4PZOA

Crystal structure of phc3 sam l967r
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
70
Chain Sequence
TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKRGPALKIARINSLKESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 3
total genus 20
structure length 70
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pzoA00
2QARB 2E8NA 1SV4A 1UCVA 2EAPA 5JRTA 2EANA 1JI7A 3BQ7A 2QB1A 1SGGA 4PZOA 5J8YA 2QB0B 1WWUA 4NL9C 2QARA 1DXSA 2DL0A 2F8KA 4NL9A 3TACB 1PK1B 1SXEA 2F44A 1PK3A 1RG6A 1LKYA 1WWVA 2LPEA 2D3DA 2GLEA 2FE9A 3HILA 2KIVA 2ES6A 4NJ8A 1X66A 4RQNA 5L1MA 2D8CA 1LKYB 2E8MA 2DKZA 3IDWA 3BS5A 3BS5B 2K4PA 3TADC 3KKAC 2KE7A 5F3XB 2KSOA 1KW4A 3SEIA 2F3NA 2LMRA 1SV0C 3TADA 1B0XA 1OW5A 5JU5A 1V85A 1OXJA 5JTIA 3H8MA 1COKA 1X40A 2ESEA 1SV0A 2L5YA 1B4FA 1PK1A 2Y9TA 1UQVA 3BS7A 3KKAA 2QKQA 2DKXA 2K60A 4MHVA 2KG5A 2B6GA 4PZNA 2E8OA 3K1RB 2EAMA 2EAOA 2KMDA 1SXDA 1V38A 4IS7A 2Y9UA 2YTUA 3SENA 1F0MA 2JV3A 4RQMA 1X9XA 2E8PA 2QB0A 5KNIA 1Z1VA 5J8YC 2KSOB
chains in the Genus database with same CATH superfamily
2QARB 2BCUA 5HMMA 5BPCA 2F1HA 4DLGA 2ATLA 2KVSA 5A0LA 5AM1A 1SGGA 3GIJA 4MFFA 1O03A 3C1ZA 2OWOA 4RT3A 3JPOA 5CRXA 3BZKA 3BQ2A 2W9BA 3MDCA 1KRPA 1WCLA 3OJUA 1RG6A 4DL4A 2Z7JA 2F77X 1T94A 4EYHB 2BZFA 3QYPA 3QU2A 2Y1JA 3MFHA 4OD0A 5ALFA 2E1EA 5J0WA 3F2CA 1ZXIA 4C4RA 2BDPA 4F5QA 5KT6A 2E3TA 4GXJA 1T8EA 3SI8A 2H3IA 5AKKA 3K75D 5KFDA 3QXGA 4GC7A 4YN4A 4IC9A 3ONNA 3EUB2 1S0OA 2LMRA 3GV5B 5KFOA 4C8OA 4EEYA 4DSFA 1JROA 1L7OA 3RF9A 4ECSA 3PX0A 3Q8SB 3HKZF 9ICWA 4KLGA 4UW9A 4ECXA 4EBEA 1K1SA 1X6IA 3AM9A 3PSIA 3VC8A 4B9SA 4C8NA 2XIDA 1K1QA 4LJXA 4O3PA 4F4ZA 1QQ7A 2AGPA 2VJ4A 4J03A 2KMDA 3QNMA 3F2DA 3AN1A 5AHXA 9ICHA 5J2HA 2D6FC 4F4KA 2VIXA 2JV3A 2FI1A 5AI4A 4J9OA 8ICWA 2ZIXA 4QZGA 4B9UA 1Z19A 4DSKA 5CEHA 3MR3A 3H40A 2NO5A 3D2NA 3IG5A 4JWNA 4ELTA 2JH1A 1XSLA 3JPPA 4F93B 1BPBA 2PI5A 2F2AB 5J0UA 4NL9A 4O3NA 3TAQA 2PFNA 4OJPA 5EWEA 4Y2RA 3QEAZ 5C0YA 4RT2A 2LM1A 4M2YA 4KMOB 4B9NA 4G3IA 3QE9Y 2GLEA 4TURA 3NASA 2BGWA 2V4RA 3QUCA 2P6UA 2ZIVB 2A3VA 3NVYA 3A0HU 1RDFA 2YN4A 1U48A 1PVRA 2BCRA 1TAQA 1HEKA 2RQ5A 5DBAA 4USAA 1QQ5A 5J2BA 1V85A 4K4IA 1OXJA 5D46A 5JTIA 3H8MA 9ICKA 2OH2A 3PW5A 1FIQA 5KFHA 3PX6A 4J9RA 2PI4A 3WK5A 5J2DA 4O9MA 5AIAA 4O5KA 5HHHA 4PPXA 2ASJA 1IG6A 2R8HA 2WB1C 4KLLA 5ALEA 1B22A 3KBBA 4PZNA 3WK4A 4CCHA 4DO9A 3AL0B 1DK2A 1SXDA 2IA6A 5KFAA 4QWEA 4IS7A 5KFBA 2OM6A 4K4GA 1VJ5A 4NLBA 2WF6A 2HVHA 3MGIA 5AKXA 1JXEA 4FFDA 2FJ6A 3J81j 1M6YA 3FYHA 2EZZA 9ICIA 3HJEA 1WCNA 2KSOB 4DL5A 5ALJA 2WHEA 5KFZA 4JV1A 4KLMA 4MFCA 1ZD4A 1KBUA 1ZQKA 4QZEA 4U7CA 5KG5A 5GTIU 4ED1A 2F8KA 5KFTA 4QWBA 3G6VA 2HOIA 4DFPA 5KAIU 4J9PA 5HMLA 2YMMA 2VA2A 2HBLA 1PK3A 3LDAA 1LKYA 4KLDA 5AK5A 9ICMA 2B0CA 1WUDA 4MF8A 4JV2A 4QJFB 2DFLA 4FBUA 3KFUF 1NJXA 2KIVA 2ZXHA 4ZOHC 3NVZA 1NK5A 1QCKA 2H3QA 1ZQHA 4M47A 5GTHU 4I2DA 7ICOA 2PMZF 3H0MB 2JGAA 3Q8LA 4KLTA 3RFAA 4F5RA 3B9JA 3GIIA 4DSEA 5KFUA 1SZPA 4C0ZA 1KLNA 5CHGA 4RNMA 5ALPA 1J97A 3PVXA 5DQGA 2K60A 4I2EA 7ICLA 3ISCA 2KHQA 4QZ8A 5KT2A 4O0IA 4OJLA 3H8SA 1MC8A 4YR2A 5AKLA 2P6RA 4ECWA 2WF7A 2DBYA 1BPDA 3PMLA 2HBJA 8ICGA 1D8BA 2RP5A 3M8SA 4B6JA 3M7DA 4QZFA 5AK3A 2JXJA 1QQ6A 4U6PA 3T5JA 1YZ6A 2KEYA 2UVUA 4ICAA 4KX3A 4TUPA 5KFJA 2BPFA 4NL9C 1XSNA 2QARA 2ZTCA 2C28A 3QU9A 2FPLA 2NRWA 1XO1A 3LVVA 2JEJA 1Z1BA 2WAQF 1ZD5A 1D8LA 4Q43A 3AUOA 4UASA 3QU4A 3TQ1A 3AMZA 2K8BB 3OSNA 1KEJA 2VKQA 4MEYA 4NJ8A 1NK7A 4RUAA 3RJFA 1N61A 4J9SA 3RJIA 1Q3VA 4I2CA 5ALWA 3KKAC 2KKPA 1KFSA 3HKZC 3RTVA 2NRTA 5AI9A 1DGJA 3OGUA 3ZDCA 5CB1A 1Z00A 4O3OA 3GZFA 3GIMA 5DB8A 4CDGA 3Q8QB 4DQRA 7ICFA 4M04A 5HP4A 1S8OA 1B4FA 3THVA 8ICAA 5AM5A 4YQWA 2XY7A 4EX6A 4RPZA 5IIJA 4I2GA 3ZD8A 1Q8KA 2BQ3A 3QEBZ 3JPSA 4ACOA 2H5XA 1HJPA 8ICLA 3OHAA 4C8KA 1QLNA 4YMOA 3KHRA 2BCVA 2R18A 2I9GA 3ZD9A 8ICCA 2XICA 1TE2A 1ZQEA 8ICYA 2RDIA 1ZQNA 1ZJNA 4F71A 2EDUA 2BQUA 5EWFA 2XI9A 2Q4TA 2UVRA 4BDPA 2ISOA 4FS1A 1RM6C 4M0AA 1ZQZA 8ICPA 1L3TA 2GO7A 1L8LA 2DQNB 3V6HA 3SQIA 3V6JA 3OJSA 5KFSA 5DGBA 4PHAA 5ALUA 2BCQA 1L3SA 1D8YA 