4PZYA

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDCYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords K-Ras
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4pzyA00
4Y0AA 3H1TA 3NBFA 1X1SA 3SI7A 5TVKA 4A36A 2OBMA 4KAXA 2ZRPA 2PZGA 1Q1BA 3Q9LA 1DAKA 4P4UA 4NYIQ 3R7WA 1FPMA 1IXZA 3X1XA 1RRGA 1XJCA 4I1SA 2IYRA 3SYKA 2GWHA 1U8YA 3AVVA 2FN4A 3IQWA 4IKEA 2J3EA 3B1YA 4LPKA 2Z83A 1YHNA 4PPFA 4ITRC 4JLPA 4FMDF 3RS5A 4CVNA 2YJTD 4LWZA 3MAAC 1IY1A 3A8TA 4TT3A 4GOKA 3HU1A 3SJBA 4EJSC 2F1HA 3LDAA 1P2VA 3O8DA 3K9NA 2ZI3A 1G1MA 1AZSC 1VCIA 4A9AA 1XEXA 4I1UA 1FQJA 3C5HA 4EPXA 3SOPA 4BFXA 4GSYA 5EZ6B 1PJRA 4TQUS 2P3SA 2P6UA 4B35A 4D81A 1XBTA 5P21A 3WYFA 2G9NA 4XOIA 3CX8A 5FOTA 3LWNA 3U3KA 1CR0A 5AJWA 1FOEB 1KO7A 1DAIA 1F60A 2B6HA 5EUQB 4NCJA 4R2HA 3R9WA 2FPKA 3X1WA 4AURA 2JGNA 1E2LA 2IYXA 4OK5A 3B85A 3RHFA 3SN6A 3UATA 4LRWA 4F92B 1QVAA 5JCZA 5HE8A 3CZPA 4TMXA 3WRXC 3FFAA 2WOOA 1E0KA 5DH9A 1E9BA 2A78A 2F9MA 5EXXA 2CNWA 3EWSA 1VTKA 3ZQJA 4TMTA 4ZI2A 3W3AA 1EFTA 1WMSA 2JLSA 2F3TA 1S9HA 2EYUA 3L0OA 4S2EA 2CE7A 2IS2A 5EP4A 1F5NA 2AX4A 2ZRDA 2REXB 5BWMA 2D62A 4PQFA 5J5CA 5TV2A 2ATVA 5D3MB 3DPUA 4KITB 3I4LA 1NY5A 3NWJA 3M1IA 4JKYA 4YXWD 1NIPA 3B1ZA 5EXPA 2UZIR 2QRNA 3ZD6A 3DM5A 5JEDA 3I62A 5JSZB 4N0EA 1YKSA 3VR6A 4G5OA 2PMKA 3SE0A 4CEIA 1NMXA 2QU8A 1G8YA 2ZR9A 2VTKA 2IC5A 1GILA 2RGNA 1UBGA 5KPJA 2CL7X 3DMDA 2ZETA 2Q3FA 3PUVA 1YZTA 2AR7A 2RGXA 4M9ZA 4RD6A 3SJCA 1ESMA 4DXAA 3KDSE 4O0MA 3QG5A 5FOWA 1ZM9A 3GEEA 1CKEA 2QE7D 3GJ8A 3BIFA 1B0UA 1SGWA 1PVOA 1UBEA 1BS1A 2Z43A 4MITA 4MRSA 3MWKA 4A8JA 4Q1FA 5JECA 1T3HA 4TL8A 4PAQA 2GAOA 1GM5A 2QBYB 3RSLA 4OKSA 3S1AA 1EFUA 2IW3A 3HDTA 2WICA 2C95A 5FFMA 5SZJA 2V9PA 2C78A 1FMLA 1NN1A 1SHZA 1ZC3A 1R0ZA 4WA7A 4L4UA 4B32A 4LYAA 4PHHA 3W5JA 1G3IA 3E2IA 2ZITA 1XEWX 2ZR7A 1W2HA 4V0MA 2FMXA 2W6JA 4YMWA 5J4YA 3SC3A 1NNEA 2QMHA 4JT4A 5ANRB 1G5RA 1HE1C 4RJLA 5HCIA 4A0GA 4XVRA 1UADA 4B3XA 4YQFA 2NOAA 2ZRLA 2A5FA 1PV4A 1H8HD 1CEEA 1YQTA 3BS4A 5JBQA 5SZKB 1XCPA 4IRUB 2VP4A 2H7VA 3KQHA 3R7WB 3HYTA 3M6AA 4MKGA 4M1SA 3WMGA 1SQ5A 3NDPA 2QP4A 2GCOA 2GZAA 5JFGA 3ZVMA 1W47A 3WYAA 1II8B 3K9LA 2CHGA 1KO8A 1CBUA 1R4AA 2XJ9A 3V9PA 1WRBA 1Q22A 2Q3MA 1M1YE 5HTKA 3DOFA 1NF3A 2PZEA 1N6IA 4HLDA 4O2RA 1NMZA 5L3QB 3AP3A 1E2JA 2OCAA 1Z3IX 1YZLA 4P31A 3V00A 2FFHA 1X8LA 4OK6A 2I1VB 2EVWX 3U7GA 2IT1A 1EFRD 2FG5A 4EPWA 2WWFA 2V6JA 3AF1A 3OEHD 2P65A 3FHOA 2O52A 1LY1A 4DLWA 3K0CA 1GRRA 4US1R 2C9OA 3AV0B 3VQTA 2XNDD 2GVZC 2NO9A 3BK7A 3QNUA 1UAAA 2J0QA 3CX7A 3EA5A 4IDQA 2PEZA 1IOZA 4MUAA 4JKIA 4IHQA 1QVRA 3E1SA 3TLXA 1PLLA 2XAUA 4JL8A 3TQFA 3UMRA 4XD7A 3CNLA 1QHSA 1NI3A 4CEIB 4B3CA 2ZSBA 3JVUA 1P61B 4PZYA 4PC6A 3W8RA 3VAAA 3VKHA 2OCYC 1CS4C 1AGPA 1U99A 4IVPA 5EE5B 1FP7A 4HUTA 4M1TA 1OIWA 1Z0FA 3EWAA 1G5PA 1HURA 1ANKA 2WAYA 4M4SA 2HXYA 4AKGA 4JJKA 1P4SA 5TB5A 1NN5A 2N42A 3RLFA 1NJFA 4NYJR 4BEBA 4ZDJA 2VP5A 3L2OB 4Q9HA 2FGKA 2WJJA 3VHLB 1Q21A 4MYTA 4K81B 3GLFB 1FX0B 3FDIA 3THOA 2FF7A 3AKEA 4OHZA 3VX3A 4DDUA 2B7BA 4ZKDA 4GOJA 2ZM5A 2J7PA 1XFAA 3OIVA 3I8XA 3QVVA 4OQLA 3IUYA 5CDFE 2RGNC 1GL9B 3FOZA 3PV0A 1XTRA 1K6MA 4IEIA 4U5XA 1XJQA 1SVOA 2WZQA 1IN7A 4YDSA 1OB5A 4LX0A 4Q1BA 1R6BX 4UXIA 4UNPA 221PA 1YZQA 1GRNA 2GK7A 3LV8A 3OEHA 1W49A 4DCNA 1GG2A 4AI6A 4NYIR 1U8ZA 4PANA 2GCPA 2OCPA 4LC0A 1TEVA 4HDQB 4A15A 5IDVA 1JNYA 3AF0A 1E4YA 3FKSA 1M6NA 3P26A 4PR0A 1IN5A 1K5DA 2ZUDA 1SKQA 5H68A 1U9IC 2BV3A 2CMKA 1AK2A 1OPXA 1P2UA 2PZFA 4POAA 5IHPA 1S9DA 5GJWC 2GCOB 4V0NA 4HZUB 2KSQA 5JEEA 1KK1A 2EU8A 3H84A 5J47A 2FSGA 1ZUIA 4JZKA 2IF0A 2W0SA 5BN5A 3SS8A 2O8EA 2ZE7A 4PHFA 2X19A 3QY0A 4KJZA 1W36D 2RGAA 2FH5B 