4PZOA

Crystal structure of phc3 sam l967r
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
70
Chain Sequence
b'TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKRGPALKIARINSLKESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyhomeotic-like protein 3
publication title Multiple polymer architectures of human polyhomeotic homolog 3 sterile alpha motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 70
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4pzoA00
4RQMA 4IS7A 5JTIA 5L1MA 1X66A 4PZOA 5KNIA 2ESEA 5JRTA 1X40A 3KKAA 1SGGA 4NJ8A 2Y9TA 3IDWA 4PZNA 2EAMA 3BQ7A 3TACB 2QARB 1RG6A 5F3XB 1PK3A 2LPEA 2EAPA 2EAOA 1SV0A 1V85A 2DKXA 2E8PA 4NL9A 2KE7A 2D8CA 1OXJA 3H8MA 1LKYA 2DL0A 2GLEA 5J8YC 1WWUA 1V38A 1JI7A 2JV3A 1B0XA 2LMRA 1OW5A 2QB0A 3TADC 1KW4A 2L5YA 3K1RB 4MHVA 2FE9A 2YTUA 3BS5A 1UQVA 2EANA 1X9XA 3BS7A 1LKYB 1WWVA 2K4PA 1SXDA 1DXSA 2B6GA 1COKA 1PK1B 2K60A 2E8OA 3KKAC 2QB0B 1PK1A 2QKQA 2F3NA 2KSOB 2F8KA 5JU5A 2Y9UA 3BS5B 2E8MA 2KSOA 1Z1VA 1SV4A 1B4FA 2F44A 2KIVA 1F0MA 5J8YA 3HILA 1SXEA 3SENA 2KMDA 1SV0C 3TADA 2E8NA 4NL9C 2KG5A 2QB1A 1UCVA 2D3DA 4RQNA 2ES6A 3SEIA 2DKZA 2QARA
chains in the Genus database with same CATH superfamily
2HOQA 3KHHA 3D2SA 2Y1JA 1TK0A 3UXPA 1XWLA 5KG2A 3JPOA 5HNKA 3RH5A 5HR7A 2P35A 5EWFA 3L5KA 4O5CA 3ETLA 1DGJA 1ZQ1C 4O3OA 2NO5A 1TAQA 3UQ2A 3JPSA 3KOOA 3PW5A 5F3XB 5EE0A 4J9QA 4ED6A 1CUKA 1HJPA 5ALDA 9ICJA 1KKXA 2Y0SC 3LWLA 1U9LA 2ZUBA 1NK9A 2WF9A 1BPEA 4Z6DA 5AKYA 3IG5A 4EELA 1T7PA 2PFNA 3LYSA 4J9OA 1TFRA 1N60A 2C2RA 4RZRA 3WKDA 3EW9A 1CRXA 4QJFB 1ZQVA 1YZ7A 4UASA 1URJA 2IBKA 5KFHA 3K1ZA 5J0PA 1K1SA 1ZQUA 4PHDA 4EYIB 1ZJNA 8ICUA 5CJ7A 3CNHA 4B6JA 3C2MA 3ZD9A 3BQ1A 1DK3A 3SV3A 2NRVA 4GXJA 3BZKA 2EQYA 5KFQA 4ED2A 1ZQAA 4KLLA 1L3TA 2R8KA 3GV5B 2HBJA 4ECYA 5ALOA 3BJYA 4CF3A 4RUAA 4TURA 2OEHA 1S0MA 3PY8A 2H3QA 4I2DA 4UATA 4Z6EA 4K4HA 3PZPA 3ZD8A 3BS5B 4FFDA 3V7JA 2E5SA 8ICGA 1HEKA 8ICSA 5AI8A 3NRWA 3SV4A 2HCFA 5DG9A 3SENA 2KMDA 4US9A 1P7DA 2FDRA 2XCPA 4LJXA 8ICPA 3SZ2A 4I2EA 5E79U 4RNNA 4JV1A 5KFZA 3SAFA 2JH7A 4GIBA 4F4KA 2W03A 1XSPA 1BPBA 4Y2RA 4B9UA 1PVRA 5KT7A 3NRZA 2IOHA 5D4BA 1L8LA 2HHVA 4J9PA 1NZPA 4ECXA 5AI5A 1FFVA 5AKKA 4IR9A 4C7YA 2JZBA 5DB8A 3V6HA 2OH2A 2LI6A 1KFSA 5J2FA 2XIDA 4EYHB 3C2KA 4QWAA 3G6XA 2FLLA 4JK1A 2LPEA 4C4SA 8ICLA 4GC6A 5AK4A 3PSTA 2HVHA 2HW3A 8ICZA 2KKPA 2J6SA 3GIKA 4BXOA 4B9TA 5CP2A 2ZJ8A 1F44A 9ICPA 4J9SA 4DO9A 1LKYA 3PMNA 4IL6U 4KITB 5J2GA 1ZRMA 7ICJA 4UAUA 4UB5A 2NYVA 1K5OA 3QE9Y 3EZ5A 9ICCA 3E0FA 1B43A 2I1QA 4RQ5A 4DL6A 4Y2XA 5KT2A 3QU2A 3ZDCA 1IIPA 5KFFA 2QB0B 4YG2A 3C23A 3IRUA 3B0YA 2KSOB 4PJ0U 9ICAA 3PO5A 2VKQA 4Q44A 2NRWA 4B9NA 4OJ5A 4J9LA 2BQRA 4PHPA 1JX4A 2VA8A 9ICTA 2IHMA 5KT4A 1SWWA 1IM4A 4CGZA 2W55A 1RYUA 2KIWA 2ZUDA 5J2CA 4J9MA 3F53A 5DGAA 2OXOA 4I2BA 1TAUA 3MC1A 4DOCA 4EBEA 1NZBA 1A0PA 5AKIA 2AGQA 3THVA 4P0PB 3MR5A 4J9KA 1D8YA 4PZOA 4ECRA 1D9FA 4IRKA 2I5HA 2Y9TA 2OM6A 4ECSA 2NRXA 2CXYA 4DLGA 2R8IA 1Y88A 1CI4A 1MA7A 3RJJA 1KEJA 1KDHA 2JEGA 8ICWA 2W9BA 4NV0A 1NK8A 2ZIWB 4C7ZA 2JEIA 1Q3VA 4KMUA 7ICUA 2F1IA 1ED1A 4NM1A 1X6JA 4TUSA 1S5LU 4M2YA 5HP4A 2BQUA 2HHWA 3H0MB 4EENA 4PGQA 2ZIUA 8ICNA 1FEZA 4QZ9A 4O5EA 3Q8MA 1ZRNA 5BOLA 3NVYA 2DUYA 2FE9A 2LM1A 3C21A 4TUQA 3JPTA 1ZQDA 4XA5A 2FLPA 4ICAA 4DFPA 4O3MA 1N63A 2KNJA 3KD3A 4DQSA 1Z4NA 3PX0A 1S77D 4ECVA 1X42A 3AN1A 4MEYA 1ZD4A 4UB6U 3KTQA 4DQPA 2H5XA 4DSJA 3QNMA 4UAVA 5HMLA 1BNPA 9ICMA 5TISU 4RPYA 5AKXA 4I28A 4FE3A 1ZETA 4OJ6A 4BWJA 2ASDA 5G5GA 4M04A 1WYGA 4YD2A 2KG5A 2ZIVB 1KBUA 5KFJA 3DDHA 5DQHA 3M9MB 5KG7A 5J2DA 2J6TA 2HVIA 4NY8A 4B9LA 2H3FA 2G0AA 4JV0A 4TQSA 2FLNA 4ED7A 2D6FC 4R66A 4QZDA 4OD0A 2ZTCA 4O3PA 3M8RA 4KLEA 3HX0A 2A1AA 3V7KA 4I2GA 4RQ1A 2KVSA 2DKXA 2FI1A 4CCHA 5AM3A 3OJUA 4QZFA 4AYBF 1DRGA 4QZHA 1D9DA 5L1IA 2W8LA 3K4GA 1ZQJA 4JB3A 3MBYA 1COOA 2VJ4A 2GO7A 3ZDEA 2FPMA 2R8HA 1L5UA 3H8JA 3OHAA 1KW4A 2YQEA 1QTMA 3OTQA 2XVTA 4C4RA 2W7OA 5KG6A 1ZJMA 2KJ8A 4KLJA 4MEXA 2E3TA 1S0VA 5IINA 4CE6A 4IQUA 4F92B 5T14A 1COKA 1V9PA 1PK1B 3RRHA 2XY5A 4OO1J 4YR2A 3H4DA 2B0CA 