3MR6A 5KFRA 1X6JA 2NRVA 2V4QA 1KQQA 2F44A 3LYSA 3IM1A 2MAXA 3MFIA 1SL2A 5J2AA 3DV9A 2NO4A 1NK0A 4Q8EA 2FE9A 3N7PD 1KN5A 4YCXA 8ICQA 1ZRMA 3PSFA 4BX9C 8ICVA 1COOA 4DFDA 3QU7A 1RQNA 3RR8A 3C2MA 4OO1J 5J0PA 2ZIVA 4GXKA 2C2DA 1XSPA 4P0PB 2FDRA 2BQRA 2W55A 3T5HA 1FEZA 4ECYA 3H4DA 2ZJ5A 2HHTA 4IQTA 3WK6A 4AYBF 1NJWA 3HRDD 1NZBA 1UQVA 1N62A 3SV3A 4Q45A 4UAYA 3WKCA 3KZIU 1F5SA 4IQVA 2E1FA 5KT7A 4YMMA 2HDOA 2ASDA 2WAQC 2Y9UA 3R9KA 4QW8A 2GWSA 1UHUA 3JPNA 2YTUA 3TI0A 3M6ZA 1X9SA 5DLGA 1PVQA 3KHHA 1JRPA 4QZHA 3Q8RB 1NK4A 1D9FA 3EYZA 2ZIUB 3BDPA 5T14A 4DOCA 4E0DA 5EWGA 4O5EA 1JXLA 3RJEA 5J2GA 2IMWP 9ICVA 5J0OA 4R65A 3KHGA 3T5LA 5ALVA 2LHTA 2HOFA 5DQIA 1NZPA 2ODGA 1ZQGA 2PFOA 3HP6A 3UPQA 5EOZA 3TACB 2YMPA 1DK3A 3C2KA 2W11A 1RQLA 1U47A 7ICEA 9ICUA 4OCZA 3RJGA 9ICXA 4Y2UA 4DS5A 1ZQBA 2HI0A 4DCCA 4J9QA 3A0BU 4Y2QA 1RYRA 1YT3A 1ZQ1C 7ICGA 3CRXA 2VA8A 4YD1A 4BWMA 2XCPA 4UB4A 3ZDEA 3PO5A 2DKZA 5AI6A 4RNNA 1SKSA 4JUZA 1ZQDA 2DGZA 2KHVA 1JIHA 2LYHA 7ICHA 1BPYA 2H3ZA 3NUQA 1SV0C 1PUZA 9ICJA 4F4XA 2W43A 3T5KA 2XY5A 1FFUA 4P2HA 4IQWA 4PJ0U 3ED5A 4LVSA 2ESEA 4Z6FA 3PX4A 2DPIA 2L5YA 3MBYA 3BQ0A 1SL0A 4ED3A 4M9NA 4DLEA 4KTQA 2MRLA 4B9LA 5AM4A 2W54A 5TISU 5KTQA 5KFXA 1BPXA 4KLQA 5DB7A 1ZQRA 3VCBA 3GV8B 4EELA 3U26A 2KN7A 5ALSA 1ZETA 2R8KA 4BWJA 9ICAA 2M0NA 5EE0A 3I28A 1P7DA 1ZQTA 1YZ7A 3M9NB 4ZH4A 4JWMA 1Z1VA 5ALZA 4P0PA 2BR0A 8ICJA 4PGYA 3MGHA 3HWTA 4JK1A 2A1JA 3EWAA 1Q3UA 2G06A 3EPGA 1WYGA 4Z6EA 4DF4A 1L7NA 4QZ9A 1ZYQA 3RB6A 2XY6A 9ICSA 1S9FA 1AQ6A 5KG6A 4JV0A 5F9LA 4CF5A 2YX8A 3E0FA 2BPGA 1S10A 2AGQA 1U49A 4C8MA 3N28A 5KFQA 1BPEA 4X5VA 3CYMA 1F44A 2ES6A 1X66A 2KJ5A 4XUSA 3BS5A 5DG7A 3RH4A 2K4PA 5AM0A 2HHSA 2FLLA 4Y2JA 3SD7A 1S0NA 1S97A 3GDXA 4BXOB 4ED7A 4RQ6A 1B0XA 2KNJA 1N5XA 1ZRNA 2AXTU 5CWRA 5J2KA 4EYIB 5IINA 2CXYA 3OHBA 4TQSA 2JRZA 3JPTA 1NNLA 4CF3A 4O3MA 4NV0A 8ICXA 7ICQA 5KAFU 3DEEA 4MHVA 2KIWA 4ELUA 5KFPA 2I1QA 3C21A 2WTFA 4K4HA 3SAGA 1N48A 1QSYA 8ICUA 2PFQA 3M1YA 9ICGA 4J9MA 3BJYA 4P4MA 7ICKA 2H3VA 1Z00B 5AICA 5E79U 3TAPA 4IR9A 5DGAA 4UB5A 3V7LA 2DF4B 3NGDA 2E8NA 5KFNA 2W9CA 4Z6DA 1L5UA 5JRTA 5L1IA 7ICRA 2JR5A 1NJZA 3CP8A 1ZQIA 5KFVA 3IHQB 5JUMA 3SV4A 1Z4OA 5AKEA 3TARA 3RAQA 4OJ5A 4O3SA 1WWVA 4UB2A 4J9KA 4FZNA 3ZDBA 2Y0SF 4RQ2A 3G6YA 1RXWA 5AK4A 2AJQA 4PGXA 2J6TA 2OCEA 3IDWA 4P4PA 3TADC 4R66A 1ZOLA 1CRXA 1MN8A 5ALTA 2VJ5A 2W7OA 2KP7A 2DPJA 7ICJA 4DFKA 2KV2A 2K8CB 1CEZA 4FBTA 2PMZC 4KITB 4R64A 4YR0A 3H4BA 5ALRA 8ICRA 1JX4A 9ICFA 1NKCA 3RB3A 3UQ0A 3M9MB 5AK6A 1TAUA 1TK5A 3TANA 2R8GA 3M8RA 1TKDA 4UAZA 4MFAA 1ZQJA 4KLJA 5J2CA 1TFRA 5G5GA 4FZMA 5KT5A 4NXZA 4PL2A 1ZQOA 4C7YA 4PGQA 2W9AA 8ICIA 1ZJMA 2RHFA 3UQ2A 1O08A 4I28A 5KG1A 3H8JA 5CA7A 7ICPA 2WF5A 2BKEA 4Y2PA 3LVWA 1UPHA 2F8LA 2HBMA 4Y2YA 1JMSA 1S77D 1A76A 2MUTB 2W04A 4EEKA 5J29A 2OXOA 5KFFA 1SL1A 1S76D 4I2HA 3TKAA 1MQ2A 4QZAA 2W9MA 4ECTA 1ZD3A 1SZHA 2I6XA 2AU0A 3DDHA 3V6KA 2H3FA 1L3VA 2V9WA 4RQ3A 4WJ3B 1SWWA 4CRXA 3ALRA 2A1JB 2AQ4A 1U9LA 3RBEA 1L7PA 3GFKB 3ISDA 1URJA 2W3RA 4PHPA 1T3NA 3M9OB 4PH5A 4C4SA 8ICZA 1V97A 2AGOA 5JU5A 1SKWA 3UMGA 3KHLA 7ICNA 1X40A 4RQ1A 2B21A 3EPIA 4F91B 4BUGA 4NLGA 4IRCA 2YMLA 3WK7A 3O0FA 2W8KA 4BJQA 5D4BA 2KZ3A 2ZTDA 2KG5A 1MA7A 4ECVA 5TZVA 4J9NA 5J0TA 2EAMA 1N60A 2KJ8A 3K4GA 5AKHA 2KJ9A 2W8LA 2Q0ZX 2KICA 1L7MA 4DOAA 3QU5A 5EE1A 5DB6A 1IIPA 3PSTA 4CF4A 4ECRA 2C2EA 3SENA 2KK0A 1X9XA 3QUTA 3RB0A 1RZTA 1X2IA 5ALKA 3PW0A 3JPRA 3Q8KA 3RH5A 5KFEA 1X42A 3GIKA 2Y0SC 4ED8A 4PHEA 4A8EA 4F2RA 4PHDA 5B5EU 3TFSA 3ETRA 9ICQA 5AKIA 1TAMA 4UBBA 2FMPA 4EBDA 1XNSA 2HW3A 4CGZA 2R8JA 2OEHA 2CRXA 3AEVA 8ICBA 5J0QA 9ICBA 1ZQVA 4M9LA 1PZNA 2G07A 5L9XA 3IN5A 4I2FA 2NRXA 3UM9A 2W9CB 4QZIA 4QW9A 4M9HA 1ZQYA 4QZCA 5KG4A 5AI8A 4QWAA 1T3QA 1KFTA 4RQ8A 2R8IA 4KLHA 3OTQA 2BPCA 4DQSA 4P0QB 3PMNA 5K4LA 3PW7A 1DGSA 5DBBA 2ISPA 3NRWA 1COKA 1SV0A 5EE3A 3SR6A 3BS7A 2FPMA 4NM2A 3HT3A 1BVSA 5IIKA 1ZQWA 4F92B 5KFGA 4R63A 1ZQLA 1VDVA 3WKAA 1RYSA 5BOLA 2ALZA 4Q44A 1UT8A 1V38A 1GO3F 3FC4A 2HSZA 2ZTEA 2FLNA 3WKDA 4YMNA 2I5HA 4FO6A 4YXJA 1RXVA 1LB2B 4UARA 