4PZYA

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDCYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords K-Ras
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pzyA00
5L3SB 2J0UA 3FHOA 4JZKA 3ICQB 2DCUA 1EFHA 1VYVA 5AWFC 4Z8XA 4B75A 2Z83A 4IVPA 5HCNA 3SOPA 4QG7A 1UKYA 2EYQA 4KBFA 4DCSA 3GFOA 3MMPA 1T5LA 5G3YA 2IUTA 3IKJA 3WBKA 2QBYA 3AUXA 2FZLA 1ZP6A 1NKTA 2AWOA 1OW3B 4Q9HA 3LO5A 1OIVA 2IYVA 5G3ZA 5KNCA 4NCJA 1C9KA 4EJSA 2LKCA 4BE7B 3TQFA 1TADA 5CK5A 4M53A 1Z6TA 4XWAA 1WMSA 1KI8A 2ZS8A 2RHDA 3LNCA 4Q1EA 4NYMR 4A0RA 3GLHA 1GL9B 1KO5A 1N25A 1WCV1 2EFCB 1M6NA 1N6HA 2X77A 4Q1BA 1VKJA 2REBA 3GEHA 1NL3A 5DYIA 2VHTA 4IVQA 1UF9A 1NLYA 5HTKA 1IM2A 3WHLA 1X1RA 4R2IA 2BKEA 3PIRA 4OYHA 1YZKA 5L3QA 4HB3A 4C4PA 1NMZA 2J9RA 1S9DA 1T3SA 2QMOA 3ADKA 4BECA 4PXAA 2VA8A 3AVQA 4QM7A 2FFBA 2JJ2D 1Q1EA 2ZJAA 1CP2A 4UKDA 3UXMA 2QPTA 1Q3HA 2V8OA 2VH5R 1ZD8A 3MG9A 4JL8A 2V6IA 2CL6X 1X3SA 1E2IA 2BMFA 3K9NA 5J4KA 3OIVA 4G5QA 3CWZA 4M8NE 4UNQA 1CF4A 2WSSD 2HUPA 4D4JA 1KK0A 2QMUA 3GLGB 2JLWA 3T35A 2EFEB 2VLIA 4WBSA 3IEUA 1NMXA 3KUDA 4G5OA 3LVRE 1NVXQ 1P62B 4KYUA 1OHHD 3T5DA 3SI7A 4EUNA 3W34A 1BH2A 1S4QA 3QSYA 4F93B 1OH6A 1DO0A 1XB2A 1F2TA 3QEJA 4S35A 2FGJA 2QPAA 4TLBA 2HT6A 1WDTA 4DDTA 1F2UB 1ZM4A 2GJKA 4MRPA 3C7KA 2WZQA 3G5UA 1T0HB 2O0HA 3R9IA 3U3RA 2C9OA 4JLKA 2ERYA 2OO7A 2QGNA 3M1IA 4LBVA 4LPSA 3W90A 1HH4A 3U2QA 3NDPA 1JEEA 2XZPA 4WA7A 1W36B 2ZYTX 3K70B 1E2FA 2KBFA 2V7QA 4I81A 2P5SA 4CYMA 3VHXA 4FMCB 6Q21A 3PUVA 1S2MA 4ZKEA 1G5RA 1CLUA 2AD5A 2AL7A 3B9PA 3LV8A 4ILEA 1DAEA 4Q5IA 3L0OA 1OF1A 1ZINA 3HU1A 2QI9C 3AQ4A 2ZR9A 4DT1B 1UEJA 4C0SA 4XSGA 3HDTA 4DSOA 1T8TA 2Q3MA 4TTPA 4WOPA 4AKEA 4WXPA 2CEAA 3U7FB 3WP1B 4OQXA 3A1TA 4XJXA 4C2UA 2VF8A 1FOEB 2W0MA 1XZPA 3C16C 3EASA 4V0NA 2FEMA 2QY9A 3WNCA 2XX3A 1GNRA 4JT4A 5DI3A 1CTQA 1OYWA 4D26A 4DB4A 3DHWC 3IIJA 4LOAA 4XVUA 3TH5A 1W46A 4PC1A 3JVVA 1JALA 1KYIA 2AKYA 2ZJZA 4TSFA 4N0EA 721PA 2XZOA 3EPKA 2G83A 4B48A 1EG7A 1Z3IX 2XITA 3D8BA 2JLXA 5EUQB 4MGYR 5EXPA 2IYWA 3ZD7A 4URUR 4V02A 4DCTA 2GXUA 4A8JA 1N0VC 3FMIA 4OHXA 2PZEA 3F0TA 5LB2A 2ZI7A 4TYYA 4FMDB 5H70A 5JCZA 1YU9A 2WWWA 1KO7A 5FI1B 1NY5A 4IJMA 1OB5A 1DOAA 4BLTA 1ZCBA 4AY2A 1R0WA 2IYSA 2V6JA 5CYPA 5E3HA 1X8KA 1N6PA 3AF4A 1O3YA 3DOFA 3P4YA 3ZZ0A 2O8BB 1IHUA 1D2NA 1VG1A 5AUOB 1CR1A 4NCNA 1G4UR 2GF0A 4GOXA 4HATA 2XNSA 2ZSDA 4HAYA 5C2JB 1AS2A 1UADA 3M4YA 2VQSA 4KYIB 3SDZA 5GVRA 5K8UA 1ZJ6A 2IYYA 1NG9A 2QENA 4MRSA 4MKIA 1SXJB 3PUYA 1V5WA 2H17A 4JKIA 4KVAA 5KNDA 3RS3A 4V0ME 1S0UA 5KTYA 1ZBDA 2NO0A 3NBZC 2OE2A 1FP6A 1BKDR 3SQWA 3B9QA 3WXMA 1ZU4A 2CLSA 2P0EA 1T3LA 4I4LA 1DG3A 1ZMXA 2VPPA 2PX0A 3UIEA 4Y0AA 1HY3A 3I8SA 4FWTA 3GLFB 1E2EA 1MOZA 1Z47A 3U61B 3V9PA 3OEEA 1X1SA 3Q5EA 1FTSA 2ANCA 3A1WA 1VIYA 2A7QA 5TVKA 3EZFA 2GVDC 4Q1FA 1EX7A 4M4SA 1JECA 2CHVA 2GXSA 4KVGA 5FOXA 1VECA 1XP8A 2CLDX 3ZIAD 4F4CA 1GNQA 3A58B 3OIUA 4ZI3A 4B76A 4OHWA 1US8A 1TF5A 5FUVA 2VEDA 4ZDKA 3VNUA 2Q3FA 2YC4C 5DI9A 2PLRA 1YZUA 5JHGB 4CEHB 3NVAA 1E2DA 5EP2A 5BN4A 1P9NA 2B21A 2GZAA 3KTAA 2H57A 3IPYA 3MUFA 1KI7A 4HYYA 3I61A 3FFBA 4TYWA 4IDNA 2IEZA 1N0UA 2ZJ2A 4JYBA 4MYHA 4NBSA 2F3RA 3BORA 4D4MA 4JKYA 4L9SA 4DDVA 3TW8B 4LZZA 1W4AA 4BLRA 4JBYA 3ZD6A 1JEDA 3TE6A 5TXGA 4I1OA 1II8A 1OLOA 1E9RA 4L8GA 3GCGA 2ZSAA 2Z4SA 2PT7A 1WP9A 2VSOA 2PMKA 3QVVA 1LS1A 4O0MA 3ZGXA 4BZQA 2GJ9A 4MDEA 1KOFA 3BE4A 4B43A 4POAA 1Z2AA 1BMFA 5AUNB 4CEIA 2FZ4A 1II0A 5DIFA 1G1MA 4HZUA 3TUIC 1SVLA 1P2VA 1GRNA 2C96A 5TMPA 3ZLJA 1VCOA 3B78A 2K5UA 3T1OA 2WWFA 1NN1A 2D2FA 4KHZA 2BCGY 2ZRFA 5DHFA 1QVAA 3NC0C 3IIKA 2R44A 4D2IA 2F3TA 3ZVLA 2QQ0A 3TR0A 3VR3A 1D8TA 3GLFE 2IC5A 3JZMA 1KK2A 5KYKA 1KNQA 1KI1A 3CIOA 2OT3B 3T1TA 4M2LA 3J81k 2VO1A 4D80A 1QHSA 3P26A 5AUPB 1IJEA 4G1UC 3K0AB 1KY2A 5JECA 5DN6A 3GJ0A 3BB4A 2NG1A 4H1UA 4JLBA 1E79D 1R0XA 1UDXA 3I73A 1AZTA 1CRPA 5TY0A 3K70D 3VU9B 4KODA 3VNVA 3Q5DA 1KAOA 2ZRAA 4OL0A 1OSNA 3O8RA 1KO1A 4HB0A 4OK3A 1NY6A 2VP4A 1G5TA 1G8YA 3EWAA 4N0DA 3A37A 5KU1A 2VHUA 3VTKA 5LB4A 3IDQA 4X8HA 3H2YA 4A4DA 3TIFA 1A5TA 1ONBA 3RNLA 5L3SA 4KAXA 4OHVA 4ITRC 5BN5A 3WRYC 3ZH9B 1ZNWA 1G3RA 1QZXA 1C4OA 4LX0A 1G9XA 1OPXA 2WAXA 3H1TA 2ZYUX 1QRAA 4RKEA 1HA3A 3A4MA 4CIDA 1OFUX 2ZRGA 3LX8A 2ZPTX 3KZ1E 2KSQA 4US0R 3FHTA 1Z0JA 1I4DD 1R6BX 1R10A 3N70A 4PANA 4RCZA 2V55B 5F9FA 2ZI4A 1TAGA 2AK3A 1UAAA 2V1UA 4RD6A 3U3OA 3FWYA 2VHJA 4KSCA 2AXPA 4QKQA 3GPLA 4KLNA 1UM8A 3BFXA 1R0ZA 3KUCA 1IXRC 4LPKA 1VCIA 4L9WA 4GPTA 1XMJA 4IEEA 2IUSA 3DO6A 4GZLA 4Q7LA 3EAQA 4LWZA 5GJBA 2HLDA 2R6GA 1G7CA 2DFNA 4RSGA 121PA 1MO6A 3K0CC 4HLUA 2XJ4A 1F60A 5FL3A 3U44B 1SVWA 5LDDC 5F9HA 1E6CA 5LD2B 1G8PA 1GZSA 3MWKA 4D0GA 3T1QA 1E32A 5JLJA 2E1RA 2QT0A 3EPLA 5CITA 4M1WA 1SVMA 4M0LA 2OCAA 1LF5A 3GLGA 2OFXA 4XTRA 3KFVA 5HPYB 1E0JA 1E98A 2OBNA 3CONA 5KDLA 1N3BA 3OZXA 5KSOA 3AVYA 1QDEA 2QMHA 4CDGA 1A82A 5HZHA 2ZUBA 4AC9A 5FTLA 1UEIA 5DSZA 4HAVA 3THWA 1P72A 3BRWD 3PCRB 3LDAA 2FEOA 2ZI9A 3BH7A 3DDCA 4LK2A 4CF7A 1VPLA 4PC6A 2QRNA 1DAIA 1DAHA 2ZJOA 4P32A 5J4YA 3ADBA 3R8FA 1NNEA 1FW6A 1YZNA 3BERA 2IXFA 