3T79A 2KICA 3OHBA 4YP3A 2K4EA 5J0YA 3PW4A 2A1JB 3KZIU 4M9LA 4UB4A 2IA6A 4JWMA 4BUGA 5CA7A 1ECWA 1S76D 4YR3A 1SKWA 1UCVA 5ALZA 5F9NA 2DQNB 3GQCA 1MQ3A 4KLMA 1S10A 3QUCA 5A0LA 2XICA 1WCLA 5HMMA 1DK2A 1NKCA 2ESEA 2Z7JA 3M6KA 3TI0A 8ICXA 1JUDA 4GC7A 4NLCA 2F1HA 3WKAA 2JRZA 1BPDA 4UB2A 3QU9A 1PZNA 1ZQQA 5JUMA 3M6ZA 3Q8KA 4F93B 4I2HA 3RRGA 1O03A 3H8MA 2WHEA 4XQ8A 2KZZA 1S8OA 1NI3A 3WK8A 4Q43A 2PFQA 1ZQTA 4FBUA 3NVWA 3DV9A 1RPLA 3UMGA 3KHLA 2BHNA 1X9SA 4K4GA 3ICXA 3LDAA 4QWEA 2W04A 2YY6A 3GIMA 3UXNA 4RQ0A 1ZD2P 2LYBA 3LVVA 3DEEA 1ZQWA 3B9JA 1RZTA 4ED3A 3AMZA 9ICQA 3CP8A 3E2EA 3D6JA 4QW9A 7ICIA 2E8MA 3PR4A 2MAXA 2RLTA 4I2IA 2IOFK 5J8YA 1SXEA 1SB3C 5G5HA 8ICOA 4MFFA 2JR5A 5CB1A 3JPPA 1JMSA 4M6WA 4IS7A 5AM0A 2NO4A 4NM2A 5L1LA 1NOMA 1X40A 4FS1A 2JZBB 5J0SA 4KN7A 3M7DA 9ICSA 2K4HA 8ICQA 3ZDDA 7ICQA 1WCNA 2EH9A 4PPXA 2AGOA 4OJOA 1NKBA 5DB7A 4AP9A 3RJHA 4K4IA 4DSLA 4G3IA 2KK0A 2BPGA 1N5WA 2DFLA 3IV6A 4UARA 4U6PA 4DSKA 1NK5A 2ZTDA 5ALMA 3C5GA 2ODGA 1WWUA 5AKHA 4HAIA 1SKRA 8ICJA 1O08A 4DFMA 2KTQA 2ZIXA 4KTQA 3K1RB 2BGWA 5DQIA 4C8MA 1L3UA 4DF8A 3EPIA 2VIXA 5KG5A 2C2EA 4BDPA 5IIOA 3EUB2 1NK7A 1ZQZA 3T3FA 1S0NA 3HP6A 1KLNA 4I27A 5KFKA 5EE9A 2W43A 3GIJA 4P2HA 4FZMA 3PR5B 3PW0A 4RT2A 2LBOA 3SAHA 2BPFA 1BGXT 3RB0A 5IILA 1Z4OA 2H3VA 3C2LA 2GOLA 3QXGA 4TUPA 3RTVA 1SV4A 1J97A 1F0MA 4RU9A 5EE3A 5DLGA 1MQ2A 2HHUA 1IXRA 1QCKA 1SV0C 2BKEA 3PNCA 3C1ZA 4KLOA 1HIWA 4DLEA 4C8NA 1TK5A 2RHFA 1TAMA 5HR6A 4ED1A 1L6NA 3LK9A 2XGPA 5K4LA 3UMBA 4DSEA 7ICVA 2F77X 3KKAA 4NJ8A 1KN5A 4C80A 2M0NA 4DL5A 3MGVA 1BPZA 3WK5A 1L7OA 2W9MA 2AQ0A 3C29A 2QARB 1PK3A 4FZLA 1ZQEA 2K8CB 1KL9A 2ZTEA 2FMSA 4QZBA 3M1YA 4FZNA 3M9OB 3GDXA 5ALHA 5BPCA 2KE7A 1WUDA 4P0QB 4DFJA 3AEVA 3RB6A 2HBMA 3V6KA 3WK4A 2WF7A 2JV3A 3WKEA 1ZQRA 3PSIA 3MR2A 1JRPA 1X6IA 1QSLA 5L9XA 2L5YA 3AL0B 4M9GA 3IP4B 4C8LA 2ZXHA 8ICEA 5AM4A 4ACOA 4NLGA 1WWVA 4MFAA 1JXLA 3MDCA 5AI4A 1ZQYA 4R65A 7ICMA 2Y0SF 3HKZC 2BR0A 4ECWA 1A6SA 4RNMA 2E8OA 1FIQA 3O0FA 2FMPA 5DBCA 2DF4B 2F2AB 2XGQA 3E58A 3H8SA 1KSPA 1IG6A 2HHQA 1NNLA 3IHQB 1XO1A 3C5FA 5ALVA 3HILA 2ASLA 3ISDA 2DPIA 3KHRA 7ICGA 5DB9A 5HHHA 3RF9A 3TADA 2MRLA 4P4OA 3QZ8A 5DGBA 1NK6A 5KFWA 2BQ3A 1KTQA 2W3SA 1UPHA 3PSPA 3UXOA 2G5HB 5L1KA 1PUZA 5L1MA 3QUQA 5ALUA 3B0XA 3NVZA 5AI0A 4NLKA 3FM9A 3PW7A 2XCAA 1C7YA 1UT8A 3MGIA 3D2NA 3RJIA 5KFTA 2EAMA 1NJXA 3Q8PB 3H4BA 3F5EA 2K4IA 2K8BB 3QEAZ 1J2NA 3OJSA 3CYMA 2ZG6A 4UB1A 3GU3A 3RR8A 3RH4A 4NL9A 4F3OA 2MSNA 5J2HA 2DWQA 2LKYA 1OXJA 5DBBA 5J2AA 3J81j 4F5NA 2V9WA 2XC9A 3PV8A 1BNOA 4KLIA 3Q8LA 3H0RB 3AM9A 5ALRA 2LMRA 4PH5A 2ISOA 5AK3A 2KFZA 1H38A 1UA0A 4I2AA 9ICRA 3HW8A 3BS5A 2E1FA 3KHGA 4DWIA 4UB8U 5KFNA 3RFAA 8ICAA 2YMQA 5AM1A 1SXDA 1KQQA 3ISBA 4F5PA 1QSSA 5ALNA 4F2SA 5C0YA 3RJGA 2DGZA 3RJEA 3OSPA 4PGXA 4YXMA 3F5AA 1C20A 1XS9D 2JGAA 1Z1VA 4KLSA 2EZZA 3HKZF 2YX8A 5ALGA 3QU5A 4QWBA 3PX6A 4QW8A 3BQ2A 5AI9A 3ZDBA 3SR6A 3PO4A 4YN4A 4KN4A 2IHNA 5CEHA 4UQGA 4YMNA 1ZXIA 1RXVA 8ICIA 4EZ6A 2NRTA 4DCCA 3ZDAA 3BQ0A 4OJLA 3PVXA 1F5SA 1FFUA 5CHGA 2P66A 5J0RA 2K89A 4DS4A 2LM4A 2W9CA 1VLBA 4EX7A 4JV2A 3RBDA 1RG6A 5KFMA 4DSFA 3SQIA 4F71A 4ELUA 3EWAA 3I1YA 4YCXA 3TKAA 4YXJA 7ICRA 1T3QA 3N7SC 4F91B 4KX5A 2A3VA 2CRXA 3OGUA 5TZVA 2KVCA 4O3QA 3G6YA 1B0XA 4KLTA 3KFUF 4YD1A 3VCBA 1ZQKA 2QB0A 1SL0A 4GXIA 4F4WA 2BZFA 3AQEA 9ICNA 4PHEA 8ICRA 1T94A 1N61A 4DS5A 5KFVA 7ICHA 2PKEA 5CRXA 1ZYQA 4DSIA 2K60A 1JROA 5AM5A 1T8EA 2HOFA 1SZHA 3WK9A 2JHDA 2VJ5A 2JMGA 5KFGA 9ICLA 7ICLA 4P0PA 4B9VA 3GV8B 3N7RC 2MUTA 4YFKA 1YT3A 1ZQMA 4USAA 5GTIU 4Q8EA 2HHXA 3MGHA 4R64A 4KX3A 3FC4A 5KFXA 4I2CA 9ICGA 5EWGA 1EXNA 8ICFA 1AROP 3F2BA 4M6WB 3TFSA 2D3DA 2XY7A 1ZQFA 2IMWP 2KJ5A 3QX7A 4HYKA 3L3FX 3RB4A 4F4ZA 4RQMA 4R8UA 3RBEA 2C22A 4ECQA 1UA1A 4NXZA 5DQGA 3UMCA 2BPCA 2RDIA 1X9MA 4RT3A 5ALSA 1L8OA 4IQVA 4P4PA 4QZCA 5J0WA 1NJWA 4PZNA 4NLBA 2UVVA 2G07A 9ICKA 2BCRA 3BQ7A 5HHIA 1RXWA 1U47A 3EYZA 1MC8A 3SD7A 4M47A 2BCSA 1D8BA 3TQ1A 3RAXA 2EAPA 3FAHA 1T4GA 5CR0A 4Y2PA 3WKCA 2AGPA 1KRPA 5EWEA 2JEFA 3RAQA 3Q8RB 7ICOA 9ICIA 4DEZA 4G9BA 2EZYA 2GLEA 4UB3A 2G5IB 