4PZYA

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
b'GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDCYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pzyA00
5EE5B 1H65A 1SVIA 1OKKA 1ZUHA 3FMPB 4IEEA 3QVVA 4MYHA 3SR0A 4ZO4A 4PAOA 2W0MA 5KSYA 2VP2A 3GLHE 3DPUA 1I4LD 1G6HA 4LJ5A 4TL6A 4EUNA 3A37A 1G4UR 4H1VA 3Q5EA 2GK7A 1NG1A 4KBGA 1US8A 2JLRA 2QTFA 4M22A 2GVDC 3VHLB 3KL4A 3D7MA 4RKEA 3TAHA 4C0AC 621PA 1XJCA 1P9NA 4TQUS 2EFEB 1UKEA 1TQ2A 2YWFA 3FFBA 3I1FA 3CH4B 4MRVA 2WWYA 5JSZB 3IQWA 1D9XA 3GJ5A 3SJCA 1P5ZB 4C0BA 1J8YF 2G0NA 3THYB 4OJKA 2IHYA 1SHKA 4NMMA 3F5FA 4OI4A 4QBIA 4S35A 4URWR 3OF5A 1EX7A 4MGZR 5KDLA 2PX3A 4JVNA 5D3QA 3TGPA 2FGKA 2BBTA 2CEAA 3X1YA 1OKKD 1TF5A 3MFYA 4CW7A 3CBQA 3Q8XB 1E3MA 3Q9LA 2Y8EA 2Q9AA 1X8KA 2QQ0A 3EZ2A 1G3RA 2VSOA 5EE9A 2D2EA 3QVUA 4Q21A 4A8JC 4ARZB 3AVQA 4TTRA 1G64A 4BECA 1Q3TA 1QBKC 1OIXA 4GMDA 3WRXC 1AZSC 2ERXA 1J7KA 2AD5A 1XMJA 2ZETA 5AJYA 4JLKA 3WY9A 3O8BA 1E2QA 3GJ7A 4XD7A 1E6CA 2P0EA 5EP1A 3VR6A 2HT6A 3CRRA 4HAXA 5FTMA 2C95A 2ZSAA 2ZTSA 4RD2A 2IWHA 1CJTC 5CB8A 4YMWA 3OEHD 3EPJA 4PR0A 5K8LA 1QHIA 2JDID 2W0SA 2C5LA 3WNCA 1UBCA 1VCNA 2RCNA 1XBTA 2XGJA 5CB6A 1XFAA 4OBEA 1Q57A 2QAGC 2RH5A 1VG8A 2QMUA 2H8KA 1H8EA 3EX7C 1SVKA 1CJUC 3LBHA 2BJVA 3U4QB 2QGNA 1GSIA 2AXNA 1KIMA 1ZIPA 1ZRHA 4IDQA 4RFVA 2F55A 3TR5A 1F2UB 1T3SA 1QVAA 3SYLA 2OM2A 1ZNYA 1D6JA 2Q6TA 1Q44A 1XXHB 4IDHA 4PZLA 1WP9A 4QHTA 1OXTA 2HF8A 4CEHA 1ZU5A 1KGDA 3RLFA 2ZJ5A 4BLPA 5EP2A 1HYQA 1LF0A 2XB4A 4B43A 1E9AA 2EQBA 2QGZA 1HV8A 4IOJA 4NU0A 1NMZA 2VIIA 1XWIA 2FSHA 4JLDA 4JL8A 4LV8B 4PHGA 4O25A 1II9A 4W5HA 4O2RA 1E2DA 4PPNA 1FMJA 2UVQA 3I8XA 3KFXA 1G20E 3ADDA 4LHWA 4Y0AA 5KDDA 5BYKA 5FL3A 3UATA 2O5VA 4CT4B 8OHMA 4GSYA 3U3JA 2MMGA 3LWNA 5JEDA 4MYTA 1BMFD 4HYYA 4QJ4A 1M34E 4MDEA 4X8OA 2G9NA 1KKLA 2ORVA 4TMTA 3RDPA 1E9SA 3MSXA 1KK3A 4PHFA 1F2TA 2QP4A 5FTNA 4IVRA 3M0EA 1L2TA 3PEVA 5EQTA 3SDZA 5FPTA 1WCV1 3AH8A 3WNBA 3VQTA 2HLDA 4RCZA 1JR6A 4M1YA 2FFAA 1Z5ZA 3QNUA 4PXAA 1W2GA 3KB1A 3CR8A 3X1XA 2FG5A 4JYBA 5J4HA 5FR1A 3GLGA 3RWOA 2GETA 3I3SR 3U5ZB 1G3UA 3DM5A 2A5FA 4MH0R 2VYFA 2IS4A 3K09A 3PJRA 3MAAC 4HZUB 3DZDA 4AIIA 5EJEA 3ETLA 4LI0A 4IVQA 1HT1E 1SGWA 3A1SA 5A5GA 3KUDA 2OBNA 2G88A 4TT3A 2X19A 5IK2D 2QI9C 4JSTA 4LV5B 1KI9A 3BC1A 4PSAA 4KLNA 4Q00A 1NF3A 2P5TB 2HCJB 4GOKA 4DLYA 2PZGA 2J7PD 1E1QA 3K9HA 3LVRE 3LY5A 3V4RA 1DPFA 4A4DA 2GEDA 4R2IA 2QG6A 1G8FA 1SKQA 4DSUA 2ZAMA 2GZAA 1MV5A 1D2MA 3L0PA 3RSOA 1TMKA 2JCSA 1DVRA 1ZJ6A 4DDUA 2VP4A 5EZ5A 2ANBA 1G17A 1ZIOA 1KMHA 2HLDD 2HUPA 5E3HA 1IQPA 1TL7C 4I1VA 4ASUD 4XWKA 3SJBA 2ZI9A 4AK9A 3SZRA 5KNCA 1AQUA 2QL6A 4JJZA 4II7A 4NYIR 1MO5A 2MMCA 3FB4A 3WMEA 2I1QA 5HR5A 2AK3A 4M9QA 4S2EA 2GAOA 4XJXA 2AFHE 2ZRMA 3KZ1E 4LZZA 3CM0A 2ZR7A 2BBWA 2BM0A 5DHFA 3Q3JB 2QMOA 4L9WA 5BXQC 3DKVA 2GCNA 2P65A 5FFMA 4DSOA 5CDFE 1E9BA 2RGGA 4RD1A 4B2PA 5FH9A 5DI3B 1KSFX 5P21A 3LD9A 2J0SA 3NDBB 3CWQA 1E32A 1FFHA 1L7VC 4C9BA 1R5OA 2YKGA 2ODNA 2NZ8A 4TZ6A 3AM1A 4GOXA 3IO3A 4HLQB 2VEDA 4PTLA 5ANRB 4LJ4A 2WSSD 2RHDA 1GNPA 2ZROA 2ZRDA 3AKYA 3LFUA 3PEUA 4EPVA 1Y63A 2ZE6A 3U3MA 3PR1A 4BLQA 1AKEA 3NWJA 1COWA 2IA5A 1ZM4A 4GZLA 3CX7A 4ILEA 4A36A 4Q7LA 2A5DA 4BFUA 2UZ3A 1QF9A 1ZM3A 2QM7A 4EPTA 5KPDA 1IBRA 5HPYB 3U7EB 2YJTD 3REGA 1YZKA 3AGPA 3FE2A 3IO5A 4BRWA 2RGNC 3CPJB 2EWWA 4ZPXA 1XEXA 1DO0A 2RGDA 4UJ5A 4V0LA 3RYTC 4D26A 4QGFA 4XTCS 3NBYC 1CJKC 4EQ6B 2D4HA 1ZYUA 3K70B 2VHJA 3P26A 1W5SA 3K0EA 3NKVA 1X3SA 4P4SA 5DLQC 4W7SA 4B76A 2R62A 4I1SA 4EPYA 4BEBA 4IFBA 1KZ7B 1E98A 3U61B 4LYAA 3CX6A 4B34A 1XEFA 2FH5B 5KSOA 1AKYA 3WYFA 1U8YA 3M1IA 3I73A 4Q9IA 3RS4A 1DG3A 4NZYA 1SXJE 3QE0A 2GXUA 4QJ5A 4GP6A 2ZREA 4LBVA 1JAHA 3A1TA 3TVDA 2W2VA 3K0FB 2CLCX 2B8WA 1FW6A 3THXA 2REOA 2RMKA 5AJWA 2V4ZA 2ODEA 1E79A 2D06A 2FOLA 1DOAA 2ZU0C 1EFHA 2WIAA 2YZ2A 4QXAA 4CEJA 3HR7A 4E22A 5IRCD 2G1KA 4B35A 2JJ2A 3MUFA 3WBJA 4EJSA 1RJ9A 5G53C 5C18A 3FKSD 3GJ8A 3GLHB 2IS6A 5TV2A 3WNDA 4DLZA 5GADl 1Z6GA 2TMKA 1HEIA 3IPYA 1MT0A 4M9XA 2BIFA 2HXSA 3QKUA 1DO2A 4D4JA 3TUZC 4HDQB 3W3AA 4BGDA 1E9CA 2LKDA 1W44A 3K70D 1QHXA 4B74A 1PVOA 2W58A 4I1UA 1IXSB 4PPGA 1CRPA 4AI6A 4CZ2A 1S3GA 1M7BA 3AP2A 3K0AA 1DAHA 2ZEJA 4EFLA 1XJQA 2ZR9A 1AGRA 2AHOA 2QQEA 1G7SA 2F43B 3JZMA 1W0JD 3KB2A 5AUNB 4Q03A 5TARA 4MGKR 5FBRB 4EFMA 2QA5A 2X2EA 3ADKA 3BFXA 3PQCA 2H1LA 1KI6B 4KJZA 4LJ7A 4C0LA 4QBGB 4F7WA 1E79D 2OO7A 1OLOA 4UNQA 2PJRA 6Q21A 4B2LA 1U9IA 2DYKA 3LLMA 1EWRA 3MWKA 1A82A 3U7FB 2EWVA 2ZSDA 5DSZA 1J2JA 1ZNWA 4YXWA 1RPZA 3FTQA 4OK3A 4JLPA 2VRWA 3CF2A 3ADBA 3K53A 4NCHA 3C14C 4ZCMA 3FDIA 3FHCB 5J4LA 1Q0UA 1I4DD 4WXPA 4CT5A 5GJBA 2FA9A 4HATA 2JEOA 1JJVA 4I4LA 2YINC 2Z43A 4TYNA 4B47A 1S9HA 1AA9A 1HTWA 4KO8A 2ZE7A 4PAQA 1EGAA 3KKPA 2O0HA 1C4OA 2IBMA 3FVQA 4BLTA 2VF8A 3OIWA 2BVNA 3K9LA 5C2JB 2CNWA 1PJRA 3LV8A 4MITA 4MGIR 5BYJA 4E5UA 3B9PA 4I1OA 1P7CA 1YVDA 4OK6A 1IY1A 4H1UA 1D5CA 3X2SA 1DAFA 4P32A 1QHHA 4LWZA 2W6JD 3C7KA 3L8YA 1S3SA 2REBA 2NG1A 5FI1B 5AUOB 4XSHA 3UWKA 3CPHA 2KWIA 3THOA 3QKSB 2HYIC 4M1TA 4JBXA 1NG9A 1TEVA 4LYFA 4V0MA 