3FMPB 2BEKA 2GK6A 4AYWA 2V3CC 3KFVA 4BECA 1O87A 3DL0A 4HAWA 1O3YA 4MRPA 5DYGA 2NZ8A 2C77A 3CZQA 5LD2B 4BGDA 3LFUA 3B5JA 1W2GA 4C9BA 1E2QA 2F43B 2JAQA 5KDOA 1JR3E 2O0JA 3AB3A 3RS4A 1BO6A 1JXOA 3CH4B 3UPUA 4LDJA 1LW7A 4MDEA 1GP2A 1UJ2A 4BFYA 5AR1A 3CH5A 1AS2A 1CJTC 3AF4A 3CNOA 2C98A 5DIFA 3SBDA 1E0AA 3IIKA 4Q4HA 1UEIA 1Z0IA 4UNSA 3IBYA 1ZC4A 4NCNA 1ETUA 2OM2A 1A7JA 2CLDX 2HV8A 1XXHB 3KJGA 4HB4A 4GBMA 4OQMA 1G3UA 1AZTA 3KKOA 3A58B 1QHGA 3LX8A 2QQEA 4KFRA 5TXGA 3U2QA 3CR8A 4CDGA 4P4SA 621PA 2VIIA 3TQCA 2N46A 4BQSA 2CL6X 2VP6A 3ADDA 3NH6A 1G20E 1KMHB 3GFOA 5A4JA 2WWHA 2DY1A 4W9MC 1XMSA 2QEQA 5DN6D 1Z6YA 3QKTA 2HCJB 4PO9A 4XJXA 2J0VA 4W5HA 3C7KA 3O8BA 5EE9A 1NG9A 4ZCMA 1U94A 4QGGA 4QM6A 2ZSDA 2QENA 2YC4C 2V7QA 4EFNA 1KGDA 1NMYA 5FOSA 5JRJA 1XF9A 2GTPA 1RW4A 2J5XA 4ZO4A 2V7QD 1A2KC 3MFYA 5GADl 2ONKA 2NO0A 2NO6A 4DT1A 3U7HB 1FFHA 1CLUA 4PHTA 2ZSEA 1XPRA 3DEFA 3AKCA 4DJTA 3UWOA 5FH9A 1JQLB 1TX4B 1E2KA 3P32A 4WZBE 1QZXA 4DLUA 3K70D 4MDFA 2XTZA 1NY6A 4B6FA 1UBFA 5FUWA 5DN6A 4C4PA 3RC8A 2PT5A 5C2JB 4ZIRB 2QGZA 3KXIA 1HYQA 1ZAKA 3PR1A 4M9SA 5E3HA 1L4UA 1AKYA 3ZQ6A 1UKEA 2Z4SA 1LS1A 1Q3TA 2ZVQX 3MD0A 2YVUA 3FMOB 4M1WA 4Q7JB 3EIEA 1J90A 4Q4AB 3GLGA 3CM0A 4TLDA 3QI2A 3ETLA 3VR5A 1ONBA 5FBWB 4Q21A 1W5SA 1ZW6A 3A6PC 3QKRB 4GP7A 1PUJA 3FYHA 4CT5A 3MUFA 4URYR 2D2FA 4DZZA 2HT1A 2IX3A 2ORVA 4QBIA 5AJXA 1S2MA 5L3QA 1E2IA 2H5EA 1TTTA 1TAGA 3VU9A 4BEJA 3B1XA 4KVAA 1MKYA 2QPTA 3FHCB 4HSEA 3DMNA 1VMAA 3NEJA 3ZJYA 3F3YA 4JLJA 2D3WA 4P3YA 3B6EA 4KBGA 5IF9A 1OXUA 4OK3A 5CDFA 1I4TD 4QBFA 4TYWA 3VKWA 3ZGXA 3T61A 1JXMA 5C18A 5DNYB 4DB2A 4UNNA 3QEJA 4L9SA 2BBOA 3GLHB 1YR7A 1Q1ZA 4JJZA 3AVWA 2IXGA 3AF3A 3SDZA 2QT1A 1SVKA 1S0UA 1EFRA 4A4DA 5CM9C 4DIDA 1F48A 1G8HA 4LBWA 4XTRA 5UKDA 3TW4A 2PH1A 2WAXA 3NH9A 4B48A 4DDTA 3C14C 1TADA 2JASA 1G17A 2C04A 1D9ZA 2AD1A 4ASUA 4Q9KA 1F3OA 2JEOA 3CUEF 1GDDA 1RJ9B 2IEZA 1E1RA 1ZNWA 2JDIA 3W6PA 1XTJA 1W0KD 4TL7A 3K0FB 5AJZA 4B74A 5JS8A 1CJKC 5DI9A 5FBVB 4LHZA 2HEIA 2R6GA 2OLJA 5DE3A 4QHTA 1LVGA 3U3MA 3UG6A 1OIXA 1U8AA 2NTYC 4XWOA 5J4LA 1G3RA 2BMJA 2AHOA 3IILA 4F93B 2P67A 2CCGA 1OFTA 2VHJA 2PT7A 2ZS7A 1Z6AA 1QHXA 4YC7A 2W6ID 2ONJA 4C0KA 2G77B 1TNDA 2J59A 4KI0A 2F1JA 1D8TA 4LJ6A 2AFIE 2A9KA 1XTQA 1N25A 2W6JD 2YWFA 2EFDB 1IXRC 4PHGA 1KAGA 1ZCBA 4NE2A 4RZUA 4G1UC 1KI8A 4IVQA 1A5TA 2A5GA 2BMFA 3FKQA 4RD1A 4BZQA 3U4QA 3LQRA 5DHAA 5FPTA 3WXMA 2IXEA 2H18A 2FGJA 4NP6A 4FMCB 4HYYA 4P33A 4G01B 4Q01A 1CJMA 5JJLA 4XVQA 2WWXA 4L8GA 1MRNA 4FCWA 4G5RA 5SZHB 1ZJ6A 2AN9A 1RFLA 3GQBA 5IK2A 2ZYUX 3OFNA 3R9XA 5BN4A 1MABA 3U44B 2HYDA 4LV6A 4RCYA 1X3SA 2FEOA 1OHHA 1YE8A 4NYMQ 3PFIA 2IYQA 3EARA 1AS0A 1VIAA 4P32A 4OQXA 1B23P 2V54A 1W36C 4IFEA 3K0EA 2XITA 4HAXA 4PZZA 1J8MF 3MG9A 3VR4A 2FU5C 1YRBA 5G41A 2RAPA 1QHIA 2BMDA 3GJ3A 2DFKB 2VP2A 2ZJAA 3RRZA 1N6RA 2UKDA 1I4LD 3ZS9A 2L0XA 1KK3A 3RRMA 3B8HA 3QKSA 3LXRA 5G3ZA 4DT1B 1NIJA 4I99A 5LB2A 4S35A 3I1FA 1KI2A 4D0GA 1ZNZA 2CLSA 2UVQA 1Z06A 4O3MA 4TMVA 3OESA 1RPZA 3BH6A 3QEOA 2FNAA 2VRWA 3B13B 3SNHA 3FPAA 3H2YA 2VL7A 1XD9A 4GRAA 4ILEA 3TKLA 2XSZA 1GZSA 4AY2A 3P27A 1M7BA 1TF5A 3W9YA 1ZUHA 1GNRA 4HATA 2IWRA 2REOA 3SU8A 5JJKA 2MMGA 5HR5A 3Q85A 5C4GB 1DVRA 2OAP1 3I5XA 2XZPA 3TAHA 4EPTA 1YZUA 3ZYCA 2PLFA 3AVTA 2JIZA 4PC2A 3NG1A 2OE2A 4UXJA 2WSSA 4HLUC 2WIAA 3KUDA 3U3RA 4KSBA 4BE7B 4IDOA 1NVWQ 2J87A 4LHWA 1K5GA 1ZM3A 5JS7A 5C1BA 3GLFE 5LPNA 1E9DA 4LBYA 4Q1CA 4TZ6A 1KTVA 5GJVC 1JB1A 5FOUA 5CIWA 1E2GA 1RRFA 3IO5A 2IS1A 1GAJA 4H1UA 4I1OA 1H8HA 1X8JA 2ZI5A 3U3OA 2PX3A 2QBYA 2XNSA 4A2WA 2NG1A 2QORA 1PUIA 4FWIB 2IXFA 2GZHA 2OUKA 1IY2A 1N0UA 2FEMA 1US8B 4IXNA 1ZU4A 3UG7A 5EP3A 4E03A 