1JI7A 2BCVA 1Z1BA 4CF4A 2ZIXB 2AH5A 3M9NB 4CDGA 1DOQA 5J2IA 3KZXA 2V4QA 4QZGA 3N28A 4EX6A 2KJ9A 4J9RA 2YTUA 2BCUA 4M9HA 1QQ7A 1VJ5A 1V97A 3NUQA 2K4PA 2B6GA 3NGDA 7ICNA 4RPXA 5KFUA 2EZXA 1ZQHA 2FPKA 2AXTU 3N4MB 1NKEA 1ZQSA 2PFPA 3D2QA 4YMMA 5ALPA 7ICPA 4GFJA 3MDAA 3FDSA 2KIVA 2G06A 5J0UA 4RQ8A 5J0TA 2I9GA 4QZEA 3JPNA 4EEYA 4PGYA 3HPOA 2VANA 2E8NA 3Q8SB 3WU2U 4RNOA 1QLNA 3A0HU 3HRDD 7ICFA 2HMXA 7ICKA 3N7PD 4YMOA 1N2XA 4RQ2A 2UVUA 4NLZA 4X5VA 1U49A 4U7CA 2B21A 4NWIA 5ALEA 1U4BA 3UM9A 3H0LB 1SGGA 4DQIA 2G09A 3H7IA 3I28A 3ONNA 1Z00A 3IDWA 8ICBA 4F5OA 5J0XA 5KFCA 2HHTA 1RQNA 4F5QA 5J2JA 5KFLA 3V72A 1CEZA 2EAOA 3PW2A 3SMVA 2YMMA 4F8RA 5KFAA 4BJQA 2HI0A 2YB1A 1QH9A 1JN3A 4QIWC 2D8CA 1PVPA 2RP5A 5AI6A 3CW2C 4PL2A 3GV7B 3NASA 9ICHA 3TFRA 5KL8B 3RR7A 1RM6C 5DLFA 2HHSA 8ICYA 2KFNA 4IR1A 3U26A 5KFEA 2WB1C 4BXOB 3KBBA 4Y2QA 4B9SA 5IIMA 2UVWA 2A1JA 2W7PA 1LKYB 4PL1A 1PVQA 1DXSA 4EZ9A 2MA1A 4KLGA 2P6UA 5ALIA 4DOAA 1NJYA 2QKQA 2CPRA 1BPYA 2FMQA 1XU4A 4O9MA 4EEKA 8ICTA 4YQWA 4F50A 4I29A 5ALTA 3GIIA 5IIIA 3Q8QB 1SIJA 3RJKA 4RQNA 4ZH4A 2HOIA 4MF8A 1JXEA 5J0OA 5KNIA 5JRTA 3UQ0A 3LVWA 2ZXIA 4GXKA 5KT5A 1ZQCA 3TAPA 2KV2A 1SWVA 5ALWA 4ECZA 9ICBA 4M9NA 2WF8A 2MU2A 1X9WA 3NS1A 2E8PA 5KT3A 4YVZA 8ICVA 2F8LA 4O3RA 4JWNA 2ASJA 4ELVA 5GTHU 4R63A 5EE1A 2W9BB 1D8LA 4QIWF 3V7LA 1LV5A 1OW5A 1L7PA 4E0DA 3TAQA 1OUQA 1QSYA 4ELTA 9ICVA 5KTQA 5ALXA 1X2IA 3R9KA 4Y2VA 2A19A 2NRZA 2PMZC 5DDMA 2ALZA 2UVRA 5D49A 2KD1A 1RQLA 2WFAA 2M9NA 2ZIUB 2O6KA 2WB1F 2J6UA 2QLTA 5JU5A 4LZDA 5AKEA 4TQRA 2WTFA 3WK7A 1RYSA 5J2KA 2PI5A 4ZOHC 4O3NA 5AICA 7ICEA 1SKSA 5D46A 4UBBA 5J2EA 1TE2A 3T5LA 3RJFA 4QNLA 3F2CA 1XO0A 4US8A 4IRDA 3TANA 1XNSA 2AHOB 3TARA 2LYHA 2NV3A 3ISCA 2WF6A 4BWMA 1X66A 4QZ8A 5KFRA 2RQ5A 1ZOLA 2W9CB 8ICCA 3OSNA 3V6JA 2W54A 3QUTA 4QWDA 5IIJA 2KP7A 2AQ4A 2KHQA 1L7MA 4Q45A 4DQQA 5AK5A 2BCQA 5J29A 3GZFA 2BDUA 3I76A 4JMUA 4MF2A 2GH1A 4F5RA 1TK8A 4KLHA 1JIHA 3SYZA 1K1QA 1M6YA 1ZQGA 3ORYA 3WK6A 2DL0A 1GO3F 2HBKA 5J8YC 4UAZA 2W3RA 4RQ3A 4M0AA 3RH6A 4Q8FA 1VDVA 4DL2A 4RQ6A 4BX9C 4MHVA 9ICEA 3JPQA 3BS7A 3C1YA 2LHTA 3VC8A 1A76A 3AU6A 2JH1A 3HT3A 2WAQC 3N97B 3HJEA 4O0IA 2PMZF 2MUTB 2XI9A 1BPXA 3MABA 1S9FA 9ICOA 4DFKA 2YB4A 5KFOA 7ICSA 4DOBA 4KLUA 2FJ6A 4MFCA 2IOFA 4XRHA 3C28A 3MR6A 8ICHA 1HUZA 7ICTA 1N5XA 1SL2A 2P6RA 4EBCA 4QWCA 3UPQA 1UT5A 9ICFA 4AYBC 4R8UB 4I2JA 5KG1A 2ES6A 4QZAA 2DKZA 3QU4A 5CWRA 2QARA 4Z6FA 4ECUA 4ED0A 2KHVA 5DKWA 3H40A 2KOBA 4Y2TA 4Z6CA 4P0QA 2W9AA 3T5HA 1LB2B 5J2BA 4DL3A 1XSNA 4GLXA 5DG7A 1U45A 1DGSA 2ZJ5A 5KFIA 4FO6A 2XO7A 2RRDA 1FO4A 5DG8A 1KFTA 4CRXA 4RQ7A 2H3ZA 3BQTA 5J0QA 4F72A 4F4XA 5AKLA 1V38A 4IRCA 4IQWA 3PSFA 2W11A 4FBTA 3QYPA 2OYYA 3MFIA 4KLFA 1N62A 3GILA 3S6JA 3HWTA 2EANA 5AKZA 3AQFA 3ALRA 1L3SA 2DBYA 2AJQA 4DFDA 3EPGA 2ATLA 4I2FA 2R18A 5ALQA 5ALYA 1XSLA 3KKAC 5C5JA 1J2MA 2Y1IA 4XUSA 5ALJA 4C8OA 2Y9UA 5IIKA 3IN5A 4UBCA 2KSOA 3G6VA 1B4FA 2KZ3A 3SI8A 5AM2A 2VA3A 3QEBZ 2BDPA 4F2RA 2WAQF 1NJZA 2Q4TA 4KMOB 2ISPA 4M9JA 4C0ZA 2QB1A 4J03A 8ICKA 1ZQNA 1L3VA 2JEJA 2R8JA 4FS2A 5JTIA 1KFDA 2EDUA 5KAFU 4O3SA 3ED5A 1Z00B 2OWOA 3T5JA 4C4TA 4Y2YA 4NLNA 5H2FU 4CNQA 2FPLA 4B9MA 4ED8A 5AIAA 5AHXA 1NK4A 2CN1A 3QU7A 2I6XA 5AK6A 5ALFA 4RUCA 1SV0A 2YMPA 4YR0A 1N48A 1IV8A 2ZIWA 4Y2JA 5AKJA 2WF5A 4KLDA 2AU0A 3PMLA 5EOZA 1T3NA 3F2DA 4DF4A 3IM1A 4LZGA 3QUBA 1Z19A 3IG8A 3T5KA 1HUOA 1ZQLA 4IC9A 5DBAA 4Y2SA 3TADC 5L1JA 2KN7A 1Q8KA 5KAIU 4JUZA 5KFPA 4UW9A 1Q3UA 2C28A 5KL1B 1X9XA 4LVSA 1B22A 3BZCA 1UHUA 1JALA 2YN4A 2V4RA 2G08A 2PI4A 2GWSA 1BVSA 1L7NA 4IQTA 4P4MA 4A8EA 2ZJAA 3ZI4A 2OHFA 5B66U 4KLQA 5KT6A 4DL4A 1SL1A 2E1EA 4BGDA 5FP0A 4NL9C 4RPZA 3NTUA 1MN8A 1LVHA 2ZIVA 1YZ6A 2R8GA 3L4PA 3SEIA 9ICUA 4EBDA 2OCEA 1XC9A 2PXIA 5KFYA 3M8SA 1S97A 5KG3A 1Z3EB 3OPXA 1RYRA 2PFOA 1TKDA 2K8AA 3BDPA 4QZIA 1NK0A 1S0OA 3PX4A 2YMLA 2Q0ZX 4RQ4A 9ICXA 2C2DA 1TVAA 3TACB 3ETRA 3MR3A 5DDYA 5AKGA 2ZUCA 5ALKA 3MFHA 1ZQBA 1RDFA 1V85A 3CRXA 3H8WA 1WG8A 1MSWD 1A77A 1U48A 4UAYA 2DPJA 2KZMA 1ZQOA 2F76X 2JXJA 1AQ6A 1ZQIA 4UAWA 1TV9A 3K75D 5AIBA 2RDJA 4O5KA 2LYAA 4C8KA 4WJ3B 2H3IA 8ICMA 1ZD3A 4OJPA 1UQVA 5KG4A 3JPRA 4F4YA 2KKVA 3FYHA 2W8KA 3WKBA 1ZQXA 2HBLA 3SAGA 5DB6A 4DQRA 3LWMA 5ALLA 2N1RA 2F1JA 1PK1A 2XY6A 2F3NA 3NVVA 2F8KA 5KG0A 3QZ7A 5KFBA 4DL7A 3A0BU 5KFSA 2F44A 4ECTA 1SZPA 4CF5A 2HDOA 4PHAA 1QQ5A 4J9NA 1QQ6A 5F9LA 5KFDA 9ICWA 2VA2A 4Y2UA 3RB3A 3AU2A 1ZQPA 1ZD5A 3AUOA 1N56A 4OCZA 1Q46A 2KEYA 5BOMA 2HSZA 5B5EU 3GFKB