5JS8A 2C98A 1HT2E 1YHNA 2F7SA 1N6KA 4URZR 4C30A 4UKDA 1LS1A 2O52A 1P2SA 1FMLA 5FPYA 4TMXA 3B1XA 1ZC3A 2GCOB 1XPOA 2IXFA 4HAYA 1XMIA 2ONKA 1N0WA 4TN1A 1X8LA 1L4YA 2FSGA 4C2TA 2BCGY 1Y3AA 5HKKA 2BBOA 3T12A 5BWMA 4G01B 1WE2A 1EG7A 5FR2A 3VR4A 1YJ5A 3NH9A 1RFLA 1TNDA 2KJQA 4N0EA 4TMVA 4NCKA 2E9SA 5CM8B 1FTNA 1QDEA 2QROA 3H0KA 2J9RA 4MRNA 1IAQA 3SU8A 3UKDA 5J4KA 4C7OA 3HU1A 3H86A 2JATA 1XB2A 2CK3A 2ZPTX 4IFEA 4ESVA 2R6AA 4NYMR 4P0TA 3B1VA 3GJ0A 4MA4A 5KYKA 2WOOA 4WBSA 1XD2B 2GKSA 3CRMA 4Q4JA 3VFDA 1UDXA 4US1R 1YZQA 2V3CC 1BYUA 2NPFA 4EJSC 4PC3A 2CMKA 2ZRFA 2DWOA 2I3BA 2BJWA 2CDNA 4KHZA 3GLFA 1NI3A 2ZUDA 1LW7A 4JLNA 1KJYA 2BBSA 1JQLB 3TK1A 1S1CA 4Z51A 2VF7A 5G41A 3IDQA 3ZYCA 2WBLC 1KO8A 1TU4A 2P6RA 1H8HD 2OEPA 3R20A 5EP3A 2DWQA 4N0DA 3PUXA 1YU9A 1N3BA 2BCJQ 2Q9CA 4O3MA 5HKKD 2PBRA 2FMXA 1A1VA 1CU1A 1KI1A 3U7GA 1S8FA 4G0NA 4AY2A 2V7QA 2GHIA 2WHXA 4U5XA 1G8YA 1VYVA 1SKYE 4H9GA 4WZ6A 3SFZA 5C4GB 2J5XA 2CK3D 2C78A 3KX2A 1QRAA 3VNUA 4PC6A 1OPXA 2ONJA 3AKCA 4QKQA 2PMKA 1U9IC 4HLUC 2NIPA 2F3TA 2HXYA 3LX8A 3HP1A 2PH1A 3QF4B 4AWXA 4DVGA 3RHFA 4NCJA 4NCIA 1KJZA 4GDFA 1YRBA 3GMTA 1ZAKA 3L43A 5IDVA 5JCZA 4BQSA 4KYIB 2FDCA 1RIFA 3TVTA 3TKLA 5L3SB 4AURA 1S1MA 3BFVA 2IXGA 3X1WA 3Q5DA 4PANA 1GRNA 5KPJA 3SBEA 4FMDF 2ZJ8A 2C2HA 2ATXA 2KI5A 1LF5A 4HAUA 3F3YA 3X1ZA 5JWOA 2OCYC 2R65A 3FWYA 1RE0A 3VMFA 3C5HA 2R2AA 1FP7A 4TYPA 2ZR0A 4IXNA 4AG6A 2X1VA 4QHSA 4BPBA 1OXXK 2GXAA 2WICA 1TPZA 2QENA 2GRJA 2XTNA 2G1JA 2QE7A 4GI7A 3U2QA 3GPLA 2HJVA 3N70A 4R2HA 4B3CA 4M2LA 1Z8FA 2ORWA 4PO8A 2R6DA 1KNXA 2WJGA 3FMIA 4Q1DA 4Z1MA 1P9RA 3R7WA 4AD8A 4OJQA 4DT1A 3PUVA 1G41A 2D74A 2OFXA 5B58C 2NO9A 3WP1B 5FPKA 2MSEB 4OQMA 4EPWA 4IRUB 3U60B 1XPUA 2GZHA 4KV9A 2ANCA 3B6EA 2IT1A 4Q01A 1N6IA 4V02A 1F5NA 4B3XA 3G82C 4UNNA 1OHHA 4Y0VA 3SI7A 3EIHA 1R8QA 2O8DB 4TL8A 3DMNA 1KI8A 1E2JA 1Z07A 3VU9A 1BOFA 1OH6A 3KQLA 2QAGA 1MABA 1S96A 2OBLA 5GVRA 3UMFA 3NHBA 2DHRA 2IYSA 3CNLA 2WAXA 1N0UA 3ZVRA 1OYWA 2IF0A 3CNOA 4QNRA 1VG9B 3D31A 4XWAA 3TH5A 4TZ0A 4A6XA 1AGPA 3JVVA 1AK2A 2ODWA 3KXLA 1YR6A 1R0YA 1Q1EA 3O8RA 2QE7D 5L8VA 4MUAA 4HDOB 4Q9KA 2CHGA 5SZKB 5LB2A 5K8UA 1GOTA 3QXJA 4Q9LA 4JL6A 3SE0A 4MRRA 1VCIA 4DHEA 2AKAB 2ZQ5A 1IN4A 2GJAA 1U8ZA 1W46A 4GT1A 4CRWB 3T1TA 2QPAA 4BASA 4EIWA 2ZE5A 5FL7D 3OAAD 3LO5A 5J40A 2WKRA 1CLUA 3LX5A 2IYWA 4A2PA 2C96A 4BFZA 2WWHA 2A5GA 2F1JA 2OZEA 4Q4AB 4LJYA 5E95A 1XP8A 2ZRBA 2B8TA 3CUEF 1OF1A 3B5JA 2GEUA 3EIQA 4RY2A 4YMUA 1M7GA 1G3IA 3QIAA 3EARA 3IKJA 1QG4A 1XPRA 3ASZA 5J47A 3EPKA 4QRHA 3QKTA 4Q1BA 1Z08A 3GFOA 3OIYA 3ZGXA 3AKEA 5B57C 1T0JB 2H17A 1IM2A 1R7RA 3M6AA 2H16A 4WZAE 4A0FA 4TMKA 2NQ2C 3NTUA 1KYIA 2QP3A 1A2BA 1TEXA 3ASYA 1IY0A 5FUWA 2EW1A 4ON9A 2Q21A 3B82A 1O3YA 2VLIA 3NHAA 1FUKA 1E4VA 1E94E 2QRZA 4BZQA 5FBLB 2CCJA 3IIKA 1Z6YA 2DWPA 4HSEA 3SBDA 4JYCA 4B33A 3AVYA 4TL9A 1F6BA 2EU8A 5DNYB 1VYTA 1JEEA 3EC1A 4PQRA 1J70A 3OEHA 3EPLA 2ZJYA 1U8AA 2JDIA 3AEZA 4JZKA 1DE0A 4AC9A 1AS3A 5JI3E 1US8B 5JMTA 4A6PA 1YR7A 4J0QA 5LD2B 3HDTA 4DCSA 2JLVA 3DKPA 2OLKA 1D9ZA 1KSGA 5JSZA 2OESA 2ZJAA 2AWOA 1MO6A 2JJ1A 3LBIA 3DMDA 1Q22A 5TXGA 5KUTA 1SVMA 2ZI6A 3KQKA 1N0VC 1JALA 1W4RA 1NSFA 2YVUA 3B78A 4JLMA 3RS0A 4IDPA 3AP3A 3MWLA 1KMQA 4BZXA 1QHYA 3WYAA 1GFIA 5DYGA 1KK0A 3KDSE 1XDBA 2KSQA 1ODFA 4CGZA 2XITA 3K9GA 2CHQA 4XVRA 2IW3A 3CONA 4ARZA 5JJIA 1WXQA 3C16C 4I81A 1UJ2A 2G77B 4IKEA 5H1YA 2FPMA 1KI2A 2J0QA 1Z0FA 3PCRB 3KJEA 3NC0C 2GCPA 4BE7B 1JR3E 4UNRA 1KI3A 5C1BA 2V9PA 3C15C 121PA 3W5JA 3A1VA 1GG2A 1T8TA 5TB5A 1BMFA 2AWNA 4YDHB 2IYXA 5TDHA 3A4LA 4JVSB 2JLUA 1NBME 2JJ1D 4A9AA 2NTYC 2KB0A 4Q9JA 1Q20A 3T06B 3PEWA 1NL3A 1IXRC 2XXAB 1HH4A 1VG0B 4GMXA 2FEOA 3U7HB 2QSZA 2RGNA 2E1RA 2J3EA 2ZI3A 1JNYA 3HU3A 1ZVQA 2YWEA 3U4QA 5EE0A 3J81k 4M8NE 1ZUNB 1F2UA 5EUQB 4B6EA 4ZDJA 1NN0A 2OAQ1 4ERNA 1AN0A 4F4IA 4RFSA 1XXHA 1XCMA 3PV0A 2FFHA 4NE2A 1Q1BA 3SNHA 5TMPA 4NYJR 2YWGA 1DAEA 4QM6A 3C4JA 2C04A 4Q1EA 1MR3F 1IHUA 1NVVQ 2VSFA 2GILA 3EZ7A 4UXHA 1R6BX 3CF0A 3MMPA 4PO9A 5IK2A 4L8GA 3T35A 2XEXA 1N6RA 2XTMA 1G6OA 2OBMA 1Z6AA 4N1AA 4LJ8A 2CJWB 2J7PA 3ZIAD 2CL6X 2C77A 3LQQA 3QXXA 3B2EA 1ZM9A 2ODBA 2HDNB 4QOSA 4C4PA 1SKYB 1CS4C 2QTHA 5EP4A 5HZHA 1E2EA 2A7QA 3SYNA 5IHPA 3DHWC 4OK5A 2I1VB 3RRYA 4DB4A 3A36A 4ASUA 1E2FA 2OE2A 4TLEA 1NP6A 2HCBA 5JHHB 2R44A 5DH9A 1GRQA 1UBGA 2DCUA 2IF2A 2QMEA 4IOKA 4I99A 4BFSA 3RANA 4KODA 5F9HA 4WVFA 4BEJA 1FL9A 3AF1A 2RAPA 3HR8A 1BIFA 1W36B 4TQAA 2WM9B 2F3RA 1Z2AA 3ZVNA 2UZIR 1UKZA 1BH2A 1PUJA 3BORA 1E0AA 1KK1A 1W4AA 4HZUA 2XB2A 1GL6A 3VR5A 2GDJA 2YYZA 3T34A 4JLOA 1N2CE 4KVGA 3RRNA 4GZMA 1TUIA 2WSSA 1CRQA 1KAGA 1T4GA 2A3RA 4HB4A 3EC2A 4MGYR 4IVPA 1S9DA 2QRNA 3C8UA 5SZHB 4ZCIA 3N2IA 5CM9C 1E96A 1JXMA 2AKYA 2ZRKA 4B71A 4MKGA 4DWJA 4P4TA 5JEEA 4JLBA 1CJVC 2GXSA 1LV7A 1Z0IA 4DEYA 4D81A 3BGWA 1G8PA 2XNDD 4MQBA 4Q1FA 2CL7X 3PITA 1XTRA 1C9KA 3CNNA 1FTSA 5FOWA 1OH7A 4Q02A 1U0LA 2J45A 5KO2A 3MCAA 4Z8XA 3ZVMA 3IEUA 4P3YA 4L9SA 4CF7A 5G3ZA 3QKRB 4U00A 4DEXA 3K8YA 1KO4A 4DDTA 4NL4H 4XSGA 4NTZA 3CKLA 3KKMA 4KAXA 5L3QB 4B48A 4C2UA 3A58B 4FWTA 