1P3JA 1KIMA 1OFHA 3VKGA 2W83A 3OAAA 1U98A 1U0LA 5LB4A 3AQ4A 2JLZA 4UXHA 4ZKEA 1OH5A 4Q66C 3BE4A 4W5JA 4DRZA 3A4NA 3GLHE 4TSFA 1CRPA 5EE0A 5KSZA 3CO5A 2BBSA 4URZR 1YZGA 1TQ2A 3RVBA 5CITA 3X1DA 5EUMA 4GZMA 1E99A 5CJ2A 4JVLA 1OW3B 4KYUA 4CYMA 5E95A 2W2VA 3SQXA 2ZIAA 2RHMA 4DCTA 4M53A 2CE2X 2J41A 2V8OA 1XD2A 2GBLA 5KNCA 3Q7QA 1XEFA 1A4RA 1GTVA 4G3XA 3WRYC 2WSMA 4FW9A 4FINA 1SVIA 1NKTA 4MRRA 2C5LA 1YR8A 2G3YA 3EZ9A 1YZNA 3GP8A 2FFBA 1JQJC 1SKYB 1P60A 2QI9C 1XMJA 3SHWA 4Q47A 1T91A 4LJ5A 4TWZA 3GLIA 2IUUA 4MUBA 3TK1A 4JSYA 1U81A 2O8FB 4P4TA 5L8VA 2LWIA 4NH0A 4BWYA 2ZQ5A 1DG3A 2FOLA 4LHVA 2JJ1A 1SKYE 2D7CA 4GZLA 2GF9A 1E6CA 5H8WA 3NC0C 2C03A 1J2JA 1E0SA 1MV5A 2PEYA 4JLOA 4DLSA 1XCGB 3EIQA 3WNBA 1Z6TA 2R2AA 4AKHA 1LV7A 2NO1A 1V43A 3AVOA 1GUAA 2OFOA 3I92A 4AWXA 1ZMXA 2QP9X 2ZRJA 4QOSA 3WBJA 4EIWA 1G19A 1TUIA 4JS0A 1E96A 1Z6GA 1DAFA 2DBYA 4TLBA 2YOHA 4MH0R 3OE7D 1WCV1 1FTSA 4X8OA 2R9VA 3MJHA 4WBSA 1OLOA 2ZROA 4B6EA 2EW1A 6Q21A 5KNDA 3VR1A 1W4RA 1VCOA 4QXAA 4TMWA 1VDZA 2RB4A 2X1VA 2ZVPX 3TR5A 2BKUA 4JLDA 3MLEA 3SYNA 4V03A 2CHVA 4D0LB 1WDTA 5KSOA 2BHRA 1OH6A 4LJ4A 1YJ5A 1RYHA 3EZ6A 1KI9A 1KJWA 3IPYA 3GLFA 4PPQA 3TRFA 3UMFA 3DDCA 4D6PA 4LPSA 2EFCB 3ZD7A 2Q0HA 1TL7C 4M9XA 3ZIAA 1AIPA 4ZI3A 1SVSA 3F8TA 5HZKA 3V4RA 1VIYA 1KI4A 4LJ9A 1P72A 4D4LA 5TMPA 1QHHB 4B2LA 1RJ9A 2GVDC 4RD0A 3VX4A 1HY3A 3HP1A 4LY6A 3ICEA 2WIBA 3ICQB 3B78A 1W0JD 4J0QA 1VCMA 3B60A 1T8TA 4EJSB 4FN5A 4NPHA 5D3MA 3H86A 1ZM2A 4YMVA 1DE0A 2ZJ2A 3C8UA 3GLIB 4NZYA 4ESHA 2RH5A 3BOSA 2ZUCA 3SQWA 1ZRHA 1COWD 2ZU6A 2GEDA 3F0TA 1C4OA 2J46A 3DO6A 1A2BA 3P20A 3MWLA 3UMSA 4C3ZA 4XSHA 4DCUA 4U02A 4MGYR 4DB4A 2IYWA 5B58C 3QOFA 4EQ6A 3D31A 1WB9A 1G21E 1E2PA 3UANA 4NYMR 3KZ1E 2IL1A 4CZ2A 3K0CC 3BRWD 1Q57A 1NBMD 1XXHA 4NU0A 4QNRA 2ZRNA 4KYIB 2WJHA 4FMCF 2IEYA 4NTZA 2MSDB 2Z6VA 4JSTA 4R7ZA 3SYLA 2ZJ5A 5DO9A 5EXSA 1MH1A 3KQNA 2ZJOA 2QAJA 3QBVA 3T34A 3C16C 1NL3A 4EKDA 4KFTA 5EXTA 2XTMA 2EQBA 3TVDA 2R65A 3KTAB 4B73A 1FUUA 4RFSA 3QIAA 4OJQA 1JAHA 3EAQA 3F5FA 5DLQC 4EFLA 3U6KA 2UZ3A 4D80A 4LGMA 4DHEA 2X2FA 3AVQA 4KXFB 4JBWA 3ADKA 2IHBA 3BJIC 1E4VA 2DCUA 2C9CA 4LJYA 1LFDB 1RYFA 2WWIA 2WMOB 5F2EA 3U4QB 5H70A 3KKNA 3R20A 1T5LA 3K0AA 5B30A 4QC2A 5FBLB 3EPKA 2IYSA 1D6JA 2ZRAA 3H4MA 2OZEA 2F55A 3PEUA 4D4JA 1QDEA 1M7GA 2AXNA 4BRUA 1CP2A 1M34E 2AKAB 1U90A 4FCVA 4LC1A 2N1BA 3RS2A 3KUCA 3AP1A 2DFNA 2VYFA 4OQNA 3ADBA 2GF0A 1JJ7A 4JBYA 1UEJA 3FB4A 2A7QA 1KI6A 4EPRA 5KUTA 2XGJA 1G41A 3LW7A 4Q9JA 1KNXA 5L3RA 1KZGB 2C2HA 4B76A 3EZ7A 1S3SA 4RSGA 2B92A 4GT1A 1KK0A 1DO2A 2C96A 2P6NA 4NYJQ 421PA 3G5UA 2ZXUA 1W0JA 3NC1C 1II8A 1R7RA 2GDJA 1RE0A 4PSKA 1TPZA 1OH7A 2KBEA 5FTMA 4TL9A 5EE3A 4OHWA 3WYGA 2XXAB 1XTSA 1ZU5A 5BW8A 1UPTA 4URVR 2J7KA 5C4MA 4KBFA 1XNJA 5FTKA 3PXGA 3DKPA 2R6DA 5HKKD 3AGQA 2R6AA 2VLIA 2WKPA 4GMDA 1G6OA 4A2QA 1RZ3A 4C0SA 4CEJB 1ZNYA 1F2UB 2ZUBA 4O25A 2D06A 2HUPA 4TMKA 3T5DA 3X1YA 2ERXA 4Q03A 2RGEA 3U60B 3CPJB 2DWPA 5B64A 1CRQA 1KI1A 4DDWA 1N6KA 2XOKD 2QG6A 2OBNA 2ZI9A 4XTCS 2XZLA 4V0OA 3VR2A 4DSOA 4Q7KA 5CM8B 1RVDA 2K5UA 1JI0A 2VPPA 3QF7A 5CK5A 2YOFA 3K70C 1R10A 2ZE8A 2B21A 4B2IA 1HUQA 1IXSB 3NVAA 4IDNA 1E9EA 3AUXA 1Z0JA 2EFEB 4LYHA 2DWQA 2ZU0C 1XMIA 3IEUA 3WP0A 3ASZA 2QQ0A 4F91B 3W8NA 2GEUA 3CWQA 2IYVA 3RDPA 4HB0A 4IJMA 3EPLA 1RKBA 2GZDA 4LI0A 4L16A 1JBKA 3U3JA 4D0NA 4Q4AA 4I81A 3RWMB 1ZBDA 3REGA 2RCNA 3LVRE 4TLCA 5LBIA 1A1VA 1FQKA 3ZDQA 3FMIA 3KTAA 1E2EA 4ZDKA 1V5WA 1G4UR 3FKSD 3L0IB 3PQCA 4MGIR 1UBCA 4DBLC 4M21A 4YMSA 1MO4A 4AD8A 3RAPR 2WWWA 4MYCA 4NKRA 4B75A 3RANA 4KVGA 1MT0A 1N5LA 3DVLA 2R62A 1LF5A 4HEJA 4ZDIA 1KO5A 3TGPA 5JI3E 1E0JA 3RABA 1N0WA 1UKYA 1JEDA 