2GK6A 2EWVA 1Z08A 3FGNA 1S8FA 5FOSA 1G291 1UBGA 1E79A 3CF0A 2HV8A 2FN4A 2OHFA 3MFYA 1XTQA 1COWD 1M7GA 4I99A 3GLHE 1GUAA 5A4JA 3ZQJA 4LJ5A 5FTMA 3IO3A 3VKWA 1G19A 2XOKA 5AJXA 4QGAA 3ZS8A 4G5SA 5CDFA 4WIAA 2WMNB 3AKCA 4PZLA 4CT5A 4DSTA 4RD4A 4XD7A 4M9XA 4R98A 3RVBA 1OE0A 1Q20A 1R8SA 2IYUA 1JB1A 2W6JA 4DT1A 3S1AB 4Q9JA 1ANKA 2G3YA 1VDZA 5L3VA 3W3ZB 5DLQC 1KDTA 2ODWA 3LQQA 3H84A 2JDIA 4LUCA 1HQYE 3PEWA 5B57C 4Q47A 2YC2C 3MCAA 1OT3A 1G5PA 4IRUB 2BJWA 3P32A 1GTVA 1CKEA 2DWOA 2PJZA 5BXQC 3TW4A 4RJLA 3QQ5A 1TEVA 3QVUA 3NEJA 2EVWX 3KKNA 2QAGC 4XVQA 4F91B 4Z1MD 4A8JB 4NL4H 4EKDA 3NC1C 4PPQA 1G3QA 4DUGA 2R62A 2QAJA 3NKVA 4RZ3A 4A36A 4BFWA 2NMVA 4NZYA 4U5XA 1KK3A 1YRAA 3QKSB 5FPTA 4MUAA 3E2IA 3X1YA 1P2TA 4M1KA 5BW8A 1ZM2A 4Q1DA 1W0JD 4FCWA 1EESA 2GXAA 1OH7A 5JFGA 2FG5A 1GL7A 4HUQB 1DELA 5FL7A 3ZVRA 2FE4A 1CXZA 1JJ7A 4M9QA 1E2GA 3MAAC 5ANRB 1T4GA 4GNKA 2WPDD 3C4JA 2YOFA 1XX6A 3A36A 3CPJB 5FR1A 4B3CA 4O2LA 2VTKA 4QBIA 3RANA 2O8BA 3MLEA 4U00A 2W00A 3FPAA 4KFTA 2W6ID 2WTUA 4URXR 4C7OB 4C0LA 1JAHA 3FFAA 3U6BA 4DBLC 3I8XA 3LXXA 2P6RA 2HCBA 3KQHA 2F1JA 4RZUA 3PEUA 1RRFA 1Y63A 1G17A 4NCHA 4Q66C 1PLJA 2R8RA 1SXJA 1NP6A 3A1UA 1CULC 3SNHA 3AVTA 2J1LA 1VYUA 3ZYCA 2V3CC 1T6NA 1CR2A 2WSMA 1XTJA 2XSZA 3W5IA 4WVFA 4IXNA 5EZ6B 3ONWA 4DCUA 2J87A 4LJ4A 3CPEA 3GJ4A 2MMCA 4ABYA 2NQ2C 1A2BA 1J8MF 3AM1A 5CIQA 2GNOA 1KKMA 2X2FA 4RFVA 3AF0A 1G7SA 3NWJA 4NONA 4Q4JB 2GESA 2Z6VA 4LV8B 2PBRA 3QNUA 4XSHA 3GLFA 5FOWA 1TMKA 2ZE8A 1YE8A 4UNRA 3ECCA 2GKSA 3H4MA 1QHHA 3NG1A 3LLUA 1OIXA 4BGDA 4ACAA 4G0NA 4JLOA 3PITA 1Q0UA 1N5IA 2QTVB 4TQUS 3PV0A 2QNRA 1YHNA 3T5GA 4CEHA 1G64A 4X8LA 1JJVA 4M1TA 1JQLB 1J90A 1E9BA 1NMYA 2B7CA 3CLVA 3PXGA 4F4JA 3D3QA 4LYAA 3Q72A 2IS6A 4PTLA 4F38A 1R7RA 1UKZA 2Z4RA 3K09C 5FPYA 4EIWA 5JRZA 1KNXA 3IO5A 3I5YA 1M8PA 2IA5A 1KIMA 2C95A 3BBPA 3HWSA 3LQRA 4EPRA 2HT1A 1ETUA 2VP0A 4BFXA 4YMUA 4QJ3A 3LRPA 1XNJA 5CIWA 1XCGB 2CBZA 2HJGA 1MRSA 1S3GA 4JLNA 4PR0A 2ZRMA 4UXHA 2RHMA 4KFUA 2D7DA 2IYZA 3AVUA 2MMGA 3CRMA 5HKKA 2O5VA 4JLVA 1AZSC 3W9YA 2D3WA 1W0JA 2QGZA 4G5RA 1TUIA 1WRBA 3ND9A 2Y8EA 1OFHA 1HT1E 1N5LA 4D4KA 4TYQA 1DS6A 3SU8A 2XJ9A 4TLDA 3ICEA 1OV4A 2R6FA 3MGCA 2WPDA 3OHMA 2FSGA 3AGPA 4BFVA 4NYIQ 3VR1A 2L0XA 1RKBA 1GOTA 2WVJA 4PC2A 4A2QA 4D0LB 2QG6A 2OM2A 3CR8A 4PX9A 3TBKA 1KO8A 3UWOA 2XNDA 5JEEA 3K0AA 2AN9A 2WJHA 3EC2A 1W5TA 2JLUA 1D6JA 4IVRA 1KZGB 2C98A 3CO5A 2V7QD 1KMHB 4QRHA 5FPSA 3SC3A 1G8FA 4V03A 3SN6A 3VAAA 4MQBA 1FNNA 2E9SA 3Q3JB 4Q03A 4DRZA 2EWWA 4RD0A 3RYTC 3HR7A 4P4UA 1MKYA 2QRZA 4HDQB 3DOEA 1BOFA 1E4YA 5EP3A 4PQRA 3X2SA 3JVUA 1UBCA 5GADl 4N1AA 2OCBA 3L82B 2WIAA 5EZ5A 4QXAA 5KSZA 1ZVQA 4HB4A 1SVKA 2H5EA 3ND8A 1PLKA 3Q7PA 2FNAA 4NMMA 4XIGS 1NN0A 4FMCF 4TT3A 3THOA 2ZM5A 1E9EA 1A1VA 5TB5A 4QHSA 2B6HA 5KDOA 1M2OB 2NGRA 5FBLB 3VR2A 3WRXC 4C0KA 2B8TA 4BASA 2ATXA 4TMZA 5E7IA 3KXKA 3P1JA 2Q9CA 1OFTA 2ANBA 4TSFD 1T3HA 4LY6A 1WBBA 2GEVA 1S3SA 2FGKA 1G6OA 621PA 2VSFA 3OIYA 3PEVA 4P3YA 1Z0AA 4GMXA 4B2PA 3K9HA 1OJLA 1IN6A 1SKYE 3CUEF 1WF3A 4Y0VA 3TUZC 4QBHA 4IOLA 4D6PA 3K0SA 1T0JB 1X86B 2PEYA 4AKHA 4JLMA 1KI9A 3DPUA 4MYTA 3QIAA 2JA1A 1AS0A 4GMDA 3EA0A 5FTKA 4LCBA 2ZSFA 3W8NA 2ODBA 1SHKA 1U98A 1U9IC 1WA5A 2RGNA 5F98A 5FPHA 2ZITA 4WXRA 2BBTA 3O47A 2ZS9A 4NYIR 1IY1A 4NDZA 1KAGA 4BEJA 3B5JA 1U2RA 1RJ9B 1NVUQ 2ECKA 4NH0A 4B32A 4D0NA 1FMLA 1EWQA 1L4YA 1MR3F 5DNYB 1Z0DA 2QEQA 4TYNA 3U44A 4JBWA 1YR7A 2Z0MA 5BN3A 2W0SA 2BJVA 1Z6YA 1YR6A 4QNRA 3SS8A 3O8CA 3OFNA 4AURA 1M1YE 1N5KA 3RRMA 4UNSA 3P4XA 1ZD1A 3QEOA 3RS5A 3THWB 1NBMA 2OAP1 1H8HA 2CCJA 4FXPA 3EIQA 4LJAA 1E9SA 3R20A 3AV0B 1G7RA 3B7GA 4PHGA 5JI3E 5CK4A 1ZD9A 2CMKA 3PVSA 4JYCA 3X1ZA 1SVSA 3QG5A 1QHGA 1DO2A 2GBLA 1EFTA 2V1XA 2X19A 3EIEA 1J99A 1E9DA 3OEED 5EXSA 1II9A 2RMKA 5FOVA 1JPNA 1AQUA 1KO4A 1P9WA 4AYWA 4YMVA 5JEDA 2C9CA 3RC3A 2ONJA 1QG2A 2AHOA 1X6VA 2C5LA 4FINA 1G3MA 5JRJA 4I1UA 4CGZA 4EFMA 4GL2A 3L0IB 1EFUA 2JLQA 2RGXA 2OFOA 2ORWA 3LXRA 4I1VA 4DLXA 2P5TB 3UMSA 4CRWB 1KJZA 3PR1A 4TLCA 3KQLA 3RC8A 3H0KA 5FR2A 4ARZB 1E1RA 1KSHA 3LWNA 4UNNA 2ZE7A 1IQPA 2FFAA 3KKOA 5TV2A 2QROA 3TKLA 3S1AA 2ZEJA 1CIPA 2FH5B 2KJQA 1GILA 1F48A 2ZR0A 5DHAA 1XJCA 2VL7A 3FVQA 4D4LA 5JZVA 1TL7C 1VMAA 2QSYA 3BIFA 3VHLB 3GLGE 1KDOA 1NSTA 4KSBA 1R2QA 2OFWA 2VHQA 3L8YA 4PZYA 1JBKA 3AKYA 4JL6A 1XXHB 2Q0HA 5J4VA 3RDPA 5HZKA 3FOZA 1W5SA 1D9XA 1BMFD 1ZIPA 3RRNA 3FHCB 4N3NA 3GEIA 1UKEA 1Z8FA 2OUKA 2J5XA 3C8UA 2WBLC 5UKDA 4C2TA 3T34A 3SR0A 3TGPA 1R8QA 1FNMA 1ZC3A 2A30A 4X8OA 2ZS7A 2YWHA 2VP5A 3GJ5A 3QKSA 3NH6A 1GITA 3MRSA 3QOFA 1G18A 4QJ4A 3A8TA 3K9LA 4TLEA 2JJ1A 2BDTA 1XMVA 1ZU5A 2DPXA 4MGIR 4Q02A 5SZJA 1F5NA 1RYHA 2YWFA 5D3MB 1DARA 2B7BA 4C3ZA 3OE7A 2IYXA 4HUQA 2E87A 3EX7C 1ZW6A 5KOYA 2CHGA 5CB8A 3DMDA 3QY0A 4IOKA 1LFDB 4YMWA 5BWMA 4PSVA 2R6DA 4MRVA 1E2NA 2PZFA 5CDFE 1MV5A 1N6LA 2Q21A 5DN6D 3O8DA 3V4FA 4PSKA 4C7OA 2ATVA 1KSJA 2EQBA 5G40A 5AJWA 5J47A 1S9HA 1FP7A 5JJLA 3CH4B 2GZHA 5LPNA 3EZ2A 3IIMA 2BC9A 1RRCA 4C9BA 2Q3HA 1I4TD 3AP2A 3KXLA 2R9VA 1P5ZB 2JJ8A 4QHTA 2UKDA 3GJ6A 2XB4A 1DVRA 1MO3A 2ZROA 