4YDSA 4HZIA 1G18A 1T8UA 2AXPA 2B7CA 2JIZA 3IGFA 1T5IA 1ZCAA 4PZZA 5DI3A 4DB2A 3UWOA 2JLYA 1GUAA 2CCKA 3K0CC 3ZDQA 3FGNA 2C9CA 2VP9A 3B60A 1G8HA 1F3OA 1FP6A 2K5UA 4IOMA 5JRJA 3ZZTA 2FNAA 5DE3A 421PA 4BWYA 4QL3A 2G6BA 3HJNA 4Q66C 4A0GA 1EFUA 2GJ8A 1CTQA 1P4SA 2A9KA 5FOVA 2XSZD 4PO1A 3QPVA 4Q7MB 2J0UB 1Q12A 2PCJA 3OEED 4K8OA 5JCPA 5F98A 1M6NA 3Q7PA 3TLXA 5GJWC 3FKSA 1OH5A 3FHTA 1VTKA 2N46A 3BJIC 1ZNXA 3VR1A 4HUQB 1P2TA 2NZJA 3BH7A 5FBQB 2PT5A 4ZIRA 3SYKA 5BQ5A 1KAOA 1RW4A 3LRPA 3S1AB 3QG1A 4GPTA 2NOAA 4EQ6A 5EZ6B 1AS0A 1CXZA 2ZSBA 2CLSA 4FMCB 4JKIA 4M1SA 2CVFA 2WJVA 2QORA 3ICQB 2JIZD 2REXB 1UFQA 3L0SA 3MJRA 1IN8A 3DDCA 3W6OA 1UKVY 3O8CA 4R9UC 4IXMA 1DG1G 3QPWA 4D0GA 4LBWA 1W0JA 2AN9A 4LHYA 1TUEA 2OCAA 4AKIA 1ZW6A 1G4AE 3QPUA 2A5JA 4PZYA 1B0UA 3GEIA 2ZE8A 4OHYA 3DM9B 4PQYA 1Z3IX 2BM1A 2QP9X 2WV9A 4OHWA 3TSWA 4B3DA 4Q4HB 2WKQA 3K0FA 2Z83A 4JSYA 4X8MA 1G291 2E87A 3GEHA 3AQ4A 3RS3A 5AK0A 1IJFA 2QPOA 3IPXA 3M4YA 4JL5A 3U44B 4KYUA 1NJFA 2XJ4A 4Q47A 3AVUA 4E09A 1FUUA 4L5BA 1JQJC 3DOFA 4US2R 3EZ6A 1OJLA 3UG7A 3RRMA 1P72A 3QEJA 3H1TA 3IHLA 3PUWA 1XD8A 2RB4A 3GLHA 3HYRA 4KI0A 4MKFA 3QG5A 5CJ2A 4GRAA 2R9VA 4E07A 2F1RA 4LYHA 1D8TA 1Z63A 2ZS9A 3NVAA 2BWJA 4QJ3A 2XX3A 1R4AA 3G5UA 3R9XA 1LTQA 1KO7A 4X8HA 4FI3C 3W5IA 1P3JA 1WRBA 1ZM2A 1VDZA 4DDWA 1JPNA 1M2OB 1OFHA 1E2LA 2NO6A 4W5WA 5FPSA 2F43A 4FMBB 5E7JA 4D6PA 2W2XA 3SQXA 3W8RA 3W34A 4HLUA 1KI6A 4LSGA 4NYIQ 1UBFA 4D0LB 3RC8A 1TX4B 2W6JA 3DO6A 3QF7A 1XZQA 1RC8A 4E03A 3ZS8A 1KDPA 1NY6A 2ZRLA 4G3XA 1HY3A 3P4XA 1E69A 1YZUA 4OI2A 2O8CB 1T3LA 3TUJC 3ZS9A 3EW9A 1Z47A 3KKOA 4DBLC 1XTKA 3NBZC 2HT1A 1OIVA 2DFKB 2IUSA 4B73A 3TIFA 2QU8A 3BB3A 3VKGA 4QBFA 1T6NA 4OQLA 1JEDA 4OQFA 1N6PA 2GNOA 2A2ZA 3TSZA 1OH8A 4DIDA 3LNCA 1A2KC 2ATVA 1W49A 2YV5A 4FCWA 4D80A 2P5SA 1VCOA 3ZZUA 1N6OA 5KNDA 3HPQA 3QOFA 2IK8A 4POAA 3RABA 1G16A 2X2FA 3UANA 2QBYB 2V1UA 1GITA 3BH0A 3LH5A 4NONA 5KHOC 1U94A 5CLLA 2BHRA 2CE2X 2VP0A 1RKBA 3D8BA 1Q3HA 1DTSA 5EXTA 2FF7A 4OQXA 1T9HA 4M9SA 5D3MB 3RRZA 2AD1A 2V1XA 2MSDB 4RZ3A 1T3HA 4TLCA 2O8EB 2RGBA 2FSIA 4KFRA 2JASA 2BKUA 4QGHA 1QHHB 4FCVA 3HU2A 4TYYA 2Z5FA 2VTKA 3NXSA 4CYMA 4PC7A 1TQ4A 1JECA 3QKSA 2GJSA 2W6ID 1U2RA 2PMDA 4HAVA 4PX9A 1W48A 3K70C 1AM4D 2DFTA 2ZSFA 3JZAA 3OZXA 1EFCA 1E1RA 1H8HA 2J41A 1M74A 1ANKA 2RGXA 2OHFA 3U3OA 3AF0A 4BLSA 4AG5A 2V6JA 3SJZA 1MO3A 4Q9HA 3RAPR 1AS2A 1JR3D 1AJEA 2W2TA 2GCOA 4D25A 4ZKDA 4TTPA 1N5KA 4FW9A 4ACAA 2D3WA 2LCFA 3UMSA 5G3YA 3LQRA 1E9DA 1NVWQ 1Z06A 1CR0A 4WA7A 3Q72A 5FTJA 4GL2A 1NBMD 1Z0AA 2WVJA 3Q7QA 3QJYA 2VO1A 3L0OA 2JAQA 1R5NA 3R9IA 1WA5A 2GZDA 2WPDA 1W2HA 3MG9A 5LB4A 3EG5A 3OFNA 4DLVA 3NIBA 3FKQA 1WMSA 5GVSA 3IEVA 4HLDA 1UEJA 3AGQA 1J8MF 1A5TA 3AF2A 1KJWA 5FOXA 2QT0A 2QY9A 1G1MA 3EA0A 5FBVB 3VKWA 1UEIA 4M9ZA 3QENA 4HAWA 1R0XA 3GJ4A 4OL0A 1E1RD 1GVNB 2C99A 1LNZA 3QXSA 3B85A 4L16A 3UXMA 3FMFA 4FCTA 1TF7A 4XVQA 2ZRIA 3PUZA 3QY0A 1ZD9A 2DFNA 4JJKA 4X8LA 1XJ0A 2R6FA 1X6VA 1U0HC 2F9LA 4DSNA 4LPKA 1XMVA 4M4SA 5IT5A 3AV0B 3O47A 3PVSA 3OE7D 4KVAA 3A4MA 2IS1A 4TLDA 2VH5R 3THWB 4DRZA 3VNVA 1R2QA 5HTKA 3A8TA 2ZYVX 1ZINA 5J4VA 1LY1A 3GD7A 3TMKA 1BO6A 2JLSA 2AX4A 1XX6A 2EFGA 1IN7A 1HURA 2WPDD 1R0WA 2QUZA 3OFND 3QQ5A 3W6NA 3B13B 3B1YA 4HDCA 3D3QA 3ECCA 1CJMA 3RS7A 1EK0A 1E2HA 1E2KA 2NO1A 2FPLA 2WMNB 1Z83A 4G5SA 5E7IA 5FUVA 4IJMA 2P6NA 1N6HA 1GWNA 2XJ9A 3GEEA 1UKYA 2NO7A 4YC7A 3PXGA 2H18A 4G5GA 4BRUA 1K5DA 3CPEA 2O0JA 4AYTA 3GLGE 4BLRA 3RWMB 1A7JA 2FWRA 3EASA 4D0NA 5ELXA 1XTQA 2EFCB 3CRW1 1G5RA 1DBSA 4LDJA 5L3SA 5F3WB 2RHMA 2PT7A 1KTVA 3AB3A 5FBWB 1FX0B 1GL7A 1ZD8A 1E2GA 4ZDKA 4A1FA 1XCGB 4FINA 3REFA 4A2WA 2BC9A 3BFKA 3G0HA 4AKHA 3QXCA 2ZRAA 1Z0DA 1M7HA 4DCVA 4KFTA 4Q7JB 2ECKA 3U6BA 2FZ4A 4C0SA 2PEZA 5FOTA 4FD2A 5JWHA 2BV3A 4OHXA 5FTLA 4YONB 3SC3A 3I5XA 4LC1A 2ZRCA 2BOVA 4HB3A 2H5EA 4OI0A 1XNJA 4RZXA 4BFTA 3CZQA 2BEKA 3MLEA 3ZJYA 4A8JB 5DO9A 3ADCA 1OT3A 2RKOA 1KK2A 1VIAA 1XMSA 2ZS7A 1SVOA 3OAAA 4TMZA 5DN6A 4W5JA 1TU3A 1QZXA 5FL7A 1K6MA 1NKSA 3NEYA 3SHWA 2O8BB 1W7AA 4P4UA 2OSBA 1VPLA 1SXJB 4NHOA 3KTAB 4JKYA 3OESA 4U7DA 1C1YA 2B7BA 3I4LA 3UMRA 4LV6A 4DUGA 2O8DA 1EESA 2VHTA 3D6TB 4WIAA 1JB1A 5GJCA 4RKFA 5EE3A 2VPPA 3MWJA 4Q48A 2ZVQX 1TTTA 2VP6A 1CULC 4LBYA 4PHTA 2BMEA 1NJGA 1X8JA 4TSFD 2VSXA 2LWIA 1II8B 1NLYA 1NRJB 4NYMQ 4F92B 4LBZA 3KXIA 1CBUA 2WJJA 1NMYA 5K8IA 1U99A 2FE4A 1PUIA 3LW8A 4LHXA 2EYQA 4MYUA 2C03A 4DXAA 3TE6A 1XCPA 4PSKA 3MWYW 2R8RA 4BUJA 4C0KA 3GLIA 2KE5A 5AJVB 3IQXA 4ZDWA 2R6GA 2XTZA 3P1JA 4W9MC 5DN6D 2XOKA 4JIMA 4XOIA 5DYIA 4KSBA 2Z4RA 3UK6A 4KU4A 1CR4A 4P31A 1GZSA 4R71A 2FV8A 2X8AA 3H2YA 3LVQE 4B3FX 5JJKA 2V6IA 3KJHA 1NN3A 1IOZA 1KSHA 3BXZA 3CH5A 3EIEA 2LKCA 4DUGD 2W00A 1FZQA 1RRPA 1ZC4A 3E2IA 1GRRA 4ESHA 4Q4AA 2GJKA 3FHOA 3BRWD 3I62A 1SXJD 1P60A 5EUMA 4O2LA 3FOZA 1E9RA 5B2ZA 4UQOA 2O8FB 1P62B 3CZPA 1GP2A 2OXCA 1NIPA 2ERYA 2Z4SA 2ZSEA 1KZGB 5A0FA 3GP8A 4CEIB 2Q3FA 5F2EA 1S0UA 1SVLA 4GNKA 1IONA 3E1SA 2AR7A 2J0VA 4RD6A 1N5IA 5EXSA 1NKTA 2AL7A 4DLRA 5KOYA 2GWHA 2ZRJA 1FNMA 4FIDA 3N2EA 1DAGA 2WJHA 4B3GA 3IIJA 