chains in the Genus database with same CATH topology
4RQMA 4IS7A 5JTIA 5L1MA 1X66A 4PZOA 5KNIA 2ESEA 5JRTA 1X40A 3KKAA 1SGGA 4NJ8A 2Y9TA 3IDWA 4PZNA 2EAMA 3BQ7A 3TACB 2QARB 1RG6A 5F3XB 1PK3A 2LPEA 2EAPA 2EAOA 1SV0A 1V85A 2DKXA 2E8PA 4NL9A 2KE7A 2D8CA 1OXJA 3H8MA 1LKYA 2DL0A 2GLEA 5J8YC 1WWUA 1V38A 1JI7A 2JV3A 1B0XA 2LMRA 1OW5A 2QB0A 3TADC 1KW4A 2L5YA 3K1RB 4MHVA 2FE9A 2YTUA 3BS5A 1UQVA 2EANA 1X9XA 3BS7A 1LKYB 1WWVA 2K4PA 1SXDA 1DXSA 2B6GA 1COKA 1PK1B 2K60A 2E8OA 3KKAC 2QB0B 1PK1A 2QKQA 2F3NA 2KSOB 2F8KA 5JU5A 2Y9UA 3BS5B 2E8MA 2KSOA 1Z1VA 1SV4A 1B4FA 2F44A 2KIVA 1F0MA 5J8YA 3HILA 1SXEA 3SENA 2KMDA 1SV0C 3TADA 2E8NA 4NL9C 2KG5A 2QB1A 1UCVA 2D3DA 4RQNA 2ES6A 3SEIA 2DKZA 2QARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQM A;  4IS7 A;  5JTI A;  5L1M A;  1X66 A;  4PZO A;  5KNI A;  2ESE A;  5JRT A;  1X40 A;  3KKA A;  1SGG A;  4NJ8 A;  2Y9T A;  3IDW A;  4PZN A;  2EAM A;  3BQ7 A;  3TAC B;  2QAR B;  1RG6 A;  5F3X B;  1PK3 A;  2LPE A;  2EAP A;  2EAO A;  1SV0 A;  1V85 A;  2DKX A;  2E8P A;  4NL9 A;  2KE7 A;  2D8C A;  1OXJ A;  3H8M A;  1LKY A;  2DL0 A;  2GLE A;  5J8Y C;  1WWU A;  1V38 A;  1JI7 A;  2JV3 A;  1B0X A;  2LMR A;  1OW5 A;  2QB0 A;  3TAD C;  1KW4 A;  2L5Y A;  3K1R B;  4MHV A;  2FE9 A;  2YTU A;  3BS5 A;  1UQV A;  2EAN A;  1X9X A;  3BS7 A;  1LKY B;  1WWV A;  2K4P A;  1SXD A;  1DXS A;  2B6G A;  1COK A;  1PK1 B;  2K60 A;  2E8O A;  3KKA C;  2QB0 B;  1PK1 A;  2QKQ A;  2F3N A;  2KSO B;  2F8K A;  5JU5 A;  2Y9U A;  3BS5 B;  2E8M A;  2KSO A;  1Z1V A;  1SV4 A;  1B4F A;  2F44 A;  2KIV A;  1F0M A;  5J8Y A;  3HIL A;  1SXE A;  3SEN A;  2KMD A;  1SV0 C;  3TAD A;  2E8N A;  4NL9 C;  2KG5 A;  2QB1 A;  1UCV A;  2D3D A;  4RQN A;  2ES6 A;  3SEI A;  2DKZ A;  2QAR A; 
#chains in the Genus database with same CATH topology
 2HOQ A;  3KHH A;  3D2S A;  2Y1J A;  1TK0 A;  3UXP A;  1XWL A;  5KG2 A;  3JPO A;  5HNK A;  3RH5 A;  5HR7 A;  2P35 A;  5EWF A;  3L5K A;  4O5C A;  3ETL A;  1DGJ A;  1ZQ1 C;  4O3O A;  2NO5 A;  1TAQ A;  3UQ2 A;  3JPS A;  3KOO A;  3PW5 A;  5F3X B;  5EE0 A;  4J9Q A;  4ED6 A;  1CUK A;  1HJP A;  5ALD A;  9ICJ A;  1KKX A;  2Y0S C;  3LWL A;  1U9L A;  2ZUB A;  1NK9 A;  2WF9 A;  1BPE A;  4Z6D A;  5AKY A;  3IG5 A;  4EEL A;  1T7P A;  2PFN A;  3LYS A;  4J9O A;  1TFR A;  1N60 A;  2C2R A;  4RZR A;  3WKD A;  3EW9 A;  1CRX A;  4QJF B;  1ZQV A;  1YZ7 A;  4UAS A;  1URJ A;  2IBK A;  5KFH A;  3K1Z A;  5J0P A;  1K1S A;  1ZQU A;  4PHD A;  4EYI B;  1ZJN A;  8ICU A;  5CJ7 A;  3CNH A;  4B6J A;  3C2M A;  3ZD9 A;  3BQ1 A;  1DK3 A;  3SV3 A;  2NRV A;  4GXJ A;  3BZK A;  2EQY A;  5KFQ A;  4ED2 A;  1ZQA A;  4KLL A;  1L3T A;  2R8K A;  3GV5 B;  2HBJ A;  4ECY A;  5ALO A;  3BJY A;  4CF3 A;  4RUA A;  4TUR A;  2OEH A;  1S0M A;  3PY8 A;  2H3Q A;  4I2D A;  4UAT A;  4Z6E A;  4K4H A;  3PZP A;  3ZD8 A;  3BS5 B;  4FFD A;  3V7J A;  2E5S A;  8ICG A;  1HEK A;  8ICS A;  5AI8 A;  3NRW A;  3SV4 A;  2HCF A;  5DG9 A;  3SEN A;  2KMD A;  4US9 A;  1P7D A;  2FDR A;  2XCP A;  4LJX A;  8ICP A;  3SZ2 A;  4I2E A;  5E79 U;  4RNN A;  4JV1 A;  5KFZ A;  3SAF A;  2JH7 A;  4GIB A;  4F4K A;  2W03 A;  1XSP A;  1BPB A;  4Y2R A;  4B9U A;  1PVR A;  5KT7 A;  3NRZ A;  2IOH A;  5D4B A;  1L8L A;  2HHV A;  4J9P A;  1NZP A;  4ECX A;  5AI5 A;  1FFV A;  5AKK A;  4IR9 A;  4C7Y A;  2JZB A;  5DB8 A;  3V6H A;  2OH2 A;  2LI6 A;  1KFS A;  5J2F A;  2XID A;  4EYH B;  3C2K A;  4QWA A;  3G6X A;  2FLL A;  4JK1 A;  2LPE A;  4C4S A;  8ICL A;  4GC6 A;  5AK4 A;  3PST A;  2HVH A;  2HW3 A;  8ICZ A;  2KKP A;  2J6S A;  3GIK A;  4BXO A;  4B9T A;  5CP2 A;  2ZJ8 A;  1F44 A;  9ICP A;  4J9S A;  4DO9 A;  1LKY A;  3PMN A;  4IL6 U;  4KIT B;  5J2G