPA 4O3OA 8ICZA 4I2GA 1ZYQA 3K1RB 4FZMA 2WF7A 4IRKA 3ED5A 1ZJMA 2E3TA 1ZETA 1ZQOA 4RQ3A 5H2FU 3GIJA 2K8CB 3GU3A 2KSOB 5EE3A 1U9LA 3I76A 1QQ5A 8ICWA 4ED8A 1URJA 4PH5A 2BCRA 5AIBA 3NVWA 3WKCA 1ZOLA 2OHFA 4PZNA 3T3FA 3BQ0A 4XQ8A 2NYVA 3QUCA 1N60A 4NV0A 2CRXA 1RZTA 2DGZA 2KE7A 5KT3A 1XSPA 5KG1A 1SV0A 4Z6CA 2DF4B 2IBKA 4DQPA 2K4PA 1ZQYA 1J2NA 2C22A 1ZQDA 2F1JA 1X2IA 4B9NA 5KFQA 1KRPA 2D6FC 3FDSA 4ED2A 3VCBA 3NGDA 5KG5A 3SI8A 4R64A 5E79U 2WF8A 4IQWA 4ZOHC 4QZ9A 3MGVA 4EENA 1L8LA 1MQ3A 1UA1A 4RT3A 2HBMA 4NL9A 5DBBA 3A0BU 3QUTA 2F8LA 2C28A 2HOIA 5KFPA 2Y1IA 4EEYA 2FPLA 3ISDA 3PX4A 3HKZF 1ZQNA 5JRTA 1B22A 3ZDEA 4FS1A 3NS1A 8ICIA 3QEAZ 3D2QA 3NTUA 2RRDA 4QNLA 5DQIA 3RB4A 3JPQA 3OGUA 3WK5A 3BJYA 2IOFK 1DGJA 1RQNA 4BXOB 3EUB2 3QEBZ 2BGWA 3EWAA 2DQNB 3VC8A 5DG9A 3EPGA 1OUQA 4FBUA 4DS5A 2WF9A 4JWNA 4RU9A 4IQVA 2XCPA 2Y9TA 5KFAA 4C4TA 1XNSA 2LBOA 4KTQA 1N5WA 4DLGA 1JALA 4P4MA 2Y0SF 3PR5B 2VA3A 3AQEA 2BHNA 1T7PA 3WK4A 4I2FA 3IP4B 3SAFA 1XSLA 2JGAA 5ALOA 3LWLA 4F71A 2AGQA 1SXEA 1MA7A 2YMMA 4C0ZA 3HPOA 3GFKB 3UQ0A 5CRXA 1IG6A 3IHQB 5KT6A 2XIDA 1IM4A 3M6KA 4DL2A 3CYMA 5F3XB 1D8BA 1NI3A 1Z1VA 4Y2UA 2FMQA 4C4RA 5DQGA 4KLIA 2W9BA 5HMMA 4NLGA 3PNCA 3WK9A 1BNPA 3AU6A 4Y2YA 2XC9A 3RR7A 3SEIA 4DFKA 2KZZA 4EYHB 2MAXA 2IHMA 2G5IB 4DS4A 3C2LA 1L7NA 4DFJA 5ALYA 4DSKA 4UB5A 1YZ7A 4F93B 1JN3A 4UB3A 3A0HU 2LMRA 2XY7A 3T5HA 5AKKA 2NRXA 4JV1A 3RB6A 5KG7A 7ICKA 1RYSA 2DKZA 1PVPA 3V72A 4KX5A 1COOA 1Z00B 5J0XA 3PO5A 4F4KA 4QZGA 1MSWD 5KFLA 2YX8A 8ICLA 1QSLA 4MF2A 3SENA 3C5FA 1C20A 1BPEA 7ICSA 3N7RC 8ICTA 5C5JA 4F50A 2EH9A 2BR0A 3Q8PB 2VJ5A 2IA6A 5J0SA 3H8WA 1U49A 4YR2A 3MDAA 3V6HA 4UQGA 3KD3A 4OCZA 4UAZA 1OW5A 2KJ8A 4EBDA 4NJ8A 2BCSA 2IMWP 2XY5A 2G5HB 3HILA 1FFVA 4YMNA 4Q44A 4GLXA 3KHHA 4I27A 4AYBF 3NVZA 2UVWA 4M9HA 3C23A 1WUDA 5ALWA 5J0OA 3GZFA 5AI0A 3CP8A 2FMPA 1TK0A 3F53A 5KFEA 2AQ0A 3ZDAA 2Y0SC 4XUSA 3C2KA 5ALIA 5AM4A 2YQEA 4ED1A 4I2EA 2MRLA 4O3NA 1XC9A 4F8RA 2VKQA 3KKAC 2BCQA 5ALFA 4PZOA 4J9MA 2YMLA 2IOHA 2E1EA 4M0AA 2EZZA 2KFZA 3Q8SB 2K4EA 5L1MA 4PGYA 3QZ7A 2R8KA 1HUOA 5J0RA 3EPIA 3O0FA 1A76A 2CXYA 3Q8RB 1KFTA 1NK5A 4ECYA 5AM2A 3WK8A 3PZPA 2AGOA 4IR1A 4GC6A 2BQ3A 3PX6A 5HMLA 4CE6A 2J6SA 2GH1A 3ZDCA 3T79A 2ATLA 1NKBA 1A0PA 4MHVA 5J2KA 1AROP 3V7KA 3ZDBA 5KG3A 2ZTCA 4UB2A 2YMQA 2HHSA 1SKRA 5BOLA 5F9LA 2PI5A 3RAQA 4I2JA 3N4MB 3GIKA 1TAMA 2KTQA 2ZUCA 4EYIB 2Z7JA 1T94A 3NRWA 5JTIA 7ICJA 1MQ2A 1SZHA 8ICXA 2F1IA 2XO7A 4O3PA 4U7CA 2HOQA 4TQRA 4DLEA 3LVWA 7ICEA 5KFVA 9ICGA 1RG6A 4DEZA 5BOMA 4QWCA 4Z6EA 2RDJA 2ZXHA 2XY6A 3PMNA 1BVSA 2RQ5A 1SWVA 4Y2XA 3WKBA 4R63A 4R66A 3PSFA 1UT5A 1ZD5A 4ECWA 4KLHA 1L5UA 7ICHA 5KFIA 2WB1F 4DSIA 5J0UA 4RPXA 2KIWA 2G07A 3RRHA 2KKPA 4Y2RA 2ZG6A 1Z1BA 5IIOA 4CNQA 3H7IA 3MR2A 4YCXA 2H3QA 4DOCA 4J9RA 3OTQA 2EDUA 4KLQA 2O6KA 2JXJA 3H40A 4AYBC 2KG5A 2V4QA 4QZEA 1GO3F 5ALZA 2FI1A 2HBLA 3RH4A 2HHQA 2ZIWB 1DOQA 4UB1A 8ICQA 3UPQA 1A6SA 4BWMA 4YD2A 2ZIWA 2AH5A 5IIKA 3C5GA 4QWAA 3BS5A 1HUZA 4PHDA 3BZCA 3AL0B 2LYHA 2D8CA 3OSNA 2G06A 4BX9C 2ZIUA 1ZQIA 3MGHA 1O08A 2QB1A 2OYYA 5J2GA 4F5NA 4F4WA 8ICEA 4KLLA 1L3TA 1NKEA 3IG5A 2P6UA 2VJ4A 1ED1A 2HHWA 1XSNA 7ICLA 3KTQA 1BPDA 2QARB 4PPXA 4DFPA 5ALVA 1Y88A 4R8UA 3BS7A 4ACOA 4RQMA 5EE1A 1WWUA 2BKEA 1ZRNA 5KT2A 1SKWA 1XS9D 1ZQRA 1SL1A 2FDRA 4ED0A 9ICIA 4FBTA 