4HYKA 2PKEA 2KZMA 4F50A 2KOBA 4UB6U 7ICIA 3ETLA 4KLSA 4M6WB 1WWUA 5KG7A 3F5EA 5J2FA 3N4MB 7ICVA 4RPXA 4ED2A 3LWLA 4FE3A 4JB3A 1T4GA 3MC1A 3RRGA 4AP9A 1NKEA 5J2JA 3H0RB 1UA0A 2F1JA 4QWDA 2O6KA 4I2AA 2GOLA 3SMVA 5KL8B 3F5AA 1NOMA 2IOFA 4EX7A 4Z6CA 4NLCA 9ICTA 3MGVA 5ALDA 3QUQA 2FMSA 4R8UB 1IXRA 4GIBA 2MA1A 5AI5A 3RBDA 2LYAA 3AQEA 2UVWA 4DQQA 5DKWA 3F2BA 4UATA 5J0RA 3C29A 3HPOA 3IP4B 1C7YA 2HCFA 2WFAA 3M6KA 3KZXA 3IG8A 5KFIA 4KLFA 2B6GA 4IRKA 3GU3A 8ICKA 2RDJA 2F1IA 3E2EA 1U4BA 4RPYA 2HHWA 1VLBA 3MDAA 4KLUA 2AQ0A 1KFDA 2KD1A 4CNQA 7ICMA 2DUYA 3HX0A 4F4WA 1FFVA 8ICSA 4Q8FA 4Y2VA 4RQ5A 5H2FU 2HMXA 1MSWD 4DSIA 4NY8A 5J8YC 2K4HA 3RJKA 4J9LA 8ICEA 1UCVA 4ECUA 4XRHA 2LKYA 1NK8A 3C28A 1SIJA 2WB1F 1BNPA 4US9A 2QB0B 3SZ2A 1KL9A 5ALYA 3N7RC 4XA5A 5L1LA 1ECWA 8ICOA 2NV3A 4Y2XA 2DL0A 2ASLA 3RAXA 5L1JA 1SXEA 2BCSA 3ZI4A 2XGPA 3BQTA 3E58A 2LPEA 1C20A 4B9MA 5HHIA 3PNCA 3HILA 5IILA 2ZIWB 2K4IA 3AU6A 1RPLA 5L1MA 2E8MA 4QZDA 4C7ZA 4ECQA 4TQRA 3NVWA 4KLIA 1J2NA 5ALQA 4O3QA 4RQ7A 3RJJA 8ICNA 3IRUA 3G6XA 4I27A 1UA1A 5ALNA 3TADA 5D49A 2KFZA 8ICHA 1TK8A 4RNOA 1Y88A 1NKBA 2K8AA 3NS1A 2G08A 4NWIA 8ICFA 3F53A 4LZDA 2BDUA 4ED6A 3KKAA 4CE6A 2QKQA 1NK9A 2DKXA 1IM4A 2E8OA 4I29A 4F8RA 3WKEA 4EENA 5DLFA 3EW9A 4QZBA 4I2BA 1HUZA 4IRDA 7ICSA 1S5LU 3UXNA 4IR1A 3NVVA 7ICUA 3D6JA 1F0MA 4Y2TA 2PFPA 3PZPA 1N56A 5KT3A 1JALA 3UXOA 4DQPA 5KNIA 2IHMA 1RYUA 2MSNA 2RLTA 3FDSA 3L5KA 1SV4A 3Q8PB 1XC9A 5AKJA 3BQ7A 3D2QA 4UQGA 2BHNA 4KN4A 4F4YA 4KLOA 1TK0A 1ED1A 2IOFK 3C5FA 1FO4A 4NLZA 2ZG6A 1DOQA 5KG0A 5KG3A 2HHQA 1X9WA 5ALGA 4YP3A 2G09A 4YR3A 4YFKA 4G9BA 4B9VA 2FMQA 3D2SA 2HVIA 3T3FA 4KX5A 4RUCA 4RQNA 4EZ6A 1CUKA 3PR5B 2EH9A 2D8CA 4MEXA 5KT4A 4EBCA 3BS5B 4DL7A 5DG9A 5IIMA 3QZ8A 5ALHA 1LV5A 4DEZA 2KE7A 5F3XB 3MR2A 3GQCA 3EZ5A 4OJOA 3BQ1A 4C8LA 1XWLA 3RR7A 2G5IB 3SEIA 4GC6A 3L4PA 1OW5A 5C5JA 2IOHA 3S6JA 1Q46A 2JEGA 5J0SA 3QUBA 1N2XA 1V9PA 2JZBB 2ZIUA 2EZXA 4QIWF 1A6SA 3K1RB 4YVZA 2VANA 1XU4A 2JHDA 9ICNA 4R8UA 2YY6A 8ICMA 4O3RA 5ALXA 1QH9A 2K89A 2XC9A 3I76A 4IL6U 1J2MA 4RQMA 5CJ7A 3WKBA 4JMUA 2E8PA 1ZQCA 1T7PA 2QB0A 3NTUA 3NRZA 4GXIA 5HR6A 1A77A 3B0XA 5CP2A 4YXMA 2EAPA 2EANA 3PW4A 3ORYA 1BGXT 2E5SA 5KFYA 5EE9A 3BZCA 1L3UA 2J6UA 3V7KA 3RJHA 4DSLA 4TUQA 3N97B 2YMQA 3KOOA 3WK8A 3C5GA 5KFKA 3SAFA 4FS2A 4F2SA 8ICTA 2ZUBA 4GFJA 4DL6A 2ZUDA 3KTQA 3UMCA 3PV8A 2JEIA 4QWCA 1NI3A 2UVVA 4C4TA 3V72A 2FPKA 3CW2C 5DQHA 2K4EA 3ISBA 1BPZA 2CPRA 4US8A 4EZ9A 4KN7A 2IBKA 4F5PA 3LK9A 3T79A 4OJ6A 2OHFA 3H0LB 4RQ4A 3UMBA 1CI4A 1QTMA 2KSOA 2C2RA 1ZQSA 4M9JA 1KW4A 3MABA 2F3NA 2WF8A 4UB3A 5HNKA 4XQ8A 3TFRA 3PO4A 1QSSA 3Q8MA 3CNHA 5G5HA 2KVCA 3V7JA 1N5WA 4F5NA 2ZXIA 2ZIWA 2YQEA 4F3OA 2HHVA 3H7IA 3C23A 3RB4A 3PW2A 9ICPA 4YG2A 1BNOA 1SWVA 4TUSA 3IV6A 1TVAA 2M9NA 1SKRA 1PVPA 4DFMA 2QLTA 3I1YA 3ICXA 2W7PA 1ZD2P 3ZDDA 1L8OA 4PL1A 5ALMA 1D9DA 2EQYA 3PSPA 4FZLA 5KL1B 2W9BB 2JEFA 2QB1A 1IV8A 5AKZA 4DSJA 4PZOA 5DDMA 4QIWC 2JH7A 4NM1A 4ECZA 1DXSA 1K5OA 4P0QA 5DG8A 4F5OA 2MU2A 1N63A 2AHOB 2ZIXB 1ZQAA 4DS4A 3QZ7A 1NK6A 5CR0A 4UB8U 5F9NA 2XVTA 2RRDA 4AYBC 4UAWA 4DQIA 1JUDA 5DBCA 2CN1A 2D3DA 2YB4A 3ZDAA 5AM2A 2P35A 5HR7A 2LYBA 1ZQMA 2ZJAA 5ALIA 4UAVA 4M9GA 5KFCA 1S0MA 1Z4NA 1L6NA 1LKYB 2A1AA 3SYZA 1MQ3A 7ICTA 1EXNA 5J0YA 4RQ0A 2ZUCA 3WK9A 5IIIA 1QSLA 3UXPA 5DB9A 4DWIA 2W3SA 4M6WA 4RU9A 2WF9A 5FP0A 4P4OA 1TV9A 1A0PA 1HIWA 2A19A 2HBKA 3PR4A 1LVHA 2VA3A 5AM3A 4IQUA 4NLNA 2P66A 2HHXA 1KTQA 1Z3EB 1S0VA 4UAUA 1ZQUA 1UT5A 3K1ZA 5AI0A 4BXOA 1ZQFA 3OPXA 2EZYA 3KD3A 5KFMA 4RZRA 1H38A 2HOQA 2PXIA 5J0XA 5AKGA 1AROP 4QNLA 5KFLA 2MUTA 4LZGA 1U45A 1KSPA 2G0AA 2XGQA 3PY8A 4NLKA 1JI7A 4KLEA 5KG2A 4UBCA 1NJYA 9ICCA 9ICLA 5J8YA 4UB1A 2GH1A 3LWMA 2YB1A 1ZQPA 4MF2A 1PK1B 5AKYA 3OSPA 2W03A 3C2LA 2F76X 5L1KA 4DL3A 3H8WA 4DL2A 9ICOA 3JPQA 1WG8A 3RH6A 2LM4A 2OYYA 4YD2A 3RRHA 1B43A 3FM9A 4O5CA 4I2JA 2JZBA 2J6SA 2IHNA 4DOBA 5ALLA 3B0YA 4Y2SA 4BGDA 2DWQA 2LBOA 2XCAA 4GLXA 2C22A 2LI6A 2Y1IA 1JN3A 2AH5A 3GILA 1HUOA 3HW8A 4C80A 5AIBA 3WU2U 3FAHA 2KTQA 5J2EA 2XO7A 1ZQXA 3SAHA 2G5HB 2NYVA 2KFNA 1KDHA 2NRZA 4ELVA 1PK1A 2Y9TA 5IIOA 3MR5A 3QX7A 4DFJA 4I2IA 2JMGA 3AQFA 4KMUA 4ED0A 5BOMA 3N7SC 1X9MA 2EAOA 3AU2A 9ICEA 5ALOA 4B9TA 5DDYA 1XS9D 1DRGA 3GV7B 4DF8A 1SB3C 2HHUA 2ZJ8A 1ZQQA 3L3FX 1OUQA 2KKVA 2N1RA 4HAIA 1KKXA 5B66U 5KFWA 5J2IA 9ICRA 2KZZA 3C1YA 1XO0A 2FLPA 4F72A