4GSYA 2IYRA 1XRJA 1A7JA 1KI2A 3MSXA 2JATA 2NZ8A 3VQTA 4M1YA 2IHBA 3K70C 3I4LA 4DLSA 1QHHB 4FCTA 1JXMA 221PA 1EFRD 4Q4JA 3X1WA 1Z0FA 2WJIA 3SBDA 1XCPA 3IGFA 5FUXA 3TAUA 3U7HB 2GCOB 2ZETA 1SZPA 2C2HA 2ZRJA 3GJ7A 5FH9A 3IBYA 3RABA 1G8HA 1UBEA 4DSNA 3WNDA 4PZZA 1MT0A 3WYAA 3FTQA 1YRBA 4JLAA 1L8QA 4QL3A 1WXQA 4TL9A 3SJCA 2DYKA 4HAZA 3HPRA 4URWR 4A2PA 1U90A 2ONKA 4DIEA 4DDUA 3NEYA 3C5HA 2PCJA 4XWKA 3FKSA 3NH9A 2ZI6A 4PPGA 1TQ4A 2QSZA 3KJHA 5C46F 2ZJ8A 3CRW1 3IPXA 1JR6A 3KB2A 3ZZUA 2F9MA 2ZUCA 2OZEA 3CPHA 4DSUA 1G8GA 1PZNA 2HLDD 4DLWA 1FL9A 3NXSA 2GZDA 1FFHA 1E0SA 3BWDD 1KSGA 1N6RA 1RYFA 4B2LA 1SXJE 3R9WA 4PAMA 3WY9A 2OLKA 4V0KA 4EPWA 2FJUA 1IN7A 1KJWA 2D2EA 3RWOA 3ADDA 1ESMA 2CE2X 2QTHA 3E5HA 1T8UA 1E96A 3TUJC 3RAPR 1GG2A 5FBQB 4RFSA 1I2MA 4GP7A 3QE0A 4DJTA 1RW4A 3B60A 1Q3TA 1E2PA 3WHKA 4OI2A 4JMPA 4GDFA 4LBZA 3AGQA 3GJ8A 3W6PA 4DLTA 4TZ0A 4Q48A 5JJIA 4TLAA 1RPZA 3UWKA 3N2EA 1JXOA 1OXTA 2ZJBA 3AEZA 1GL6A 1XD2B 5IK2A 4DDWA 5KNBA 1IN5A 4NYJQ 3C14C 2W2TA 5H1YA 1N5JA 3NHBA 4JLDA 2PX3A 4LYJA 1CJTC 1W36D 2YINC 2CL7X 1KMHA 2GK7A 3RRYA 2XOKD 1D2MA 3PG5A 5CM9C 5E7JA 2DWQA 1GM5A 4ZV4A 3NDBB 2QM7A 2J7KA 2ZREA 4XD7D 3QPVA 4F92B 3SFVA 2W6JD 4PQYA 4KLZA 3IUYA 1Z22A 2OXCA 2ZRNA 1M7BA 2MSCB 3UPUA 5BQ5A 2QT1A 8OHMA 2GEDA 4OQFA 3BAFA 2WJGA 3RS7A 4ZCMA 3R9XA 4HAUA 1JI0A 3AF1A 4IEIA 2JDID 5FOTA 1EFRA 1AN0A 1Q57A 1KDRA 4PO8A 1GFIA 2ZAMA 4Q4AB 4C30A 2JCSA 3TRFA 4B3XA 3SBEA 2I4IA 1R5OA 3OF5A 1OXUA 5FTJA 2XTNA 4KITB 1FQKA 3MJRA 1GKUB 1DBSA 2YHSA 3OAAA 5CLLA 3KKMA 3QKUA 3AKEA 2H92A 1W7AA 4GFDA 1AS3A 1BS1A 1XEXA 2CNWA 4OQNA 1IBRA 2FFQA 2W2VA 1HV8A 4UXJA 4DUGD 3KJIA 4BRWA 5B30A 4URVR 2YNMA 2KWIA 4AKGA 1HURA 5EE5B 4JBXA 1OKKA 5EE1A 4AIIA 3HJNA 1IXSB 3BH0A 4JJZA 4P33A 3LW7A 1UFQA 1AM4D 4W5HA 3KJGA 2XTMA 4W7SA 5C4GB 4GT1A 1QG4A 4OKSA 4LBYA 1KTVA 2R2AA 3EIHA 2YOGA 2ZI5A 5FL7D 4MKFA 3FMFA 2QAGB 5AUQA 3RS4A 2TMKA 1JR3A 1KMQA 4DZZA 4NYJR 1VG0B 2ZUDA 1NKSA 4A0GA 4BFZA 1VCNA 4FIDA 1RJ9A 1UJ2A 3ADCA 4M9SA 2C03A 3QBTA 3ASYA 1R0YA 1VHTA 2ZIAA 2OXRA 3Q9LA 2BBWA 2O0JA 4O2RA 2G88A 1P4SA 2ZRCA 2ZU6A 2QA5A 3IHWA 1E2QA 4C0JA 3SYKA 3U6KA 1XCMA 2IT1A 2H7VA 1JPJA 1SXJD 1OIWA 2ZQ5A 3L0PA 3O8BA 3NBXX 1XBTA 2PMDA 1KI4A 2Q9BA 4TMXA 5DO9A 2XSZD 5F3WB 5K8TA 4Q7MB 2WJVA 2BBOA 1A4RA 1EK0A 2J0VA 3LBNA 1DAMA 3PFIA 3K0FB 4B34A 1TF7A 2WM9B 2WOOA 4QBGB 2DY1A 1TPZA 2FPLA 3B6EA 4QOSA 4MGZR 2VSXA 1T5IA 1CR0A 3VFDA 3CNOA 1ZUNB 3R8CA 1Z63A 5CYOA 1YZGA 2AKAB 4RD3A 1UKVY 2RH5A 2VYFA 1W4RA 3KQNA 1TU4A 4GOKA 2DFLA 1D9ZA 4BUJA 3GEEA 2IX3A 3QXHA 2FPKA 4V0OA 1SVIA 3X1DA 4MRNA 1AJEA 3KXIA 2FWRA 2Z5FA 2W58A 1HTWA 1W49A 1Q44A 1J70A 4Z54A 2QUZA 1XMIA 5DH9A 2ZU0C 4TMTA 3GJ3A 4AYXA 4ERNA 5JWRA 3CF6R 5EE3A 3TSWA 3LFUA 5EXXA 4IDOA 4OJKA 2JAQA 3E70C 4JIMA 4BQSA 4OK6A 4ZI2A 1MO5A 3QKRB 1BIFA 1GAJA 4ARZA 2EU8A 2EFGA 5H68A 4BLPA 1EFCA 3FMPB 4HDCA 3K1JA 4MYCA 1Z0KA 3NHAA 3RHFA 5CM8B 5FBWB 3VKHA 821PA 4PC7A 2OCYC 5J40A 2J41A 3C15C 3R7WB 4EJSC 1XZQA 1X8JA 2C04A 2REOA 3EA5A 4JJKA 5TARA 1D2EA 2PLFA 4U7DA 1CJMA 2XGJA 1DAFA 1KI6B 3W3AA 4GP6A 2AK2A 1NBME 2WJYA 3EPJA 3THXB 1PJRA 2FA9A 3UKDA 3EPHA 1XXHA 3RS2A 4M22A 1W1WA 5GJWC 4JVMA 1OH8A 2A5GA 1RIFA 1IXZA 2FV8A 5TDHA 4DWJA 5HKKD 5HCIA 4ZCLA 2XZLA 2GDJA 4C0QC 2UVQA 2ZAOA 5EQTA 2C77A 2CDNA 1EGAA 1YJ5A 5DYGA 2IUUA 4FWIB 3VX4A 4B33A 3L2OB 5FI0B 5GJVC 3PJRA 3AVOA 5EE9A 4Q9KA 2O8DA 5D3MA 1XTSA 4KI0A 1E1QA 2ASEA 4W9MC 4TL7A 3DEFA 2GJ8A 4KCGA 1OXSC 1WE2A 3B1WA 3THYB 3REFA 4RCYA 4LGMA 2J3EA 3CX6A 2IYTA 2XNDD 1WB9A 4LC1A 4AYTA 1JQJC 4QGFA 3NBFA 3QENA 3CR7A 1LTQA 3QKTA 3UATA 4B44A 4D82A 1IONA 5A0FA 2C8VA 2B8WA 2IWRA 1NG1A 3B1XA 3U3JA 1XJQA 2O8CB 2J45A 2GJSA 2PJRA 1H8EA 3KJEA 2HF9A 4IDQA 3Q8XB 4PSAA 3GLIB 3B82A 2KBEA 3VMFA 3T15A 1PVOA 1FPMA 1P75A 2ZJYA 1B23P 5J5CA 3UMRA 2ZSEA 1KY3A 4TT3D 4P0TA 1MRNA 1DAGA 1Q1ZA 4R71A 2O52A 1XDBA 4RZ2A 1VG8A 5SZHB 4OQMA 4LJYA 2GCPA 4F4IA 3FDIA 4ACBA 4HLCA 1RRGA 2G77B 3GFPA 2QL6A 3I32A 3TAHA 1GRRA 2IF2A 2GCOA 3LH5A 3Q85A 4BFUA 1B0UA 1KJYA 4M21A 4Z51A 1P73A 2AR7A 4PPFA 4YXWA 1PUJA 1E0AA 1KSFX 1W44A 5KSPA 5C1BA 2OILA 4C0HA 1G3IA 4WZBE 3CNLA 4YMSA 2O8FA 3KFXA 1TTTA 4B3FX 4DEYA 2GCNA 2HF8A 3I72A 4RVCA 1KI3A 2OESA 3K8YA 4Q7JB 2DFTA 2VP2A 1FX0B 3UG7A 1E69A 1IJFA 4HAWA 4TN1A 1ZUHA 1YR9A 1UBFA 4FI3C 1SHZA 4TQAA 1WQ1R 2ZRHA 2UZIR 2IHYA 4KFSA 4A8JC 2A9KA 3A4NA 5K8LA 2X2EA 3BGWA 5CB6A 4H9GA 5JSZB 4IDHA 2N46A 1EXMA 4GOJA 1W47A 2GVZC 1W48A 4LRWA 1ODFA 3AF2A 4MITA 4RFSB 1W0KA 1Q12A 3HP1A 4EPYA 4TQ9A 4QHYA 3D7MA 2GJAA 3OFND 2ZRLA 2VIIA 1DTSA 1S96A 4YONB 1W2HA 2QTFA 4OQLA 4M1OA 4MKGA 3Q7QA 2YJTD 3CNNA 3DM5A 1I2DA 2AX4A 4Z8YA 4R9UC 3RSLA 2HYIC 1NBMD 1O87A 1H8HD 2CK3A 1CJVC 1OYYA 1U0JA 1XTRA 2R6AA 2W2XA 3K0EA 1NIPA 4KJZA 3WP0A 4LHZA 5K8IA 2ODEA 3K0CA 3PUWA 3ZQ6A 2RGDA 4IFBA 1KHTA 2IXGA 4Q4HB 1YKSA 4NHOA 3WMEA 1Z29A 3C5CA 2Q6TA 3SJBA 1XU4A 1XF9A 3TVTA 1XD2A 3QXSA 3SHWA 2ORIA 3QXXA 1S1MA 4RD1A 4CZ2A 1Z83A 4DC9A 3KDSE 4NYMQ 2VP6A 4MRRA 3ASZA 2XEXA 3X1XA 1H65A 3HU2A 3OEHA 4KU4A 4EQ6B 4WAUA 1ZNYA 4IOMA 3SJAA 1FUUA 2B92A 4IDPA 3T1VA 4ZPXA 