1NN1A 2J46A 2F1HA 1K8RA 2WJIA 3BERA 3PENA 1GNQA 4NPHA 4V03A 1E2NA 4JLAA 5AJZA 3QEOA 1SQ5A 4NKRA 1Z6TA 2GEVA 2XOKD 2IYTA 1KY3A 3BBPA 3I92A 2FZLA 3NG1A 4LX0A 3R8CA 2WMOB 1E9EA 4BFWA 3L8ZA 1NVXQ 1IN6A 1OV4A 2ZRHA 4TMWA 5AJXA 3AUYA 2AFIE 2YNMA 4NBSA 3GFPA 2Q3HA 1P61B 2GJ9A 2ZJOA 1AZTA 2Z0MA 2PEYA 3OIUA 2YHSA 2BMJA 4V0KA 4F91B 5CLQA 1OFUX 4MYCA 2WWWA 1RRFA 2YOFA 4A0HA 2NGRA 2OILA 3U6KA 2NO0A 1UF9A 3THYA 4WZBE 4IW3B 3WHLA 4EAQA 3L2OB 1E2IA 2ZYTX 3PEYA 2GF0A 2PL3A 3LBNA 5J4YA 2IYRA 3DZ8A 2D2FA 1QVRA 2Q0HA 3KFVA 2ZJ2A 4LHVA 1VIYA 3U3RA 2WTUA 1F48A 2QTVB 2GBLA 4QG7A 3WHKA 1NIJA 2XNSA 4KSCA 5K8TA 1IJEA 1SVWA 2Z6VA 2ZAOA 3BD9A 4MDFA 1PLKA 3B1WA 1N5LA 2ZUBA 821PA 3ZH9B 2IEYA 4A2QA 1GKUB 2R6CA 3A1UA 3I8SA 5SZJA 1T0HB 1GDDA 1ESNA 4RSGA 2YOHA 5B64A 1RYHA 2V54A 3W3ZB 3ZIAA 2IS2A 3V00A 1GL9B 1SZPA 1RYFA 3A1WA 3K0CA 4F38A 1QHGA 1ZUIA 4WAUA 1DELA 1EFRA 1MH1A 5CK4A 1P75A 3BAFA 1SXJC 3PG5A 3C5CA 3BK7A 3PFIA 1E4YA 2NPIA 1S4QA 4XVUA 2DPXA 1G5TA 2D62A 1UADA 1OSNA 4DCTA 1NSTA 1R0ZA 3TAUA 1NNEA 1G3MA 3B8HA 4R98A 4ZV4A 1ONBA 4B44A 5HZKA 4A15A 3ZD6A 2D7DA 3IIMA 2XXAA 4R7ZA 5JBQA 1OYYA 2ASEA 4EDHA 1CIPA 1LVGA 4KITB 4N3NA 1JAIA 1XU4A 3CO5A 5CITA 1RZ3A 4KXFB 3QUSA 4C0HA 4CEHB 1MRSA 1SVSA 2QN6A 5LBIA 5BN3A 2YC4C 5EXPA 4RD3A 1KY2A 1ELOA 2GK6A 2ZJBA 5JRZA 2B6HA 4RFSB 3KXKA 3AUXA 4NDZA 4DLUA 521PA 4B2IA 3K9NA 4G5OA 4V0ME 1HA3A 2HF9A 4ZI3A 1Z28A 4LPSA 1W5TA 2GA8A 3NC1C 4DLTA 1YRAA 1OB2A 4D4MA 3BH6A 3A4NA 1M1YE 4TL7A 2CJWA 1EFRD 2QPTA 5SZIA 2BMDA 4QC2A 4U02A 2QNRA 4XD7D 2WJYA 4M0LA 4MKIA 3CLVA 3LAWA 1VKJA 2CE7A 4OHVA 3SJAA 2GAAA 1JI0A 3WMFA 4URVR 2AK2A 4Q1CA 3FFAA 1Z0JA 2C9YA 4US0R 1F2TB 3ZVLA 2XNDA 4KCGA 1TADA 2A78A 4FN5A 4TQ9A 5A4JA 2BKEA 2H57A 5M04A 3GJXC 4DIEA 1TF2A 1ZBDA 4LOAA 5HCIA 1H8ED 4FMCF 2W83A 5TVKA 3W8NA 4EKDA 1I2MA 1LS6A 4IOLA 3AVWA 3GCGA 1KI7A 3GLGB 1TQDA 4XTRA 1OW3B 3KQUA 1P9WA 5AUQA 3BB4A 1IN5A 1ZU4A 3GLFE 3SS8A 1EFTA 4F4CA 3T1OA 2GVZC 3V9PA 2FSFA 1IY2A 1GAJA 2DY1A 3CWZA 4NH0A 3LW7A 4ACBA 4C0QC 2N1BA 1W0KA 2GTPA 2B92A 3K1JA 4PPFA 3FMOB 4Q4LA 3T5DA 5BN4A 2HV8A 4L15A 1G3QA 1XRJA 2CVHA 5CYPA 2H7VA 2IYQA 4DSTA 3DOEA 4V0NA 2RGAA 2WZQA 2SHKA 4D4LA 1G7CA 1BYIA 5LD2C 4URXR 4GOJA 1DAMA 2QAJA 5BW8A 1FNNA 5LPNA 2XSZA 1LFDB 2VHCA 4LJAA 4UXIA 3KUCA 3P4YA 1KDRA 3OEEA 1W1WA 4LY6A 1HQYE 1MKYA 1KMHB 1V43A 4NCNA 3EXAA 5HE8A 2VP5A 5DISB 2BEJA 2GBLC 2P2LA 1RRCA 2OAP1 2G0TA 4QFMA 1E0JA 1E0KA 721PA 2J7KA 3T5GA 3TW8B 4YMSA 2C9OA 4K81B 2Q9BA 3QKRA 1BS1A 3NEJA 1W36D 3T15A 1NY5A 4IHQA 221PA 1I2DA 1L8QA 4QNMA 2PJZA 1HE8B 2FPKA 1W0KD 2N42A 2OXRA 1FQKA 3CW2A 5L3QA 1XD9A 4TWZA 2ZRNA 1WF3A 2IYVA 3ZQJA 3HWSA 1OB5A 4C0JA 4EPRA 1N6NA 2QMHA 1A4RA 1AQYA 5KNBA 2DFLA 4HUTA 2WWIA 3GJ3A 5FUXA 4TT3D 4B75A 4QM7A 4K46A 2IX3A 1KDTA 1CR1A 2JLQA 3DVLA 4ZKEA 3EAQA 1E1QD 1V5WA 1W4BA 3WRYC 2F9MA 1YZNA 2FGJA 3QSYA 5CJPA 4DDVA 1X86B 1FQJA 1OXSC 3MD0A 3GJ6A 1F60A 2L0XA 1WBBA 3AVXA 4NYJQ 2J0UA 2X77A 1L4UA 1XEXB 5CK5A 1UDWA 3TRFA 1G5PA 2MSCB 2KBFA 4TYWA 3B1ZA 4QGGA 2DR3A 4HUQA 3QI2A 4O0MA 4GBMA 1G19A 2F6RA 3BIFA 2PZEA 5KU1A 3S1AA 1OIWA 3N5CA 2A5YB 4ZIRB 4P4SB 3CIOA 3TBKA 1ZM7A 4M1KA 4LGMA 2QZ4A 4DZZA 4M1MA 2PLFA 2CLDX 3TW4A 2OV2A 1XEWX 3A6PC 4MRSA 4TLBA 1R8SA 1J99A 4OYHA 1VHTA 4AYXA 1U90A 1MRNA 2IYZA 3T1QA 2HEIA 4A82A 2HYDA 4JVLA 3W90A 2EVWX 1ESMA 2D7CA 4EPXA 4GFDA 3THXB 3GFTA 5J5CA 1SULA 4Q4HA 3JVUA 3NH6A 1UBEA 3SFVA 3T1VA 2ZVPX 1VCMA 3NDPA 2IWRA 3UIEA 4CEJB 1N25A 1COWD 3KQNA 3U44A 5JI2E 3K0SA 5DHAA 2XZLA 4D82A 4EJSB 1YQTA 1MO4A 1RJ9B 1U81A 3V4FA 5JHGB 4OQNA 5JLJA 3VX3A 1KHTA 2XAUA 4F4JA 2QSYA 2OT3B 3P20A 2BMFA 2GXQA 4TTQA 2QEQA 3GLIE 1W36C 2JLXA 4YLGA 2G3YA 1XEWY 2RGEA 4RZUA 1XTSA 2I4IA 4RD4A 2IXEA 1OE0A 4IDOA 1RVDA 4UNSA 3K0AB 2FFQA 2WOJA 5EE1A 3K09C 3EZFA 2EYUA 3EA5A 3UPUA 1K5GA 1NVUQ 2WWGA 5L3VA 1BKDR 3U3KA 1VYUA 2PLRA 1II0A 4GP7A 3TR0A 2RGCA 3SEAA 4ZDIA 5BN5A 4LRWA 3CF6R 1RRGA 4Q7KA 3W9YA 1UM8A 2PCLA 4MUBA 4Z8YA 1X1SA 3SQWA 2QT1A 4Z54A 2OFOA 4BFYA 4Q18A 1NMXA 2YOGA 2EFDB 4QGAA 4HEJA 2PX0A 4DLSA 3CRQA 5DIFA 2WIBA 4BFXA 5LDDC 3H84A 2W6IA 5IF9A 5G40A 4OHZA 2ZI7A 2J59A 2O8CA 2IL1A 2JJ2D 4MKHA 4YMVA 4LCBA 4DLXA 2P3SA 5JECA 1JR3A 3VX4A 4URUR 2DB3A 1P2UA 5KSPA 3TUIC 5H70A 4HLCA 2J1LA 3ICEA 2V55B 1KKMA 5FTKA 4B6FA 3I72A 3I61A 1I4TD 2VHUA 1UAAA 2IYUA 3KKQA 1NBMA 3ZLJA 3ZZ0A 1WBDA 2FFBA 3X1DA 4URYR 2ZXUA 1XTJA 3GQBA 2IYYA 1X1RA 2IYLD 5KDOA 3CRVA 2WAYA 2QBYA 3SN6A 5E7MA 1S2MA 4M1WA 4LYJA 4M53A 4JLVA 3VR3A 5JWRA 5HCNA 1HUQA 1KOFA 5D3MA 1T91A 4IDNA 1YR8A 3ONWA 1VG1A 3O8DA 2O8EA 3FPAA 1YKSA 4QBHA 5CIQA 5HE9A 2ZUCA 3P32A 1CKEA 5AR1A 1GM5A 4HB0A 5UKDA 2B21A 3BE4A 5JS7A 1ETUA 4Q5IA 1U98A 3CR7A 4RVCA 5CYOA 3KJGA 3P27A 2F1IA 4YXWD 3OIVA 4LJ6A 1Q1QA 2VQSA 1W4CA 1Z22A 5EXXA 1SHZA 1VECA 2WWXA 2ZJZA 3OE7A 1DS6A 3L82B 4MRPA 1E99A 3KQHA 1KI4A 3WXMA 2FEMA 1CR2A 2HJGA 4RJLA 1CEEA 1G7TA 3B9QA 1YZLA 3MJHA 1GILA 1NN5A 5FPHA 4YQFA 4RZ2A 2H92A 2OLJA 5FI0B 2VL7A 4C7OB 2V8OA 3C41J 4RD0A 3L0IB 3RC3A 2ZIAA 1XD2A 3HPRA 5C4MA 1TAGA 2KBEA 2CNWD 4YMTA 2JLWA 4Q4JB 3EZ9A 3DEFA 1Z2CA 4HAZA 5FOSA 