A;  1ZRM A;  7ICJ A;  4UAU A;  4UB5 A;  2NYV A;  1K5O A;  3QE9 Y;  3EZ5 A;  9ICC A;  3E0F A;  1B43 A;  2I1Q A;  4RQ5 A;  4DL6 A;  4Y2X A;  5KT2 A;  3QU2 A;  3ZDC A;  1IIP A;  5KFF A;  2QB0 B;  4YG2 A;  3C23 A;  3IRU A;  3B0Y A;  2KSO B;  4PJ0 U;  9ICA A;  3PO5 A;  2VKQ A;  4Q44 A;  2NRW A;  4B9N A;  4OJ5 A;  4J9L A;  2BQR A;  4PHP A;  1JX4 A;  2VA8 A;  9ICT A;  2IHM A;  5KT4 A;  1SWW A;  1IM4 A;  4CGZ A;  2W55 A;  1RYU A;  2KIW A;  2ZUD A;  5J2C A;  4J9M A;  3F53 A;  5DGA A;  2OXO A;  4I2B A;  1TAU A;  3MC1 A;  4DOC A;  4EBE A;  1NZB A;  1A0P A;  5AKI A;  2AGQ A;  3THV A;  4P0P B;  3MR5 A;  4J9K A;  1D8Y A;  4PZO A;  4ECR A;  1D9F A;  4IRK A;  2I5H A;  2Y9T A;  2OM6 A;  4ECS A;  2NRX A;  2CXY A;  4DLG A;  2R8I A;  1Y88 A;  1CI4 A;  1MA7 A;  3RJJ A;  1KEJ A;  1KDH A;  2JEG A;  8ICW A;  2W9B A;  4NV0 A;  1NK8 A;  2ZIW B;  4C7Z A;  2JEI A;  1Q3V A;  4KMU A;  7ICU A;  2F1I A;  1ED1 A;  4NM1 A;  1X6J A;  4TUS A;  1S5L U;  4M2Y A;  5HP4 A;  2BQU A;  2HHW A;  3H0M B;  4EEN A;  4PGQ A;  2ZIU A;  8ICN A;  1FEZ A;  4QZ9 A;  4O5E A;  3Q8M A;  1ZRN A;  5BOL A;  3NVY A;  2DUY A;  2FE9 A;  2LM1 A;  3C21 A;  4TUQ A;  3JPT A;  1ZQD A;  4XA5 A;  2FLP A;  4ICA A;  4DFP A;  4O3M A;  1N63 A;  2KNJ A;  3KD3 A;  4DQS A;  1Z4N A;  3PX0 A;  1S77 D;  4ECV A;  1X42 A;  3AN1 A;  4MEY A;  1ZD4 A;  4UB6 U;  3KTQ A;  4DQP A;  2H5X A;  4DSJ A;  3QNM A;  4UAV A;  5HML A;  1BNP A;  9ICM A;  5TIS U;  4RPY A;  5AKX A;  4I28 A;  4FE3 A;  1ZET A;  4OJ6 A;  4BWJ A;  2ASD A;  5G5G A;  4M04 A;  1WYG A;  4YD2 A;  2KG5 A;  2ZIV B;  1KBU A;  5KFJ A;  3DDH A;  5DQH A;  3M9M B;  5KG7 A;  5J2D A;  2J6T A;  2HVI A;  4NY8 A;  4B9L A;  2H3F A;  2G0A A;  4JV0 A;  4TQS A;  2FLN A;  4ED7 A;  2D6F C;  4R66 A;  4QZD A;  4OD0 A;  2ZTC A;  4O3P A;  3M8R A;  4KLE A;  3HX0 A;  2A1A A;  3V7K A;  4I2G A;  4RQ1 A;  2KVS A;  2DKX A;  2FI1 A;  4CCH A;  5AM3 A;  3OJU A;  4QZF A;  4AYB F;  1DRG A;  4QZH A;  1D9D A;  5L1I A;  2W8L A;  3K4G A;  1ZQJ A;  4JB3 A;  3MBY A;  1COO A;  2VJ4 A;  2GO7 A;  3ZDE A;  2FPM A;  2R8H A;  1L5U A;  3H8J A;  3OHA A;  1KW4 A;  2YQE A;  1QTM A;  3OTQ A;  2XVT A;  4C4R A;  2W7O A;  5KG6 A;  1ZJM A;  2KJ8 A;  4KLJ A;  4MEX A;  2E3T A;  1S0V A;  5IIN A;  4CE6 A;  4IQU A;  4F92 B;  5T14 A;  1COK A;  1V9P A;  1PK1 B;  3RRH A;  2XY5 A;  4OO1 J;  4YR2 A;  3H4D A;  2B0C A;  3T79 A;  2KIC A;  3OHB A;  4YP3 A;  2K4E A;  5J0Y A;  3PW4 A;  2A1J B;  3KZI U;  4M9L A;  4UB4 A;  2IA6 A;  4JWM A;  4BUG A;  5CA7 A;  1ECW A;  1S76 D;  4YR3 A;  1SKW A;  1UCV A;  5ALZ A;  5F9N A;  2DQN B;  3GQC A;  1MQ3 A;  4KLM A;  1S10 A;  3QUC A;  5A0L A;  2XIC A;  1WCL A;  5HMM A;  1DK2 A;  1NKC A;  2ESE A;  2Z7J A;  3M6K A;  3TI0 A;  8ICX A;  1JUD A;  4GC7 A;  4NLC A;  2F1H A;  3WKA A;  2JRZ A;  1BPD A;  4UB2 A;  3QU9 A;  1PZN A;  1ZQQ A;  5JUM A;  3M6Z A;  3Q8K A;  4F93 B;  4I2H A;  3RRG A;  1O03 A;  3H8M A;  2WHE A;  4XQ8 A;  2KZZ A;  1S8O A;  1NI3 A;  3WK8 A;  4Q43 A;  2PFQ A;  1ZQT A;  4FBU A;  3NVW A;  3DV9 A;  1RPL A;  3UMG A;  3KHL A;  2BHN A;  1X9S A;  4K4G A;  3ICX A;  3LDA A;  4QWE A;  2W04 A;  2YY6 A;  3GIM A;  3UXN A;  4RQ0 A;  1ZD2 P;  2LYB A;  3LVV A;  3DEE A;  1ZQW A;  3B9J A;  1RZT A;  4ED3 A;  3AMZ A;  9ICQ A;  3CP8 A;  3E2E A;  3D6J A;  4QW9 A;  7ICI A;  2E8M A;  3PR4 A;  2MAX A;  2RLT A;  4I2I A;  2IOF K;  5J8Y A;  1SXE A;  1SB3 C;  5G5H A;  8ICO A;  4MFF A;  2JR5 A;  5CB1 A;  3JPP A;  1JMS A;  4M6W A;  4IS7 A;  5AM0 A;  2NO4 A;  4NM2 A;  5L1L A;  1NOM A;  1X40 A;  4FS1 A;  2JZB B;  5J0S A;  4KN7 A;  3M7D A;  9ICS A;  2K4H A;  8ICQ A;  3ZDD A;  7ICQ A;  1WCN A;  2EH9 A;  4PPX A;  2AGO A;  4OJO A;  1NKB A;  5DB7 A;  4AP9 A;  3RJH A;  4K4I A;  4DSL A;  4G3I A;  2KK0 A;  2BPG A;  1N5W A;  2DFL A;  3IV6 A;  4UAR A;  4U6P A;  4DSK A;  1NK5 A;  2ZTD A;  5ALM A;  3C5G A;  2ODG A;  1WWU A;  5AKH A;  4HAI A;  1SKR A;  8ICJ A;  1O08 A;  4DFM A;  2KTQ A;  2ZIX A;  4KTQ A;  3K1R B;  2BGW A;  5DQI A;  4C8M A;  1L3U A;  4DF8 A;  3EPI A;  2VIX A;  