3W6NA 3U3MA 3CRRA 2BHRA 3HYRA 5AR1A 3A1SA 4LJ8A 5E95A 1E1RD 2FDCA 2ZVPX 3HU3A 3GP8A 4L16A 3F3YA 3MWYW 4P31A 3SHFA 421PA 3RLFA 4DIDA 2XAUA 3BH6A 5F2EA 1GP2A 2A5JA 4JLPA 1JAIA 4L5BA 4TMVA 1AQYA 4YC7A 3HR8A 4ZDIA 1P60A 1NLZA 1FQJA 1KKLA 1MABB 2MSDB 2CVFA 5HR5A 4NPHA 4Q4AA 1RRPA 1E2HA 1DEKA 4LJ9A 1L2TA 1XEXB 5CJ2A 5M04A 2OV2A 3RRZA 3F8TA 4M1SA 1ZYUA 3N5CA 4EFNA 3LA6A 5C4MA 3CKLA 3QXCA 5B2ZA 1NI3A 5JJKA 2DHRA 4V0LA 2A5FA 2R6CA 2ZRKA 3DZDA 3EC1A 3PENA 4B73A 1LF0A 3KQKA 3D31A 5AJZA 5FOUA 4O25A 2RAPA 4NP6A 2IBMA 3M0EA 1YR8A 2JJ1D 3BD9A 1G4AE 4W5WA 1K6MA 3OIWA 1VCMA 3DVLA 2WICA 3OE7D 2A3RA 1Q1QA 1XD8A 2HCJB 1R4AA 2P6NA 2QAGA 4AG6A 2JGNA 2ODNA 3LLMA 1RZ3A 2RGAA 1HYQA 4YLGA 4F7WA 2YKGA 2OCPA 1IAQA 4JSTA 4TWZA 4FMDF 4FD2A 3SZRA 4RY2A 4X8MA 2X8AA 2O8EB 4AI6A 2ZVQX 3WMGA 5CLQA 1XWIA 2RCNA 1ZUIA 4E09A 3FE2A 2AD1A 2AXNA 1VG9B 3GMTA 4BEBA 4MGKR 2DR3A 1D5CA 2WWIA 3SYLA 5FBRB 4A1FA 4B35A 1EX6A 4C0BA 3B1YA 4U02A 1SKQA 1E9FA 4DXAA 1NRJB 2D7CA 1NVVQ 2JEOA 5E4FA 1I4LD 3ZVMA 4WW0A 1ZIOA 3KQUA 1Z06A 2FFHA 1OH5A 3CX8A 4ON9A 1E9AA 4BPBA 3K0FA 3VR4A 2QP3A 2A78A 4LDJA 2O0KA 4IFEA 5FBVB 1J2JA 3B1VA 2WIBA 3PUXA 4BLSA 2KE5A 2JLSA 3QPUA 5G41A 1OXVA 3MWLA 2ZRIA 2IF0A 2BBSA 2DFKB 2QN6A 4JVNA 4E22A 4MKHA 1DG1G 4K8OA 1W4BA 4B6FA 1GKYA 3U60B 4OI4A 3UMFA 2ZYWX 4HAXA 4G3XA 4M1MA 2H8KA 1NIJA 3LW8A 4PAOA 1NLFA 1JR3E 1Z07A 1FMJA 4MUBA 3ZDQA 2C78A 1C1YA 1U0HC 1G21E 1TF2A 2FF7A 3FKSD 3G82C 2ERXA 2GA8A 4US1R 2QE7A 2P2LA 1Q21A 3TLXA 2VHCA 3QKRA 5HE8A 3CRVA 3AKDA 3BB3A 4E5UA 1YZTA 1GWNA 1GSIA 1Z0IA 1S1CA 2J7PD 3EZ9A 3G0HA 3R7WA 5KO2A 3CW2A 1G3UA 2D4HA 1N6OA 2FSIA 4RZXA 1CEEA 1W2GA 1KI6A 4D81A 2X1VA 4A6XA 3DM9B 3THXA 1AA9A 2QPOA 3DKVA 3BC1A 2NPFA 2GEUA 2ZR7A 1U99A 2CJWB 3LX5A 3ZVNA 2GXQA 1PUIA 4LHWA 3WNBA 3AVWA 1BYIA 4PHHA 3K09A 1NVVR 4HLUC 4A6PA 4US2R 2GF9A 2IW3A 4LI0A 4A82A 1QVRA 2OBLA 3U4QB 5CJPA 4QFMA 2FX3A 2REXB 2I1VB 4B47A 4ESHA 2F55A 4BLOA 2FOLA 3V00A 2D62A 5IK2D 1KZ7B 5FUWA 5P21A 3QG1A 1UDWA 4DCVA 2P6UA 3THYA 2NTYC 4JL5A 3HPQA 4DLZA 3EZ6A 2WWXA 2VF7A 1TQ2A 3WYFA 2WMOB 3W6OA 4S2EA 1SGWA 3BJIC 3B8HA 1GVNB 4OJQA 1AKYA 2JJ2A 3F5FA 2QORA 4W5JA 4ZDJA 4TMWA 3HYTA 1QHYA 2PH1A 4BLQA 4LHYA 3CF2A 1E94E 1NSFA 2O8CA 1KK1A 2R65A 2WV9A 2IEYA 3BFKA 5JI2E 3LAWA 2WSSA 3MD0A 3TQCA 4EPTA 1YVDA 4PO1A 3GLIA 1QHNA 1N6NA 4HDOB 4DVGA 1VTKA 1W36C 1AGRA 1N0WA 2BMJA 4P4SB 4XWOA 4TTQA 5L8VA 1OHHA 1XXHE 1IN8A 4DHEA 2ZXUA 1U0LA 4JVLA 2XB2A 1NJFA 3K9GA 2N42A 4UNPA 3UG6A 1WBDA 3CWQA 3SEAA 2BEJA 3AB3A 3L0SA 3OAAD 2NO9A 3GQBA 2O8FB 1M34E 4OHZA 4PQFA 3SJZA 3DZ8A 3D6TB 5JWHA 2CNWD 4WZAE 2P3SA 1GIAA 4URZR 3QXJA 2VBCA 4QGGA 4K46A 1ZC4A 1LB1B 4QC2A 1K5GA 1OKKD 2ZRPA 4UQOA 2IWHA 2NO6A 2IS1A 4GZMA 4PO9A 4LV6A 1NN5A 1W4CA 3LBIA 1NN3A 4ASUD 1TQ6A 1QHXA 4PPNA 2BKUA 1VYTA 1OFIA 2YZ2A 5A5GA 2YYZA 2V9PA 1FX0A 2J7PA 1LW7A 1IY0A 5JS7A 1E4VA 1HE1C 4AD8A 1JR3D 2QU8A 2I3BA 2VP9A 2XXAB 2BWJA 3QF4B 5JHHB 2HYDA 4AWXA 3AP3A 3A6PC 2IS4A 3VR6A 1UPTA 3FYHA 5JSZA 1FUKA 2OG2A 2WHXA 1EWRA 2EFDB 3E1SA 1G6HA 3CRQA 3QPWA 5E7MA 1LS6A 1HT2E 3BOSA 2EFHB 1XMSA 5FFMA 2RB4A 4OHYA 1P7CA 4XTCS 5FUYA 2CL0X 3TSZA 1IY2A 1IOZA 4MYUA 1G41A 1U9IA 1RFLA 2Q9AA 2MSEB 3BS4A 3DL0A 3P20A 3ETLA 2AFHE 2J0SA 4C0AC 2GETA 5FPKA 4GRAA 4CVNA 1ZRHA 4NE2A 3BXZA 3AUYA 4II7A 4Q4LA 4ZIRB 4BFTA 5KPJA 4QM6A 2KB0A 4OBEA 1G20E 2A5YB 4DEXA 2PCLA 2JIZD 4OK5A 3RWMB 4CT4B 2PT5A 2F6RA 3T12A 2G9NA 4Q4HA 5JCPA 4JT2A 1SXJC 4LBWA 3CZQA 4DLYA 1ZCAA 4CEJB 2F43B 4LC0A 1Z5ZA 4EQ6A 1OB2A 2A5DA 2CXXA 2WJJA 4EFLA 4TMKA 2N1BA 4AG5A 4NKRA 3W5JA 2WAYA 1J7KA 2CCGA 1QBKC 3EXAA 2QP4A 1U8AA 1CU1A 3TJZA 4MA4A 3LBHA 1ZM9A 4Q1CA 4ZDWA 3EARA 1N6IA 5KDDA 2GAOA 5GJCA 2F7SA 2C9YA 3KX2A 1E0KA 4G01B 4OI1A 4RD2A 5KPDA 2J0UB 4TYPA 3DKPA 3KB1A 1MABA 4LV5B 2LWIA 2FSFA 1T91A 2UZ3A 4PC3A 3W8RA 4MH0R 4ZKDA 4Q00A 1XD9A 4YQFA 1L4UA 2VRWA 1XPOA 2G0TA 1P61B 1AGPA 3DMNA 3A1VA 1OXXK 5D3QA 5DE3A 2ZE5A 2KI5A 4GBMA 4RKFA 2V54A 4NU0A 4B3GA 3QBVA 3I1FA 2QBYB 3VR5A 4KV9A 4Q21A 3I62A 2G1JA 5AJYA 2ZRDA 3ZIAA 4ASUA 2PEZA 1SQ5A 1Y3AA 3SE0A 3UK6A 5JBQA 2P65A 4EJSB 1K8RA 2BMDA 3PEYA 1GDDA 1YZLA 4HI0E 5LBIA 4XVRA 1XEWY 2OBMA 5EXTA 1E2MA 4O3MA 1XFAA 1E1QD 2BIFA 3GLHB 4UJ5A 4WZ6A 2ZANA 3CH5A 4LYHA 5L3RA 3IQWA 5DISB 3IHLA 2IK8A 2G6BA 2HJVA 4L4UA 2IYQA 4GI7A 2F9LA 1ZNXA 1GKIA 1BYUA 1M74A 2WWGA 3A4LA 3TK1A 4Q7KA 2FMXA 2OEPA 5L3QB 1R5BA 4E07A 4B2IA 2O8EA 2EW1A 2JLRA 2BVNA 2OLJA 3GD7A 4A15A 1TNDA 2RGGA 3I3SR 4Q1AA 3NBYC 4XH9B 2CVHA 4JLJA 4PAQA 2H16A 521PA 3K53A 3KL4A 4JSYA 5C18A 1E2JA 4DKXA 1H8ED 1ZNZA 5ELXA 2QP9X 1LVGA 3QI2A 4AKIA 1CJKC 2JIZA 1XPRA 1RE0A 1Z2CA 5EUMA 2HXSA 4UJ3A 2NO1A 2FU5C 4JVSB 5IHPA 1JNYA 1NVWQ 1HUQA 1HQCA 2W83A 5GVSA 1F2TB 3SYNA 4HB2A 1XJ0A 2F1IA 1E9CA 2YOHA 1NF3A 4IKEA 2H18A 3B1ZA 1FZQA 1L7VC 1XTKA 1YQTA 1U94A 2CHQA 4BWYA 3U5ZB 2CE7A 1IN4A 4TL8A 1QHIA 2ZYVX 1J8YF 1E2LA 4M9ZA 2YWEA 2IL1A 4YXWD 1R5NA 1F2UA 1P9RA 4B3BA 3VKGA 3CM0A 3N2IA 4KFRA 5IT5A 1TX4B 4LJ6A 3CBQA 4XOIA 5SZIA 1LY1A 3AF3A 3CZPA 1KDPA 3FMOB 4TTRA 3V4RA 3WYGA 3PUZA 1P3JA 1F3OA 2I1QA 3KKPA 2O8DB 3SFZA 