1DARA 1P2VA 3IUYA 3GLFB 2XZOA 2ZS8A 4D2IA 3ZD7A 1D2NA 1XXHE 4PHHA 3EPHA 2OCBA 1N6LA 1HE1C 2FU5C 4FXPA 4LJ9A 3TQCA 1ZCBA 4B32A 4DJTA 1EWQA 3KJIA 4ITRC 2JGNA 5H8WA 4LHZA 3TQFA 1E9FA 4CDGA 1YE8A 1PLLA 3F0TA 3RNLA 1W47A 1N5JA 4JT4A 3LLUA 2FN4A 4PC1A 4ABYA 1T5LA 1YR9A 5FOUA 1QHNA 5TY0A 3TSOA 4LK2A 4G5RA 3ND8A 3H4MA 3B7GA 3QBVA 1TQ6A 1E2MA 5DGXA 2O0KA 1YZTA 4OI1A 1PLJA 3THWA 2CHVA 4TLAA 2IUUA 3PUYA 3MRSA 3WP0A 1R5BA 5JJLA 2OG2A 2EFHB 2BDTA 1NLFA 2G83A 1P73A 3HYTA 3QF4A 4XH9B 1WQ1R 2YWHA 5AUPB 1QHSA 3AVPA 2IC5A 3BWDD 5JFGA 1GKIA 1U0JA 3DL0A 1M8PA 1WDTA 2CCGA 4LC0A 4PPQA 5CDFA 4P33A 1Q1ZA 2CL0X 3E5HA 3IHWA 3NBFA 3WYGA 3MGCA 1Z0KA 1O87A 2FX3A 1EX6A 2ZANA 2ZU6A 3LDAA 4NP6A 1D2EA 1AIPA 3AKDA 4M21A 2OCPA 3EWAA 4WW0A 3Q85A 3T61A 3BS4A 4M1OA 3I5YA 3AVVA 3LXRA 1FX0A 4TSFA 5KSZA 4BFVA 5GJVC 4DKXA 2ORIA 2IEZA 2JA1A 2DBYA 4Q1AA 3UG6A 1KNQA 2IUTA 1HQCA 2ZRGA 5H68A 4PAMA 1DADA 3BOSA 4TYQA 2ZYUX 4XIGS 3AVTA 4CIDA 5F9FA 3I32A 4FWIB 4EFNA 2VBCA 4LUCA 4F93B 2V7QD 3F8TA 2CXXA 4JT2A 3WBKA 1G7RA 1R10A 1XZPA 5L3RA 3WMGA 3R7WB 4DT1B 1KO5A 3KKNA 4JLJA 4C3ZA 5E4FA 3FYHA 2VA8A 5CIWA 3IBYA 2ZRPA 1OFTA 1GIAA 4UNPA 4A8JA 4RCYA 2IHBA 4KLZA 1Z29A 1KO1A 4UJ3A 2P67A 1G9XA 2UKDA 4JS0A 1OXUA 4AKGA 1P6XA 1ZP6A 1EXMA 3RVBA 3RSLA 1PZNA 4UXJA 3ND9A 4DCUA 2O8BA 1OFIA 4PFSA 2P6UA 2YC2C 2A30A 5KTYA 4JVMA 1XF9A 2GESA 1SXJA 2OFWA 3KTAA 4V0OA 2JLZA 1E0SA 3VU9B 1G21E 2XZPA 4HI0E 3W6PA 1CF4A 2QAGB 1MABB 1YZGA 1JJ7A 2CBZA 4L4UA 2VHQA 2WKPA 4BLOA 4KFSA 4A92A 3LXXA 4AKEA 1LB1B 4JMPA 3QBTA 5C46F 3RS5A 2NMVA 3R9WA 1B23P 3IBGA 1II8A 4A0RA 1KDOA 1OXVA 3VTKA 4PC2A 3AF3A 1DAKA 3R8FA 4WXRA 3QXHA 1Z6XA 4KFUA 4Q19A 1NLZA 4CVNA 1PV4A 2ZI4A 3AP1A 4D4KA 2FJUA 3NBXX 1JXOA 1JBKA 1VHLA 1DEKA 1ZD1A 1J90A 4Z1MD 1KSJA 1ZMXA 1CP2A 3GLIB 1JPJA 2ZYWX 4PSVA 4DLWA 3TJZA 1GTVA 2ZI5A 4DCNA 4G1UC 4ZI2A 1FOEB 3VR2A 1G8GA 2JJ8A 5FUYA 4AYWA 5JZVA 1GNRA 1WB9A 1ZNZA 3IILA 4IEIA 4KBFA 1E2PA 1VMAA 1OHHD 3EWSA 4PQFA 1XTIA 1NVVR 3LA6A 3RS2A 3SOPA 5B30A 2ZM5A 2QM8A 2PZFA 3VHXA 4DC9A 3ZQ6A 3BB1A 3AVOA 1FPMA 2GF9A 4HB2A 3PIRA 1IXZA 1GKYA 2WSMA 2O8FA 4BZPA 3TNFA 4ZCLA 3AF4A 1UPTA 3CB4A 4JBYA 4JBWA 1DAIA 2ZITA 4OKSA 1Q21A 4QHYA 4WOPA 4XWOA 2Q3MA 1MOZA 4FMDB 4CEIA 3CX8A 3E70C 5DI9A 2WWFA 2OUKA 2C8VA 3SHFA 1QG2A 3VAAA 4B3BA 3VKHA 4G5QA 3OHMA 5AWFC 2J87A
chains in the Genus database with same CATH superfamily
3DE3X 2JGFA 1SVIA 1U3CA 3FMPB 1DEXA 3CVOA 1HDGO 4LCEA 1X9HA 3FWHA 1W52X 5SY4A 3T41A 4CIBA 1U31A 2XUJA 3WMXA 5DHPA 2HF2A 5HDBB 3SOZA 2FPPB 2QD3A 4XR4A 2BGTA 3MWGA 2W0MA 2VP2A 3GLHE 3INNA 4J4BA 2LGJA 3VA7A 1X7DA 4TL6A 2RK3A 3N07A 4TKUB 3WYCA 4EUNA 2PUFA 1G4UR 1FSPA 4MKRA 2LTAA 3Q5EA 5ER9A 1NG1A 4KBGA 2QTFA 4PCUA 3LX6A 1OBOA 2QHXA 4C0AC 5KYXA 2OOKA 4TQUS 5JPCA 4UVEA 1T6BY 2IYNA 3CZCA 3F1LA 3FFBA 1QPGA 3I1FA 2WHPB 1HYHA 3FRIA 2YY7A 3ROGA 3AKZA 4W99A 1RHMA 4MRVA 3LBFA 1F7UA 2WWYA 3ITKA 4GPAA 1T2FA 2BFOA 1D9XA 1PW5A 3DYBA 3OPXA 2PX5A 3DFUA 5EHGA 3OUUA 1WETA 2CMDA 4RTOA 1L3IA 1FQWA 2P1DA 4OI4A 2OB1A 3MERA 1E6LA 1HMYA 4HNAB 4JX8A 3DEHA 3IEIA 4QDZA 3MJEA 1K3TA 4YAUA 4JVNA 1SUDA 3D9QX 3A26A 3KQQA 3MUNA 4LMRA 4ZI7A 1TF5A 1KYVA 3MFYA 5AYVA 5INTA 4X66B 1TK2A 3Q9LA 2W8BA 5C5IA 1KWKA 2W4IA 1VLHA 2C3UA 5I7VA 3ZTYA 2D59A 4A8JC 4UOZA 3AVQA 4X62B 4TTRA 4BATA 2AQIA 4FI3F 5JNVA 2NUTA 1OIXA 3FXAA 2RHHA 3MK31 4NV1A 1WV0A 1DT5A 2ERXA 1J7KA 2AD5A 1CR6A 1XMJA 4FC6A 2XCOA 1UFKA 5AJYA 1Q84A 3MBKA 1X87A 4I9FA 3EGXA 3OZAA 2ADMA 3K16A 2SECE 1DU4A 4HAXA 4ZT2A 2C95A 1C9EA 2ZTSA 2ZSAA 2C92A 2BCEA 3OJFA 1TIBA 1CJTC 4AF7A 3OEHD 1E5LA 3G5LA 2F64A 4YH1A 4MLDA 2GBCA 3AY6A 5FD8A 2HK9A 1LBQA 3FRJA 3WNCA 7MDHA 3WDKA 2YCLA 1QQAA 3AZOA 2YXPX 2ZIZA 1Q57A 3B20A 2QAGC 3H9UA 3HP4A 4BAUA 1TT5A 3T38A 1OZGA 1DWUA 2QMUA 5LNK1 2H8KA 2LE0A 4F9GA 4NZPA 2ZVDA 4Q3DA 3AIOA 2A6PA 3QLVC 1ZUNA 4MUGA 4B5LA 1GSIA 4JUIA 4RTMA 1GTZA 4F4FA 2LCIA 2RE8A 1IVYA 3AHGA 4OMUA 1CRZA 5T4EA 1ULHA 3OZRA 3EYAA 4XDGA 4I3HA 1Q44A 1KVTA 2QLLA 4IDHA 5K4HA 4CEHA 4BO5A 3RU7A 4ZEOA 3RLFA 1DWPA 5HSGA 3AEKA 3CY6A 2ZJ5A 4H1WA 5FP0A 8LDHA 3DPSA 5EP2A 4B43A 2XB4A 2F9FA 3PQ4A 4UFNA 2RG1A 2A84A 2EQBA 4NATA 3AINA 2JC3A 3E7XA 3NYRA 1NMZA 2PSDA 2NU9A 3HV0A 4JL8A 4LV8B 3BDVA 4UPVA 5FT9A 1DXYA 4TPKA 4XGKA 4O2RA 1SC3A 4LSZA 1FFEA 1FMJA 2UVQA 3KFXA 3TXYA 2RAVA 2NZVG 1CSEE 3VC1A 1P3DA 3C0KA 5KDDA 4EY4A 3PDWA 3LVBA 2I33A 4J1QA 3UATA 5KKCA 4E5KA 2A9RA 1CQIB 1I24A 2RJNA 3CBGA 4AXBA 3VZCA 4JBHA 2II6A 2QK4A 3A3NA 3P2KA 4UBKA 4M7RA 4D98A 2GLUA 5F33A 3N28A 3QSGA 4PTYA 4UEJA 4EA6A 3K6SB 5JEDA 1HYGA 1AT1A 1H1DA 4HYYA 4QJ4A 1M34E 4PO3X 3VVBA 3IQIX 4HOYA 1FX1A 1GZ3A 4YPOA 1UWLA 1L3BA 1SUIA 4PGHA 4GXQA 4KWHA 4PHFA 4BCBA 1F2TA 4YLYA 1ZPDA 3L6DA 4IVRA 2Q1UA 4X20B 5L4SA 4I55F 3F3KA 2EG9A 5GOZA 5FPTA 1M2WA 1NXTA 3S44A 3VQTA 4X45A 1K63A 3IUSA 1WWKA 4ZQIA 1KF0A 3G6WA 1JMKC 3G79A 3GRUA 1Z8NA 3RBZA 3EK2A 2G09A 3KLBA 2QV0A 3PJFA 3QNUA 1KPHA 1W2GA 3FVVA 4OB8A 1Y1TA 4PXAA 4TKMA 1QSGA 4JYBA 1X15A 5CH3A 5J4HA 2YJZA 1E1CB 4QXRA 1JHQA 3O7MA 2GAIA 5CT5A 5H0IA 3U5ZB 2LBPA 3R74A 2Y1FA 4TV8A 1TYCA 