1T4GA 5IINA 1SL0A 4JV2A 3GIMA 2NRWA 1Q46A 5J0TA 1ECWA 4DL5A 1JXLA 3KFUF 2JV3A 3N7PD 3SD7A 3C29A 3KHLA 4MFCA 3SAHA 5ALKA 2R8JA 2HW3A 5AKZA 1V9PA 4NXZA 4B9SA 1UCVA 2W03A 4R65A 3G6VA 4GXIA 3WU2U 1FEZA 1Z00A 5KFUA 4YR0A 4FS2A 3SV3A 1MN8A 4KMUA 4LZGA 4Y2VA 2Q0ZX 4ED6A 9ICLA 1QQ6A 3EYZA 1XWLA 8ICMA 9ICOA 4MFFA 4KLJA 8ICOA 4RZRA 4JV0A 4DCCA 1F5SA 2W3SA 4O0IA 2W9CA 3THVA 3MGIA 5D49A 4OJ6A 9ICBA 2RLTA 1T3QA 2HOFA 1PUZA 1HIWA 4NLNA 2MUTA 1QQ7A 3OJSA 8ICPA 5J2IA 3N97B 5B5EU 3UMBA 1ZQPA 1H38A 1OXJA 5J2EA 1S10A 4I2BA 3V6KA 1XO1A 4DQRA 4J03A 5ALLA 2AQ4A 4QW9A 3H8MA 3QNMA 2GOLA 2IOFA 3QU7A 4NM2A 1YZ6A 4YD1A 5DLGA 1X9XA 2W43A 5EE0A 3NVYA 2UVVA 3ONNA 4PJ0U 5DG8A 9ICCA 2LKYA 1BPBA 4O3QA 1U4BA 2WAQF 2C2EA 3E0FA 3UMCA 2Q4TA 5KFTA 2YB4A 5L1JA 3QUBA 1KTQA 2P66A 4F2SA 8ICCA 1NK9A 8ICNA 5AK4A 1ZQUA 2WAQC 3QU4A 3F5AA 2FMSA 2MU2A 1PZNA 1L6NA 2J6UA 1TKDA 2YMPA 4R8UB 3SZ2A 4O9MA 4US9A 4WJ3B 4ECVA 1JXEA 4NLCA 5L9XA 4O3SA 1Z19A 2JEIA 4YN4A 4RUCA 4PL1A 2HVHA 1D9DA 3RJIA 4KLFA 2R8GA 4C4SA 1VDVA 1N5XA 3UXPA 4IR9A 4I2DA 2JZBA 5AI8A 2RHFA 5AK6A 3V7JA 1LVHA 4ELUA 1NKCA 4RPZA 5L1KA 4FZLA 4ED7A 3H8SA 3Q8LA 9ICQA 4CCHA 4QIWC 3T5LA 2E1FA 3Q8MA 1S97A 4RNOA 1PK1A 9ICPA 4B9MA 4PGXA 5DDYA 2ISPA 3KZIU 1TFRA 3ZI4A 5AHXA 2W7PA 5CWRA 1NK8A 4P2HA 1UT8A 5AM0A 4RQ7A 4QIWF 2W9MA 3L4PA 2AHOB 5KFBA 3RB0A 1ZQCA 1ZQKA 2PFNA 5F9NA 2DPIA 7ICTA 5ALPA 5AI9A 5KAIU 4C8KA 2ZTDA 3EW9A 2KOBA 2PFPA 4FE3A 1X6IA 4YVZA 2K8AA 2JH7A 4EELA 2LPEA 2RDIA 5KAFU 5KFJA 5KG0A 2W9CB 4YMOA 4YR3A 2ASJA 3PW7A 3TANA 1CI4A 5JU5A 4P0PB 5ALNA 1SB3C 1ZQ1C 9ICXA 1QCKA 1ZQSA 1K5OA 3GDXA 5BPCA 4M6WB 4Y2QA 4NLBA 4C8NA 3AUOA 3GV7B 1BPZA 4G9BA 3C2MA 2ZIXA 3G6XA 2A1AA 2JZBB 4HYKA 2JEJA 3UM9A 3PSPA 1K1SA 3BZKA 4RQ4A 1J2MA 2LYBA 3IM1A 2E5SA 2G0AA 4ELTA 2EZXA 4C80A 5D46A 4UAWA 3BS5B 3JPTA 5KG6A 2ZUBA 2PI4A 4DSEA 4DF8A 3SYZA 3H8JA 2ZIVA 4DSFA 1Q8KA 3C1YA 4F5PA 1COKA 2BQUA 3ALRA 4JK1A 9ICAA 3M9MB 1RXWA 1MC8A 3GILA 2C2RA 4ELVA 4KLSA 1ZD2P 3CRXA 2R18A 2MA1A 4UAUA 2L5YA 4NLKA 1TV9A 3GV8B 5AKJA 2DL0A 1NK6A 2WB1C 4YXMA 3M9OB 2NO5A 1HEKA 1SV4A 3FM9A 2NV3A 1KDHA 4IQTA 3WK6A 3AM9A 3TFSA 3ETLA 5J2JA 2BPFA 3D2SA 2XGPA 4PHAA 1ZQJA 2H3FA 2CN1A 4KLOA 4TQSA 1QSYA 1ZD4A 4KMOB 5ALSA 4EZ6A 5KFHA 4MFAA 3M6ZA 5HHIA 5J0PA 4NY8A 4DL7A 8ICSA 2HHXA 2C2DA 3QU9A 1KN5A 4UB4A 3UXNA 4FFDA 5T14A 5J0YA 4Q8EA 3TQ1A 5ALDA 3M9NB 1D8LA 2W55A 1TK8A 5KFOA 3PSIA 2A19A 1S76D 5AM3A 1S9FA 3LVVA 1WYGA 3ISCA 3M1YA 3T5JA 2KNJA 4DF4A 7ICPA 2PMZF 1P7DA 5AM1A 2HVIA 4QZDA 4J9OA 4M9NA 3QUQA 5DBCA 5KG4A 2YB1A 4ECRA 4O3RA 1JMSA 2K60A 5DKWA 4J9PA 7ICVA 2MUTB 8ICYA 4M2YA 3AU2A 5KFXA 4OD0A 4EZ9A 9ICNA 3K1ZA 2H3VA 3Q8KA 2KP7A 3TFRA 4NL9C 4OJOA 4U6PA 1X9WA 9ICJA 1M6YA 9ICTA 4XRHA 2HSZA 2Y1JA 1DGSA 4F91B 3ZDDA 4KLEA 4C7ZA 2KEYA 2A3VA 2KVCA 8ICKA 2MSNA 4I2HA 2F8KA 4G3IA 5KT7A 3SQIA 4PHEA 2PFQA 2ZXIA 3PSTA 2EANA 2K8BB 1DK2A 5ALRA 1U47A 3IDWA 5FP0A 2HBJA 4F92B 1SXDA 3PY8A 1L8OA 3SR6A 1LV5A 3R9KA 2FPMA 2H3ZA 2YN4A 4YG2A 3HP6A 2KJ9A 2DPJA 4OJLA 5J2HA 1X66A 4BGDA 4YMMA 2BZFA 5J0WA 1DK3A 2BCUA 2KV2A 5AKHA 5AKEA 4Z6FA 3U26A 1U48A 5K4LA 4ICAA 3CNHA 3TADC 9ICMA
chains in the Genus database with same CATH topology