5KG5 A;  2C2E A;  4BDP A;  5IIO A;  3EUB 2;  1NK7 A;  1ZQZ A;  3T3F A;  1S0N A;  3HP6 A;  1KLN A;  4I27 A;  5KFK A;  5EE9 A;  2W43 A;  3GIJ A;  4P2H A;  4FZM A;  3PR5 B;  3PW0 A;  4RT2 A;  2LBO A;  3SAH A;  2BPF A;  1BGX T;  3RB0 A;  5IIL A;  1Z4O A;  2H3V A;  3C2L A;  2GOL A;  3QXG A;  4TUP A;  3RTV A;  1SV4 A;  1J97 A;  1F0M A;  4RU9 A;  5EE3 A;  5DLG A;  1MQ2 A;  2HHU A;  1IXR A;  1QCK A;  1SV0 C;  2BKE A;  3PNC A;  3C1Z A;  4KLO A;  1HIW A;  4DLE A;  4C8N A;  1TK5 A;  2RHF A;  1TAM A;  5HR6 A;  4ED1 A;  1L6N A;  3LK9 A;  2XGP A;  5K4L A;  3UMB A;  4DSE A;  7ICV A;  2F77 X;  3KKA A;  4NJ8 A;  1KN5 A;  4C80 A;  2M0N A;  4DL5 A;  3MGV A;  1BPZ A;  3WK5 A;  1L7O A;  2W9M A;  2AQ0 A;  3C29 A;  2QAR B;  1PK3 A;  4FZL A;  1ZQE A;  2K8C B;  1KL9 A;  2ZTE A;  2FMS A;  4QZB A;  3M1Y A;  4FZN A;  3M9O B;  3GDX A;  5ALH A;  5BPC A;  2KE7 A;  1WUD A;  4P0Q B;  4DFJ A;  3AEV A;  3RB6 A;  2HBM A;  3V6K A;  3WK4 A;  2WF7 A;  2JV3 A;  3WKE A;  1ZQR A;  3PSI A;  3MR2 A;  1JRP A;  1X6I A;  1QSL A;  5L9X A;  2L5Y A;  3AL0 B;  4M9G A;  3IP4 B;  4C8L A;  2ZXH A;  8ICE A;  5AM4 A;  4ACO A;  4NLG A;  1WWV A;  4MFA A;  1JXL A;  3MDC A;  5AI4 A;  1ZQY A;  4R65 A;  7ICM A;  2Y0S F;  3HKZ C;  2BR0 A;  4ECW A;  1A6S A;  4RNM A;  2E8O A;  1FIQ A;  3O0F A;  2FMP A;  5DBC A;  2DF4 B;  2F2A B;  2XGQ A;  3E58 A;  3H8S A;  1KSP A;  1IG6 A;  2HHQ A;  1NNL A;  3IHQ B;  1XO1 A;  3C5F A;  5ALV A;  3HIL A;  2ASL A;  3ISD A;  2DPI A;  3KHR A;  7ICG A;  5DB9 A;  5HHH A;  3RF9 A;  3TAD A;  2MRL A;  4P4O A;  3QZ8 A;  5DGB A;  1NK6 A;  5KFW A;  2BQ3 A;  1KTQ A;  2W3S A;  1UPH A;  3PSP A;  3UXO A;  2G5H B;  5L1K A;  1PUZ A;  5L1M A;  3QUQ A;  5ALU A;  3B0X A;  3NVZ A;  5AI0 A;  4NLK A;  3FM9 A;  3PW7 A;  2XCA A;  1C7Y A;  1UT8 A;  3MGI A;  3D2N A;  3RJI A;  5KFT A;  2EAM A;  1NJX A;  3Q8P B;  3H4B A;  3F5E A;  2K4I A;  2K8B B;  3QEA Z;  1J2N A;  3OJS A;  3CYM A;  2ZG6 A;  4UB1 A;  3GU3 A;  3RR8 A;  3RH4 A;  4NL9 A;  4F3O A;  2MSN A;  5J2H A;  2DWQ A;  2LKY A;  1OXJ A;  5DBB A;  5J2A A;  3J81 j;  4F5N A;  2V9W A;  2XC9 A;  3PV8 A;  1BNO A;  4KLI A;  3Q8L A;  3H0R B;  3AM9 A;  5ALR A;  2LMR A;  4PH5 A;  2ISO A;  5AK3 A;  2KFZ A;  1H38 A;  1UA0 A;  4I2A A;  9ICR A;  3HW8 A;  3BS5 A;  2E1F A;  3KHG A;  4DWI A;  4UB8 U;  5KFN A;  3RFA A;  8ICA A;  2YMQ A;  5AM1 A;  1SXD A;  1KQQ A;  3ISB A;  4F5P A;  1QSS A;  5ALN A;  4F2S A;  5C0Y A;  3RJG A;  2DGZ A;  3RJE A;  3OSP A;  4PGX A;  4YXM A;  3F5A A;  1C20 A;  1XS9 D;  2JGA A;  1Z1V A;  4KLS A;  2EZZ A;  3HKZ F;  2YX8 A;  5ALG A;  3QU5 A;  4QWB A;  3PX6 A;  4QW8 A;  3BQ2 A;  5AI9 A;  3ZDB A;  3SR6 A;  3PO4 A;  4YN4 A;  4KN4 A;  2IHN A;  5CEH A;  4UQG A;  4YMN A;  1ZXI A;  1RXV A;  8ICI A;  4EZ6 A;  2NRT A;  4DCC A;  3ZDA A;  3BQ0 A;  4OJL A;  3PVX A;  1F5S A;  1FFU A;  5CHG A;  2P66 A;  5J0R A;  2K89 A;  4DS4 A;  2LM4 A;  2W9C A;  1VLB A;  4EX7 A;  4JV2 A;  3RBD A;  1RG6 A;  5KFM A;  4DSF A;  3SQI A;  4F71 A;  4ELU A;  3EWA A;  3I1Y A;  4YCX A;  3TKA A;  4YXJ A;  7ICR A;  1T3Q A;  3N7S C;  4F91 B;  4KX5 A;  2A3V A;  2CRX A;  3OGU A;  5TZV A;  2KVC A;  4O3Q A;  3G6Y A;  1B0X A;  4KLT A;  3KFU F;  4YD1 A;  3VCB A;  1ZQK A;  2QB0 A;  1SL0 A;  4GXI A;  4F4W A;  2BZF A;  3AQE A;  9ICN A;  4PHE A;  8ICR A;  1T94 A;  1N61 A;  4DS5 A;  5KFV A;  7ICH A;  2PKE A;  5CRX A;  1ZYQ A;  4DSI A;  2K60 A;  1JRO A;  5AM5 A;  1T8E A;  2HOF A;  1SZH A;  3WK9 A;  2JHD A;  2VJ5 A;  2JMG A;  5KFG A;  9ICL A;  7ICL A;  4P0P A;  4B9V A;  3GV8 B;  3N7R C;  2MUT A;  4YFK A;  1YT3 A;  1ZQM A;  4USA A;  5GTI U;  4Q8E A;  2HHX A;  3MGH A;  4R64 A;  4KX3 A;  3FC4 A;  5KFX A;  4I2C A;  9ICG A;  5EWG A;  1EXN A;  8ICF A;  1ARO P;  3F2B A;  4M6W B;  3TFS A;  2D3D A;  2XY7 A;  1ZQF A;  2IMW P;  2KJ5 A;  3QX7 A;  4HYK A;  3L3F X;  3RB4 A;  4F4Z A;  4RQM A;  4R8U A;  3RBE A;  2C22 A;  4ECQ A;  1UA1 A;  4NXZ A;  5DQG A;  3UMC A;  2BPC A;  2RDI A;  1X9M A;  4RT3 A;  5ALS A;  1L8O A;  4IQV A;  4P4P A;  4QZC A;  5J0W A;  1NJW A;  