4MJLA 5CLHA 1HL7A 2YMPA 3H8JA 3K09A 4IYRA 2VPTA 4RESA 4AIIA 5EJEA 1E18A 3DZKA 3ETLA 3GMSA 3IULA 3MJSA 1Z18A 3FY4A 1XQVA 3OTIA 3LUAA 4U6SA 5DNEA 3ZV7A 1BDMA 3KUDA 2OBNA 2G88A 4ZT7A 2G82A 1KI9A 1FYDA 2YXNA 4PSAA 4DLYA 2P5TB 4PU0A 5DYWA 4MQFA 3OPQA 3V4RA 1C7EA 2AJDA 3K9HA 2AF4C 1DJPA 4IGFA 3DLBA 3NWPA 3N39C 4KE7A 1QMGA 2GEDA 5D87A 2IPOA 4R2IA 2P77A 3OX3A 1QF6A 3ZU6A 2FN8A 4CTKA 1SKQA 2XB8A 2PKXA 2CNKA 2ZAMA 3BFJA 2GCIA 3TIVA 4F3KA 5F7ZA 1TMKA 2JCSA 3WK7A 1L5ZA 2VP4A 2J48A 3WWEA 1ZIOA 1W8IA 1XVLA 3RUIA 2EJTA 5BSMA 1PJZA 4Y2QA 1DFGA 3QE2A 4HQNA 1KAMA 5F5LA 3T9BA 4HRAA 4C01A 4F5ZA 5DM2A 1K9VF 2QL6A 4GIBA 1FUEA 2BP7B 3L7JA 1JSLA 3CJTA 1SCJA 1MO5A 3VRHA 3AI2A 1ZN2A 2I1QA 3DDUA 4JJ8A 4GVPA 3H9GA 3TLAA 4HDNA 4MMYB 2RH9B 3MEQA 4CMBA 2P4UA 2WFAA 2WG0A 3KZ1E 3LO8A 4LHEA 4LZZA 5ECYA 1ZAYA 4MQUA 1W5EA 2BBWA 2BM0A 1DQPA 3O4HA 4WFIA 4L9WA 4NCAA 2JGDA 2GCNA 5FFMA 4BUCA 3B89A 4DSOA 3SZ3A 2C4WA 4B2PA 1ECFA 1KSFX 2IXDA 5CJJA 1FFHA 2WU1A 1E61A 2AC2A 1MJGA 1S8OA 1WW2A 1SCUB 2O50A 2R4UA 3MWDB 4HN9A 2IUEA 3AEQA 4V0RA 2VEDA 4PTLA 5TC4A 4LJ4A 1Z5GA 2WSSD 1GNPA 3LFUA 3DF7A 3PEUA 4M8SA 2BEUB 3RUFA 3U3MA 3HBNA 4YCSA 3O2QB 1SBTA 4BAGA 4BLQA 1DWOA 1COWA 2IA5A 2B2CA 4GZLA 3CX7A 4LZOA 5AI6A 1AKVA 1ABFA 5DIZA 2J08A 2YJGA 3FOCA 3AFOA 2LW7A 2UAGA 3MLBA 1H9CA 2P91A 3LLCA 4FDVA 4YIKA 4EPTA 1SA0A 2WD8A 3Q98A 5KPDA 1IMJA 4B7CA 1RQLA 2X13A 4NU5A 1YZKA 3U7EB 3BKXA 3AGPA 3FE2A 3IO5A 4IG9A 5JNSA 1FVXA 4OX9B 3RFFA 2GPJA 4UJ5A 4V0LA 4FCCA 1KEZA 5D6NA 3QVXA 4IR7A 4D26A 1R0RE 1EUZA 3NBYC 4DQ0A 5FF9A 2VHJA 1ZK0A 3CPSA 4JJ4A 3A1NA 3BL5A 4D6YA 1IH8A 5C37A 1J1UA 1XVTA 4M89A 2BFFB 3AUTA 3PBKA 4P4SA 3FPGA 4WNYA 4B7UA 6GPBA 4LNAA 1KZ7B 4WT7A 1ZVVA 1WQ4A 1DDGA 3L1IA 4AMBA 3DDWA 4R01A 1R1DA 2D8AA 3F6SA 3MS4A 3PE6A 2FH5B 3K15A 4H7EA 3VZRA 3VZDA 4KPYA 1QNFA 2XYHA 2O0MA 3JRNA 4BBJA 2DSTA 3M1IA 3I73A 4PNEA 3M81A 1U3VA 1DG3A 3DTVA 4MWOA 4NZYA 2R87A 1SXJE 3H9QA 5DB4A 5IJXA 1BXZA 3KPUA 1LXCA 3TG2A 1Y6ZA 4YACA 5L4LA 1EFPA 1NONA 3OJLA 3NZEA 1VOTA 3D2CA 3RFUA 1E6MA 3UGTA 2REOA 4BAZA 5AJWA 2Y4OA 2V4ZA 2BFDB 2WZDA 2FOLA 3X1KA 2VKTA 1AUQA 1GPDG 1EFHA 2WIAA 2ZU0C 2G71A 2BI8A 3M6VA 4GKAA 2VXCA 1KAQA 3DZIA 4BV8A 5IRCD 1S3IA 2G1KA 4IDFA 5EJIA 4EO7A 2OLEA 3PPXA 4I0WB 4QT4A 3KYBA 1L0BA 2W6QA 3KKEA 2W4MA 3N3BC 1NUQA 2B34A 2KQUA 5DX0A 3VU3A 1AQNA 4KRFA 1JG1A 2HPAA 4WKCA 4DLZA 1Z6GA 1Y6RA 2TMKA 4RH0A 1MT0A 1WCWA 3QKUA 1ENPA 5SYNA 1DO2A 2C54A 4AJEA 5GAJA 4I7EA 1MZVA 3RR2A 4BGDA 2B1JA 2VTBA 3A4YA 4ZT5A 1ICIA 2LKDA 4P7KA 1P1IA 3R9XB 2VZ0A 1PVOA 4CKEB 4P3OA 2OQVA 2W58A 2Q1SA 3K4QA 2QRPA 4BQEA 3K9QO 3MWFA 3AHHA 1YR1A 4AI6A 1DC4A 1D2RA 3VGPA 4QA9A 5LP1A 3V34A 1H4TA 2IVFA 3SP1A 2CVQA 3AFNA 2OHHA 4F6RB 2QQEA 4F4UA 4P3NA 4Z3OA 3HFSA 1ZXLA 2JGJA 1X7ZB 3FUUA 3QV2A 3EQ2A 1GQFA 3IPCA 5TARA 2NWQA 2DMRA 3DO5A 2B1RA 4MGKR 4KJZA 5AICA 1KI6B 2P9BA 2Y27A 2RKWA 3JR3A 2CFTA 3TQIA 4F7WA 2VI5A 4RVSA 4BTVA 5JNRA 1L7DA 2HBYA 1XRSB 2OO7A 1ML4A 3DDHA 3H5WA 4KR3A 2DERA 3OPNA 2XUFA 1OTHA 4WDRA 5EJMA 1U9IA 2N75A 2Q5OA 3UHPA 2VN8A 3OIFA 2YJ5A 4DA6A 2BEVB 3R6WA 1KJ8A 4S1WA 3G1WA 3LF1A 3U7FB 1PQWA 2EWVA 4R1UA 1HDYA 1ULAA 2Z04A 1GUFA 1MAAA 3VSAA 1F9EA 2E55A 1K3UB 4YXWA 1JU9A 5AJHA 4QUGA 3S7ZA 2IZ5A 3N58A 2VRWA 3K53A 4YQEA 5AVVA 4NCHA 4ZCMA 4D7AA 1CQPA 5B7GA 4NV0A 3BXFA 4DN6A 4M8LA 5A4KA 2QRKA 4IJ6A 3WHPA 7GPBA 3OLZA 1Q0UA 1C41A 2GM3A 3OU2A 2FA9A 3T7KA 1V71A 2JEYA 2K7ZA 1YULA 2JEOA 4F3TA 5HK8A 1J0AA 2Z43A 4TYNA 4IF6A 4PAQA 4UEQA 3BMOA 1ZONA 3A9RA 4GLJA 1SG6A 1DTWB 2IBMA 3FVQA 3VTFA 4YIHA 5DXAA 2BVNA 2N1MA 1YUBA 3A25A 4FS8A 4QQNA 5ALQA 1GR0A 2QZZA 3LV8A 3OA2A 4MITA 3GLSA 5C53B 1JYSA 2W6OA 3A4IA 1RZVA 2VDVE 4FM9A 1D5CA 2AJLI 4YUAA 1TQ8A 3KR1A 3X2SA 1QH0A 1DAFA 1P2GA 2OV3A 3O9ZA 1UEXC 3R5FA 4I4TF 3V7FA 2B82A 3ZGZA 1BW9A 1VL8A 2Q45A 2ZT5A 3CLRD 5LWHA 2PX4A 3ZW7A 2VC2B 3B9BA 4EABA 2KWIA 4DR5B 1O7JA 5JSUA 5CX4A 3ZTWA 3U7JA 4E11A 1YZ3A 1Q1AA 1YDEA 1L1FA 3K0KA 4KXYA 1A8IA 2BUCA 2EIHA 2WVAA 3LDUA 1G20B 3F9CA 3Q7RA 2F7SA 3S3TA 3AB7A 4BNHA 4URZR 5CCDA 5JCJA 3WNVA 1QV7A 3GV0A 3K8QA 4CGYA 2BZGA 2JH8A 2O52A 1FMLA 1RRKA 4HDSB 4TMXA 1XR3A 5DTJA 1ZC3A 3KYDB 3N7AA 2V9ZA 1GFWA 5KOHA 2J6HA 6PFKA 1XMIA 4JWKA 3MRTA 3RQSA 3ZD8A 4AS3A 1Y7TA 4C2TA 1SIUA 5ALYA 1Y3AA 3U4CA 4UU1A 3RAGA 5HKKA 1GA6A 2G8NA 4Q3KA 3VR4A 3D6HA 3F5DA 1TNDA 1NRXA 2KJQA 3N74A 4XGRA 4NCKA 3DOIA 2PQMA 4RGVA 5KNDD 1QDEA 1QPBA 2QROA 2VH2A 3KQWA 4MRNA 1IAQA 1NJ6A 3P9ZA 1L4LA 2OB2A 3EZGA 5J4KA 2JATA 2H4XA 4ESVA 5KC8A 3CA8A 1XDUA 3PX3A 1Z4QA 3N2KA 4P0TA 2QX7A 2WSLA 4I2VA 5KYKA 2NQTA 1QZ3A 5IKOA 3HZOA 1PUXA 1GPKA 2GKSA 1ZD2P 4Q4JA 1A5AB 5SY6A 4US1R 1HG1A 1TC1A 3VDNB 5JXWA 4WJLA 2V3CC 3AI3A 3GYGA 3IAXA 3DFKA 4WINA 4WCFB 5FRDA 1JSZA 2CDNA 1N36B 4B79A 1NI3A 4XJSA 4YJ3A 4JLNA 4CIXA 5I5EA 3FTCA 1QOQB 1YDHA 1PT8A 2VPXA 4DLNA 3TK1A 5T3YA 5HHTA 2PRSA 4IDGA 5JCJD 1OA1A 1OAOA 1WPRA 3STVA 3IDQA 2NLOA 1IPHA 1KO8A 5A5DA 4TXNA 5KTOA 3R20A 4N0DA 5HZMA 3IB3A 2ZJ0A 1RZRA 2Q2QA 4GBGA 1B26A 3A7EA 4WUVA 1N3BA 2BCJQ 2E4WA 2Q9CA 5EIFA 5HDQA 5HKKD 2GM4A 2OYCA 1Z38A 1N8NA 1CU1A 3B2NA 