chains in the Genus database with same CATH topology
2QARB 2E8NA 1SV4A 1UCVA 2EAPA 5JRTA 2EANA 1JI7A 3BQ7A 2QB1A 1SGGA 4PZOA 5J8YA 2QB0B 1WWUA 4NL9C 2QARA 1DXSA 2DL0A 2F8KA 4NL9A 3TACB 1PK1B 1SXEA 2F44A 1PK3A 1RG6A 1LKYA 1WWVA 2LPEA 2D3DA 2GLEA 2FE9A 3HILA 2KIVA 2ES6A 4NJ8A 1X66A 4RQNA 5L1MA 2D8CA 1LKYB 2E8MA 2DKZA 3IDWA 3BS5A 3BS5B 2K4PA 3TADC 3KKAC 2KE7A 5F3XB 2KSOA 1KW4A 3SEIA 2F3NA 2LMRA 1SV0C 3TADA 1B0XA 1OW5A 5JU5A 1V85A 1OXJA 5JTIA 3H8MA 1COKA 1X40A 2ESEA 1SV0A 2L5YA 1B4FA 1PK1A 2Y9TA 1UQVA 3BS7A 3KKAA 2QKQA 2DKXA 2K60A 4MHVA 2KG5A 2B6GA 4PZNA 2E8OA 3K1RB 2EAMA 2EAOA 2KMDA 1SXDA 1V38A 4IS7A 2Y9UA 2YTUA 3SENA 1F0MA 2JV3A 4RQMA 1X9XA 2E8PA 2QB0A 5KNIA 1Z1VA 5J8YC 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR B;  2E8N A;  1SV4 A;  1UCV A;  2EAP A;  5JRT A;  2EAN A;  1JI7 A;  3BQ7 A;  2QB1 A;  1SGG A;  4PZO A;  5J8Y A;  2QB0 B;  1WWU A;  4NL9 C;  2QAR A;  1DXS A;  2DL0 A;  2F8K A;  4NL9 A;  3TAC B;  1PK1 B;  1SXE A;  2F44 A;  1PK3 A;  1RG6 A;  1LKY A;  1WWV A;  2LPE A;  2D3D A;  2GLE A;  2FE9 A;  3HIL A;  2KIV A;  2ES6 A;  4NJ8 A;  1X66 A;  4RQN A;  5L1M A;  2D8C A;  1LKY B;  2E8M A;  2DKZ A;  3IDW A;  3BS5 A;  3BS5 B;  2K4P A;  3TAD C;  3KKA C;  2KE7 A;  5F3X B;  2KSO A;  1KW4 A;  3SEI A;  2F3N A;  2LMR A;  1SV0 C;  3TAD A;  1B0X A;  1OW5 A;  5JU5 A;  1V85 A;  1OXJ A;  5JTI A;  3H8M A;  1COK A;  1X40 A;  2ESE A;  1SV0 A;  2L5Y A;  1B4F A;  1PK1 A;  2Y9T A;  1UQV A;  3BS7 A;  3KKA A;  2QKQ A;  2DKX A;  2K60 A;  4MHV A;  2KG5 A;  2B6G A;  4PZN A;  2E8O A;  3K1R B;  2EAM A;  2EAO A;  2KMD A;  1SXD A;  1V38 A;  4IS7 A;  2Y9U A;  2YTU A;  3SEN A;  1F0M A;  2JV3 A;  4RQM A;  1X9X A;  2E8P A;  2QB0 A;  5KNI A;  1Z1V A;  5J8Y C;  2KSO B; 
#chains in the Genus database with same CATH topology
 2QAR B;  2BCU A;  5HMM A;  5BPC A;  2F1H A;  4DLG A;  2ATL A;  2KVS A;  5A0L A;  5AM1 A;  1SGG A;  3GIJ A;  4MFF A;  1O03 A;  3C1Z A;  2OWO A;  4RT3 A;  3JPO A;  5CRX A;  3BZK A;  3BQ2 A;  2W9B A;  3MDC A;  1KRP A;  1WCL A;  3OJU A;  1RG6 A;  4DL4 A;  2Z7J A;  2F77 X;  1T94 A;  4EYH B;  2BZF A;  3QYP A;  3QU2 A;  2Y1J A;  3MFH A;  4OD0 A;  5ALF A;  2E1E A;  5J0W A;  3F2C A;  1ZXI A;  4C4R A;  2BDP A;  4F5Q A;  5KT6 A;  2E3T A;  4GXJ A;  1T8E A;  3SI8 A;  2H3I A;  5AKK A;  3K75 D;  5KFD A;  3QXG A;  4GC7 A;  4YN4 A;  4IC9 A;  3ONN A;  3EUB 2;  1S0O A;  2LMR A;  3GV5 B;  5KFO A;  4C8O A;  4EEY A;  4DSF A;  1JRO A;  1L7O A;  3RF9 A;  4ECS A;  3PX0 A;  3Q8S B;  3HKZ F;  9ICW A;  4KLG A;  4UW9 A;  4ECX A;  4EBE A;  1K1S A;  1X6I A;  3AM9 A;  3PSI A;  3VC8 A;  4B9S A;  4C8N A;  2XID A;  1K1Q A;  4LJX A;  4O3P A;  4F4Z A;  1QQ7 A;  2AGP A;  2VJ4 A;  4J03 A;  2KMD A;  3QNM A;  3F2D A;  3AN1 A;  5AHX A;  9ICH A;  5J2H A;  2D6F C;  4F4K A;  2VIX A;  2JV3 A;  2FI1 A;  5AI4 A;  4J9O A;  8ICW A;  2ZIX A;  4QZG A;  4B9U A;  1Z19 A;  4DSK A;  5CEH A;  3MR3 A;  3H40 A;  2NO5 A;  3D2N A;  3IG5 A;  4JWN A;  4ELT A;  2JH1 A;  1XSL A;  3JPP A;  4F93 B;  1BPB A;  2PI5 A;  2F2A B;  5J0U A;  4NL9 A;  4O3N A;  3TAQ A;  2PFN A;  4OJP A;  5EWE A;  4Y2R A;  3QEA Z;  5C0Y A;  4RT2 A;  2LM1 A;  4M2Y A;  4KMO B;  4B9N A;  4G3I A;  3QE9 Y;  2GLE A;  4TUR A;  3NAS A;  2BGW A;  2V4R A;  3QUC A;  2P6U A;  2ZIV B;  2A3V A;  3NVY A;  3A0H U;  1RDF A;  2YN4 A;  1U48 A;  1PVR A;  2BCR A;  1TAQ A;  1HEK A;  2RQ5 A;  5DBA A;  4USA A;  1QQ5 A;  5J2B A;  1V85 A;  4K4I A;  1OXJ A;  5D46 A;  5JTI A;  3H8M A;  9ICK A;  2OH2 A;  3PW5 A;  1FIQ A;  5KFH A;  3PX6 A;  4J9R A;  2PI4 A;  3WK5 A;  5J2D A;  4O9M A;  5AIA A;  4O5K A;  5HHH A;  4PPX A;  2ASJ A;  1IG6 A;  2R8H A;  2WB1 C;  4KLL A;  5ALE A;  1B22 A;  3KBB A;  4PZN A;  3WK4 A;  4CCH A;  4DO9 A;  3AL0 