2ORIA 5AK0A 1JR3A 1E9FA 1N3BA 1Z0AA 2BKEA 1W7AA 1UDXA 2HJGA 1KSFX 3QKRA 2BC9A 1SXJA 4HI0E 3FFBA 1QG2A 5JWRA 1LB1B 5KHOC 5F98A 3W6NA 3Q72A 1Z47A 3K09A 4NONA 5CIQA 1N5KA 4E07A 1UM8A 5CB8A 4B71A 3CF2A 1AQYA 1W48A 2ZREA 1YVDA 3TSWA 2IBMA 721PA 4CF7A 5FPHA 2RMKA 3TVTA 2ODEA 2B8TA 2ODWA 3I3SR 2IYTA 3TJZA 2CHQA 3NBZC 4GNKA 5CK4A 1XB2A 2EFGA 1HT1E 1GL6A 1P75A 1E2NA 3K9HA 4KHZA 1GWNA 1HEIA 3KKMA 1FNNA 4OQFA 2Q3HA 1P6XA 2BBWA 3PENA 2WOJA 4RD3A 5FI0B 1QBKC 4DEXA 3OIYA 1NBMA 5J4VA 1NJGA 2BJWA 4HDOB 4M1KA 2FA9A 2YHSA 4TN1A 1VG9B 3BAFA 4FMBB 1C9KA 2O8BA 2B7CA 4XIGS 2WSSD 5DI3B 5FPKA 3HWSA 4PC3A 1X6VA 4ACAA 1E1RD 1WE2A 2JDID 2PJZA 3OFND 3SFZA 1NSTA 3O8RA 3LVQE 4UQOA 3B1WA 5AUOB 3A1TA 1Q0UA 3LY5A 4OL0A 2FWRA 3S1AB 2QSYA 4TTPA 5CLQA 2HJVA 4PO1A 3L0PA 2DFLA 3HYRA 1AS3A 2F7SA 2FZ4A 1D2EA 4LBVA 1TU3A 4Q02A 4R9UC 4Q4JA 3HR8A 4TSFD 4UNRA 521PA 3ND8A 4BFWA 2E87A 4LUCA 1F6BA 1KMHA 2P0EA 1ZVQA 4YDHB 5HE9A 3A1VA 3SJZA 1G8PA 2CXXA 4TTQA 4ZPXA 4NHOA 2D4HA 2Q9AA 2VEDA 4QL3A 1UDWA 3VMFA 3ZVLA 1QHNA 2ZJ8A 2WV9A 3LRPA 4FMDB 1KDPA 1XTIA 2Z5FA 3IPXA 3X2SA 2X77A 2FDCA 3U61B 2RGCA 2OEPA 1VG8A 2CDNA 2VQSA 1XMVA 3Q8XB 1HH4A 1ZYUA 1E1QD 1Z22A 1Z6XA 2QMOA 4D4KA 4M2LA 3EASA 2XB4A 1WP9A 1D2MA 2FFAA 4PPGA 4OI4A 2JJ2D 4LJ8A 2ZRIA 2OV2A 2QPAA 2VSFA 3IQXA 1KY2A 2VO1A 4Q7MB 1N5IA 3BB1A 4KLNA 1IN8A 4A0FA 2ZI7A 3QUSA 3QE0A 3EPHA 4ZV4A 1W4CA 2XJ4A 4US2R 4WW0A 2XZOA 4F4IA 3LD9A 4Z51A 2WM9B 3QPUA 3SR0A 4BUJA 4W5WA 1ZP6A 2NPFA 4MYUA 3FTQA 3TBKA 2ZYVX 1AN0A 4RD4A 1CTQA 1UFQA 5FL7D 2GXAA 3D3QA 3WBKA 1GKYA 4HLQB 2PCLA 4EAQA 3A37A 1GKIA 2ZRBA 3HU2A 2JLRA 1VG0B 2QY9A 4BLSA 3BB3A 4B3BA 3O8CA 3GLIE 1XX6A 2QM8A 2JLWA 1T5IA 1VYTA 3BD9A 2NGRA 4XWKA 3TAUA 4HAZA 2ZJBA 5K8TA 3AVYA 1NRJB 1DAEA 3QXSA 2JLVA 4FCTA 1ZUNB 4Q9LA 3QJYA 3AGPA 4MKFA 2FPLA 3ASYA 3TE6A 2YV5A 1Z07A 3PJRA 1KK2A 4G0NA 4U7DA 2D7DA 5JMTA 3ZIAD 4AYTA 1WA5A 5KU1A 1BMFA 4DSNA 2F9LA 1Q44A 2H17A 3EW9A 2BDTA 1P62B 5FI1B 3GFTA 3WP1B 2QAGB 4DIEA 2FSHA 2I4IA 2GXUA 2ZRFA 4BPBA 3SEAA 4IFBA 2ZTSA 5LD2C 3IEVA 1OH8A 5JLJA 1A82A 4Q48A 1JPJA 1N6LA 2GCNA 5L3SA 3C41J 4I4LA 4N1AA 4BFUA 5IK2D 3K9GA 3CRVA 1G6HA 3WMFA 2GNOA 4B47A 4K46A 3R9IA 4AIIA 1L7VC 2O0KA 1P9WA 4CEJA 2KBFA 3CONA 3Q3JB 4DC9A 4IVRA 2JA1A 3WNCA 3LLUA 1FTNA 1PZNA 2Z4RA 3VHXA 3AF2A 2WKRA 3DOEA 4TYNA 1SVLA 2QUZA 3BWDD 3ZVNA 1U9IA 3K0FA 2G1KA 3T1VA 4JBXA 3I61A 4R98A 4PXAA 3LQQA 1PLKA 3GLGB 3R8FA 4QJ4A 1OF1A 4LZZA 4IDPA 2W58A 2IK8A 4TMZA 4A6XA 1W4AA 2EYQA 3QXXA 3QPVA 1RC8A 1XWIA 4HUQB 1G291 4PQRA 4AYXA 2V1XA 2QMUA 3KJEA 3AH8A 1IHUA 1R5OA 1T0HB 3QF4B 4H1VA 2KJQA 3X1ZA 4DLZA 5KPDA 2DWOA 1AQUA 5HKKA 2ZI4A 1AGRA 2ZS9A 2V55B 1GOTA 2GJ9A 4X8HA 2FZLA 4AG5A 3OIUA 4ABYA 1CR4A 1XP8A 1T0JB 5CLLA 4ZCIA 2AXPA 4V0KA 2IYZA 2ANCA 3NBYC 4XVUA 3QXHA 1R0YA 4RZ2A 2YYZA 4C0LA 4AK9A 1CR1A 2F6RA 4MRNA 4X8LA 1Z08A 1Z83A 4GFDA 5GJCA 2E9SA 3BERA 3OF5A 3VNUA 5F9FA 1YR9A 3CB4A 4F38A 2W2XA 4M9QA 1NSFA 4CW7A 5FTNA 3FHTA 2WKQA 1ELOA 3IKJA 4HAVA 4R2IA 2QZ4A 2RGGA 4YXWA 3W34A 4FWTA 1G7CA 2G83A 4DUGA 5GVRA 4FXPA 2CJWB 1M7HA 2ZYTX 4M22A 4NCIA 2CVHA 1GVNB 3U7FB 3I72A 4TYQA 2WPDD 2CCJA 1VCNA 3OAAD 1JR3D 2DYKA 1R0XA 4WVFA 1IM2A 3OZXA 2QGNA 1DS6A 1N6HA 2G6BA 4OI0A 1GITA 2ZS8A 2CBZA 3K70B 2MSEB 5BXQC 4G5QA 1KO4A 1EGAA 1NVUQ 2SHKA 1G18A 2NPIA 4DLXA 4JIMA 4HB2A 1KZ7B 3LX5A 1GFIA 1DG1G 2QM7A 1OKKA 4A92A 1Q20A 2OO7A 1DADA 4D4MA 4HZIA 4N3NA 4DKXA 1NVVR 3SJAA 4R71A 3CRMA 1HQCA 2JIZD 2JCSA 3A4MA 2IS4A 2HLDA 2BJVA 3B7GA 3IO3A 4MYHA 4U00A 2BVNA 1TUEA 3THXA 2BM1A 3PUZA 1KSGA 5KYKA 2YINC 3KL4A 4M1OA 2WVJA 3DHWC 4V0LA 3PVSA 3R8CA 4QGHA 4OHYA 1NVVQ 2NMVA 3DM9B 4EFMA 3BBPA 2ZSAA 4BFTA 1U0JA 3RS0A 