3E48A 2LUOA 2C7GA 2YRFA 3H9BA 2AJBA 1ZJZA 3FBGA 1YOVB 4GU5A 3P9CA 3PQ5A 4G0NA 5DKFA 4AY2A 4WLFA 2CN1A 1G8YA 1G8JA 5JVDF 2VXBA 3V42A 3HJUA 4L27A 1M0TA 4PLHA 5HW0A 5JAIA 4WZ6A 3MMXA 1JDJA 2BLLA 2J5XA 3AEXA 4WMLA 4DFDA 2C78A 4FSXA 3ZWWA 1RCFA 3VNUA 2QLBA 4FLFA 4HDRB 2AYYA 3SZGA 5GZ3A 1U9IC 2JHPA 1LPOA 1M1NB 1STOA 3EDCA 4QXQA 4EZBA 5BVGA 4OQEA 1K92A 2HXYA 2Q28A 3HB0A 1MB2A 2ERCA 3QF4B 3RHFA 1KC1A 4NCJA 4NCIA 2WUVA 1KJZA 1Z5WA 3TL3A 3RUHA 3V2HA 2A0XA 1DXQA 2CFIA 4GDFA 3GMTA 3L43A 1P6UA 1O94A 1VE1A 2RHRA 2FDCA 3MMNA 3QX3A 1EVZA 4OSOA 2I76A 1LC0A 1S1MA 1C4XA 3EZLA 2IXGA 5JNTA 3Q5DA 3V48A 5HF6A 1EZ4A 4EG3A 1R9JA 1H2ZA 3I4CA 3URKA 3A7DA 3KLNA 3X1ZA 5JWOA 1DX6A 4D41A 2F3SA 4M0CA 4BGEA 1RWOA 3SNKA 4AJLA 2O23A 3OF2A 5C9ZA 5TR9A 3FNIA 1L5RA 3VMFA 1ZICA 4FFVA 3C5HA 3KT8A 4R8KA 1FP7A 3QVKA 1Z0SA 4WKOA 3I6IA 4BNZA 2GWRA 4G0MA 1JHYA 3DWIA 5KYUA 1YMQA 3P9XA 4IXNA 3ZNQA 4BPBA 3L1KA 3KOOA 3FZNA 1TPZA 2O2EA 3NHJA 5KJ6A 2VNIA 4RTPA 2QENA 4C4ZA 3RG8A 2GRJA 2FG7C 3LT1A 2G1JA 4Y2PA 4ER5A 4MRMB 2HJVA 4TS3A 4CLOA 2I9PA 2ORWA 3GP8A 1CS0A 3KIPA 3GWZA 2ATEA 2O6LA 4KXNA 4RMNA 5TRTA 2B36A 4OJQA 3C8HA 3RJZA 5AW6A 5B58C 1CUYA 2NO9A 3WP1B 5FPKA 2MSEB 5T3UA 1TJ5A 3CEJA 3WRXA 4F3CA 4E4RA 4R6XA 3ZDDA 2Z95A 2AN1A 2O2SA 1N9GA 2IT1A 2WJWA 1GEGA 4H31A 1EGMB 3L1JA 3WXBA 1CDDA 1OHHA 1JJFA 4UM5A 3HLTA 1OAKA 1S3FA 2FKNA 2CNBA 2GFHA 4OHMA 4IZOA 4D46A 1KU6A 2YJNA 4AKSA 4Y9SA 3NOVA 4Q4DA 3ERCA 3EXHA 1R8YA 2MU1A 1KQNA 4BV9A 3EIOA 1QORA 2P69A 1MABA 3LWBA 1CUZA 5KTKA 3NHBA 2DHRA 4MINA 5AVOA 2WAXA 1NC1A 3PPIA 4WN9A 3PEFA 2G1PA 5ALXA 1LX6A 2IF0A 1IU9A 3R24A 1C7FA 4C7BA 1VG9B 3TH5A 4EMUA 4A6XA 3PXUA 1WDMA 1AK2A 5CNMA 8ATCA 1A7KA 3KXLA 3UHJA 4DR7B 2J6CA 4JVOA 5FV4A 5JJBA 5CCXA 1JFTA 2MYTA 3MB8A 4Y7CA 1LPMA 2JJMA 2CHGA 3VPHA 2E1PA 4JB3A 4D8TA 3PTLA 1QS0A 2JFHA 3NBKA 3WAJA 2F90A 4JL6A 3O21A 4PLZA 1VCIA 2AKAB 2HZ7A 5FCDA 1AZLA 1MBZA 1U7PA 4PXYA 3N8KA 1DFIA 5CVDA 4YUVA 3WR5A 3K71B 1MEOA 1XNRB 2JKVA 3IDAA 5CG2A 2HN9A 1W46A 2JGLA 3AG5A 4CRWB 2P9JA 3QJ5A 3PHBE 4MS4B 5CURA 1XYVA 5FL7D 5IJAA 5J40A 3OTOB 5ESXA 4WSOA 3LX5A 4BFZA 2C96A 4YUYA 1OAOC 1UKAA 2A5GA 2B3TA 3MJ4A 4LJYA 1D4OA 1PKXA 2DR0A 5DYYA 3OLYA 3OQOA 1OF1A 2FXVA 3B5JA 3KETA 2GEUA 2XT6A 4DIKA 3O4JA 3BEOA 5JALA 1T1RA 1AUOA 3M3DA 1MMFB 4RY2A 4B83A 4C6TA 1C9YA 3AR4A 1G3IA 1VLJA 3L7LA 5EMNA 3IKJA 1D1TA 2PQ2A 1QG4A 2DBZA 5F35A 4HPWA 4UPEA 5J5VA 5CFMA 9MHTA 3OE5A 5J47A 5LQJA 3EPKA 2VQEB 2YBDA 3K4HA 4MUJA 5FHRA 5FV7A 5TPWB 1SPBS 3QGMA 3S2ZA 4HWGA 1LH0A 1WHTA 5JH7F 3HKDA 1VP3A 2BGJA 3KALA 3NNSA 4RC9A 4GYKA 5FA5A 4WZAE 4FEAA 3UAWA 1ZEMA 4P81A 2BFWA 3EGIA 4YP9A 3TZHA 1KYIA 4YRDA 2QP3A 5JZMA 1HO3A 1R00A 4L95C 1LSOA 2Q21A 2VLIA 3EDRA 5DGCA 3R2JA 4HGOA 4EF6A 1FUKA 4K05A 1IM8A 2I7XA 2OBYA 1QIJA 1TA4A 3BRCA 4H16A 1BGWA 2DQKA 5EJ6A 5HCUA 3HSKA 2H4FA 3PDIA 4RO0A 1MJNA 4HSEA 2I4OA 2FOIA 2C4KA 2R5NA 3KWLA 4G1BA 4KO3S 3GH3A 4TL9A 5AHXA 5HQ3B 3DD5A 2CHEA 2VSYA 4PQRA 1K7SN 2D0IA 3OD1A 3TD2A 3JVDA 2JDIA 1T9GS 1AO3A 3W1VA 4TN5A 4IEFB 4AC9A 3I8OA 5K3AA 1US8B 4KMOA 4J0QA 1IOWA 3PRJA 4AY5A 1JKJB 1JTVA 1Q19A 2VJAA 4ND7A 4REOA 1FXWF 4DMRA 1E7MA 3W05A 5DHSA 1MJHA 3SZUA 3PUHA 4ZU1X 3KLMX 3LDFA 4EG1A 2AWOA 1MO6A 4ZXFA 3LBIA 3KP1A 1GTSA 1E4EA 3QFRA 3GZ4A 5D7NA 3FTDA 2WIFA 4W5OA 1KKUA 1O96A 1Q22A 1SVMA 1TCAA 4JC0A 1JALA 3RS0A 1NSFA 3ITDA 3DBHB 4IDPA 4O4JA 2EBHX 5J2TB 4ZZ1A 3ZY6A 1KMQA 1CQJA 4BNVA 2WT9A 4O63O 1QHYA 2TMDA 1GXSA 1MOQA 2FZVA 3E3NA 3LP8A 3O94A 3ROEA 1AGYA 1XDBA 2PU7A 4JC8A 2ZIXA 5FI3A 3V1KA 3VR5H 1HDIA 2BH9A 1P18A 4HDMB 4AJJA 4RVFA 2WYHA 1RC0A 1P19A 2E49A 4G41A 2RI1A 1T0PA 1T5BA 3MCVA 4MP6A 3PD0A 4ARZA 4BN5A 1EGQA 2QN2A 4FD3A 4NQZA 2KHZA 3O5AA 3OLWA 3WICA 1CZOA 2FPMA 1P7WA 2J33A 2FPWA 5DVZA 4PTZA 2PZAA 2WG2A 3NC0C 2VWHA 2OGUA 4PF1A 2H5LA 5E4YA 4BE7B 4DBVO 1PQUA 2BHTA 4ESOA 3C3YA 4Y9RA 2CYBA 1FEZA 2FSPA 5EKSA 2I2CA 1YQGA 5A9SA 5BW4A 4E6PA 1GQYA 5EJ4A 4KQMA 3C3DA 3F74A 2AWNA 2XVZA 2YXBA 2WJZB 2WUEA 2XH8A 1UQTA 3CG4A 2PVCA 2WR8A 9ATCA 4DADA 1NBME 1K3FA 1UCFA 3OM1A 2NTYC 4A9AA 2AMJA 4BLVA 1T0IA 3TINA 4NG4A 3GCXA 2DSNA 2BF4A 4KHPB 2ID7A 3HWRA 4Y2VA 2VRCA 2ZUTA 2XXAB 1DUVG 2HQOA 3GNLA 2NAPA 2QRGA 2QSZA 1LWNA 1NJ8A 2J3EA 3I9V1 3RUEA 3GO4A 2IOFA 3HU3A 2Y1OA 3U4QA 4L0CA 1DMRA 3J81k 4M8NE 4JXJA 2Q0XA 1F2UA 3TW6A 4RIIA 2PBLA 3HACA 4LE2A 4F4IA 1EUCB 4RFSA 1XXHA 5AH0A 3LYHA 1FYEA 4JEIA 1YACA 1EJ6A 4JJIA 4NE2A 1Q1BA 4KXUA 4G9EA 4CL0A 1PW7A 2BONA 4BJ1A 2FPSA 2GPAA 3F5QA 2VSFA 4ALMA 3EZ7A 3UJ9A 1R6BX 3EXIB 4DBZA 4X7BA 1ZCFA 4L8GA 5IK2A 3T35A 4RTNA 2PD4A 2AI3A 2ZVJA 4WKBA 3BTSA 3N6XA 4LJ8A 1J06A 1UMCB 2J7PA 4GOLD 1HRKA 1PVDA 4WJZA 4YP5A 4XX0A 3ST7A 2HPHA 3VPDA 1DQSA 3U3XA 5A9RA 1O03A 4Q9NA 4ZVMA 2DQYA 1AB6A 2XGGA 3LQQA 3KZXA 3HBMA 5GWXA 2G4LA 2IFTA 4YRNA 3B2EA 2GS9A 1HEUA 1TVKB 1ZM9A 3EVZA 5CPFA 5HIJA 4J2HA 3DVRX 1QXSA 1SKYB 5EP4A 1Z5OA 3JQBA 1G5IA 2A7QA 3SYNA 4OK5A 1UOEA 1BHSA 1P0QA 3DDZX 1E8MA 4MV0A 4YJ2F 2VRCD 2VS1A 3RRYA 4HNSA 5JYCA 4HF7A 2OE2A 2VAXA 3AJRA 3C3BA 5ALWA 1L1QA 1N4DA 3G9ZA 2HCBA 4G2NA 1M0EA 3GG2A 5JHHB 3RBAA 