2QQEA 1N6KA 2NPIA 2WWHA 4HLDA 2RKOA 3VX3A 5IRCD 4DB2A 4MDFA 4DLUA 4A0HA 4CW7A 2WKQA 5DGXA 2PZGA 2D74A 4OI0A 2DBYA 5FTNA 2BCJQ 3KKQA 1A2KC 2QZ4A 2D06A 4PHTA 2LKDA 4FMBB 4V0MA 1E2KA 5DI3B 1KGDA 1Z28A 3I92A 1W0KD 2RGNC 5B58C 2Z43A 1Z6GA 1U8ZA 5AJVB 4TZ6A 4AK9A 5KHOC 2PL3A 1TU3A 4IXMA 1DAKA 2BEKA 2CJWA 4Q9LA 2WKPA 3CX7A 1TQDA 1PLLA 4Q9IA 1FTNA 4NCIA 1DPFA 2CK3D 4QBFA 1VHLA 3L43A 5H8WA 1N2CE 3QJYA 1XTIA 3U4QA 5LD2C 2J46A 3AH8A 1LNZA 4ZO4A 2NZJA 4Q19A 5B64A 2RGCA 1G16A 1XEWX 1CR4A 2ZE6A 2EYUA 5AK0A 5KSYA 2IXEA 1E99A 1CJUC 1SVOA 2FSHA 2LCFA 2BM1A 4KXFB 2A2ZA 3IILA 5HE9A 3OEHD 4QNMA 1U8YA 3FB4A 3I5XA 1LV7A 4KBGA 3U3KA 2JLVA 1F6BA 3LY5A 2G1KA 1P6XA 3AP1A 4HZIA 2NOAA 2GBLC 1GRQA 2JLYA 3AVVA 1TUEA 4B71A 4NCKA 2OAQ1 1ESNA 2DWPA 2IS2A 2WOJA 1ZM3A 2F1HA 3C41J 5IF9A 3BFVA 2YV5A 4I1SA 4B3DA 2GILA 3B85A 2JASA 4IW3B 1ELOA 2ZSBA 1RVDA 4PFSA 3WBJA 4P4SA 4KO8A 1Q22A 1ZAKA 1PV4A 4A9AA 4FN5A 1VIAA 2GRJA 3FKQA 4DLRA 2BV3A 4YMTA 2J0QA 5EJEA 4QGHA 4YDSA 1XEFA 4IHQA 1TEXA 1G7TA 1M7HA 3AVXA 2ZRBA 4P4TA 3CB4A 1HEIA 5JMTA 2C99A 2AFIE 2HEIA 5SZKB 4HSEA 4UXIA 2AWNA 1GNPA 3NIBA 4YDHB 3TR5A 5J4HA 1QF9A 2GHIA 3AVPA 2WKRA 1US8B 4B6EA 1COWA 5EP4A 4QJ5A 1CBUA 3U7EB 3JZAA 2BOVA 4LSGA 4Q01A 2ZI3A 1MO4A 3LVQE 2IYLD 3EW9A 3KTAB 5JS8A 3IEVA 2YVUA 3QUSA 3OESA 2H1LA 1MH1A 4URYR 3L8ZA 3P27A 5IDVA 3TMKA 2XXAA 4TL6A 4L15A 5JWOA 3QF4A 2G0NA 2V4ZA 3TNFA 4Q18A 2NIPA 4DLVA 5BYJA 4LYFA 2ZJ5A 3B13B 3ZZTA 3LD9A 5BYKA 2CCKA 2GTPA 3NTUA 3GJXC 2ORVA 4LJ7A 3REGA 4EDHA 1II8B 3BB1A 1X8LA 3QF7A 3M6AA 2P67A 2JLZA 1AIPA 5EP1A 4E03A 3GLIE 3IQXA 4D25A 1Q1BA 4J0QA 4R2HA 4BRUA 1RC8A 4HEJA 4EPXA 4A92A 4ESVA 3UANA 4JS0A 3H86A 1DADA 4Z1MA 4CEIB 3U7GA 4HZUB 4LHVA 4A2WA 3EWSA 4HUTA 4DCNA 4H1VA 1E3MA 1CS4C 4K81B 3RSOA 3SQXA 4NTZA 2YWGA 2GWHA 1NJGA 4IOJA 4ZIRA 2F1RA 2HXYA 4BZPA 4FCVA 1YZQA 3GFTA 4EAQA 1AK2A 2NO7A 4FW9A 1U81A 4BZXA 3WMFA 4B74A 4A0FA 2ZTSA 4BFSA 5G53C 5EE0A 1AKEA 1SKYB 1Z6XA 3TSOA 5KUTA 1P2UA 4BFYA 2QMEA 3B2EA 2OSBA 2BMEA 3BK7A 2RGBA 1BO6A 2F43A 5J4LA 4CEJA 1XPUA 1SULA 1P2SA 1V43A 2GAAA 1K5DA 3TVDA 3PQCA 1DE0A 4PHFA 2W6IA 4LHXA 4ZCIA 2SHKA 4EPVA 2J59A 3ZJYA 3MWJA 3RS0A 1Z6AA 4HLQB 1HE8B 2QE7D 2FPMA 2QM8A 3EG5A 2HDNB 2CLCX 3MJHA 1ZM7A 1T9HA 2BM0A 3VU9A 3T61A 4R7ZA 2WWYA 1CRQA 2DB3A 3IBGA 3T06B 2XTZA 3EZ7A 2RGEA 3ZS9A 4G5GA
chains in the Genus database with same CATH superfamily
4TSRA 4RACA 4P5EA 4Y6PA 3DTVD 4IF6A 2DCUA 5AP9A 5HDQA 3ERCA 3MOSA 2PMEA 5CCBA 1TU0A 1VYVA 3DLPX 4RF3A 4GZ6A 4MYSA 4L8LA 4PZ0A 5HCNA 3PE4A 1F0KA 3ZWBA 1MB4A 2IY9A 3PDUA 4MRAA 4KBFA 4I5FA 4OHKA 3GFOA 2FR1A 2V6BA 3WWEA 4BN5A 5I4KA 1YIOA 1MW8X 1QKJA 4DVJA 3H11A 4MVXA 1B8PA 2C4TA 4K0KB 4Z9AA 1M0EA 5G3YA 5K0EA 3FPFA 1G42A 2FVYA 1HNXB 2IUTA 5KWVA 2IKSA 4HWKA 3CJTA 1Z18A 3PCXA 1CUJA 1L3BA 3RYIA 3TLBA 5BN1A 5DNCA 3E7DA 1R0CA 1SIOA 1H2YA 3GEMA 5G3ZA 4EJSA 2LKCA 1PZEA 3WA7A 4CTKA 4HDKA 5GZ3A 2DWCA 1TADA 1X19A 3IERA 5DGHA 3KR1A 3IT0A 3JV7A 4U2GA 4XWAA 1RWNA 4RM3A 4UTVA 7REQB 3LNCA 3HS3A 1W1UA 5LSAA 2HQRA 4NYMR 4A0RA 1CUWA 4UBKA 1WCV1 3D8UA 1NYTA 3FOBA 1UBUS 1M6NA 3IODA 2IODA 4M0UA 1FJXA 4QEDA 1NL3A 5LMZA 1K8YB 1UF9A 4P98A 3EQ7A 3WXBA 3BHMA 4X5OA 1IM2A 4ZV9A 1X1RA 1JR4A 3EIFA 4R2IA 3G17A 3PIRA 2FW0A 3WHLA 4HB3A 4C4PA 3E27A 4G5HA 1T3SA 4JQSA 5GY7A 3SHTA 4Z7OB 3AVQA 4YREA 3NYIA 1CPYA 2G0AA 1CP2A 2HPZA 3AZOA 3IAM1 4YCJA 3UXMA 1B0ZA 4DCCA 1JG3A 1XUOA 3C1OA 3QPAA 4JL8A 2V6IA 3SYMA 2GLXA 1X3SA 2PWBA 3F9IA 4G5QA 4JOQA 4KRXA 2M32A 2QWXA 2GD2A 4WKCA 1DOZA 4MAAA 3HCEA 1GQOA 2EFEB 5GGXA 3IEUA 1NMXA 1D6SA 5AW7A 3VDRA 3WLTA 2POQX 2QVCA 5IH3A 3AHIA 3I52A 3JRWA 1XELA 5A05A 3T5DA 1H2WA 3K9CA 3K1AB 5HFNA 3I3OA 1KY4A 1S4QA 1EEXB 1XA4A 2P5YA 3D3WB 1QX3A 1DO0A 1XB2A 1XZJA 1ZMOA 2Y1WA 2FGJA 3QEJA 2QPAA 3ER9A 1GSOA 2SICE 4M6WA 1F2UB 1GG5A 1ZM4A 4E4RA 1VE3A 2R0QC 1YTUA 4LFAB 2WZQA 3SR4A 1T0HB 3U3RA 4ALNA 2C9OA 3NUGA 5ERGB 4JLKA 2HFKA 2OO7A 2D2XA 2CFCA 4LBVA 4WECA 4EHJA 1IY9A 1JWBB 3U2QA 3NDPA 2XZPA 4KWTA 5HQ3A 3Q98A 2WP0A 3PSHA 4BVEA 4W1SA 4L0CA 1GNVA 4RXTA 2P5SA 1W29A 2YV1A 3O9MA 3QTLA 4FMCB 1V7PC 3OQHA 3PUVA 1FE8A 1Y33E 2VNKA 1S2MA 3QJGA 2X1LA 3GFRA 1XRPA 2RCYA 5ER6A 4Q5IA 3BE8A 5I4BA 4R1QA 3ZI7A 1ZINA 4OFWA 2ZR9A 1PW5A 4F3CA 5JPCA 1FDWA 1RYYA 5CA0B 2Q3MA 1JS1X 4AKEA 1PRYA 4WOPA 1I6LA 4CV2A 2YNMC 1UC5B 1E7WA 1Q91A 3CIFA 3OURA 2F48A 1O95D 3AJAA 5EEHA 3KE9A 3IJEB 1FP1D 1G5FA 3RSQA 3DHEA 1WDKA 5AI6A 1FNDA 2I3GA 1RKQA 3BCUA 1XROA 2QLLA 4V0NA 2QY9A 4HBGA 1QH1B 4HDNA 3L7IA 3P9SA 4I55B 1I4OA 1OBCA 4JT4A 5BR4A 1KAHA 4ZVUA 4DILA 4N03A 4KXMA 5KNBH 3DHWC 4LOAA 1Z82A 1EB9A 2OXIA 1A69A 1ZWLA 3ZQKA 4JU9A 3NONA 3RSFA 1Y9JA 3G2PA 2I7XA 2AKYA 3NHKA 4ZU6X 2ZJZA 4TSFA 1Q1GA 1XOIA 3E84A 3G0OA 1L5LA 721PA 4Z53A 1F9EA 4A2CA 1GGMA 2HIGA 5JFTA 1J24A 3EPKA 1IXYA 1EG7A 2C83A 2EARA 2GM4A 4DARA 4BVGA 4MGYR 2MYNA 4V02A 5F23A 1NW3A 3I9FA 1QYCA 1VHJA 1TK2A 3ZXXA 4OHXA 1UP4A 2XWBF 3LUJA 3F0TA 1ZHHA 5LB2A 1F5SA 2VUUA 3UW1A 1WXFA 4EZBA 2JRLA 1PEYA 2G04A 3BF7A 5FKJA 5H70A 1AGYA 1KO7A 1NY5A 3P9KA 4YALA 1DOAA 1CNEA 5K05A 5DRYA 3UTDA 4P2GA 