4PZN A;  4NLB A;  2UVV A;  2G07 A;  9ICK A;  2BCR A;  3BQ7 A;  5HHI A;  1RXW A;  1U47 A;  3EYZ A;  1MC8 A;  3SD7 A;  4M47 A;  2BCS A;  1D8B A;  3TQ1 A;  3RAX A;  2EAP A;  3FAH A;  1T4G A;  5CR0 A;  4Y2P A;  3WKC A;  2AGP A;  1KRP A;  5EWE A;  2JEF A;  3RAQ A;  3Q8R B;  7ICO A;  9ICI A;  4DEZ A;  4G9B A;  2EZY A;  2GLE A;  4UB3 A;  2G5I B;  1JI7 A;  2BCV A;  1Z1B A;  4CF4 A;  2ZIX B;  2AH5 A;  3M9N B;  4CDG A;  1DOQ A;  5J2I A;  3KZX A;  2V4Q A;  4QZG A;  3N28 A;  4EX6 A;  2KJ9 A;  4J9R A;  2YTU A;  2BCU A;  4M9H A;  1QQ7 A;  1VJ5 A;  1V97 A;  3NUQ A;  2K4P A;  2B6G A;  3NGD A;  7ICN A;  4RPX A;  5KFU A;  2EZX A;  1ZQH A;  2FPK A;  2AXT U;  3N4M B;  1NKE A;  1ZQS A;  2PFP A;  3D2Q A;  4YMM A;  5ALP A;  7ICP A;  4GFJ A;  3MDA A;  3FDS A;  2KIV A;  2G06 A;  5J0U A;  4RQ8 A;  5J0T A;  2I9G A;  4QZE A;  3JPN A;  4EEY A;  4PGY A;  3HPO A;  2VAN A;  2E8N A;  3Q8S B;  3WU2 U;  4RNO A;  1QLN A;  3A0H U;  3HRD D;  7ICF A;  2HMX A;  7ICK A;  3N7P D;  4YMO A;  1N2X A;  4RQ2 A;  2UVU A;  4NLZ A;  4X5V A;  1U49 A;  4U7C A;  2B21 A;  4NWI A;  5ALE A;  1U4B A;  3UM9 A;  3H0L B;  1SGG A;  4DQI A;  2G09 A;  3H7I A;  3I28 A;  3ONN A;  1Z00 A;  3IDW A;  8ICB A;  4F5O A;  5J0X A;  5KFC A;  2HHT A;  1RQN A;  4F5Q A;  5J2J A;  5KFL A;  3V72 A;  1CEZ A;  2EAO A;  3PW2 A;  3SMV A;  2YMM A;  4F8R A;  5KFA A;  4BJQ A;  2HI0 A;  2YB1 A;  1QH9 A;  1JN3 A;  4QIW C;  2D8C A;  1PVP A;  2RP5 A;  5AI6 A;  3CW2 C;  4PL2 A;  3GV7 B;  3NAS A;  9ICH A;  3TFR A;  5KL8 B;  3RR7 A;  1RM6 C;  5DLF A;  2HHS A;  8ICY A;  2KFN A;  4IR1 A;  3U26 A;  5KFE A;  2WB1 C;  4BXO B;  3KBB A;  4Y2Q A;  4B9S A;  5IIM A;  2UVW A;  2A1J A;  2W7P A;  1LKY B;  4PL1 A;  1PVQ A;  1DXS A;  4EZ9 A;  2MA1 A;  4KLG A;  2P6U A;  5ALI A;  4DOA A;  1NJY A;  2QKQ A;  2CPR A;  1BPY A;  2FMQ A;  1XU4 A;  4O9M A;  4EEK A;  8ICT A;  4YQW A;  4F50 A;  4I29 A;  5ALT A;  3GII A;  5III A;  3Q8Q B;  1SIJ A;  3RJK A;  4RQN A;  4ZH4 A;  2HOI A;  4MF8 A;  1JXE A;  5J0O A;  5KNI A;  5JRT A;  3UQ0 A;  3LVW A;  2ZXI A;  4GXK A;  5KT5 A;  1ZQC A;  3TAP A;  2KV2 A;  1SWV A;  5ALW A;  4ECZ A;  9ICB A;  4M9N A;  2WF8 A;  2MU2 A;  1X9W A;  3NS1 A;  2E8P A;  5KT3 A;  4YVZ A;  8ICV A;  2F8L A;  4O3R A;  4JWN A;  2ASJ A;  4ELV A;  5GTH U;  4R63 A;  5EE1 A;  2W9B B;  1D8L A;  4QIW F;  3V7L A;  1LV5 A;  1OW5 A;  1L7P A;  4E0D A;  3TAQ A;  1OUQ A;  1QSY A;  4ELT A;  9ICV A;  5KTQ A;  5ALX A;  1X2I A;  3R9K A;  4Y2V A;  2A19 A;  2NRZ A;  2PMZ C;  5DDM A;  2ALZ A;  2UVR A;  5D49 A;  2KD1 A;  1RQL A;  2WFA A;  2M9N A;  2ZIU B;  2O6K A;  2WB1 F;  2J6U A;  2QLT A;  5JU5 A;  4LZD A;  5AKE A;  4TQR A;  2WTF A;  3WK7 A;  1RYS A;  5J2K A;  2PI5 A;  4ZOH C;  4O3N A;  5AIC A;  7ICE A;  1SKS A;  5D46 A;  4UBB A;  5J2E A;  1TE2 A;  3T5L A;  3RJF A;  4QNL A;  3F2C A;  1XO0 A;  4US8 A;  4IRD A;  3TAN A;  1XNS A;  2AHO B;  3TAR A;  2LYH A;  2NV3 A;  3ISC A;  2WF6 A;  4BWM A;  1X66 A;  4QZ8 A;  5KFR A;  2RQ5 A;  1ZOL A;  2W9C B;  8ICC A;  3OSN A;  3V6J A;  2W54 A;  3QUT A;  4QWD A;  5IIJ A;  2KP7 A;  2AQ4 A;  2KHQ A;  1L7M A;  4Q45 A;  4DQQ A;  5AK5 A;  2BCQ A;  5J29 A;  3GZF A;  2BDU A;  3I76 A;  4JMU A;  4MF2 A;  2GH1 A;  4F5R A;  1TK8 A;  4KLH A;  1JIH A;  3SYZ A;  1K1Q A;  1M6Y A;  1ZQG A;  3ORY A;  3WK6 A;  2DL0 A;  1GO3 F;  2HBK A;  5J8Y C;  4UAZ A;  2W3R A;  4RQ3 A;  4M0A A;  3RH6 A;  4Q8F A;  1VDV A;  4DL2 A;  4RQ6 A;  4BX9 C;  4MHV A;  9ICE A;  3JPQ A;  3BS7 A;  3C1Y A;  2LHT A;  3VC8 A;  1A76 A;  3AU6 A;  2JH1 A;  3HT3 A;  2WAQ C;  3N97 B;  3HJE A;  4O0I A;  2PMZ F;  2MUT B;  2XI9 A;  1BPX A;  3MAB A;  1S9F A;  9ICO A;  4DFK A;  2YB4 A;  5KFO A;  7ICS A;  4DOB A;  4KLU A;  2FJ6 A;  4MFC A;  2IOF A;  4XRH A;  3C28 A;  3MR6 A;  8ICH A;  1HUZ A;  7ICT A;  1N5X A;  1SL2 A;  2P6R A;  4EBC A;  4QWC A;  3UPQ A;  1UT5 A;  9ICF A;  4AYB C;  4R8U B;  4I2J A;  5KG1 A;  2ES6 A;  4QZA A;  2DKZ A;  3QU4 A;  5CWR A;  2QAR A;  4Z6F A;  4ECU A;  4ED0 A;  2KHV A;  5DKW A;  3H40 A;  2KOB A;  4Y2T A;  4Z6C A;  