2E8PA 5JRTA 1DXSA 2DKZA 2QB0B 5J8YA 1B4FA 3BS5A 3KKAA 2EAOA 2KMDA 1SV0C 2DKXA 1KW4A 3SENA 2D8CA 3K1RB 1B0XA 4MHVA 5KNIA 1PK1B 3TADA 1V38A 3BS5B 2QB1A 1PK3A 2EAPA 2K60A 2Y9TA 2KSOB 4RQNA 2Y9UA 3TACB 1COKA 2QARB 1SGGA 1PK1A 4NL9C 4PZNA 1OW5A 4NJ8A 3BS7A 4RQMA 5JTIA 1UQVA 2ESEA 3HILA 2L5YA 1WWUA 2KE7A 1OXJA 2QB0A 1V85A 2DL0A 1X40A 2E8OA 1SXEA 2E8MA 1RG6A 1SV0A 2F8KA 1F0MA 3H8MA 2KSOA 1SV4A 2FE9A 5F3XB 2K4PA 1WWVA 2EANA 1Z1VA 1X9XA 2E8NA 3IDWA 1LKYB 3BQ7A 1SXDA 2EAMA 4IS7A 2LPEA 1LKYA 2F44A 3SEIA 2JV3A 2B6GA 5JU5A 5J8YC 2D3DA 2GLEA 2QARA 3KKAC 1X66A 2QKQA 4PZOA 4NL9A 2KG5A 2YTUA 2ES6A 1JI7A 2LMRA 5L1MA 2KIVA 2F3NA 1UCVA 3TADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  5JRT A;  1DXS A;  2DKZ A;  2QB0 B;  5J8Y A;  1B4F A;  3BS5 A;  3KKA A;  2EAO A;  2KMD A;  1SV0 C;  2DKX A;  1KW4 A;  3SEN A;  2D8C A;  3K1R B;  1B0X A;  4MHV A;  5KNI A;  1PK1 B;  3TAD A;  1V38 A;  3BS5 B;  2QB1 A;  1PK3 A;  2EAP A;  2K60 A;  2Y9T A;  2KSO B;  4RQN A;  2Y9U A;  3TAC B;  1COK A;  2QAR B;  1SGG A;  1PK1 A;  4NL9 C;  4PZN A;  1OW5 A;  4NJ8 A;  3BS7 A;  4RQM A;  5JTI A;  1UQV A;  2ESE A;  3HIL A;  2L5Y A;  1WWU A;  2KE7 A;  1OXJ A;  2QB0 A;  1V85 A;  2DL0 A;  1X40 A;  2E8O A;  1SXE A;  2E8M A;  1RG6 A;  1SV0 A;  2F8K A;  1F0M A;  3H8M A;  2KSO A;  1SV4 A;  2FE9 A;  5F3X B;  2K4P A;  1WWV A;  2EAN A;  1Z1V A;  1X9X A;  2E8N A;  3IDW A;  1LKY B;  3BQ7 A;  1SXD A;  2EAM A;  4IS7 A;  2LPE A;  1LKY A;  2F44 A;  3SEI A;  2JV3 A;  2B6G A;  5JU5 A;  5J8Y C;  2D3D A;  2GLE A;  2QAR A;  3KKA C;  1X66 A;  2QKQ A;  4PZO A;  4NL9 A;  2KG5 A;  2YTU A;  2ES6 A;  1JI7 A;  2LMR A;  5L1M A;  2KIV A;  2F3N A;  1UCV A;  3TAD C; 
#chains in the Genus database with same CATH topology
 1TAU A;  1KBU A;  4J9K A;  4GXJ A;  1VLB A;  2AJQ A;  2BPC A;  2KJ5 A;  5J8Y A;  4M47 A;  1FIQ A;  2JMG A;  1X9S A;  4IRD A;  5DG7 A;  5KT4 A;  5AM5 A;  2W9A A;  4O5C A;  4DFM A;  2NO4 A;  4PGQ A;  5KNI A;  4QWE A;  1ZQH A;  1HJP A;  4J9Q A;  4LVS A;  1ZRM A;  1CUK A;  1NJY A;  4F4X A;  4GXK A;  2OEH A;  5AK3 A;  2H5X A;  3LDA A;  4EBE A;  3LK9 A;  4P0Q B;  4DSJ A;  7ICR A;  4MEY A;  1ZQF A;  1D8Y A;  4UAR A;  2HI0 A;  3OSP A;  3MC1 A;  2HHT A;  4B9L A;  2PXI A;  3RAX A;  5G5G A;  4TUR A;  3KZX A;  3DEE A;  4IC9 A;  4UAY A;  1SL2 A;  5CEH A;  3D2N A;  2VA8 A;  2DBY A;  3B0X A;  1X6J A;  3ETR A;  4K4G A;  1ZQL A;  4Z6D A;  2E8N A;  3AN1 A;  3BQ2 A;  2RP5 A;  3PML A;  3DV9 A;  2ALZ A;  4DFD A;  2LHT A;  2F1H A;  3PV8 A;  1O03 A;  5EE9 A;  1NOM A;  3WKE A;  2V4R A;  2W04 A;  5DB7 A;  5J2C A;  3N28 A;  5J8Y C;  1QLN A;  4IL6 U;  2G09 A;  5J29 A;  2GLE A;  2QKQ A;  5IIJ A;  3M8R A;  4DOA A;  5KFM A;  2IHN A;  5DGB A;  4K4H A;  4CF5 A;  4NWI A;  8ICH A;  1JI7 A;  4QZA A;  2LM1 A;  2VIX A;  2FLP A;  3Q8Q B;  5ALQ A;  4LJX A;  2XVT A;  4EX6 A;  4ECX A;  3HJE A;  4J9S A;  4K4I A;  2DWQ A;  4UAV A;  4KIT B;  1TE2 A;  8ICV A;  1NK0 A;  1QSS A;  4P4P A;  2W7O A;  2A1J B;  4Y2S A;  1PVQ A;  1RYR A;  1QTM A;  4GFJ A;  4KN7 A;  5AK5 A;  3BDP A;  4DL3 A;  1KLN A;  1Z4O A;  2OM6 A;  4MEX A;  4CF3 A;  1Z3E B;  4M9L A;  3C1Z A;  2Y9U A;  1KL9 A;  3MFI A;  4DSL A;  1X42 A;  3RJE A;  4I29 A;  4FO6 A;  3RH6 A;  4BJQ A;  2HHU A;  5DB9 A;  2ZIV B;  2QB0 A;  4O5E A;  2E8M A;  2WFA A;  1S5L U;  4J9L A;  2EZY A;  1F0M A;  2WF5 A;  1RYU A;  3FYH A;  4TUQ A;  2W54 A;  3RJK