B;  1DK2 A;  1SXD A;  2IA6 A;  5KFA A;  4QWE A;  4IS7 A;  5KFB A;  2OM6 A;  4K4G A;  1VJ5 A;  4NLB A;  2WF6 A;  2HVH A;  3MGI A;  5AKX A;  1JXE A;  4FFD A;  2FJ6 A;  3J81 j;  1M6Y A;  3FYH A;  2EZZ A;  9ICI A;  3HJE A;  1WCN A;  2KSO B;  4DL5 A;  5ALJ A;  2WHE A;  5KFZ A;  4JV1 A;  4KLM A;  4MFC A;  1ZD4 A;  1KBU A;  1ZQK A;  4QZE A;  4U7C A;  5KG5 A;  5GTI U;  4ED1 A;  2F8K A;  5KFT A;  4QWB A;  3G6V A;  2HOI A;  4DFP A;  5KAI U;  4J9P A;  5HML A;  2YMM A;  2VA2 A;  2HBL A;  1PK3 A;  3LDA A;  1LKY A;  4KLD A;  5AK5 A;  9ICM A;  2B0C A;  1WUD A;  4MF8 A;  4JV2 A;  4QJF B;  2DFL A;  4FBU A;  3KFU F;  1NJX A;  2KIV A;  2ZXH A;  4ZOH C;  3NVZ A;  1NK5 A;  1QCK A;  2H3Q A;  1ZQH A;  4M47 A;  5GTH U;  4I2D A;  7ICO A;  2PMZ F;  3H0M B;  2JGA A;  3Q8L A;  4KLT A;  3RFA A;  4F5R A;  3B9J A;  3GII A;  4DSE A;  5KFU A;  1SZP A;  4C0Z A;  1KLN A;  5CHG A;  4RNM A;  5ALP A;  1J97 A;  3PVX A;  5DQG A;  2K60 A;  4I2E A;  7ICL A;  3ISC A;  2KHQ A;  4QZ8 A;  5KT2 A;  4O0I A;  4OJL A;  3H8S A;  1MC8 A;  4YR2 A;  5AKL A;  2P6R A;  4ECW A;  2WF7 A;  2DBY A;  1BPD A;  3PML A;  2HBJ A;  8ICG A;  1D8B A;  2RP5 A;  3M8S A;  4B6J A;  3M7D A;  4QZF A;  5AK3 A;  2JXJ A;  1QQ6 A;  4U6P A;  3T5J A;  1YZ6 A;  2KEY A;  2UVU A;  4ICA A;  4KX3 A;  4TUP A;  5KFJ A;  2BPF A;  4NL9 C;  1XSN A;  2QAR A;  2ZTC A;  2C28 A;  3QU9 A;  2FPL A;  2NRW A;  1XO1 A;  3LVV A;  2JEJ A;  1Z1B A;  2WAQ F;  1ZD5 A;  1D8L A;  4Q43 A;  3AUO A;  4UAS A;  3QU4 A;  3TQ1 A;  3AMZ A;  2K8B B;  3OSN A;  1KEJ A;  2VKQ A;  4MEY A;  4NJ8 A;  1NK7 A;  4RUA A;  3RJF A;  1N61 A;  4J9S A;  3RJI A;  1Q3V A;  4I2C A;  5ALW A;  3KKA C;  2KKP A;  1KFS A;  3HKZ C;  3RTV A;  2NRT A;  5AI9 A;  1DGJ A;  3OGU A;  3ZDC A;  5CB1 A;  1Z00 A;  4O3O A;  3GZF A;  3GIM A;  5DB8 A;  4CDG A;  3Q8Q B;  4DQR A;  7ICF A;  4M04 A;  5HP4 A;  1S8O A;  1B4F A;  3THV A;  8ICA A;  5AM5 A;  4YQW A;  2XY7 A;  4EX6 A;  4RPZ A;  5IIJ A;  4I2G A;  3ZD8 A;  1Q8K A;  2BQ3 A;  3QEB Z;  3JPS A;  4ACO A;  2H5X A;  1HJP A;  8ICL A;  3OHA A;  4C8K A;  1QLN A;  4YMO A;  3KHR A;  2BCV A;  2R18 A;  2I9G A;  3ZD9 A;  8ICC A;  2XIC A;  1TE2 A;  1ZQE A;  8ICY A;  2RDI A;  1ZQN A;  1ZJN A;  4F71 A;  2EDU A;  2BQU A;  5EWF A;  2XI9 A;  2Q4T A;  2UVR A;  4BDP A;  2ISO A;  4FS1 A;  1RM6 C;  4M0A A;  1ZQZ A;  8ICP A;  1L3T A;  2GO7 A;  1L8L A;  2DQN B;  3V6H A;  3SQI A;  3V6J A;  3OJS A;  5KFS A;  5DGB A;  4PHA A;  5ALU A;  2BCQ A;  1L3S A;  1D8Y A;  3MR6 A;  5KFR A;  1X6J A;  2NRV A;  2V4Q A;  1KQQ A;  2F44 A;  3LYS A;  3IM1 A;  2MAX A;  3MFI A;  1SL2 A;  5J2A A;  3DV9 A;  2NO4 A;  1NK0 A;  4Q8E A;  2FE9 A;  3N7P D;  1KN5 A;  4YCX A;  8ICQ A;  1ZRM A;  3PSF A;  4BX9 C;  8ICV A;  1COO A;  4DFD A;  3QU7 A;  1RQN A;  3RR8 A;  3C2M A;  4OO1 J;  5J0P A;  2ZIV A;  4GXK A;  2C2D A;  1XSP A;  4P0P B;  2FDR A;  2BQR A;  2W55 A;  3T5H A;  1FEZ A;  4ECY A;  3H4D A;  2ZJ5 A;  2HHT A;  4IQT A;  3WK6 A;  4AYB F;  1NJW A;  3HRD D;  1NZB A;  1UQV A;  1N62 A;  3SV3 A;  4Q45 A;  4UAY A;  3WKC A;  3KZI U;  1F5S A;  4IQV A;  2E1F A;  5KT7 A;  4YMM A;  2HDO A;  2ASD A;  2WAQ C;  2Y9U A;  3R9K A;  4QW8 A;  2GWS A;  1UHU A;  3JPN A;  2YTU A;  3TI0 A;  3M6Z A;  1X9S A;  5DLG A;  1PVQ A;  3KHH A;  1JRP A;  4QZH A;  3Q8R B;  1NK4 A;  1D9F A;  3EYZ A;  2ZIU B;  3BDP A;  5T14 A;  4DOC A;  4E0D A;  5EWG A;  4O5E A;  1JXL A;  3RJE A;  5J2G A;  2IMW P;  9ICV A;  5J0O A;  4R65 A;  3KHG A;  3T5L A;  5ALV A;  2LHT A;  2HOF A;  5DQI A;  1NZP A;  2ODG A;  1ZQG A;  2PFO A;  3HP6 A;  3UPQ A;  5EOZ A;  3TAC B;  2YMP A;  1DK3 A;  3C2K A;  2W11 A;  1RQL A;  1U47 A;  7ICE A;  9ICU A;  4OCZ A;  3RJG A;  9ICX A;  4Y2U A;  4DS5 A;  1ZQB A;  2HI0 A;  4DCC A;  4J9Q A;  3A0B U;  4Y2Q A;  1RYR A;  1YT3 A;  1ZQ1 C;  7ICG A;  3CRX A;  2VA8 A;  4YD1 A;  4BWM A;  2XCP A;  4UB4 A;  3ZDE A;  3PO5 A;  2DKZ A;  5AI6 A;  4RNN A;  1SKS A;  4JUZ A;  1ZQD A;  2DGZ A;  2KHV A;  1JIH A;  2LYH A;  7ICH A;  1BPY A;  2H3Z A;  3NUQ A;  1SV0 C;  