4P0Q A;  2W9A A;  3T5H A;  1LB2 B;  5J2B A;  4DL3 A;  1XSN A;  4GLX A;  5DG7 A;  1U45 A;  1DGS A;  2ZJ5 A;  5KFI A;  4FO6 A;  2XO7 A;  2RRD A;  1FO4 A;  5DG8 A;  1KFT A;  4CRX A;  4RQ7 A;  2H3Z A;  3BQT A;  5J0Q A;  4F72 A;  4F4X A;  5AKL A;  1V38 A;  4IRC A;  4IQW A;  3PSF A;  2W11 A;  4FBT A;  3QYP A;  2OYY A;  3MFI A;  4KLF A;  1N62 A;  3GIL A;  3S6J A;  3HWT A;  2EAN A;  5AKZ A;  3AQF A;  3ALR A;  1L3S A;  2DBY A;  2AJQ A;  4DFD A;  3EPG A;  2ATL A;  4I2F A;  2R18 A;  5ALQ A;  5ALY A;  1XSL A;  3KKA C;  5C5J A;  1J2M A;  2Y1I A;  4XUS A;  5ALJ A;  4C8O A;  2Y9U A;  5IIK A;  3IN5 A;  4UBC A;  2KSO A;  3G6V A;  1B4F A;  2KZ3 A;  3SI8 A;  5AM2 A;  2VA3 A;  3QEB Z;  2BDP A;  4F2R A;  2WAQ F;  1NJZ A;  2Q4T A;  4KMO B;  2ISP A;  4M9J A;  4C0Z A;  2QB1 A;  4J03 A;  8ICK A;  1ZQN A;  1L3V A;  2JEJ A;  2R8J A;  4FS2 A;  5JTI A;  1KFD A;  2EDU A;  5KAF U;  4O3S A;  3ED5 A;  1Z00 B;  2OWO A;  3T5J A;  4C4T A;  4Y2Y A;  4NLN A;  5H2F U;  4CNQ A;  2FPL A;  4B9M A;  4ED8 A;  5AIA A;  5AHX A;  1NK4 A;  2CN1 A;  3QU7 A;  2I6X A;  5AK6 A;  5ALF A;  4RUC A;  1SV0 A;  2YMP A;  4YR0 A;  1N48 A;  1IV8 A;  2ZIW A;  4Y2J A;  5AKJ A;  2WF5 A;  4KLD A;  2AU0 A;  3PML A;  5EOZ A;  1T3N A;  3F2D A;  4DF4 A;  3IM1 A;  4LZG A;  3QUB A;  1Z19 A;  3IG8 A;  3T5K A;  1HUO A;  1ZQL A;  4IC9 A;  5DBA A;  4Y2S A;  3TAD C;  5L1J A;  2KN7 A;  1Q8K A;  5KAI U;  4JUZ A;  5KFP A;  4UW9 A;  1Q3U A;  2C28 A;  5KL1 B;  1X9X A;  4LVS A;  1B22 A;  3BZC A;  1UHU A;  1JAL A;  2YN4 A;  2V4R A;  2G08 A;  2PI4 A;  2GWS A;  1BVS A;  1L7N A;  4IQT A;  4P4M A;  4A8E A;  2ZJA A;  3ZI4 A;  2OHF A;  5B66 U;  4KLQ A;  5KT6 A;  4DL4 A;  1SL1 A;  2E1E A;  4BGD A;  5FP0 A;  4NL9 C;  4RPZ A;  3NTU A;  1MN8 A;  1LVH A;  2ZIV A;  1YZ6 A;  2R8G A;  3L4P A;  3SEI A;  9ICU A;  4EBD A;  2OCE A;  1XC9 A;  2PXI A;  5KFY A;  3M8S A;  1S97 A;  5KG3 A;  1Z3E B;  3OPX A;  1RYR A;  2PFO A;  1TKD A;  2K8A A;  3BDP A;  4QZI A;  1NK0 A;  1S0O A;  3PX4 A;  2YML A;  2Q0Z X;  4RQ4 A;  9ICX A;  2C2D A;  1TVA A;  3TAC B;  3ETR A;  3MR3 A;  5DDY A;  5AKG A;  2ZUC A;  5ALK A;  3MFH A;  1ZQB A;  1RDF A;  1V85 A;  3CRX A;  3H8W A;  1WG8 A;  1MSW D;  1A77 A;  1U48 A;  4UAY A;  2DPJ A;  2KZM A;  1ZQO A;  2F76 X;  2JXJ A;  1AQ6 A;  1ZQI A;  4UAW A;  1TV9 A;  3K75 D;  5AIB A;  2RDJ A;  4O5K A;  2LYA A;  4C8K A;  4WJ3 B;  2H3I A;  8ICM A;  1ZD3 A;  4OJP A;  1UQV A;  5KG4 A;  3JPR A;  4F4Y A;  2KKV A;  3FYH A;  2W8K A;  3WKB A;  1ZQX A;  2HBL A;  3SAG A;  5DB6 A;  4DQR A;  3LWM A;  5ALL A;  2N1R A;  2F1J A;  1PK1 A;  2XY6 A;  2F3N A;  3NVV A;  2F8K A;  5KG0 A;  3QZ7 A;  5KFB A;  4DL7 A;  3A0B U;  5KFS A;  2F44 A;  4ECT A;  1SZP A;  4CF5 A;  2HDO A;  4PHA A;  1QQ5 A;  4J9N A;  1QQ6 A;  5F9L A;  5KFD A;  9ICW A;  2VA2 A;  4Y2U A;  3RB3 A;  3AU2 A;  1ZQP A;  1ZD5 A;  3AUO A;  1N56 A;  4OCZ A;  1Q46 A;  2KEY A;  5BOM A;  2HSZ A;  5B5E U;  3GFK B; 
#chains in the Genus database with same CATH homology
 4RQM A;  4IS7 A;  5JTI A;  5L1M A;  1X66 A;  4PZO A;  5KNI A;  2ESE A;  5JRT A;  1X40 A;  3KKA A;  1SGG A;  4NJ8 A;  2Y9T A;  3IDW A;  4PZN A;  2EAM A;  3BQ7 A;  3TAC B;  2QAR B;  1RG6 A;  5F3X B;  1PK3 A;  2LPE A;  2EAP A;  2EAO A;  1SV0 A;  1V85 A;  2DKX A;  2E8P A;  4NL9 A;  2KE7 A;  2D8C A;  1OXJ A;  3H8M A;  1LKY A;  2DL0 A;  2GLE A;  5J8Y C;  1WWU A;  1V38 A;  1JI7 A;  2JV3 A;  1B0X A;  2LMR A;  1OW5 A;  2QB0 A;  3TAD C;  1KW4 A;  2L5Y A;  3K1R B;  4MHV A;  2FE9 A;  2YTU A;  3BS5 A;  1UQV A;  2EAN A;  1X9X A;  3BS7 A;  1LKY B;  1WWV A;  2K4P A;  1SXD A;  1DXS A;  2B6G A;  1COK A;  1PK1 B;  2K60 A;  2E8O A;  3KKA C;  2QB0 B;  1PK1 A;  2QKQ A;  2F3N A;  2KSO B;  2F8K A;  5JU5 A;  2Y9U A;  3BS5 B;  2E8M A;  2KSO A;  1Z1V A;  1SV4 A;  1B4F A;  2F44 A;  2KIV A;  1F0M A;  5J8Y A;  3HIL A;  1SXE A;  3SEN A;  2KMD A;  1SV0 C;  3TAD A;  2E8N A;  4NL9 C;  2KG5 A;  2QB1 A;  1UCV A;  2D3D A;  4RQN A;  2ES6 A;  3SEI A;  2DKZ A;  2QAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...