A;  1WWV A;  4UB6 U;  3IRU A;  1CRX A;  2ZJ5 A;  1TK5 A;  3BQ7 A;  1NJW A;  3E2E A;  3MR3 A;  9ICU A;  4PHP A;  2ASL A;  4US8 A;  2KN7 A;  2UVU A;  2BCV A;  9ICR A;  1ZQX A;  3FC4 A;  4UBC A;  2JEF A;  1ZJN A;  2WF6 A;  5AI5 A;  3L3F X;  2KIV A;  4IQU A;  3DDH A;  2XI9 A;  4RT2 A;  2ODG A;  1S8O A;  3K75 D;  3GV5 B;  4FZN A;  8ICB A;  3RB3 A;  5KTQ A;  1RPL A;  3H0R B;  5ALM A;  1XU4 A;  2KZM A;  4KX3 A;  3RR8 A;  5KFD A;  4RNM A;  5ALJ A;  2AXT U;  4I2I A;  2WTF A;  5AKY A;  5D4B A;  1C7Y A;  4OO1 J;  3KBB A;  2EAP A;  4B9U A;  4A8E A;  3HRD D;  5CB1 A;  2KKV A;  5KFN A;  1L7M A;  2XCA A;  4CRX A;  2N1R A;  5J0Q A;  3G6Y A;  3IG8 A;  4F3O A;  2ZTE A;  3TAC B;  2BPG A;  3IN5 A;  4RNN A;  3BQ1 A;  4YP3 A;  1L3U A;  5J2D A;  3TAQ A;  2ESE A;  3KHG A;  5KFY A;  7ICU A;  5AKL A;  3D6J A;  4RUA A;  1V85 A;  2R8H A;  1L7O A;  2ZJA A;  3TKA A;  1U45 A;  1NZP A;  3N7S C;  3MDC A;  1JRP A;  5IIL A;  1UA0 A;  2HBK A;  3PW2 A;  4DQI A;  2KD1 A;  2BQR A;  1S0M A;  4ECQ A;  3ISB A;  5DGA A;  4B6J A;  4NLZ A;  3HT3 A;  3EZ5 A;  5KFC A;  3QE9 Y;  3V7L A;  4EBC A;  3T5K A;  3L5K A;  4QJF B;  2B6G A;  4UBB A;  3I1Y A;  2M0N A;  1FFU A;  3UXO A;  4F5O A;  1Q3U A;  2I5H A;  1AQ6 A;  1ZQB A;  4KLT A;  7ICN A;  4TUP A;  3NUQ A;  4QWB A;  1IV8 A;  4DO9 A;  2PMZ C;  1BPY A;  2E8P A;  4NM1 A;  3KHR A;  1WCN A;  1ZQM A;  4O5K A;  5DB6 A;  2QB0 B;  2KK0 A;  5JUM A;  3OHA A;  3PW5 A;  2KMD A;  1DRG A;  3F2C A;  3PW4 A;  4QZH A;  8ICU A;  3AQF A;  5DDM A;  4F72 A;  3NAS A;  3PO4 A;  2H3I A;  3I28 A;  5HHH A;  1N61 A;  5AI4 A;  1SKS A;  4P0Q A;  5KFR A;  7ICM A;  1NK4 A;  3TI0 A;  3M8S A;  5C0Y A;  2CPR A;  5KFW A;  2F77 X;  2HDO A;  1SGG A;  1SWW A;  3J81 j;  4I28 A;  5AKG A;  2XIC A;  4Y2P A;  5KFF A;  1YT3 A;  4DWI A;  3NRZ A;  7ICF A;  2JRZ A;  4RQ5 A;  2R8I A;  1RM6 C;  3C28 A;  2K4I A;  2YY6 A;  4F5Q A;  3KOO A;  2BDU A;  3SV4 A;  3QU2 A;  2GWS A;  4C8O A;  1IIP A;  2ZIX B;  2G08 A;  1T8E A;  4Y2T A;  1ZQT A;  3MBY A;  1B43 A;  1QH9 A;  2W11 A;  5ALE A;  4X5V A;  3MFH A;  4CGZ A;  5CA7 A;  1X9M A;  4Q8F A;  2KHV A;  4F2R A;  2OXO A;  3QX7 A;  1VJ5 A;  1KFD A;  8ICR A;  3F2B A;  4HAI A;  1LB2 B;  3RBD A;  1EXN A;  3NVV A;  4M9G A;  4C8L A;  4M04 A;  5TIS U;  1ZQE A;  2JR5 A;  2ISO A;  4ECU A;  5IIM A;  7ICG A;  1NJZ A;  1TVA A;  8ICF A;  2V9W A;  3RH5 A;  3AMZ A;  3LWM A;  2HHV A;  3MR5 A;  2BDP A;  4RQ6 A;  9ICV A;  3PR4 A;  5KL8 B;  1ZQW A;  5DQH A;  2ZUD A;  2GO7 A;  4P4O A;  3FAH A;  5ALU A;  1RDF A;  3UMG A;  4J9N A;  3RJG A;  3H0L B;  2A1J A;  5EWG A;  1KW4 A;  9ICE A;  4Y2J A;  5KFK A;  2JH1 A;  5G5H A;  3OHB A;  4OJP A;  5ALX A;  3SAG A;  3HKZ C;  2OH2 A;  3QZ8 A;  3SMV A;  4CDG A;  5J2B A;  1V38 A;  4UAT A;  5ALH A;  4RQ8 A;  5KT5 A;  2LYA A;  4DQQ A;  2KZ3 A;  3ZD9 A;  4UAS A;  1BGX T;  4RPY A;  3V6J A;  4RQN A;  2EQY A;  5AKX A;  2J6T A;  4B9T A;  4MF8 A;  1J97 A;  4QW8 A;  2VA2 A;  2NRZ A;  3S6J A;  2PFO A;  5ALG A;  3RBE A;  4BXO A;  4AP9 A;  1ZD3 A;  4UB8 U;  1UQV A;  3PVX A;  4QZ8 A;  1WG8 A;  3ORY A;  3IV6 A;  4UW9 A;  3WKA A;  3PW0 A;  4BWJ A;  4YQW A;  5KFS A;  2ZIU B;  5GTH U;  1D9F A;  4JWM A;  4USA A;  3ICX A;  1T3N A;  5DB8 A;  5GTI U;  5III A;  3OJU A;  4KLD A;  1LKY B;  