1PUZ A;  9ICJ A;  4F4X A;  2W43 A;  3T5K A;  2XY5 A;  1FFU A;  4P2H A;  4IQW A;  4PJ0 U;  3ED5 A;  4LVS A;  2ESE A;  4Z6F A;  3PX4 A;  2DPI A;  2L5Y A;  3MBY A;  3BQ0 A;  1SL0 A;  4ED3 A;  4M9N A;  4DLE A;  4KTQ A;  2MRL A;  4B9L A;  5AM4 A;  2W54 A;  5TIS U;  5KTQ A;  5KFX A;  1BPX A;  4KLQ A;  5DB7 A;  1ZQR A;  3VCB A;  3GV8 B;  4EEL A;  3U26 A;  2KN7 A;  5ALS A;  1ZET A;  2R8K A;  4BWJ A;  9ICA A;  2M0N A;  5EE0 A;  3I28 A;  1P7D A;  1ZQT A;  1YZ7 A;  3M9N B;  4ZH4 A;  4JWM A;  1Z1V A;  5ALZ A;  4P0P A;  2BR0 A;  8ICJ A;  4PGY A;  3MGH A;  3HWT A;  4JK1 A;  2A1J A;  3EWA A;  1Q3U A;  2G06 A;  3EPG A;  1WYG A;  4Z6E A;  4DF4 A;  1L7N A;  4QZ9 A;  1ZYQ A;  3RB6 A;  2XY6 A;  9ICS A;  1S9F A;  1AQ6 A;  5KG6 A;  4JV0 A;  5F9L A;  4CF5 A;  2YX8 A;  3E0F A;  2BPG A;  1S10 A;  2AGQ A;  1U49 A;  4C8M A;  3N28 A;  5KFQ A;  1BPE A;  4X5V A;  3CYM A;  1F44 A;  2ES6 A;  1X66 A;  2KJ5 A;  4XUS A;  3BS5 A;  5DG7 A;  3RH4 A;  2K4P A;  5AM0 A;  2HHS A;  2FLL A;  4Y2J A;  3SD7 A;  1S0N A;  1S97 A;  3GDX A;  4BXO B;  4ED7 A;  4RQ6 A;  1B0X A;  2KNJ A;  1N5X A;  1ZRN A;  2AXT U;  5CWR A;  5J2K A;  4EYI B;  5IIN A;  2CXY A;  3OHB A;  4TQS A;  2JRZ A;  3JPT A;  1NNL A;  4CF3 A;  4O3M A;  4NV0 A;  8ICX A;  7ICQ A;  5KAF U;  3DEE A;  4MHV A;  2KIW A;  4ELU A;  5KFP A;  2I1Q A;  3C21 A;  2WTF A;  4K4H A;  3SAG A;  1N48 A;  1QSY A;  8ICU A;  2PFQ A;  3M1Y A;  9ICG A;  4J9M A;  3BJY A;  4P4M A;  7ICK A;  2H3V A;  1Z00 B;  5AIC A;  5E79 U;  3TAP A;  4IR9 A;  5DGA A;  4UB5 A;  3V7L A;  2DF4 B;  3NGD A;  2E8N A;  5KFN A;  2W9C A;  4Z6D A;  1L5U A;  5JRT A;  5L1I A;  7ICR A;  2JR5 A;  1NJZ A;  3CP8 A;  1ZQI A;  5KFV A;  3IHQ B;  5JUM A;  3SV4 A;  1Z4O A;  5AKE A;  3TAR A;  3RAQ A;  4OJ5 A;  4O3S A;  1WWV A;  4UB2 A;  4J9K A;  4FZN A;  3ZDB A;  2Y0S F;  4RQ2 A;  3G6Y A;  1RXW A;  5AK4 A;  2AJQ A;  4PGX A;  2J6T A;  2OCE A;  3IDW A;  4P4P A;  3TAD C;  4R66 A;  1ZOL A;  1CRX A;  1MN8 A;  5ALT A;  2VJ5 A;  2W7O A;  2KP7 A;  2DPJ A;  7ICJ A;  4DFK A;  2KV2 A;  2K8C B;  1CEZ A;  4FBT A;  2PMZ C;  4KIT B;  4R64 A;  4YR0 A;  3H4B A;  5ALR A;  8ICR A;  1JX4 A;  9ICF A;  1NKC A;  3RB3 A;  3UQ0 A;  3M9M B;  5AK6 A;  1TAU A;  1TK5 A;  3TAN A;  2R8G A;  3M8R A;  1TKD A;  4UAZ A;  4MFA A;  1ZQJ A;  4KLJ A;  5J2C A;  1TFR A;  5G5G A;  4FZM A;  5KT5 A;  4NXZ A;  4PL2 A;  1ZQO A;  4C7Y A;  4PGQ A;  2W9A A;  8ICI A;  1ZJM A;  2RHF A;  3UQ2 A;  1O08 A;  4I28 A;  5KG1 A;  3H8J A;  5CA7 A;  7ICP A;  2WF5 A;  2BKE A;  4Y2P A;  3LVW A;  1UPH A;  2F8L A;  2HBM A;  4Y2Y A;  1JMS A;  1S77 D;  1A76 A;  2MUT B;  2W04 A;  4EEK A;  5J29 A;  2OXO A;  5KFF A;  1SL1 A;  1S76 D;  4I2H A;  3TKA A;  1MQ2 A;  4QZA A;  2W9M A;  4ECT A;  1ZD3 A;  1SZH A;  2I6X A;  2AU0 A;  3DDH A;  3V6K A;  2H3F A;  1L3V A;  2V9W A;  4RQ3 A;  4WJ3 B;  1SWW A;  4CRX A;  3ALR A;  2A1J B;  2AQ4 A;  1U9L A;  3RBE A;  1L7P A;  3GFK B;  3ISD A;  1URJ A;  2W3R A;  4PHP A;  1T3N A;  3M9O B;  4PH5 A;  4C4S A;  8ICZ A;  1V97 A;  2AGO A;  5JU5 A;  1SKW A;  3UMG A;  3KHL A;  7ICN A;  1X40 A;  4RQ1 A;  2B21 A;  3EPI A;  4F91 B;  4BUG A;  4NLG A;  4IRC A;  2YML A;  3WK7 A;  3O0F A;  2W8K A;  4BJQ A;  5D4B A;  2KZ3 A;  2ZTD A;  2KG5 A;  1MA7 A;  4ECV A;  5TZV A;  4J9N A;  5J0T A;  2EAM A;  1N60 A;  2KJ8 A;  3K4G A;  5AKH A;  2KJ9 A;  2W8L A;  2Q0Z X;  2KIC A;  1L7M A;  4DOA A;  3QU5 A;  5EE1 A;  5DB6 A;  1IIP A;  3PST A;  4CF4 A;  4ECR A;  2C2E A;  3SEN A;  2KK0 A;  1X9X A;  3QUT A;  3RB0 A;  1RZT A;  1X2I A;  5ALK A;  3PW0 A;  3JPR A;  3Q8K A;  3RH5 A;  5KFE A;  1X42 A;  3GIK A;  2Y0S C;  4ED8 A;  4PHE A;  4A8E A;  4F2R A;  4PHD A;  5B5E U;  3TFS A;  3ETR A;  9ICQ A;  5AKI A;  1TAM A;  4UBB A;  2FMP A;  4EBD A;  1XNS A;  2HW3 A;  4CGZ A;  2R8J A;  2OEH A;  2CRX A;  3AEV A;  8ICB A;  5J0Q A;  9ICB A;  1ZQV A;  4M9L A;  1PZN A;  2G07 A;  5L9X A;  3IN5 A;  4I2F A;  2NRX A;  3UM9 A;  2W9C B;  4QZI A;  4QW9 A;  4M9H A;  1ZQY A;  4QZC A;  5KG4 A;  5AI8 A;  4QWA A;  1T3Q