1VLQA 2V6JA 5E3HA 1SCIA 1VSVA 1TYZA 1CY8A 3P4YA 4NNJA 2P0AA 3ZZ0A 1PVVA 3BIWA 4PZ9A 2WU8A 3D81A 1Y8QA 5HRUA 2W42A 3HVIA 3DZKA 1D2NA 1JE0A 3TIVA 5CT4A 4L85A 2HWUA 1LK5A 3GP3A 2ECOA 4HATA 3FSEA 1OC2A 2HMVA 4PG5A 4HAYA 4JENA 3AONB 1EKXA 2X58A 3JQ8B 2Z2IA 4R3WA 3Q8MA 1TLLA 1DEAA 2O1XA 3JAKA 1ZJ6A 2IYYA 1ECPA 4KYIB 1VJRA 3R7LA 5ICCA 4MRSA 4MKIA 4J7XA 1MAUA 2XVMA 3L41A 1JMVA 1C8VB 3LMKA 4W9NC 4V0ME 3C1AA 1RBQA 3G1WA 3BRQA 1XLUA 2NO0A 2OE2A 3GHHA 3T7CA 1BKDR 1NPDA 3B3GA 3TQSA 2RGRA 3GGDA 4U2FA 3ZDDA 5GP1A 1DMRA 3N2KA 2P4SA 3G2KA 3Q6NA 1RMYA 4HF7A 2Z8YA 3AHGA 4OUDA 1L0BA 4CG1A 4AU1A 2I6XA 1UAGA 2PX0A 1Y7LA 2HHAA 2I5PO 1HY3A 2I4NA 4KUGA 4CKBB 1XU9A 1FP4B 4NMXB 2VPQA 1U6JA 3VPBA 3ZWOA 3GP5A 5LOVF 3H5NA 2VYQA 3GLFB 4XCQA 3Q5EA 5ES3A 3F74A 2CSXA 4POOA 1FTSA 2GLUA 1MCZA 2GBFA 1VIYA 1WXHA 2GYYA 2VT2A 4F3KA 4FE7A 5JPDA 5TVKA 3WIDA 2JL1A 1XZKA 1EX7A 4M4SA 1VKOA 1JECA 1M2GA 1GR1A 1HFKA 1LC0A 2PKQO 3VR5D 2B69A 2ZZKA 3DA8A 1M5RA 1V6AA 2CLDX 4YJGB 2EJWA 1VIMA 2WYWA 4F4CA 3K2IA 5DK6A 3A58B 2UYQA 5KOHB 1US8A 1TF5A 1N7GA 5FUVA 3ZTTA 2Q3FA 3RSCA 5DI9A 5JHGB 4X1YA 1U04A 5GOTA 2J9ZB 1GV0A 1E2DA 1JFFA 1U28C 2FETA 1T9AA 2FZ5A 2J8ZA 2I9PA 2R97A 1T5HX 1ZI9A 1ACLA 2PZKA 3AOEC 1GLVA 4REQB 4EVQA 4PYJA 1UDRA 3O31A 4BGIA 2SCUA 1TT7A 1LNQA 1UK6A 2QD2A 3MVEA 1QYDA 3I61A 1ZDMA 3NR2A 3DNPA 4IINA 4JYBA 2VDMB 4MYHA 4NBSA 4DIBA 2C97A 2UYGA 1H85A 3WGKA 3RBAA 1THGA 3RQSA 1WCXA 4ZEMA 4LZZA 1SC4A 2P2GA 1F8GA 4JBYA 3V9AA 1RHUA 1SU6A 4EL5A 3AF6A 3TE6A 1J20A 3H8WA 1OLOA 4H6WA 4LVNA 1Q83A 1O5TA 1ZBQA 2G63A 3GCGA 4L8GA 4MUYA 4XPIB 2DBVO 2Z4SA 1TIPA 1WP9A 3E9EA 2NZXA 1CCWA 1LS1A 4LGCA 3DGEC 4IH4A 4QUEA 4XYMA 1TIBA 3IQZA 2W6MA 2YRFA 4GWKA 4JUDX 1SIWA 4A8PA 3EAFA 3BE4A 5BT9A 2Z5GA 3KXDA 1G1MA 2A67A 1RU3A 1FDVA 1SVLA 3B1JA 3QQPA 5HX7A 2C96A 1Q1NA 4UM8B 4GLJA 1P81A 3T1OA 2WWFA 2QD4A 4KAAA 5B12A 3G0BA 1H23A 2ZULA 2BH2A 4K6FA 4ZP1A 4S1WA 3IIKA 3SHQA 1OMOA 1UPAA 2R44A 1MAVA 2AVDA 5T3YA 2PG3A 2QQ0A 2UZ1A 3OWXA 4FJ0A 4HEHA 2H4WA 5GV8A 4B5LA 2Y1KA 3NOVA 4INOA 4TWBA 4QEZA 2DECA 3PNQA 1PR2A 2DUJA 3HB7A 1LJUA 3PFFA 4RAOA 2P75A 1RM3A 3KVVA 1MA0A 3RRJA 5L95A 5F5LA 3J81k 1OWPA 4MS4B 2V5UA 5AUPB 3OTHA 5GTDA 1ZOIA 4TLLB 1SQFA 3K0AB 3UAYA 3KOOA 4ALMA 1L4KA 3UPDA 1SPBS 3F5MA 2HRCA 3LT5A 4WFKA 3MAJA 1ISJA 2CJPA 2WD7A 3I0MA 4JLBA 3VNAA 3EVTA 4AMYA 2PPVA 3DVQX 5EWJB 5C8XA 2OVFA 1XZNA 1JHDA 3AI7A 1MIHA 3K70D 3AHHA 5LYYA 1FNCA 2ENWA 4RY8A 4EJ0A 1ZLXA 4JP8A 3G5AA 2PUWA 2W43A 4QVGA 3UKJA 5D6OA 1UMBB 1WO8A 2RHLA 4RLHA 1DZ3A 1OSNA 4OK3A 4EG7A 3O8RA 1NY6A 1UXHA 2F4NA 1FDOA 2BFCB 1V11A 2G28A 1UBHS 1B43A 1JLKA 5LB4A 2C29D 4X24A 4X8HA 3OOEA 3ZCTA 2O4UX 4A4DA 2ZDQA 1ONBA 4KMSA 1ISPA 2GNPA 2QRQA 3O6VA 4GE0A 3UV7A 4RHTA 2V7UA 3DYIA 3IEKA 4KAXA 3SEQA 2NSLA 3TZBA 3WRYC 4CV1A 5BN5A 4CUZA 1C4OA 3Q9SA 4E15A 2XCRB 5JU6A 1G9XA 4EHIA 1GL3A 5B37A 4EX6A 1SA0A 3NALA 1QRAA 4MDYA 3RYIB 2ZAGA 3MRXA 5K0GA 1OWOA 1U63A 3V1NA 1E6MA 4CKZA 4US0R 1NR1A 1E6WA 2WUEA 1I4DD 3N70A 4B09A 2C20A 5LMUB 5F9FA 1WV0A 4HO1X 2Y0CA 2AK3A 2HWXA 5IC5A 3U3OA 1GV1A 4LNUA 4QVKA 3DOOA 2AXPA 1BH6A 2B34A 4MW0A 1UM8A 2YUIA 3BFXA 3LQ1A 1TM5E 4M1EA 4MAFA 5C4IA 5CDGA 4BMZA 2HA4A 4F3YA 1TVCA 3SM9A 4GGMX 1I8TA 1QFZA 1U2DC 4PYMA 4A03A 4BS9A 4LPKA 4FOOA 4L9WA 1EE2A 3DE7X 1XQ1A 3H6HA 4M36A 3KHSA 2PU5A 4GZLA 4NBWA 1QUEA 4LWZA 4AJNA 5DBEX 4K86A 2XGOA 4UBIA 3I2HA 2R6GA 2QV7A 4IJKA 3B9BA 1JU9A 1FTWA 121PA 4IKOA 1GZ4A 4HLUA 4NFLA 1TA0A 4R05A 5E9JA 4ZAGA 3ROTA 5C5IA 3JD3A 1HNZB 2AW5A 3DYBA 1BXGA 2H1FA 3L8DA 2PZAA 1SVWA 2C4HA 4N65A 4RHFA 4YCAA 5F9HA 1E66A 4BHTA 4G1EB 1B00A 2AOVA 4DIKA 5CD9A 2EKPA 3O4RA 5KB3A 3KL2A 2QT0A 3OZDA 3E9RA 3H1GA 5AKIA 1ZNQO 1SVMA 2P9JA 3OKAA 2X8LA 3R41A 2UUBB 1LF5A 4FFOA 2WVGA 1RI1A 2C9DA 4CLDA 3RYHA 1K6EA 3Q6MA 4H7HA 4XTRA 5EIEA 4D8UA 3FCOA 5HPYB 1E0JA 2VWPA 4CQLA 5IT0A 3OZXA 5DCWA 4QXMA 3AVYA 4XJSA 2QL7A 5HZHA 3DLIA 3AM3A 5EHIA 5THQA 4F0JA 4XAQA 1EFDN 3SZ3A 2DTXA 1O0SA 1PK7A 2V7VA 1ZCFA 1J2RA 2A84A 3LDAA 3M6XA 4UBOA 4WEQA 3NDRA 5DDIP 4Z6KA 1WKVA 4NBTA 4F04A 1NNEA 1DAHA 1PKEA 4P32A 5J4YA 1Z16A 3ETEA 3BFJA 5B1DA 4N8EA 1MJGA 1XQXA 3Q3EA 1S8FA 1G2PA 1E79A 3AUTA 2JAUA 3A25A 3HVRA 4A16A 1A8UA 2OHFA 2G9UA 1RBMA 4I99A 4BMVA 4ZICA 2IUFA 3IO3A 2J67A 3VKWA 2XOKA 3U48A 1U02A 3AHCA 2GEBA 3G5LA 3H0CA 3L5OA 4LHSA 1RI4A 1XHEA 1TJ3A 3PHJA 3ILXA 3S2SA 4FLEA 4EM6A 2PR2A 1P17A 4R98A 3HDYA 3RVBA 1Q20A 1R8SA 4FYKA 1JB1A 3Q11A 3TNJA 2WUFA 4R1LA 2ZM6B 4KREA 1ZH4A 4Q9JA 5TQ0A 2G3YA 1VDZA 5L3VA 1FEZA 5GJCA 1XALA 2JARA 3OLWA 1RXSA 1RQPA 1UAYA 2ODWA 1W96A 4J4HA 1E1CB 3ESXA 3PC8A 2GNAA 4IM7A 4OXKA 4J49A 4GKBA 1XG5A 1X9GA 1WP4A 4Q47A 3SF0A 5JQGF 1OT3A 2WFMA 3O9VA 4LRSB 3ZWDA 2YW2A 4WPGA 3O8NA 4KX5A 1BHO1 3Q8LA 3VPSA 2GK4A 3EXIA 3QVSA 3BTSA 3QQ5A 1LWNA 4LS3A 4O5OA 2WYVA 3GVXA 2EVWX 3KKNA 4KDRA 3EVBA 3SCZA 5B2FA 5JATA 3PJGA 4LE1A 4WVLA 1I5OA 4YMLA 1PFUA 4BIIA 4O3FA 1H3EA 2Y27A 1T2EA 4A6DA 1IG3A 1ADGA 2R62A 2RC5A 2ROQA 4EGFA 2OBBA 3CCCA 2NMVA 5FJJA 5KTRA 1FFYA 3OFVA 3E22A 1GNSA 1OVGA 1V5EA 2Y93A 3E2IA 3RTEA 5CBPA 2ZWMA 2BZGA 1IVYA 