3QXG A;  4Q43 A;  5TZV A;  2EAM A;  2FLN A;  1LKY A;  4QZI A;  4C7Y A;  2F44 A;  5AKI A;  2W9B B;  3B0Y A;  5B66 U;  1N48 A;  8ICJ A;  3WK7 A;  4F4Z A;  4QZC A;  2KHQ A;  2QAR A;  1UHU A;  1N62 A;  4B9V A;  1ZQV A;  3JPR A;  1ZQQ A;  3WKD A;  4EX7 A;  2F2A B;  3F2D A;  1S0V A;  1N2X A;  4YXJ A;  3ZD8 A;  2KVS A;  4OJ5 A;  1F44 A;  4E0D A;  1JRO A;  3MAB A;  1NJX A;  5A0L A;  1KSP A;  1B4F A;  2QLT A;  5AIA A;  9ICK A;  2F76 X;  4IRC A;  3TAP A;  1SV0 C;  4ZH4 A;  2KIC A;  3C21 A;  2ZJ8 A;  2OCE A;  3JPS A;  4ECS A;  4JUZ A;  4QZB A;  3E58 A;  4F5R A;  1Q3V A;  4O3M A;  5EOZ A;  1ZQA A;  3JPO A;  3OPX A;  4GC7 A;  2I6X A;  3K4G A;  1S77 D;  3RRG A;  4XA5 A;  1WCL A;  2OWO A;  1L3V A;  5HP4 A;  1JUD A;  2LI6 A;  2P35 A;  1KKX A;  4BUG A;  5CHG A;  5AIC A;  5EWF A;  4QZF A;  3GQC A;  3RJJ A;  2KFN A;  4QWD A;  1NK7 A;  1ZXI A;  5J2A A;  1SZP A;  8ICA A;  2W8K A;  2VAN A;  2E8O A;  4KLG A;  7ICI A;  1NNL A;  1K1Q A;  5ALT A;  3AEV A;  3JPP A;  5DLF A;  4DL6 A;  5DBA A;  2DUY A;  4GIB A;  2FE9 A;  3HWT A;  3MR6 A;  4KN4 A;  5EWE A;  9ICW A;  4DL4 A;  4RQ2 A;  1FO4 A;  1KFS A;  3RJH A;  1A77 A;  3M7D A;  5KG2 A;  4I2C A;  1JIH A;  2K4H A;  5L1L A;  4DQS A;  4ECZ A;  2WHE A;  1JX4 A;  4ED3 A;  3LYS A;  4JB3 A;  2DFL A;  1ZQZ A;  2YTU A;  3UQ2 A;  1XO0 A;  7ICO A;  2ES6 A;  2F3N A;  3JPN A;  1KEJ A;  4TUS A;  2UVR A;  2FLL A;  1DXS A;  2FJ6 A;  4KLU A;  3RF9 A;  4RQ1 A;  3KKA A;  5KL1 B;  5J2F A;  2EAO A;  4PL2 A;  3GII A;  2NRV A;  2DKX A;  1RQL A;  2B21 A;  3QYP A;  2ASD A;  1B0X A;  2JHD A;  3B9J A;  4RQ0 A;  1RXV A;  1PK1 B;  3TAD A;  9ICH A;  2FPK A;  4DOB A;  3TAR A;  2I1Q A;  1PK3 A;  2NRT A;  5CP2 A;  2I9G A;  3RTV A;  5KFG A;  2B0C A;  3RJF A;  3CW2 C;  1ZQG A;  5HR7 A;  1BPX A;  3QU5 A;  1N63 A;  1IXR A;  3F5E A;  2W8L A;  1PVR A;  1V97 A;  1X40 A;  2W3R A;  2AU0 A;  1NZB A;  3H4D A;  5HNK A;  1S0O A;  2K89 A;  4I2A A;  2JEG A;  1CEZ A;  2KSO A;  1L3S A;  5AI6 A;  7ICQ A;  2P6R A;  5KFZ A;  2AGP A;  4M6W A;  3H4B A;  2HMX A;  4JMU A;  4EEK A;  1TAQ A;  3HW8 A;  4YFK A;  1SIJ A;  4CF4 A;  1BNO A;  3HX0 A;  5L1I A;  4ECT A;  4IS7 A;  4P0P A;  2HCF A;  4Q45 A;  2LM4 A;  1S0N A;  4C8M A;  2D3D A;  9ICS A;  2XGQ A;  3H0M B;  3RFA A;  4M9J A;  1KQQ A;  1L7P A;  5HR6 A;  4F4Y A;  4KLM A;  9ICF A;  2M9N A;  4LZD A;  5CJ7 A;  1UPH A;  1N56 A;  8ICG A;  3BQT A;  2PKE A;  3PX0 A;  5CR0 A;  1Z4N A;  4BDP A;  4O3O A;  8ICZ A;  4I2G A;  1ZYQ A;  3K1R B;  4FZM A;  2WF7 A;  4IRK A;  3ED5 A;  1ZJM A;  2E3T A;  1ZET A;  1ZQO A;  4RQ3 A;  5H2F U;  3GIJ A;  2K8C B;  3GU3 A;  2KSO B;  5EE3 A;  1U9L A;  3I76 A;  1QQ5 A;  8ICW A;  4ED8 A;  1URJ A;  4PH5 A;  2BCR A;  5AIB A;  3NVW A;  3WKC A;  1ZOL A;  2OHF A;  4PZN A;  3T3F A;  3BQ0 A;  4XQ8 A;  2NYV A;  3QUC A;  1N60 A;  4NV0 A;  2CRX A;  1RZT A;  2DGZ A;  2KE7 A;  5KT3 A;  1XSP A;  5KG1 A;  1SV0 A;  4Z6C A;  2DF4 B;  2IBK A;  4DQP A;  2K4P A;  1ZQY A;  1J2N A;  2C22 A;  1ZQD A;  2F1J A;  1X2I A;  4B9N A;  5KFQ A;  1KRP A;  2D6F C;  3FDS A;  4ED2 A;  3VCB A;  3NGD A;  5KG5 A;  3SI8 A;  4R64 A;  5E79 U;  2WF8 A;  4IQW A;  4ZOH C;  4QZ9 A;  3MGV A;  4EEN A;  1L8L A;  1MQ3 A;  1UA1 A;  4RT3 A;  2HBM A;  4NL9 A;  5DBB A;  3A0B U;  3QUT A;  2F8L