A;  1KFT A;  4RQ8 A;  2R8I A;  4KLH A;  3OTQ A;  2BPC A;  4DQS A;  4P0Q B;  3PMN A;  5K4L A;  3PW7 A;  1DGS A;  5DBB A;  2ISP A;  3NRW A;  1COK A;  1SV0 A;  5EE3 A;  3SR6 A;  3BS7 A;  2FPM A;  4NM2 A;  3HT3 A;  1BVS A;  5IIK A;  1ZQW A;  4F92 B;  5KFG A;  4R63 A;  1ZQL A;  1VDV A;  3WKA A;  1RYS A;  5BOL A;  2ALZ A;  4Q44 A;  1UT8 A;  1V38 A;  1GO3 F;  3FC4 A;  2HSZ A;  2ZTE A;  2FLN A;  3WKD A;  4YMN A;  2I5H A;  4FO6 A;  4YXJ A;  1RXV A;  1LB2 B;  4UAR A;  4HYK A;  2PKE A;  2KZM A;  4F50 A;  2KOB A;  4UB6 U;  7ICI A;  3ETL A;  4KLS A;  4M6W B;  1WWU A;  5KG7 A;  3F5E A;  5J2F A;  3N4M B;  7ICV A;  4RPX A;  4ED2 A;  3LWL A;  4FE3 A;  4JB3 A;  1T4G A;  3MC1 A;  3RRG A;  4AP9 A;  1NKE A;  5J2J A;  3H0R B;  1UA0 A;  2F1J A;  4QWD A;  2O6K A;  4I2A A;  2GOL A;  3SMV A;  5KL8 B;  3F5A A;  1NOM A;  2IOF A;  4EX7 A;  4Z6C A;  4NLC A;  9ICT A;  3MGV A;  5ALD A;  3QUQ A;  2FMS A;  4R8U B;  1IXR A;  4GIB A;  2MA1 A;  5AI5 A;  3RBD A;  2LYA A;  3AQE A;  2UVW A;  4DQQ A;  5DKW A;  3F2B A;  4UAT A;  5J0R A;  3C29 A;  3HPO A;  3IP4 B;  1C7Y A;  2HCF A;  2WFA A;  3M6K A;  3KZX A;  3IG8 A;  5KFI A;  4KLF A;  2B6G A;  4IRK A;  3GU3 A;  8ICK A;  2RDJ A;  2F1I A;  3E2E A;  1U4B A;  4RPY A;  2HHW A;  1VLB A;  3MDA A;  4KLU A;  2AQ0 A;  1KFD A;  2KD1 A;  4CNQ A;  7ICM A;  2DUY A;  3HX0 A;  4F4W A;  1FFV A;  8ICS A;  4Q8F A;  4Y2V A;  4RQ5 A;  5H2F U;  2HMX A;  1MSW D;  4DSI A;  4NY8 A;  5J8Y C;  2K4H A;  3RJK A;  4J9L A;  8ICE A;  1UCV A;  4ECU A;  4XRH A;  2LKY A;  1NK8 A;  3C28 A;  1SIJ A;  2WB1 F;  1BNP A;  4US9 A;  2QB0 B;  3SZ2 A;  1KL9 A;  5ALY A;  3N7R C;  4XA5 A;  5L1L A;  1ECW A;  8ICO A;  2NV3 A;  4Y2X A;  2DL0 A;  2ASL A;  3RAX A;  5L1J A;  1SXE A;  2BCS A;  3ZI4 A;  2XGP A;  3BQT A;  3E58 A;  2LPE A;  1C20 A;  4B9M A;  5HHI A;  3PNC A;  3HIL A;  5IIL A;  2ZIW B;  2K4I A;  3AU6 A;  1RPL A;  5L1M A;  2E8M A;  4QZD A;  4C7Z A;  4ECQ A;  4TQR A;  3NVW A;  4KLI A;  1J2N A;  5ALQ A;  4O3Q A;  4RQ7 A;  3RJJ A;  8ICN A;  3IRU A;  3G6X A;  4I27 A;  1UA1 A;  5ALN A;  3TAD A;  5D49 A;  2KFZ A;  8ICH A;  1TK8 A;  4RNO A;  1Y88 A;  1NKB A;  2K8A A;  3NS1 A;  2G08 A;  4NWI A;  8ICF A;  3F53 A;  4LZD A;  2BDU A;  4ED6 A;  3KKA A;  4CE6 A;  2QKQ A;  1NK9 A;  2DKX A;  1IM4 A;  2E8O A;  4I29 A;  4F8R A;  3WKE A;  4EEN A;  5DLF A;  3EW9 A;  4QZB A;  4I2B A;  1HUZ A;  4IRD A;  7ICS A;  1S5L U;  3UXN A;  4IR1 A;  3NVV A;  7ICU A;  3D6J A;  1F0M A;  4Y2T A;  2PFP A;  3PZP A;  1N56 A;  5KT3 A;  1JAL A;  3UXO A;  4DQP A;  5KNI A;  2IHM A;  1RYU A;  2MSN A;  2RLT A;  3FDS A;  3L5K A;  1SV4 A;  3Q8P B;  1XC9 A;  5AKJ A;  3BQ7 A;  3D2Q A;  4UQG A;  2BHN A;  4KN4 A;  4F4Y A;  4KLO A;  1TK0 A;  1ED1 A;  2IOF K;  3C5F A;  1FO4 A;  4NLZ A;  2ZG6 A;  1DOQ A;  5KG0 A;  5KG3 A;  2HHQ A;  1X9W A;  5ALG A;  4YP3 A;  2G09 A;  4YR3 A;  4YFK A;  4G9B A;  4B9V A;  2FMQ A;  3D2S A;  2HVI A;  3T3F A;  4KX5 A;  4RUC A;  4RQN A;  4EZ6 A;  1CUK A;  3PR5 B;  2EH9 A;  2D8C A;  4MEX A;  5KT4 A;  4EBC A;  3BS5 B;  4DL7 A;  5DG9 A;  5IIM A;  3QZ8 A;  5ALH A;  1LV5 A;  4DEZ A;  2KE7 A;  5F3X B;  3MR2 A;  3GQC A;  3EZ5 A;  4OJO A;  3BQ1 A;  4C8L A;  1XWL A;  3RR7 A;  2G5I B;  3SEI A;  4GC6 A;  3L4P A;  1OW5 A;  5C5J A;  2IOH A;  3S6J A;  1Q46 A;  2JEG A;  5J0S A;  3QUB A;  1N2X A;  1V9P A;  2JZB B;  2ZIU A;  2EZX A;  4QIW F;  1A6S A;  3K1R B;  4YVZ A;  2VAN A;  1XU4 A;  2JHD A;  9ICN A;  4R8U A;  2YY6 A;  8ICM A;  4O3R A;  5ALX A;  1QH9 A;  2K89 A;  2XC9 A;  3I76 A;  4IL6 U;  1J2M A;  4RQM A;  5CJ7 A;  3WKB A;  4JMU A;  2E8P A;  1ZQC A;  1T7P A;  2QB0 A;  3NTU A;  3NRZ A;  4GXI A;  5HR6 A;  1A77 A;  3B0X A;  5CP2 A;  4YXM A;  2EAP A;  2EAN A;  3PW4 A;  3ORY A;  1BGX T;  2E5S A;  5KFY A;  5EE9 A;  3BZC A;  1L3U A;  2J6U A;  3V7K A;  3RJH A;  4DSL A;  4TUQ A;  3N97 B;  2YMQ A;  3KOO A;  3WK8 A;  3C5G A;  5KFK A;  3SAF A;  4FS2 A;  4F2S A;  8ICT A;  2ZUB A;  4GFJ A;  4DL6 A;  2ZUD A;  3KTQ A;  3UMC A;  3PV8 A;  2JEI A;  4QWC A;  1NI3 