3PJEA 5DH9A 1YIAA 4GI1A 4I5FA 2YH2A 2Q41A 3F6PA 4G1MB 1L5OA 3DXZA 5K5EA 2Z1MA 4KW7A 1IZZA 4BP3A 1BCSB 2B3DA 3D59A 3L6EA 4HH3C 3OIGA 3SQOA 1JPUA 2GASA 3BHNA 2WI8A 3DVAA 3HV2A 2EKZA 3OKCA 4JBLA 5F9HA 2WE8A 1UPUA 4JJFA 3HR8A 3ETEA 3KV1A 1V3TA 4TQAA 1W36B 4I6JA 1F14A 1UJ5A 1TAHA 1Z2AA 2J5RA 2UZIR 4BB6A 3T5PA 3W06A 1D09A 1E0AA 1V5GA 4EX7A 3FFXA 3QVJA 2HW8A 1KZ6A 3JQGB 3RIEA 1HTTA 1JT2A 2CXRA 1QLWA 2H06A 4JENA 3T34A 1HI9A 4A8PA 4TVSA 2VK2A 5ALRA 4P7JA 1VKRA 2W6CX 1N2CE 4XPIB 2GD1O 3COYA 3T4XA 3ZWCA 2XF8A 4ZYZA 1H85A 3BWMA 2HL6A 1TUIA 1C4WA 3N75A 2E4XA 2QVZX 2FFRA 4C4RA 4EKGA 1WSWA 1GG8A 4MGYR 1U3FA 4IVPA 5SZHB 1I80A 1GU7A 3I2JA 4JROA 2VDNB 4XYGA 3UJCA 2H1RA 5CM9C 3AHIA 5K3DA 1RJDA 5EPUA 4EHAA 4Y1RB 2C5EA 2XCIA 1TYZA 3BILA 4MKGA 5DNAA 3V1MA 3U4GA 3QNWA 4JLBA 4B71A 5JEEA 3UOGA 1V8PA 4MUIA 5JJ5A 1NU8A 1Z82A 2NU7A 3AR7A 3AETB 4HTFB 2Z2ZA 2OSVA 1SQ0A 1T8PA 2ENWA 3F71A 1TM3E 4KN9S 1P45A 4Q1FA 1XTRA 1LBTA 3ZC3A 2N9UA 4DQUA 1CB0A 3I76A 3S2YA 5FOWA 2VK4A 2X5KO 4KX3A 2SCUB 3MCAA 3O82A 4MVJA 2ZGVA 3LHFA 3D0RA 3IEUA 4Z8XA 3DDNA 4L9SA 4CF7A 3ZVMA 4JXZA 1QFZA 5G3ZA 4B4DA 4YMHA 3U1BA 5DK4A 3VGJA 5E6RA 1L5HA 4DDTA 4NL4H 2BDEA 1OMOA 5KWSA 2G07A 2GUWA 2ZJ3A 3CKLA 3EF3A 3JARA 3KKMA 4NTZA 4EYEA 1KEEA 2OC9A 3GN1A 1Q16A 5C5CA 3A58B 2P4SA 2Z8ZA 4ND8A 4IH1A 1MH9A 1T8UA 4PS0A 4R81A 4DNQA 4V1CI 1NRWA 3IGFA 5T41A 1B1CA 2V7GA 2XWQA 4EUHA 4MNTA 2JFBA 3H18A 5ALOA 4J6EA 5DI3A 2PD3A 2BSXA 4JA2A 2JLYA 3ZBUA 3FFWA 4DE5A 1FMFA 3K0CC 2A9OA 4YCMA 3D5EA 4O33A 4UZFA 2C9CA 1G8HA 4KXMA 2K5UA 2RGRA 1CQZA 5K6AA 2FNAA 1M8FA 1O95A 4PSDA 2G76A 4TV9A 5AKGA 3NATA 3ZNOA 3KR0A 1S2DA 2CL5A 3ZHOA 1ZIYA 2BW0A 2G6BA 3TL2A 4Q66C 3R7FA 1EUYA 3ZDQA 1DCFA 2QD2A 3TZEA 2LNDA 3H9CA 3K1AB 1KR5A 4FX2A 3ZV4A 1GD1O 4BO9A 1HYBA 1FJGB 4Q7MB 5F98A 2PD6A 3R3VA 4OQYA 3TFWA 3TLXA 1QAMA 3DP9A 1ZLXA 2AIRA 3V5NA 5KTRA 4UOEA 3ZHTA 2IV2X 2GFQA 4LRUA 5FBQB 4HXEB 3SYKA 2Y1EA 1BXRA 2QTNA 2WYOA 2XODA 1RW4A 3AESA 3A9WA 3Q10A 4PNHA 4V38A 4KOEC 4ZEMA 5JXGA 2NOAA 1PGNA 1QYXA 3OPYB 1JA9A 4KDCA 2A9JA 1AS0A 1CXZA 2C5AA 2CMGA 3BXEA 3EH2A 5AQ1A 6YASA 4RCVA 2O2GA 3UUFA 2AOWA 1E66A 2ZT6A 2JG3A 1CFJA 1RD4A 2QORA 2WJVA 2O2XA 3ICQB 1IVSA 2B8NA 5I5GA 4QREA 7AT1A 3ANMA 4B6QA 5E2BA 2CXPA 4ZHQA 4WVLA 4MUXA 1U8FO 4CU2A 3DUFB 4PPYA 2GBFA 2B2XA 2AN9A 4GWGA 2XEDA 4DR6B 4O2BA 1FS6A 3SD7A 4X6XA 1I1QB 3ZWNA 1ZW6A 1WKCA 3GA0A 4MUMA 4P86A 1RLMA 1EZ1A 2ZE8A 3GEIA 2I6XA 3IDOA 3HYCA 3JQBC 4AT1A 4EP1A 4F5YA 5KYYA 1FDUA 1KIFA 1I1OA 2PGAA 4CKBB 1KYQA 1PDWA 1DUSA 1VBNA 2WKQA 4KIWA 4B3DA 1G291 4XRGA 2E87A 2PBZA 3ANSA 1IB6A 3BJMA 3GEHA 4DRXB 2A94A 3V2GA 5CUQA 4NBKA 4XM2A 1EM8A 2H2IA 3M7IA 4AZ3A 4QVIA 5EUBA 3SC4A 2X22A 3OWHA 3EY9A 4PX3A 2AFIA 3BSYA 3FGZA 1NJFA 1E3WB 1VXOA 1EJBA 1MQSA 3RF6A 1ECJA 4P1ZA 5HUJA 3JATA 4US2R 1V4BA 1OJLA 1YB6A 5EKXA 3RJ9A 3RRMA 3CVUA 4RHXA 3MQFA 3H1TA 4JXXA 3WSVA 2QX6A 1Q0PA 3DWFA 4KI0A 1ZBQA 1RKXA 3EMDA 3M33A 1ZK2A 4OEHA 3ESBA 5CJ2A 2R9VA 4AO8A 4EW2A 3O7WA 1GU0A 5DTEA 2ZS9A 1AMOA 1H2YA 2HU5A 4LKOA 1FNDA 2XX3A 3BFPA 4UHBA 2X9LA 2CLKB 1P3JA 3KOZA 5JLAA 2QOEA 2WM2A 4I5IA 5I7FA 3Q1KA 1ZG3A 1UXHA 1MX1A 1ZZEA 1WCXA 3TTSA 5JAMA 2C82A 4CL3A 3DEIA 1OFHA 4LOLA 3NTQA 4ZCPA 2C2GA 3ROKA 4W5WA 1R4MB 4FMBB 4D6PA 2W2XA 3OO1A 2H1WA 4V3BA 4PAGA 3W8RA 3WJ2A 2HU2A 3UHOA 1CUVA 1PEDA 1PJ2A 2XMQA 2ZSJA 1OWNA 3OQIA 4HLUA 1NF8A 3DBOB 1XZLA 2V0NA 3QX8A 4JDPA 4LSGA 2B1IA 4BO7A 4NYIQ 2C2KA 3QF7A 1EFKA 1RC8A 3PRHA 4E03A 2FWIA 2X15A 4BB0A 4L5YA 4CKWB 2VDRB 2ZRLA 1MW9X 3DCYA 1QOPB 3OPMA 4AP5A 4RDXA 1E7YA 2BSQA 1HY3A 2FF5A 3QYAA 1JHMA 3ID6C 3O4IA 1TD9A 2OORC 4LVCA 3T1YB 1X7WA 2JGRA 1VSTA 3PQ8A 5I47A 1KFCB 3HM9A 3WAKA 1ZWLA 1LK0A 4LGVA 2ZRQA 3WQQA 3L05A 1TM7E 2JGMA 1RM4A 3CVVA 1OIVA 2HT1A 4YROA 2QL9A 4E4TA 5JAQA 3USES 4MWCA 3TIFA 2RG7A 3NP9A 4U39A 4QBFA 2PDAA 4HWOA 2WJPA 1I7SB 1JEDA 3Q6NA 4YPFA 4EEXA 5DCUA 3AERA 4X1KA 1OH8A 4CG3A 2EFYA 1RLUA 4DIDA 2YV5A 2RIRA 1K0FA 2AOTA 2P5SA 1VCOA 4OUKX 1N6OA 4CN8A 2EKDA 4F97A 1DP4A 5EKUA 3HPQA 1Y8RB 5CB0A 5IAKA 1XP5A 1FXUA 3KOUA 3O31A 4KQFA 1RAEA 2QBYB 1ZXXA 1ZUD1 3GJRA 2WUFA 3LH5A 2XUZA 2BAGA 3JQ6A 3OZVA 4N3BA 4UVDA 2A58A 2BHRA 4UD6A 4BVBA 2CE2X 1J24A 1Y4SA 4HMQA 4CLDA 1X19A 2W2LA 3KUKA 1Y89A 1YVEI 1FMTA 4CMCA 2PLNA 1QBGA 2IIVA 4A2CA 4OP2A 4RSHA 1T3HA 2VJBA 3DAOA 4FDAA 4UVHA 3ZH2A 4DPMA 3HO1A 4F4DA 2WAAA 3GXBA 4KFRA 4LISA 4DF3A 1Z0ZA 2QN3A 2JASA 4KN5A 5EFZA 5J1SB 1QHHB 3QU5A 3UMVA 4TYYA 1G6KA 2Z5FA 4O4LB 3NXSA 1XCBA 3L5OA 4LVOA 4PC7A 5ECGC 1TQ4A 5ER6A 1CEXA 3P9RA 1U2RA 3K70C 5FAKA 4RULA 4K26A 1VA4A 1GUZA 1UC9A 1C3OB 3R23A 5J43A 2D1SA 2YUIA 4FQ7A 3R5JA 3OSZA 1VSQA 2XZDA 2Y1LA 1GCUA 4MW0A 2V6JA 4MQ4A 5DEOA 3SJZA 3U81A 3K92A 4IMPA 2HUNA 2OCGA 4Q9HA 3RAPR 3GDGA 1XHEA 2WDZA 1O08A 2W2TA 4RABA 4ZVRA 2UV8A 4MUFA 1ENYA 1U8EA 2GCOA 4X90A 5I7WA 4TTPA 1N5KA 1RQXA 2D3WA 1GPJA 1G6Q1 3UMSA 3LQRA 4G1FA 4NENB 2C3PA 4LDNA 1E9DA 1C50A 1NVWQ 4PFKA 4QQFA 1ACJA 4BMNA 4DXHA 2JJQA 4WA7A 1I3LA 3P9KA 3Q72A 3VC7A 1NBMD 4HYEA 3M1YA 4WCDA 3QJYA 5KVSA 5DX1A 5EPEA 5KBYA 3WOHA 4C3OB 2BF7A 3G9TA 5ICSA