A;  2C28 A;  2HOI A;  5KFP A;  2Y1I A;  4EEY A;  2FPL A;  3ISD A;  3PX4 A;  3HKZ F;  1ZQN A;  5JRT A;  1B22 A;  3ZDE A;  4FS1 A;  3NS1 A;  8ICI A;  3QEA Z;  3D2Q A;  3NTU A;  2RRD A;  4QNL A;  5DQI A;  3RB4 A;  3JPQ A;  3OGU A;  3WK5 A;  3BJY A;  2IOF K;  1DGJ A;  1RQN A;  4BXO B;  3EUB 2;  3QEB Z;  2BGW A;  3EWA A;  2DQN B;  3VC8 A;  5DG9 A;  3EPG A;  1OUQ A;  4FBU A;  4DS5 A;  2WF9 A;  4JWN A;  4RU9 A;  4IQV A;  2XCP A;  2Y9T A;  5KFA A;  4C4T A;  1XNS A;  2LBO A;  4KTQ A;  1N5W A;  4DLG A;  1JAL A;  4P4M A;  2Y0S F;  3PR5 B;  2VA3 A;  3AQE A;  2BHN A;  1T7P A;  3WK4 A;  4I2F A;  3IP4 B;  3SAF A;  1XSL A;  2JGA A;  5ALO A;  3LWL A;  4F71 A;  2AGQ A;  1SXE A;  1MA7 A;  2YMM A;  4C0Z A;  3HPO A;  3GFK B;  3UQ0 A;  5CRX A;  1IG6 A;  3IHQ B;  5KT6 A;  2XID A;  1IM4 A;  3M6K A;  4DL2 A;  3CYM A;  5F3X B;  1D8B A;  1NI3 A;  1Z1V A;  4Y2U A;  2FMQ A;  4C4R A;  5DQG A;  4KLI A;  2W9B A;  5HMM A;  4NLG A;  3PNC A;  3WK9 A;  1BNP A;  3AU6 A;  4Y2Y A;  2XC9 A;  3RR7 A;  3SEI A;  4DFK A;  2KZZ A;  4EYH B;  2MAX A;  2IHM A;  2G5I B;  4DS4 A;  3C2L A;  1L7N A;  4DFJ A;  5ALY A;  4DSK A;  4UB5 A;  1YZ7 A;  4F93 B;  1JN3 A;  4UB3 A;  3A0H U;  2LMR A;  2XY7 A;  3T5H A;  5AKK A;  2NRX A;  4JV1 A;  3RB6 A;  5KG7 A;  7ICK A;  1RYS A;  2DKZ A;  1PVP A;  3V72 A;  4KX5 A;  1COO A;  1Z00 B;  5J0X A;  3PO5 A;  4F4K A;  4QZG A;  1MSW D;  5KFL A;  2YX8 A;  8ICL A;  1QSL A;  4MF2 A;  3SEN A;  3C5F A;  1C20 A;  1BPE A;  7ICS A;  3N7R C;  8ICT A;  5C5J A;  4F50 A;  2EH9 A;  2BR0 A;  3Q8P B;  2VJ5 A;  2IA6 A;  5J0S A;  3H8W A;  1U49 A;  4YR2 A;  3MDA A;  3V6H A;  4UQG A;  3KD3 A;  4OCZ A;  4UAZ A;  1OW5 A;  2KJ8 A;  4EBD A;  4NJ8 A;  2BCS A;  2IMW P;  2XY5 A;  2G5H B;  3HIL A;  1FFV A;  4YMN A;  4Q44 A;  4GLX A;  3KHH A;  4I27 A;  4AYB F;  3NVZ A;  2UVW A;  4M9H A;  3C23 A;  1WUD A;  5ALW A;  5J0O A;  3GZF A;  5AI0 A;  3CP8 A;  2FMP A;  1TK0 A;  3F53 A;  5KFE A;  2AQ0 A;  3ZDA A;  2Y0S C;  4XUS A;  3C2K A;  5ALI A;  5AM4 A;  2YQE A;  4ED1 A;  4I2E A;  2MRL A;  4O3N A;  1XC9 A;  4F8R A;  2VKQ A;  3KKA C;  2BCQ A;  5ALF A;  4PZO A;  4J9M A;  2YML A;  2IOH A;  2E1E A;  4M0A A;  2EZZ A;  2KFZ A;  3Q8S B;  2K4E A;  5L1M A;  4PGY A;  3QZ7 A;  2R8K A;  1HUO A;  5J0R A;  3EPI A;  3O0F A;  1A76 A;  2CXY A;  3Q8R B;  1KFT A;  1NK5 A;  4ECY A;  5AM2 A;  3WK8 A;  3PZP A;  2AGO A;  4IR1 A;  4GC6 A;  2BQ3 A;  3PX6 A;  5HML A;  4CE6 A;  2J6S A;  2GH1 A;  3ZDC A;  3T79 A;  2ATL A;  1NKB A;  1A0P A;  4MHV A;  5J2K A;  1ARO P;  3V7K A;  3ZDB A;  5KG3 A;  2ZTC A;  4UB2 A;  2YMQ A;  2HHS A;  1SKR A;  5BOL A;  5F9L A;  2PI5 A;  3RAQ A;  4I2J A;  3N4M B;  3GIK A;  1TAM A;  2KTQ A;  2ZUC A;  4EYI B;  2Z7J A;  1T94 A;  3NRW A;  5JTI A;  7ICJ A;  1MQ2 A;  1SZH A;  8ICX A;  2F1I A;  2XO7 A;  4O3P A;  4U7C A;  2HOQ A;  4TQR A;  4DLE A;  3LVW A;  7ICE A;  5KFV A;  9ICG A;  1RG6 A;  4DEZ A;  5BOM A;  4QWC A;  4Z6E A;  2RDJ A;  2ZXH A;  2XY6 A;  3PMN A;  1BVS A;  2RQ5 A;  1SWV A;  4Y2X A;  3WKB A;  4R63 A;  4R66 A;  3PSF A;  1UT5 A;  1ZD5 A;  4ECW A;  4KLH A;  1L5U A;  7ICH A;  5KFI A;  2WB1 F;  4DSI A;  5J0U A;  4RPX A;  2KIW A;  2G07 A;  3RRH A;  2KKP A;  4Y2R A;  2ZG6 A;  1Z1B A;  5IIO A;  4CNQ A;  3H7I A;  3MR2 A;  4YCX A;  