A;  2UVV A;  4C4T A;  3V72 A;  2FPK A;  3CW2 C;  5DQH A;  2K4E A;  3ISB A;  1BPZ A;  2CPR A;  4US8 A;  4EZ9 A;  4KN7 A;  2IBK A;  4F5P A;  3LK9 A;  3T79 A;  4OJ6 A;  2OHF A;  3H0L B;  4RQ4 A;  3UMB A;  1CI4 A;  1QTM A;  2KSO A;  2C2R A;  1ZQS A;  4M9J A;  1KW4 A;  3MAB A;  2F3N A;  2WF8 A;  4UB3 A;  5HNK A;  4XQ8 A;  3TFR A;  3PO4 A;  1QSS A;  3Q8M A;  3CNH A;  5G5H A;  2KVC A;  3V7J A;  1N5W A;  4F5N A;  2ZXI A;  2ZIW A;  2YQE A;  4F3O A;  2HHV A;  3H7I A;  3C23 A;  3RB4 A;  3PW2 A;  9ICP A;  4YG2 A;  1BNO A;  1SWV A;  4TUS A;  3IV6 A;  1TVA A;  2M9N A;  1SKR A;  1PVP A;  4DFM A;  2QLT A;  3I1Y A;  3ICX A;  2W7P A;  1ZD2 P;  3ZDD A;  1L8O A;  4PL1 A;  5ALM A;  1D9D A;  2EQY A;  3PSP A;  4FZL A;  5KL1 B;  2W9B B;  2JEF A;  2QB1 A;  1IV8 A;  5AKZ A;  4DSJ A;  4PZO A;  5DDM A;  4QIW C;  2JH7 A;  4NM1 A;  4ECZ A;  1DXS A;  1K5O A;  4P0Q A;  5DG8 A;  4F5O A;  2MU2 A;  1N63 A;  2AHO B;  2ZIX B;  1ZQA A;  4DS4 A;  3QZ7 A;  1NK6 A;  5CR0 A;  4UB8 U;  5F9N A;  2XVT A;  2RRD A;  4AYB C;  4UAW A;  4DQI A;  1JUD A;  5DBC A;  2CN1 A;  2D3D A;  2YB4 A;  3ZDA A;  5AM2 A;  2P35 A;  5HR7 A;  2LYB A;  1ZQM A;  2ZJA A;  5ALI A;  4UAV A;  4M9G A;  5KFC A;  1S0M A;  1Z4N A;  1L6N A;  1LKY B;  2A1A A;  3SYZ A;  1MQ3 A;  7ICT A;  1EXN A;  5J0Y A;  4RQ0 A;  2ZUC A;  3WK9 A;  5III A;  1QSL A;  3UXP A;  5DB9 A;  4DWI A;  2W3S A;  4M6W A;  4RU9 A;  2WF9 A;  5FP0 A;  4P4O A;  1TV9 A;  1A0P A;  1HIW A;  2A19 A;  2HBK A;  3PR4 A;  1LVH A;  2VA3 A;  5AM3 A;  4IQU A;  4NLN A;  2P66 A;  2HHX A;  1KTQ A;  1Z3E B;  1S0V A;  4UAU A;  1ZQU A;  1UT5 A;  3K1Z A;  5AI0 A;  4BXO A;  1ZQF A;  3OPX A;  2EZY A;  3KD3 A;  5KFM A;  4RZR A;  1H38 A;  2HOQ A;  2PXI A;  5J0X A;  5AKG A;  1ARO P;  4QNL A;  5KFL A;  2MUT A;  4LZG A;  1U45 A;  1KSP A;  2G0A A;  2XGQ A;  3PY8 A;  4NLK A;  1JI7 A;  4KLE A;  5KG2 A;  4UBC A;  1NJY A;  9ICC A;  9ICL A;  5J8Y A;  4UB1 A;  2GH1 A;  3LWM A;  2YB1 A;  1ZQP A;  4MF2 A;  1PK1 B;  5AKY A;  3OSP A;  2W03 A;  3C2L A;  2F76 X;  5L1K A;  4DL3 A;  3H8W A;  4DL2 A;  9ICO A;  3JPQ A;  1WG8 A;  3RH6 A;  2LM4 A;  2OYY A;  4YD2 A;  3RRH A;  1B43 A;  3FM9 A;  4O5C A;  4I2J A;  2JZB A;  2J6S A;  2IHN A;  4DOB A;  5ALL A;  3B0Y A;  4Y2S A;  4BGD A;  2DWQ A;  2LBO A;  2XCA A;  4GLX A;  2C22 A;  2LI6 A;  2Y1I A;  1JN3 A;  2AH5 A;  3GIL A;  1HUO A;  3HW8 A;  4C80 A;  5AIB A;  3WU2 U;  3FAH A;  2KTQ A;  5J2E A;  2XO7 A;  1ZQX A;  3SAH A;  2G5H B;  2NYV A;  2KFN A;  1KDH A;  2NRZ A;  4ELV A;  1PK1 A;  2Y9T A;  5IIO A;  3MR5 A;  3QX7 A;  4DFJ A;  4I2I A;  2JMG A;  3AQF A;  4KMU A;  4ED0 A;  5BOM A;  3N7S C;  1X9M A;  2EAO A;  3AU2 A;  9ICE A;  5ALO A;  4B9T A;  5DDY A;  1XS9 D;  1DRG A;  3GV7 B;  4DF8 A;  1SB3 C;  2HHU A;  2ZJ8 A;  1ZQQ A;  3L3F X;  1OUQ A;  2KKV A;  2N1R A;  4HAI A;  1KKX A;  5B66 U;  5KFW A;  5J2I A;  9ICR A;  2KZZ A;  3C1Y A;  1XO0 A;  2FLP A;  4F72 A; 
#chains in the Genus database with same CATH homology
 2QAR B;  2E8N A;  1SV4 A;  1UCV A;  2EAP A;  5JRT A;  2EAN A;  1JI7 A;  3BQ7 A;  2QB1 A;  1SGG A;  4PZO A;  5J8Y A;  2QB0 B;  1WWU A;  4NL9 C;  2QAR A;  1DXS A;  2DL0 A;  2F8K A;  4NL9 A;  3TAC B;  1PK1 B;  1SXE A;  2F44 A;  1PK3 A;  1RG6 A;  1LKY A;  1WWV A;  2LPE A;  2D3D A;  2GLE A;  2FE9 A;  3HIL A;  2KIV A;  2ES6 A;  4NJ8 A;  1X66 A;  4RQN A;  5L1M A;  2D8C A;  1LKY B;  2E8M A;  2DKZ A;  3IDW A;  3BS5 A;  3BS5 B;  2K4P A;  3TAD C;  3KKA C;  2KE7 A;  5F3X B;  2KSO A;  1KW4 A;  3SEI A;  2F3N A;  2LMR A;  1SV0 C;  3TAD A;  1B0X A;  1OW5 A;  5JU5 A;  1V85 A;  1OXJ A;  5JTI A;  3H8M A;  1COK A;  1X40 A;  2ESE A;  1SV0 A;  2L5Y A;  1B4F A;  1PK1 A;  2Y9T A;  1UQV A;  3BS7 A;  3KKA A;  2QKQ A;  2DKX A;  2K60 A;  4MHV A;  2KG5 A;  2B6G A;  4PZN A;  2E8O A;  3K1R B;  2EAM A;  2EAO A;  2KMD A;  1SXD A;  1V38 A;  4IS7 A;  2Y9U A;  2YTU A;  3SEN A;  1F0M A;  2JV3 A;  4RQM A;  1X9X A;  2E8P A;  2QB0 A;  5KNI A;  1Z1V A;  5J8Y C;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...