3GLGE 2XOKA 3LXXA 2I3BA 5DSZA 2X2EA 2H57A 2ZE5A 3C15C 1E79D 3Q5EA 3K8YA 2OFXA 3QBTA 4GP6A 5EP2A 5FR2A 3PCRB 1IJFA 5JHHB 4DSTA 4PO8A 3MCAA 1IN6A 4KSCA 1CF4A 1TQ6A 3NHBA 1LF0A 3C4JA 4BASA 2F1IA 4QJ3A 3EX7C 3FGNA 2PJRA 3BFVA 2J0UA 1FNMA 5C46F 4UJ5A 2OXRA 2FFQA 2WMNB 5E4FA 4ERNA 5AUNB 5L3SB 4IDHA 2ZANA 4Q4LA 2D74A 3AP2A 2AWNA 3QPWA 2JLQA 3KQKA 2XTNA 5JCPA 4WAUA 2XXAA 2ZRMA 3QG1A 2A5DA 4ESVA 2RGDA 5B57C 1G8FA 1OFIA 4HDCA 4NDZA 4G5SA 2JLXA 1XJ0A 1MR3F 5CYPA 4IOKA 2V6IA 2H92A 5L3VA 4W7SA 1EX6A 3CW2A 4D82A 2XEXA 3EC1A 5FTLA 2AKYA 1SULA 5EZ5A 4Z8YA 4TZ0A 1YU9A 3WHKA 3MJRA 5KTYA 5J40A 1Z5ZA 1FUKA 5FUVA 1SHKA 4WXPA 2CL0X 4K8OA 3WMEA 4ARZB 3DKVA 1VPLA 2A5JA 2VP9A 1DELA 2C9YA 4GI7A 4LJ7A 3K1JA 4UJ3A 2QA5A 2WWYA 5EJEA 2QSZA 1L8QA 1WF3A 1D2NA 5EQTA 4DCVA 1LNZA 1Z2CA 4NBSA 5FPYA 2WJGA 4B3FX 2VSOA 2GEVA 4DVGA 1J70A 3THWA 2QROA 2O8DB 2J7PD 4XWAA 4TT3D 1RRPA 4LV5B 1KSJA 1T8UA 1E9RA 3VU9B 1DOAA 3NTUA 1KKLA 4JL6A 3FVQA 3A1WA 5A0FA 3M0EA 4C30A 1ZIOA 2YZ2A 3QSYA 3O47A 3B9PA 4A0RA 2CCKA 3PG5A 4IOMA 4CGZA 1OJLA 1OSNA 2GILA 4RFSB 1XCMA 2ODNA 3GJ5A 5DYIA 2ZE6A 3IBGA 3L8ZA 1NN3A 4QNMA 2OG2A 3B2EA 3LBIA 1R8SA 4NMMA 3QKSB 1FP6A 1KJYA 3WHLA 1XU4A 5G40A 1CJVC 3DZ8A 4NCHA 2XX3A 2QTVB 2VHQA 1HTWA 3QKUA 2GJAA 4MKHA 3LAWA 1GL7A 3WNDA 1Y63A 2WWGA 4M1YA 1KNQA 1E69A 4KV9A 1EX7A 5JRZA 4P4SB 4E09A 3TUZC 2VF7A 3U5ZB 3U6BA 1QF9A 3OHMA 2RHDA 3P4YA 2CLCX 2ZEJA 1W5TA 3GFPA 3LW8A 2G88A 1UKVY 1MABB 3U44A 3RNLA 2QL6A 3KFXA 2OLKA 2BCGY 1R2QA 2GBLC 4URUR 2C99A 1LS6A 3GJXC 2IYYA 1ZINA 1BYUA 4JVMA 3K09C 2E1RA 4JVSB 2BMEA 4Q4HB 4KFSA 2J45A 4BLRA 2OBLA 4URWR 3TH5A 1SXJD 4KO8A 1HE8B 1DO0A 4LK2A 1IY0A 2C8VA 2EWVA 2ZAOA 1G16A 4P0TA 1NLZA 5FL7A 4OI1A 5J4HA 2HF8A 3FE2A 4EJSA 4Q18A 2P5SA 4AKEA 3CPHA 1VG1A 3N70A 4C2UA 4PZLA 2H1LA 5KO2A 3W5IA 3T15A 2QNRA 2NQ2C 121PA 2FPMA 1S1CA 1BOFA 2A2ZA 2Z0MA 1Q1EA 1NLFA 5JHGB 1S1MA 4CEHA 1KMQA 5E7MA 4GPTA 5TARA 4DLRA 2ERYA 4LHYA 3A1SA 3ECCA 2DPXA 3EIHA 2QRZA 2R6FA 4BFZA 2WJIA 3T1QA 1M8PA 1ZM7A 3T5GA 5FUXA 2ZRCA 1MO6A 1P73A 4C0BA 1TQDA 4C0JA 2VA8A 4B33A 1N2CE 1Z0DA 3OEED 1XZPA 1KSHA 3PEYA 3GJ0A 2LKCA 4GL2A 3NIBA 2G0TA 5CJPA 3K53A 1MO3A 2ZJYA 2ZYWX 2YC2C 3BC1A 2FSFA 2OESA 3RS3A 1WQ1R 4F4JA 1KHTA 4RKFA 3IIMA 1OKKD 1OT3A 1S3GA 4TTRA 1TQ4A 1E2FA 4XSGA 1OXVA 4A1FA 4TQ9A 3BGWA 1DBSA 1E2DA 2H8KA 3EA0A 1J99A 1E94E 1GKUB 1OB2A 2HDNB 5DI3A 2V1UA 1BH2A 1XDBA 3D7MA 3E5HA 3JZMA 1CR2A 3OE7A 2H16A 2VHUA 1GIAA 2GXSA 3A36A 3EG5A 4QBGB 3GEIA 4WZ6A 2F1RA 2W2TA 4ZCLA 3TNFA 4MQBA 4EUNA 1JEEA 5KSYA 1N6PA 4OI2A 3CRRA 2VF8A 2AK2A 2OCBA 4RVCA 3A1UA 3ND9A 4EPVA 2PLRA 4LSGA 2O8FA 3DZDA 4BLOA 3GJ4A 1SXJB 2B8WA 3BXZA 1R8QA 4MKIA 4GDFA 4B2PA 3MGCA 4TQAA 2Q9BA 1FW6A 4KCGA 1XEXB 3CRQA 1BMFD 3VTKA 4Z1MD 3KB1A 5FBRB 821PA 1U0HC 1KI6B 2IWHA 4QRHA 2O8DA 3EC2A 4FIDA 4CRWB 4WZAE 1G64A 4OJKA 2PBRA 1EFHA 1VYUA 2PX0A 4JT2A 4KFUA 3LBNA 4DLTA 4ZIRA 2TMKA 1IJEA 1VHLA 5F3WB 4DWJA 3PUWA 3RS7A 3BB4A 4NCKA 3LLMA 1E9CA 1G5TA 2OSBA 2VP0A 2ZPTX 4A6PA 3K0AB 3I5YA 1Z28A 4DEYA 3CIOA 3MWJA 3N2IA 3G82C 1IBRA 2JLYA 2FV8A 2IUSA 5AUPB 5GVSA 1DAMA 3PIRA 4TYYA 2W00A 3HPQA 3JZAA 2ZAMA 3TSOA 1ZD1A 1G3QA 3BH7A 4PSAA 2X8AA 2AL7A 3W6OA 3BFKA 3KQLA 3CF6R 2R6CA 1OIVA 1Z29A 2YOGA 5H1YA 3TMKA 4Z1MA 2BOVA 4HZUA 2QAGA 1Q12A 2EWWA 2ZSFA 3THYA 4DDVA 4PAOA 2XB2A 1ZD9A 4HLCA 3HJNA 1JAIA 4DUGD 3CR7A 3LO5A 4C0AC 2WTUA 3IDQA 4F4CA 4C7OB 1L4YA 1NLYA 2IYUA 4Z8XA 3IHWA 1WBBA 2ANBA 4Q00A 1E9SA 2J0UB 4B44A 3I32A 5FUYA 3AKDA 4RY2A 4FD2A 2YWEA 4BZPA 3GPLA 2VH5R 3NEYA 5HZHA 1KDRA 1XPOA 4JLMA 3VR3A 2CEAA 5K8LA 1XD2B 4YMUA 4KLZA 4QBHA 2WHXA 2XNDA 2GHIA 1ESNA 1Q3HA 4IOJA 4JL5A 4PFSA 4DLVA 1XXHE 1S8FA 