2H3Q A;  4DOC A;  4J9R A;  3OTQ A;  2EDU A;  4KLQ A;  2O6K A;  2JXJ A;  3H40 A;  4AYB C;  2KG5 A;  2V4Q A;  4QZE A;  1GO3 F;  5ALZ A;  2FI1 A;  2HBL A;  3RH4 A;  2HHQ A;  2ZIW B;  1DOQ A;  4UB1 A;  8ICQ A;  3UPQ A;  1A6S A;  4BWM A;  4YD2 A;  2ZIW A;  2AH5 A;  5IIK A;  3C5G A;  4QWA A;  3BS5 A;  1HUZ A;  4PHD A;  3BZC A;  3AL0 B;  2LYH A;  2D8C A;  3OSN A;  2G06 A;  4BX9 C;  2ZIU A;  1ZQI A;  3MGH A;  1O08 A;  2QB1 A;  2OYY A;  5J2G A;  4F5N A;  4F4W A;  8ICE A;  4KLL A;  1L3T A;  1NKE A;  3IG5 A;  2P6U A;  2VJ4 A;  1ED1 A;  2HHW A;  1XSN A;  7ICL A;  3KTQ A;  1BPD A;  2QAR B;  4PPX A;  4DFP A;  5ALV A;  1Y88 A;  4R8U A;  3BS7 A;  4ACO A;  4RQM A;  5EE1 A;  1WWU A;  2BKE A;  1ZRN A;  5KT2 A;  1SKW A;  1XS9 D;  1ZQR A;  1SL1 A;  2FDR A;  4ED0 A;  9ICI A;  4FBT A;  1T4G A;  5IIN A;  1SL0 A;  4JV2 A;  3GIM A;  2NRW A;  1Q46 A;  5J0T A;  1ECW A;  4DL5 A;  1JXL A;  3KFU F;  2JV3 A;  3N7P D;  3SD7 A;  3C29 A;  3KHL A;  4MFC A;  3SAH A;  5ALK A;  2R8J A;  2HW3 A;  5AKZ A;  1V9P A;  4NXZ A;  4B9S A;  1UCV A;  2W03 A;  4R65 A;  3G6V A;  4GXI A;  3WU2 U;  1FEZ A;  1Z00 A;  5KFU A;  4YR0 A;  4FS2 A;  3SV3 A;  1MN8 A;  4KMU A;  4LZG A;  4Y2V A;  2Q0Z X;  4ED6 A;  9ICL A;  1QQ6 A;  3EYZ A;  1XWL A;  8ICM A;  9ICO A;  4MFF A;  4KLJ A;  8ICO A;  4RZR A;  4JV0 A;  4DCC A;  1F5S A;  2W3S A;  4O0I A;  2W9C A;  3THV A;  3MGI A;  5D49 A;  4OJ6 A;  9ICB A;  2RLT A;  1T3Q A;  2HOF A;  1PUZ A;  1HIW A;  4NLN A;  2MUT A;  1QQ7 A;  3OJS A;  8ICP A;  5J2I A;  3N97 B;  5B5E U;  3UMB A;  1ZQP A;  1H38 A;  1OXJ A;  5J2E A;  1S10 A;  4I2B A;  3V6K A;  1XO1 A;  4DQR A;  4J03 A;  5ALL A;  2AQ4 A;  4QW9 A;  3H8M A;  3QNM A;  2GOL A;  2IOF A;  3QU7 A;  4NM2 A;  1YZ6 A;  4YD1 A;  5DLG A;  1X9X A;  2W43 A;  5EE0 A;  3NVY A;  2UVV A;  3ONN A;  4PJ0 U;  5DG8 A;  9ICC A;  2LKY A;  1BPB A;  4O3Q A;  1U4B A;  2WAQ F;  2C2E A;  3E0F A;  3UMC A;  2Q4T A;  5KFT A;  2YB4 A;  5L1J A;  3QUB A;  1KTQ A;  2P66 A;  4F2S A;  8ICC A;  1NK9 A;  8ICN A;  5AK4 A;  1ZQU A;  2WAQ C;  3QU4 A;  3F5A A;  2FMS A;  2MU2 A;  1PZN A;  1L6N A;  2J6U A;  1TKD A;  2YMP A;  4R8U B;  3SZ2 A;  4O9M A;  4US9 A;  4WJ3 B;  4ECV A;  1JXE A;  4NLC A;  5L9X A;  4O3S A;  1Z19 A;  2JEI A;  4YN4 A;  4RUC A;  4PL1 A;  2HVH A;  1D9D A;  3RJI A;  4KLF A;  2R8G A;  4C4S A;  1VDV A;  1N5X A;  3UXP A;  4IR9 A;  4I2D A;  2JZB A;  5AI8 A;  2RHF A;  5AK6 A;  3V7J A;  1LVH A;  4ELU A;  1NKC A;  4RPZ A;  5L1K A;  4FZL A;  4ED7 A;  3H8S A;  3Q8L A;  9ICQ A;  4CCH A;  4QIW C;  3T5L A;  2E1F A;  3Q8M A;  1S97 A;  4RNO A;  1PK1 A;  9ICP A;  4B9M A;  4PGX A;  5DDY A;  2ISP A;  3KZI U;  1TFR A;  3ZI4 A;  5AHX A;  2W7P A;  5CWR A;  1NK8 A;  4P2H A;  1UT8 A;  5AM0 A;  4RQ7 A;  4QIW F;  2W9M A;  3L4P A;  2AHO B;  5KFB A;  3RB0 A;  1ZQC A;  1ZQK A;  2PFN A;  5F9N A;  2DPI A;  7ICT A;  5ALP A;  5AI9 A;  5KAI U;  4C8K A;  2ZTD A;  3EW9 A;  2KOB A;  2PFP A;  4FE3 A;  1X6I A;  4YVZ A;  2K8A A;  2JH7 A;  4EEL A;  2LPE A;  2RDI A;  5KAF U;  5KFJ A;  5KG0 A;  2W9C B;  4YMO A;  4YR3 A;  2ASJ A;  3PW7 A;  3TAN A;  1CI4 A;  5JU5 A;  4P0P B;  5ALN A;  1SB3 C;  1ZQ1 C;  9ICX A;  1QCK A;  1ZQS A;  1K5O A;  3GDX A;  5BPC A;  4M6W B;  4Y2Q A;  4NLB A;  4C8N A;  3AUO A;  3GV7 B;  