2O20A 3GFBA 4EEKA 1ZM2A 3ANTA 1VSBA 3GN1A 4L6AA 4NZNA 1DKLA 1HOTA 4Q1DA 5JBIA 1W0JD 4M7PA 4OFXA 2UXDB 1EESA 2QRGA 2GXAA 2JI7A 5JFGA 2FG5A 2MT9A 3N2NA 1U9CA 1GL7A 4WZBB 4AF6A 3MWFA 1PFGA 2QJTA 2G71A 4UTZA 5F4BA 4EHBA 1X1BA 1SO8A 3IKMB 3ZVRA 4S24A 3ZPXA 1JJ7A 1E2GA 5ANRB 2CMHA 1T4GA 3QGMA 4BWGA 4BCDA 2GO7A 2WPDD 1VBNA 2YOFA 3PPYA 4QFDA 3CPJB 2PT9A 3GY0A 4O2LA 3URMA 1DX6A 5DRTA 2CMDA 1PVDA 2QG9A 3F4BA 2W2PA 3VO8A 2W6ID 2WTUA 4URXR 3TOVA 2AFVA 2R1VB 3JALA 4YRCA 4Q3OA 1JAHA 1EA7A 1W88B 4C0LA 4C7OB 2PGNA 4IUCS 5AKGA 4WXYB 2EL7A 2UYOA 3TFWA 3I42A 4RZUA 1IL0A 2I9KA 3PEUA 2OA0A 3KQMA 1G17A 1T9DA 1FFBA 1RPJA 1YBVA 3ESRA 5FOQA 4O4LA 1KH2A 3I9V6 1W52X 1PGNA 3A1UA 1UXIA 3AVTA 4ER7A 3QTBA 4TVOA 3DW3X 2O2SA 1KQOA 3G9TA 4G26A 2XSZA 3ZYCA 3DO8A 4XWWA 5A3QA 3ILHA 4LFCB 3N59A 5DK4A 2C4VA 3E3NA 5DXAA 1B41A 4URFA 1YGYA 1NXWA 4WWHA 2X0FA 3LX6A 2DC1A 3H42B 3AM1A 3ZDZB 2GNOA 1KKMA 1TYCA 4EI9A 4P34A 3NMUF 3NWJA 4NONA 1N2HA 4Q4JB 2ID8A 3NO4A 3OKFA 3U26A 3JQ9C 1XCBA 3CNQS 2AG5A 5D01A 4CT0A 1LK0A 1NBWB 4MYRA 3A2MA 4UNRA 2PVPA 4CN8A 3FVVA 3H4MA 1IHYA 3BGVA 3ZY2A 1C0LA 5BSVA 1N9GA 2G06A 3B70A 1J8QA 3PZBA 4ZT2A 5EMHA 1NFFA 4WADA 1CT9A 3RD5A 2VQ3A 3VJRA 2BJHA 5KNCD 5H80A 1U1FA 3WI7A 3PV0A 1BQ4A 3ZJVA 4HN9A 4N76A 1EGMB 3DKIA 4XGKA 1JJVA 4TKVA 5IYZB 1JQLB 1E9BA 4F4JA 2WM3A 3N53A 4LWQA 3ZJUA 1STOA 3Q72A 3QMWA 4H7FA 1V1JA 2AS0A 2WD8A 3DBIA 4OV6B 4RVOA 3IMFA 4PTLA 3R76A 3GGPA 3D3EA 2B98A 2X0DA 1EUYA 1CY7A 1O2DA 5FPYA 3ZCSA 4CPDA 1JHQA 1EVLA 1JTEA 1U4NA 2GZSA 5D7NA 1UZLA 4JI8B 1KIMA 2C95A 4OHPA 3VZRA 3HDGA 3ZW8A 5FA5A 1KFJB 1XAIA 3GEDA 3VU9A 2JHGA 3A9TA 4YMUA 3M82A 1M8JA 3OQIB 1OI7A 3TECE 1D2RA 5IAKA 2C58A 5CP8A 3HKDA 4DNXA 1KPHA 3A27A 3JXEA 4QWMA 5BSMA 2VZ8A 3OUTA 4YCBA 3WMWA 2VRNA 5HNKA 4UXHA 2RHMA 3H97A 5LZ4A 4WI1A 2G9QA 1RPNA 2OM6A 4KFUA 2D7DA 3PIIA 4IGIA 9ATCA 3AVUA 2MMGA 3OJOA 1Y1SA 3HNPA 3QFHA 2YX1A 2O5VA 3DTTA 5K8JB 4C78A 2LP4Y 2YXNA 2A88A 1T4BA 3DVAA 3MCVA 4G5RA 1RJWA 5KYXA 2GZRA 1TUIA 3T1YB 1EZ1A 2YJNA 1N5LA 2PS0A 2YYYA 2OXEA 3LZDA 4C08A 1DS6A 3ICEA 1YQGA 5IMBA 3DZIA 1IZYA 2BW0A 2X23A 2Z6AA 2ZJ1A 3AGPA 3OTWA 4L57A 1BXKA 5AXBA 4Q16A 4NYIQ 4CL8A 2Q0SA 2L0XA 4WRRA 3LXMA 3N0VA 2QG6A 2A0FA 1KQGA 1WIWA 4H6VA 3NIGB 1RXYA 1Z36A 1VDMA 3EC2A 1OD6A 3MJSA 2JLUA 3OF3A 2QOEA 3EF3A 1D6JA 5T8KC 3RWBA 3SVTA 4MQEB 2V7QD 3ISTA 3TTUA 1UDBA 1G8FA 2DJIA 1KMCA 2VYND 3LC1O 4V03A 1USIA 1ZHFA 4R3NA 4MQBA 3VAAA 4EA8A 5LR6A 3KK0A 1O96A 4Y7DA 4IGFA 4Q03A 4DRZA 1ACJA 4J7UA 3HR7A 1MKYA 1U8UA 1OZFA 5HOEA 4OAPA 1SUFA 4HDQB 1BOFA 1NBEA 4I4TA 5C3UA 2A9VA 4PNHA 3LHSA 2P1DA 2GRAA 5ITVA 2NSJA 2D0DA 2I1WA 5L53A 2HBYA 3FJ1A 1DIHA 1TZKA 2CYBA 2RI1A 3AO0B 4NMMA 4ND3A 3Q1KA 4FFVA 4TT3A 1U3FA 5AK6A 2RSLA 2CW5A 4OHOA 3THOA 2ZM5A 3K0BA 1A1VA 1IM8A 5JH7A 2FMUA 3LYLA 4HPWA 4GM1A 5KDOA 5DTRA 1VBKA 4BVLA 3KALA 2JI4A 4DLBA 2YIDA 4GPAA 4ZEVA 5HQTA 3P1JA 2HX1A 4H1WA 2ANBA 3I37X 1WZCA 1KS9A 1PR0A 2NU6A 3B8EA 1G6OA 1N2SA 2BFFA 2HDOA 3E0QA 1Z0AA 1ZN8A 3QPBA 4K87A 1KR2A 1SWWA 4XUEA 2GH1A 3LC7O 1PT9A 1SKYE 3CUEF 1GGHA 5CT9A 4QBHA 2WM2A 2B0JA 2PEYA 4AKHA 3HV2A 5LIPA 3QIAA 4CXMA 1N2IA 2AH5A 4GMDA 5FTKA 2LTAA 1QLJA 5BWBA 3L0BA 4LWPA 2GJ4A 5JMOA 1MRZA 1FA9A 1SHKA 4CG0A 5FPHA 3WGGA 4DR6B 4WXRA 5IUKC 4C3UA 4CQMD 3G0IA 3B5JA 2F3QA 4LZPA 1ZJZA 3CFYA 5CVDA 4RTJA 1OLXB 3FPGA 4NAVA 2CHFA 4LDQA 1RJ9B 1NVUQ 4UUOA 1RQNA 2ZKIA 4C04A 1CDDA 2H9AA 1FMLA 1Z56C 2VCEA 3R6GA 4ZVPA 5A5DA 5DNYB 4LGYA 5JNVA 4TYNA 3U44A 1ABFA 3ISVA 1CVLA 5BQ3A 2W0SA 4UAGA 1XK7A 3I12A 4HEA1 1YR6A 4ID9A 3C6ZA 3PGA1 4TV8F 1E3DA 4RIHA 1M1YE 4MA0A 1ZHOA 1PUXA 5KNDD 3A9WA 1M67A 3QEOA 1OWMA 4A5SA 1H22A 3EIQA 4IL5A 3EMDA 1E9SA 4CL2A 3AV0B 2XUQA 1RQ2A 3A2NA 3PKIA 3BWEA 3IP5A 4LTMA 4PHGA 4YRJA 1Y3CE 1KL7A 3BREA 3VJKA 3NP7A 3UXYA 2R11A 1JH9A 5EXSA 1II9A 5FOVA 1GQSA 3HVJA 3EDMA 3EVCA 1AQUA 1KO4A 2E48A 4UE6A 5CEEA 4LXQA 4AYWA 3TDKA 2JFOA 2IHKA 2XV1A 3W1WA 5AW0A 3QE9Y 4YJ3A 4MWZA 1CR6A 2G40A 3AL2A 4LRXA 3UXEA 2HR1A 1D8AA 3THRA 3E58A 4AVYA 2RE8A 4OF4A 2C5LA 3GYBA 5LBTA 4PNPA 5JRJA 3FZQA 5FFNA 3L0IB 3K05A 3N2ZB 4NJMB 3W7BA 3REQB 4ZYUA 4YT4A 4ND4A 2QU7A 2YIJA 2NTEA 3V5NA 3DAFA 1LA2A 1PR5A 1YA8A 2VJCA 3F5SA 3PQ7A 5AI0A 3TOSA 4FLMA 1H2AS 5FR2A 3S27A 4ARZB 1YS7A 1TM2A 1KXJA 4TZTA 1SC6A 1UK7A 3UGTA 1QXSA 2XD4A 4QUAA 4FFDA 3LT0A 3TKLA 4FEAA 2X3UA 1U1IA 2VAPA 3CW9A 2FH5B 2KJQA 3LIIA 5ENZA 4IFIA 3N5KA 1D5WA 2P91A 5DHAA 4ZTBA 5CDHA 4D4LA 3ESBA 2BTQB 1JVNA 1TL7C 3Q15C 1VMAA 1H05A 3I9JA 3PRHA 3QW4B 2QMZA 4I50B 5AW5A 3U81A 3DB2A 4EARA 4RQTA 3S1LA 3WOHA 2ONCA 5MFZA 2VDPB 1AE1A 1ULSA 2CJYA 2Q0HA 2ZW9A 3DE4X 3ESCA 3VU8A 3I9LA 1BMFD 5G0WA 5C34B 3N2GA 1Z8FA 3LPCA 2ID7A 2D5BA 1R0LA 2XCOA 4C2TA 3SR0A 3TGPA 2PQ2A 1ZC3A 2JGEA 2ID4A 2ZPUA 2VP5A 3FSGA 3GJ5A 4CM1A 2P77A 4KPFC 3SX2A 5DM0A 1G18A 1TJNA 3SBXA 3MILA 2HWKA 2X40A 3R2JA 4WZAB 4XWYA 1USKA 2XUJA 5KWIA 2JJ1A 2DPXA 5B58T 4Q02A 5KSZA 2FB9A 3GGGA 3AY0A 5D3MB 1RYHA 3JQBC 1HGXA 5AM4A 2D6FA 3KT6A 5ALHA 1ULUA 2DY0A 5B55A 4BOYA 1XJWA 5LUAA 2IYXA 1N5OX 4IDGA 5EIOA 5IAOA 2YDYA 3H6GA 5K1ZA 5KOYA 3EZYA 4GVLA 