4TLAA 2GJ8A 4XD7D 2GJKA 2XSZD 5JZVA 3KX2A 5E7IA 3V4FA 5AJVB 1F2UA 1P9NA 3EXAA 3KXKA 3AVPA 4F7WA 3AUYA 4CIDA 2CK3A 2ZRGA 4DSUA 1Z63A 2KB0A 1WBDA 1KYIA 3QF4A 2ZRKA 5JSZA 1CIPA 1COWA 5DGXA 5J4KA 1M74A 4PTLA 3TSZA 4O2LA 3WY9A 5F9HA 3LNCA 3THYB 3J81k 1E98A 3EPJA 2NIPA 3BH0A 4A8JB 4XH9B 3NBXX 3OIWA 2I1QA 4RZXA 4Q5IA 2G0NA 4GMXA 2HYIC 4YMTA 3ADCA 2O0HA 4QG7A 1JECA 1GNPA 3MWYW 1P5ZB 4LOAA 5IT5A 5AUQA 3IGFA 4BRWA 2A30A 1G7RA 3AEZA 3TR0A 1HQYE 4HLUA 3FMFA 1XPUA 1E1QA 4LJAA 2F3RA 4Q7LA 5FPSA 1EESA 3D6TB 1D9XA 5CB6A 1NN0A 4RFVA 4EDHA 5GJBA 1JJVA 2JLUA 3KXLA 1OXXK 3UWKA 2OT3B 3P1JA 1NP6A 1T3SA 3LA6A 4US0R 5BYJA 5BYKA 1DPFA 1XZQA 4I1VA 3E70C 1TF7A 1N0VC 2YKGA 1G4AE 4N0DA 3MSXA 2JJ2A 1ZCAA 3CNNA 2D2EA 1HT2E 3FWYA 1DEKA 4MA4A 4A82A 2PL3A 1XRJA 4IEEA 3GMTA 4RZ3A 3CX6A 3MMPA 3SZRA 4Q1DA 3GD7A 1T4GA 1X1RA 1TF2A 4UNQA 3GCGA 3ZH9B 3CLVA 4WXRA 1XEWY 3GJ7A 1W4BA 3CBQA 4PAMA 2NO7A 3HR7A 4MGZR 3G0HA 3M4YA 4GOXA 3RWOA 1Z2AA 1T3LA 4B34A 1H8EA 1KI7A 2J0SA 4V02A 1EXMA 2JJ1D 3VFDA 4UKDA 4OYHA 3SBEA 1EWQA 1QRAA 1DAHA 2CVFA 1QHHA 1TMKA 1MRSA 2QPOA 2VBCA 4JLBA 2QTHA 2NZJA 4LYJA 4V0ME 4M1MA 2QT0A 5M04A 2DR3A 1S4QA 3B1VA 2VSXA 4QGFA 5D3QA 4ACBA 2KWIA 2OXCA 1KKMA 4M8NE 3ZZTA 4Q4JB 4BLPA 2ATXA 1J7KA 1OXSC 4Q1AA 1Z0KA 2AFHE 1IONA 5E7JA 4JYBA 4URXR 5DHFA 1F2TA 1DAGA 1G9XA 2DHRA 1KDTA 4B3GA 1W0KA 3GJ6A 1KOFA 1W36B 5ELXA 4D25A 4C7OA 3THXB 1XD8A 2O5VA 3QENA 4HUQA 4D2IA 4WIAA 5LDDC 5KSPA 1JALA 3AVXA 4EQ6B 3LBHA 1I2DA 4KODA 1LTQA 1SXJC 2R44A 4AG6A 3L0SA 2Y8EA 3PUYA 5KNBA 3T06B 2VHCA 4MGKR 2OFWA 2W0MA 2GRJA 1OE0A 1YR6A 4C0QC 4OBEA 4YONB 4NL4H 5FTJA 5HPYB 3L82B 5FOXA 1MOZA 2FE4A 2QAGC 4QJ5A 3W90A 4ASUD 4H9GA 1OFUX 3I8SA 3L8YA 3IHLA 1E2MA 4JLKA 2BCJQ 3KKQA 4G5GA 1E79A 1ZM4A 2CK3D 2KE5A 3GLHA 5FOVA 3T12A 4RKEA 8OHMA 1AKEA 1XTKA 2P5TB 3UXMA 1R5BA 1IQPA 3ZS8A 1JPNA 2QE7A 2P6RA 1TU4A 1II9A 2LKDA 4PC7A 3K0SA 3CF0A 1IAQA 5DISB 3TUIC 3KQUA 3RC3A 2BEJA 4KU4A 4QM7A 4C2TA 4QKQA 2HLDD 4E5UA 1AJEA 1W1WA 5JJIA 2O8CA 4BLTA 1KDOA 4BLQA 1Q1QA 2CNWD 2JATA 4RD2A 2IHYA 2IS6A 2ZR0A 1Y3AA 1D5CA 3UK6A 4AKIA 5K8IA 4Q9IA 2IA5A 5JI2E 2QMEA 3ZVRA 5KOYA 2BIFA 2ZI6A 4PC1A 4ZDWA 3BORA 3TW8B 5AWFC 3NKVA 1R5NA 2OILA 1G7SA 3SFVA 2ZRHA 1FX0A 1SVMA 2YNMA 1DTSA 2ASEA 3CKLA 4JLNA 5TY0A 2FJUA 1EWRA 2AD5A 2WBLC 3CWZA 1G7TA 3CRW1 3QQ5A 1BKDR 2AWOA 3ZZUA 4AC9A 2PCJA 1GNQA 1EG7A 4PQYA 4QFMA 5EE1A 4A0HA 2RKOA 1CULC 3AVUA 1KY3A 2Q21A 1VHTA 3HPRA 3RRYA 3B82A 4FI3C 1N5JA 2GJSA 3PITA 4JLVA 3RYTC 4A8JC 1CXZA 2PMDA 4OHVA 2DB3A 3T1TA 1KI3A 1SZPA 3TUJC 2BWJA 3IIJA 3QXCA 2GAAA 4TLEA 1GSIA 1KAOA 2F43A 3D8BA 4B43A 2A3RA 4C0HA 1W46A 2YWHA 3QXJA 2MMCA 2O8CB 3Q5DA 3PEWA 1F2TB 4RCZA 1J8YF 1E9AA 4LV8B 2JJ8A 1UKZA 3KJHA 2KI5A 3NDBB 1P2TA 1CJUC 3OEEA 1SXJE 2WJYA 4WOPA 1OV4A 3P4XA 2OHFA 1KO1A 1NG1A 2GKSA 4IXMA 3ZLJA 2OAQ1 2Q9CA 5SZIA 2YWGA 2ODBA 1E2HA 3UKDA 5IRCD 4DLYA 4OHXA 1S96A 4EPYA 5BQ5A 4JMPA 4CT4B 4JVNA 3NXSA 3AM1A 1T6NA 4HB3A 4BFSA 4QGAA 5B2ZA 4II7A 5FBQB 3C5CA 3W3ZB 1AM4D 4QHSA 1ZD8A 1NVXQ 3ONWA 3PEVA 1HA3A 2ORWA 5BN3A 3T1OA 3VNVA 1L2TA 1ZNXA 3MRSA 2WPDA 4HAYA 4L5BA 5CYOA 1X86B 2GESA 3KJIA 1ODFA 2LCFA 3NHAA 4PPNA 2IYLD 4LHXA 4IOLA 2HF9A 2O8BB 3THWB 1P7CA 4HAUA 2IUTA 4L15A 4TL6A 1OYWA 1US8A 4X8MA 3B9QA 1H65A 4PX9A 1T9HA 1W44A 1GRQA 3H0KA 1NBME 4LCBA 2CJWA 5KDLA 1I2MA 3ZZ0A 4DCSA 4IW3B 3I73A 4LYFA 4ARZA 1X8KA 5KDDA 1RIFA 5G3YA 1CU1A 1MO5A 1VKJA 1I4DD 2W6IA 5AJYA 5FR1A 5JWHA 1R0WA 1YRAA 1IN4A 2HCBA 1E3MA 1BYIA 3LH5A 2BBTA 4L9WA 2ZJZA 1E32A 1JR6A 2FX3A 2GETA 4TYPA 2GA8A 3JVVA 1ZIPA 4A2PA 3KKPA 2FSIA 3N5CA 4E22A 2IF2A 3L43A 4JLAA 1P2SA 2BM0A 3PUXA 5FL3A 2Q6TA 2R8RA 5HCNA 1YZKA 2J1LA 4PSVA 