1BPZ A;  4G9B A;  3C2M A;  2ZIX A;  3G6X A;  2A1A A;  2JZB B;  4HYK A;  2JEJ A;  3UM9 A;  3PSP A;  1K1S A;  3BZK A;  4RQ4 A;  1J2M A;  2LYB A;  3IM1 A;  2E5S A;  2G0A A;  4ELT A;  2EZX A;  4C80 A;  5D46 A;  4UAW A;  3BS5 B;  3JPT A;  5KG6 A;  2ZUB A;  2PI4 A;  4DSE A;  4DF8 A;  3SYZ A;  3H8J A;  2ZIV A;  4DSF A;  1Q8K A;  3C1Y A;  4F5P A;  1COK A;  2BQU A;  3ALR A;  4JK1 A;  9ICA A;  3M9M B;  1RXW A;  1MC8 A;  3GIL A;  2C2R A;  4ELV A;  4KLS A;  1ZD2 P;  3CRX A;  2R18 A;  2MA1 A;  4UAU A;  2L5Y A;  4NLK A;  1TV9 A;  3GV8 B;  5AKJ A;  2DL0 A;  1NK6 A;  2WB1 C;  4YXM A;  3M9O B;  2NO5 A;  1HEK A;  1SV4 A;  3FM9 A;  2NV3 A;  1KDH A;  4IQT A;  3WK6 A;  3AM9 A;  3TFS A;  3ETL A;  5J2J A;  2BPF A;  3D2S A;  2XGP A;  4PHA A;  1ZQJ A;  2H3F A;  2CN1 A;  4KLO A;  4TQS A;  1QSY A;  1ZD4 A;  4KMO B;  5ALS A;  4EZ6 A;  5KFH A;  4MFA A;  3M6Z A;  5HHI A;  5J0P A;  4NY8 A;  4DL7 A;  8ICS A;  2HHX A;  2C2D A;  3QU9 A;  1KN5 A;  4UB4 A;  3UXN A;  4FFD A;  5T14 A;  5J0Y A;  4Q8E A;  3TQ1 A;  5ALD A;  3M9N B;  1D8L A;  2W55 A;  1TK8 A;  5KFO A;  3PSI A;  2A19 A;  1S76 D;  5AM3 A;  1S9F A;  3LVV A;  1WYG A;  3ISC A;  3M1Y A;  3T5J A;  2KNJ A;  4DF4 A;  7ICP A;  2PMZ F;  1P7D A;  5AM1 A;  2HVI A;  4QZD A;  4J9O A;  4M9N A;  3QUQ A;  5DBC A;  5KG4 A;  2YB1 A;  4ECR A;  4O3R A;  1JMS A;  2K60 A;  5DKW A;  4J9P A;  7ICV A;  2MUT B;  8ICY A;  4M2Y A;  3AU2 A;  5KFX A;  4OD0 A;  4EZ9 A;  9ICN A;  3K1Z A;  2H3V A;  3Q8K A;  2KP7 A;  3TFR A;  4NL9 C;  4OJO A;  4U6P A;  1X9W A;  9ICJ A;  1M6Y A;  9ICT A;  4XRH A;  2HSZ A;  2Y1J A;  1DGS A;  4F91 B;  3ZDD A;  4KLE A;  4C7Z A;  2KEY A;  2A3V A;  2KVC A;  8ICK A;  2MSN A;  4I2H A;  2F8K A;  4G3I A;  5KT7 A;  3SQI A;  4PHE A;  2PFQ A;  2ZXI A;  3PST A;  2EAN A;  2K8B B;  1DK2 A;  5ALR A;  1U47 A;  3IDW A;  5FP0 A;  2HBJ A;  4F92 B;  1SXD A;  3PY8 A;  1L8O A;  3SR6 A;  1LV5 A;  3R9K A;  2FPM A;  2H3Z A;  2YN4 A;  4YG2 A;  3HP6 A;  2KJ9 A;  2DPJ A;  4OJL A;  5J2H A;  1X66 A;  4BGD A;  4YMM A;  2BZF A;  5J0W A;  1DK3 A;  2BCU A;  2KV2 A;  5AKH A;  5AKE A;  4Z6F A;  3U26 A;  1U48 A;  5K4L A;  4ICA A;  3CNH A;  3TAD C;  9ICM A; 
#chains in the Genus database with same CATH homology
 2E8P A;  5JRT A;  1DXS A;  2DKZ A;  2QB0 B;  5J8Y A;  1B4F A;  3BS5 A;  3KKA A;  2EAO A;  2KMD A;  1SV0 C;  2DKX A;  1KW4 A;  3SEN A;  2D8C A;  3K1R B;  1B0X A;  4MHV A;  5KNI A;  1PK1 B;  3TAD A;  1V38 A;  3BS5 B;  2QB1 A;  1PK3 A;  2EAP A;  2K60 A;  2Y9T A;  2KSO B;  4RQN A;  2Y9U A;  3TAC B;  1COK A;  2QAR B;  1SGG A;  1PK1 A;  4NL9 C;  4PZN A;  1OW5 A;  4NJ8 A;  3BS7 A;  4RQM A;  5JTI A;  1UQV A;  2ESE A;  3HIL A;  2L5Y A;  1WWU A;  2KE7 A;  1OXJ A;  2QB0 A;  1V85 A;  2DL0 A;  1X40 A;  2E8O A;  1SXE A;  2E8M A;  1RG6 A;  1SV0 A;  2F8K A;  1F0M A;  3H8M A;  2KSO A;  1SV4 A;  2FE9 A;  5F3X B;  2K4P A;  1WWV A;  2EAN A;  1Z1V A;  1X9X A;  2E8N A;  3IDW A;  1LKY B;  3BQ7 A;  1SXD A;  2EAM A;  4IS7 A;  2LPE A;  1LKY A;  2F44 A;  3SEI A;  2JV3 A;  2B6G A;  5JU5 A;  5J8Y C;  2D3D A;  2GLE A;  2QAR A;  3KKA C;  1X66 A;  2QKQ A;  4PZO A;  4NL9 A;  2KG5 A;  2YTU A;  2ES6 A;  1JI7 A;  2LMR A;  5L1M A;  2KIV A;  2F3N A;  1UCV A;  3TAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...