5EG5A 3CH7A 3QY0A 2NT4A 4IOKA 4YMWA 4EX7A 1NATA 1X87A 2H0QA 2R6DA 3AQIA 2PZFA 3EGCA 4YYZA 5CDFE 2RJ3A 1XWFA 2JVKA 3PYMA 2Q21A 4LX8A 3ZKWA 4FEYA 4TXNA 5B3JC 3V4FA 4DA4A 1ECFA 1SHLA 1XNGA 2XE8A 3GK3A 3RV3A 4C6RA 4GWLA 2HA7A 3STUA 3DT9A 1JZTA 3CH4B 3JTEA 3RHZA 5INTA 4QYWA 1M1NA 3OCCA 3ESAA 3EZ2A 4EHKA 1FS5A 4MGHA 5KVCA 8MHTA 4ZZ1A 3KXLA 5HK9A 1P5ZB 3FDFA 3BD7A 5MGNA 4QDTA 1FNBA 4QDXA 4QHTA 2DG2A 2H5JA 4WEOA 2Q5FA 2EJTA 3GDHA 4H16A 2DP4E 3JQAB 4MGEA 1DQPA 1P80A 2IYRA 2ABWA 5IZCC 1BKYA 1L7AA 1ZQ9A 1V7ZA 1J00A 1K8XB 2H11A 3LLVA 3MSXA 4P7BA 5E6RA 1IMOA 3VQTA 3QVWA 4LOJA 3TCXB 4DLSA 4B3HA 1YCDA 2AFHB 1IZZA 3OPVA 1BE1A 3IX7A 4NX2A 1N32B 4LC9A 3FSRA 1TQHA 3OU2A 1YDGA 1Z0FA 2HAEA 2ZIWB 1XCPA 2JHCA 3IGFA 2HCTA 2ZETA 4B7AA 2ZRJA 1DKRA 1YZYA 3OZWA 1PN3A 3R7AA 5FH9A 3IBYA 4UUQA 3M9XA 1UBEA 1N1EA 4K6MA 4DSNA 5KQGA 1KAMA 2OXTA 4KXVA 4PZEA 4V39A 1S8NA 2QTGA 1L8QA 2WFLB 2VNIA 4BNTA 1XTVA 2L82A 2CXTA 2DYKA 2QTVA 3K32A 2MDTA 4KGZA 4R7TA 4UZSA 3SKVA 2YVKA 4A2PA 4YCSA 2VPZA 4F86A 5ITZB 1WDWB 1QWSA 2I6QA 1JVBA 4OB6A 5E8JA 4DDUA 4RWZA 1BS9A 3TGWA 1T4CA 4YR9A 2PZBA 1QGYA 3N8IA 4AY5A 1MJNA 5LL6P 1O94C 3FI0A 2PN1A 1IBMB 3QLVC 1YDFA 1Z7EA 3KB2A 3ZZUA 3CPHA 4DSUA 4BO2A 2HLDD 4DLWA 1FL9A 2AYXA 3NXSA 5CH8A 1KSGA 3M4NA 2P2DA 4BQNA 3HABA 4B2LA 3K8ZA 4PAMA 4QUBA 3SD7A 2IVFA 1O54A 1JJIA 1XE3A 3FWKA 2XYRA 2VH1A 3H6KA 2TMDA 4GH5A 2IOQA 1Z17A 1ZOPA 3G0CA 3M9LA 3ADDA 1ESMA 1QZUA 1T8UA 1E96A 1XRQA 1KARA 2EDAA 4IR7A 4QOJA 4AN0A 5JBNA 2EF0A 1QIKA 4KGVA 1P0PA 1QJCA 4CJXA 1RADA 1TYAE 1I2MA 4L22A 1Y7TA 1L7OA 4KUEA 4PW0A 1SUAA 1V1MA 1LBEA 2LE0A 3H1FA 1JZSA 2WG1A 4OBWA 5K3CA 1K0FA 5IJ0A 4QARA 3T7DA 4AG3A 2QS9A 4YCLA 4GDFA 2DR0A 4KO2S 3O1IC 1U3DA 1ZN2A 1KEWA 2FN7A 4C21A 4IDEA 4TLAA 3ZJ5A 1NHWA 3JQFC 3P2KA 4MW9A 1OXTA 1AHNA 3AEZA 3AYZB 3G85A 3AIOA 2HC9A 2DWUA 3SZMA 3RUPA 1Q14A 4NYJQ 5JW6A 4DYDA 1PX0A 4N8SA 3UCXA 2Z8ZA 3VTZA 3G89A 5FQNA 2JGJA 1DBVO 4LYJA 3U4CA 1TC2A 1QNLA 3EISA 1MC5A 4YV7A 1OYOA 3QV2A 2CL7X 3ZY3A 1KMHA 1CYDA 5EC8A 2AMFA 2X4LA 4Y6QA 2FFJA 3LDFA 4NMLA 5E7JA 3ZU2A 2DWQA 4D43A 4ZO6A 4H7IA 4YRSA 1HNWB 4Z1OA 4ZV4A 3A7DA 3C3XA 4XD7D 1BZYA 1YS6A 2NADA 1Y4UA 2VJNA 3SFVA 3AL0C 1JYEA 2ZRNA 2GYWA 3A1CA 3F46A 1TMOA 5JH7B 4Y98A 3BFPA 5LLSA 1KIAA 5LOVB 4HAUA 5EA2A 2B4RO 1CQJB 4YRKA 4Z4GA 1AN0A 3KS9A 5BPHA 1NULA 2AA3A 4C76A 1JBQA 2ZAMA 1U6KA 3Q0IA 1YJCA 3UICA 4B3XA 4CMAA 1FFAA 1YONA 1R5OA 3OF5A 1OXUA 3EPPA 4FFMA 5FYDA 2WHEA 4F8YA 1ZMTA 2XMBA 2O2JA 1WTCA 1DBSA 3Q3CA 4GX2A 3H2HA 3T4XA 3PDWA 3K35A 4FT2A 4RIFA 1XEXA 4OQNA 2CDRA 2FFQA 3UUFA 3EIWA 2AE1A 4BRWA 4LOHA 3O95A 4X44A 1GZHB 2WF7A 4UMVA 1P2DA 4E5KA 4AKGA 4BBJA 1HURA 1XZHA 2HV9A 3TLYA 3HJNA 1NMQA 1RTTA 4JH0A 4I1YA 4P33A 4F11A 1W8DA 1IRXA 1YS4A 1NF8A 3WWZA 3D0OA 4GSLA 3AFHA 1MNAA 2WYIA 5BNIA 3IQHX 3TZCA 3O2JA 5LYJF 2H1CA 4UCFA 2IDZA 4ZYVA 5FL7D 3RS4A 3FMFA 1JR3A 1U7WA 4KXYA 3K6RA 5EWMA 1JIJA 3WSWA 4BFCA 1O6BA 4BNLA 4C4OA 4DZZA 5KQRA 1NKSA 1UM9A 1CUDA 1ST2A 3IMGA 1QIEA 1GA6A 1VCNA 4FIDA 4TOIA 1YQQA 5F1PA 2OV6A 1CZKA 4OP1A 4M9SA 5FWYB 5IN4A 2CFRA 3W7AA 1VHTA 2ZIAA 3KU4A 2OXRA 3C3JA 3KZXA 2C4WA 1RWMA 2DSNA 3IIIA 2G88A 2V03A 4QGSA 4QFBA 4L74A 5PNTA 3BL6A 3RRFA 4YLYA 1XCMA 2IT1A 5JCOC 3AEUB 3L0PA 1OIWA 5T6MA 4EHHA 1NFQA 3FMGA 1P45A 3BXEA 5DO9A 5JZOA 2WJVA 1F6WA 3OKCA 2RHGB 3OPQA 3QYAA 4HK4A 4YRFA 3PR3A 5I51A 4DTIA 4WLFA 1Y4DE 1Z8NA 1Z35A 1HNNA 3FJYA 2BCEA 2WM9B 1N7HA 2WOOA 2ZTVA 4QBGB 4S12A 3NNSA 5AMXA 3KHUA 1P4HA 1CR0A 5I9TA 1PT7A 3UA3A 3CNOA 3VFDA 1AUVA 4EJSB 1VPWA 1VMDA 1U2EA 3DQPA 1UKVY 3BE6A 1K66A 4OOFA 5I7WA 3GZTB 1A5AB 1TU4A 3R5SA 3S81A 4EK9A 4EW1A 1N2CB 2R96A 4RV4A 4M55A 1U0BB 1D9ZA 1V7CA 1Y37A 1SK9A 2QVBA 3EXHC 2ZIXB 2Q0QA 4MVJG 5IWCA 3H1EA 1JQDA 3GZNA 4E5DA 3KXIA 2WV7A 1NDHA 3CU5A 2FG6C 3H1AA 2XUFA 4DQDA 2IBSA 4LYEA 1J09A 2Y68A 1NVKA 2B4AA 4TXJA 3AG6A 3R3WA 4R1UA 1W59A 2V7GA 4WD3A 2CFOA 2QUZA 3L1JA 2OCKA 4BXOA 1QS0A 2OWDA 4XYGA 4ERNA 4PBRA 3OHPA 1WVGA 4M86A 3CF6R 3WWYA 3E70C 3SX0A 3UHPA 5FHRA 4ZI2A 2PIDA 4BLPA 1RC0A 1BIFA 5CXUA 3DDSA 3RFTA 2QXTA 4XGNA 3K1JA 4OPMA 1EGHA 4DLPA 3A0UA 4D4IA 4LMPA 5GMOA 3VKHA 4NZOA 3CH6A 3VSCA 4KIUA 3C15C 1FVOA 4EJSC 2C31A 2REOA 4JJKA 5TARA 3DTVB 1T3GA 1EA5A 1CUYA 4B8YA 5BQOA 3W5UA 3CZ9A 2AMJA 5EMNA 1DAFA 2B61A 2AK2A 1NBME 3DE2X 3N2GB 4N3AA 4O08A 3E9QA 1DTWB 3GRVA 2Y1LA 3OZIA 4ZVSA 5LA6F 1U2SA 1XXHA 3ORRA 3UUEA 3F71A 5ARDA 4C07A 5ECGC 2GASA 4H27A 4NHEA 4L8VA 3W4IA 2AZDA 1FTGA 2QM3A 5TDHA 3GJQA 5HCIA 2OGWA 3C8MA 4BP9A 3MGGA 2C0CA 4IIEA 2UVQA 2ZAOA 2R48A 5E1MA 1L5VA 3HADA 1P39A 1YJ5A 3NYQA 1JDVA 3A1FA 4FWIB 4MWTA 2ZWIA 4II2A 1M34A 1N75A 1W4LA 1CUAA 3D7NA 2XUZA 2MWMA 1DGQA 4Q9KA 2O8DA 4UPDA 3RSHA 3ZE8A 1E5VA 3LHIA 1E1QA 1GJRA 1KEUA 4K88A 5F1KA 3W9UA 3WX0A 4DKJA 2PFKA 2GJ8A 3NM4A 4KCGA 1RP1A 2JCBA 1OJ7A 1OU0A 2P2YA 2ZBUA 3CLUD 4LGMA 2ERCA 3O92A 5ALKA 3UJ7A 2IYTA 4FX2A 3KPWA 2F1OA 3AI3A 3UAVA 3L8EA 2B2NA 4AYTA 4F5ZA 4RSRA 2XKKA 3QENA 3CR7A 2O3JA 2RARA 4K1LA 4O2AF 4B44A 4GP9A 3T3HA 1YJQA 1IONA 1E3EA 5ALGA 1N57A 1Y34E 1NVMB 2GA9A 4BB0A 1VI6A 3QVJA 3M70A