1OHHD 3EZFA 2MSCB 3GEHA 3AKYA 3Q7PA 4Q19A 3QVUA 2EFHB 4ON9A 3N2EA 1HV8A 4Z54A 4D26A 5G53C 3A4LA 1H8ED 2A5YB 2DFTA 3EZ2A 2QN6A 1AA9A 1K8RA 1FL9A 2V4ZA 4BZXA 1NKSA 2J9RA 2AK3A 3RSOA 1N6NA 4Y0VA 4LBZA 2VHTA 1DARA 1EFCA 1TEXA 4YLGA 4CEHB 5TDHA 4M0LA 1PLJA 3SHFA 1WXQA 4Q1EA 5JWOA 1P9RA 3KB2A 4B3DA 3RRNA 1UF9A 1RRCA 2WJVA 5A5GA 1FZQA 1N6OA 2HT6A 3TIFA 1G8GA 1M2OB 2RGBA 3BFXA 3HU3A 1C1YA 1QHYA 3UIEA 1EK0A 1KJZA 2REBA 1II0A 1OYYA 1OXTA 2GXQA 2O8EB 1BIFA 3REFA 3CPEA 4MRVA 5EP1A 2QP3A 3T35A 2G1JA 2ECKA 4BFVA 2P2LA 4JYCA 5K8UA 4QHYA 1Z8FA 1SVWA 1VECA 1VYVA 1U2RA 3U7EB 1G3MA 2HXSA 2QTFA 1QG4A 1FMJA
chains in the Genus database with same CATH superfamily
3AMVA 1YI0A 3KZOA 3P52A 2BTQB 3QFCA 5E9AA 2OBMA 4KAXA 4F6LA 1Q1BA 3TQHA 2D59A 1WETA 4OLFA 4P4UA 3T4XA 3IULA 4EATA 2CB0A 3NM6B 2GCGA 3PS9A 1RRGA 1G38A 4FC6A 4KMOA 2HKIA 1PFWA 2Y93A 4LZJA 1DDOA 3VOTA 1PZXA 2FN4A 2X4GA 2YS7A 3E9RA 4JB3A 1JJFA 2VZEA 3NTLA 4PPFA 1EP9A 5A9SA 1I7NA 4ITRC 4FMDF 3RS5A 2YJTD 3K6SA 5DXJA 2WZBA 3DMHA 4K7JA 2O8NA 4MVJM 3S99A 4BQEA 2F62A 3SJBA 4HGNA 4RUKA 4RWEA 3P0FA 2VEOA 5DNVA 3ILYA 3F49S 3RIEA 4EUFA 4M98A 2PGAA 1CUYA 1FQJA 2EIXA 3W2HA 5D7NA 3SOPA 2H4FA 1YC2A 5ILQA 3U40A 5AK3A 2PM8A 6REQB 2MU1A 5JBIA 3PGKA 3W3AD 2P6UA 1M10A 2Z56A 3E7DA 4EX6A 1XBTA 2V7XA 3JQQA 4PY2A 4CM4B 2G9NA 5CLJA 9LDBA 1J0DA 5FWDA 3QVGB 3RUDA 3U3KA 4PONA 1C0KA 4C3OB 4CF5A 1KO7A 4F9EA 4UMDA 4YJ2F 5H3HA 1JDJA 2CDRA 4LSWA 1JAYA 1XLWA 2B6HA 3IPLA 5EUQB 5JZMA 3OPYB 1EWVA 1PJ2A 4RTSA 1RVV1 3D4BA 3UATA 3GT3A 3DVAB 4F92B 1IHPA 5JQGF 2WUEA 2Q0QA 5F3DA 1HLDA 1QVAA 2GCIA 3DCJA 5HE8A 2OQIA 3CZPA 3LQ1A 4L8LA 3KVOA 5CHEA 5EJIA 4LZAA 4EHIA 4N7BA 1E9BA 2A78A 1Z0SA 3GMIA 2P41A 3QITA 2YJNA 3V42A 5DB4A 3PLNA 5E8JA 3H5AA 3GEDA 4PG7A 4YI5A 4ZAZA 4YNBA 3SHTA 1OI7A 4FZJA 2JLSA 2F3TA 1S9HA 2EYUA 3L0OA 4BTEA 3BMOB 2Z3VA 2V7VA 2PGOA 3H75A 3IH5A 5LXTF 2RSLA 2REXB 3OPNA 1WUHS 4YR7A 4YWJA 3IPAA 1OT5A 5JSUA 4NAVA 2JZNA 3DPUA 4LW8A 1OREA 3LOQA 4F5EA 2OHJA 3QBJA 1TM7E 3DBOB 2I91A 4RL4A 1J5PA 1W93A 1OX5A 3AZPA 4DV0B 3ZU4A 5EKDA 3OF2A 5CU7A 3B1ZA 5EXPA 4ZYVA 1ULBA 2QQ5A 1K7SN 3BWCA 2QRNA 4Z99A 3DM5A 3ZD6A 1U0BB 5B1DA 3WS7A 5BORA 4K9PA 4OVKA 4NMLA 1U0NA 3H9JA 3N6XA 2JHPA 3CJRA 4FYJA 4HK4A 3ZLBA 4UBKA 2ZR9A 3BXPA 3ZZMA 3L7MA 3TTXA 2VTKA 1CQWA 3UOWA 3RI3A 1YL6A 2WIFA 3FLEA 5KPJA 4EEZA 5EIEA 3ND5A 2IHKA 2H1IA 2AR7A 3CCBA 3H9BA 4HS4A 3WOVA 2G8LA 4OAOA 2K87A 5JY6A 3QE2A 2I7TA 1T0BA 2CY0A 3NCHA 3B38A 4O0MA 5FOWA 4GLOA 2I62A 9ABPA 3PJEA 3MQ2A 2QE7D 5B3JC 1JA0A 1SGWA 4UZFA 3MWKA 5KQLA 3UKJA 1XDWA 3L7CA 2PX4A 2D5AA 4XIJA 1DT3A 3BKWA 3L1UA 4I08A 2Y6UA 3QLVC 4ZAGA 3RSLA 1A71A 4LHSA 4JUAA 1MRZA 1EFUA 2QM3A 2QQFA 1T0UA 2BEVA 3JRWA 5KKNB 5YASA 1NPTO 5FFMA 1WR8A 4B46A 3NPAA 2C78A 1I3LA 1NN1A 3QLUC 4MVWA 4EBFA 5AVSA 1EK1A 1J0CA 2XCSB 2WU3A 1W85B 3MERA 4C2BA 1P18A 2P7IA 3AIKA 4WA7A 5HZMA 1J9EA 1K4KA 2HMYB 5AXDA 3W5JA 1G3IA 2LCQA 3MWEA 2BI4A 4P1ZA 3EISA 1W2HA 1R0CA 1T2EA 2W6JA 1F5SA 4RE6A 2FQXA 4O4HF 4TQGA 2X5OA 4YMWA 5E1MA 4ZYZA 3DVSX 4H3SA 2QMHA 4Y2PA 1L4FA 5FUQA 5HCIA 2QMYA 1E7SA 1HL7A 2ZJ3A 2JFWA 1DWOA 2O23A 2VAXA 4HH3C 1QGUB 4XVRA 4QUBA 4A0GA 3W7AA 1O95A 3OOEA 2AOUA 4B3MB 3GXOA 2ZRLA 3K15A 4KDCA 5CFZA 4WBNA 5LNK1 2DGDA 4OTZA 3WNQA 3BGVA 3PLRA 4ZPJA 1PV4A 2FK7A 4YT5A 1CEEA 1G2QA 1UQUA 2C2WA 1M75A 3BHMA 3BTSA 4UC0A 3UHAA 4YUWA 2FQ1A 5EL0A 5F4BA 1I9GA 3KQHA 1EH5A 3E1GA 1XI2A 3HYTA 4MKGA 3UM9A 2IBSA 3VVBA 4M1SA 4ETMA 3WMGA 1SQ5A 4HRYA 4NBVA 4U1RA 2HWXA 3D7KA 4KXLA 4AKSA 3X2EA 5C8YB 5HRUA 4IDBA 2GCOA 1VPEA 2HHCA 2E4ZA 4BGIA 2Z6AA 4ARUA 4BRZA 3K9LA 1KRXA 1USGA 3E58A 3U19A 3D3KA 2HA2A 3R4CA 3DPIA 2Q45A 1K8ZB 2NYVA 2KHZA 3BWMA 5DGDA 3TB6A 4WBNF 5A3QA 4BKRA 2I80A 4YJGB 1E2JA 2EC5A 2Q99A 3EXEA 4HEQA 1BDMA 1RHMA 1CRZA 1QPBA 2E5WA 4JP3A 3KEFA 3V00A 2CUTA 3D0KA 4CN9A 4LF5B 4D92A 4L0MA 3REQB 4E13A 4EPWA 1NULA 4IQ0A 4ZU6X 4P22A 1A4IA 2WWFA 1ZITA 5BQFA 2QS9A 3FHOA 4DC1A 2YS6A 3K0CA 1GRRA 1RWVA 4J16A 1TT5B 2Y0BA 3IAUA 4NWIA 3O83A 1FDVA 1ODJA 2WWVD 1WV1A 3OOYA 3EFHA 3QNUA 2J0QA 5L7WA 2UYOA 3N59A 3WTBA 5T3YA 4EY5A 1LLFA 1TVCA 3V8MA 5AVQA 3HDQA 1NMSA 5DLYA 3V4PB 2KLHA 3IHTA 3RGGA 2W2KA 1BHQ1 1SC4A 5KREA 1KZ6A 1Z75A 4IHQA 3RT7A 4Q7EA 1ZHHA 1DUSA 2HWWA 3PL1A 4NS1A 3TLXA 1PLLA 4II2A 4JL8A 3TQFA 2P4QA 4IV8A 3I30X 4UM7A 5BXYA 2D2XA 4JQSA 1SM4A 4BX8A 3U0BA 2NWQA 3VKHA 1E7RA 4DTIA 1KIFA 2NYAA 3A3OA 4G1CA 1TEZA 4IGAA 3PNQA 5BO5A 4ZOBA 4TWJA 1FP7A 1KVUA 2O1WA 3VC2A 3EWAA 3TIGA 3UC5A 3WGVA 5ED4A 2VYVA 1NJ5A 4B4UA 2WAYA 2UYQA 3LRXA 4F71A 4HDSB 2PUJA 1ZMOA 1P4SA 2FW0A 4JJKA 4AJOA 3MN1A 4PAGA 4MI1A 4CT0A 3NXKA 3L2OB 1KVQA 4NESA 3PFNA 4Q9HA 4O33A 1U8XX 5JNSA 1L4KA 3ESQA 1T0PA 1YHZA 4X41A 4K0RA 2WQ6A 1I5EA 3G2QA 2FF7A 3NORA 2G1AA 4KI7A 1NU8A 2B7BA 2FSPA 2QGFA 1PE0A 4KOAA 2BGLA 3OIVA 1XFAA 4YFVA 5KNDD 2AEFA 3KOUA 3EEOA 3ZCPA 3ZJTA 3IUYA 1BHO1 2NSHA 3RARA 4LF6B 4M1QA 1P44A 4YRBA 3FOZA 4RAOA 1SQ0A 1RZRD 1XTRA 5AQEA 1XSEA 4I14A 2GBIA 2V4MA 2WU0A 2JK1A 2Z4TA 2J30A 3SF0A 3TNJA 1NF9A 1X1DA 1C7JA 4V0QA 4Y2QA 4KPFC 1PTJA 4F8JA 1BQEA 3NM5A 3TLMA 1R6BX 4P34A 4UXIA 4M37A 2WJ4A 4Y2RA 5ER9A 5T6MA 4WCFB 4CFYA 6REQA 3OEHA 1A8PA 4RIEA 3D3NA 1I6LA 3H7AA 1LK5A 4QDKA 1Z4LA 2BUCA 3CNBA 4AZ3B 1JNYA 2NV0A 1E4YA 2YR0A 4GHWA 3KJNA 4PR0A 3UVEA 1IN5A 4RGYA 1B76A 2NW6A 3EMBA 4P92A 5AQ1A 3GHYA 1OPXA 2PZFA 3KEGA 1V8OA 4MWSA 1S9DA 4UFPA 1V5GA 3ZDZB 2OAGA 1O03A 4JFAA 4V0NA 1Z4PX 3IERA 2YJ3A 4JLUA 4O2BA 2NZWA 4JZKA 2IF0A 1OZAA 2TSYB 4R69A 2Y3IA 3DLPX 4H31A 2O8EA 2IOFA 4PHFA 1SNYA 3H8VA 5C1PA 5BVHA 3QY0A 1W36D 2CFIA 3GPDG 1XRNA 2Y92A 3X3HA 1IMOA 1RI4A 2V3CC 1FS4A 2QRVB 3DYIA 3HVUA 1O87A 4HAWA 2WQZA 4BNZA 4NR0A 4MRPA 1Q14A 2NZ8A 1PUXA 2C77A 2JANA 3ZW8A 5IANA 5LD2B 1FP4A 4QTZA 4C21A 4ZI7F 3UO8B 4YJDA 4C9BA 2WJAA 2HGSA 2R7MA 1QYVA 3O4GA 2JAQA 3EGIA 2PMEA 3UAXA 3ZE1B 2P1DA 5F7ZA 2JGFA 3M7IA 2PJDA 3WRYA 2ACEA 2DE0X 2EJCA 3TLJA 5LFAA 1W5BA 1JXOA 2J9GA 5LA6A 2RAUA 3I01A 2QD1A 5I9SA 1CJTC 2P9EA 1P8JA 3AF4A 2QY6A 2QNIA 2R86A 3QWIA 4GWLA 1GNSA 4RY9A 4E2FA 4KNWA 4HAIA 3W06A 2AQIA 1EK2A 3U4IA 3IBYA 4OSOA 2AFRA 4D3ZA 4INOA 3ACBA 1XXHB 1E5TA 3M49A 4CT5A 2YWXA 3VZQA 2WP8J 3G0GA 3NT5A 3ENWA 4OQMA 2P3OA 4U2BA 3M3PA 3DHNA 1JLHA 5FF9A 3A58B 2QQEA 5BSMA 3CR8A 3RK1A 3N86A 3QW4B 3TQCA 2N46A 4B0OA 2YXNA 1I6KA 2VP6A 3HUEA 1RJGA 4J0FA 4KX5A 1LBEA 1G20E 3R7NA 1J07A 3R8XA 4JJAA 3B6KA 1W29A 2V3VA 2AMLA 4HN9A 1VL1A 2VRCD 5KYGA 1ICEA 3GLSA 2XUIA 4G84A 4R4JA 3L04A 3LCMA 3STWA 4PYJA 3KSBC 1WBBA 5ALMA 5EE9A 1YB4A 4PZUA 4AUKA 2BM9A 2E21A 2YYSA 3OD5A 1NG9A 3TTYA 3DL4A 2WG1A 1NM5A 2VF5X 4RKWA 1HDCA 3TTTA 3HBJA 2WD8A 1VJCA 1I5RA 5CT6A 4KPUB 3TNLA 1N7JA 1PS0A 5AM4A 2YC4C 4ALLA 3OCXA 1Y6FA 2DUJA 5EZQA 3EAGA 5FOSA 1QDLB 5C7LO 5JXGA 1PJAA 2J5XA 2ZJFA 2JI6A 3IT3A 4OHUA 4AAYA 3FZNA 2ONKA 2E6UX 2NO6A 2NX2A 4DT1A 4O4IF 4RV4A 1CZNA 3LY7A 4PHTA 3JX9A 3TZKA 4DJTA 3UWOA 1JQLB 3BGSA 4DLAA 2AB0A 3PYLA 5TNXA 4WZBE 3SDBA 4A91A 2XWPA 4JWKA 2XTZA 1T9BA 2HCTA 3K4QA 4MP8A 4IKPA 3WLRA 1W96A 2JH8A 3GZ4A 3HN7A 4RKQA 1EM6A 4Q6BA 5L4SA 3LNTA 3MPOA 1D2RA 2PT5A 3FTDA 4P36A 4DGSA 1ZAKA 2OO3A 4LMBA 1L4UA 1AKYA 1YDHA 3R0VA 5CCDA 5E3HA 3DBRA 4GUAA 1QZ3A 1E7WA 4IH1A 3WJAA 2YVUA 1VMKA 2A9OA 3FMOB 3A6DA 1J90A 4Q7JB 5EFZA 5FEUA 4QPJC 5LLDA 3ETLA 4L8WB 4O1HA 1ISSA 5FBWB 1LD3A 4R40A 4B6OA 3A6PC 3OCZA 3W2FA 1Z5WA 4UARA 2HO5A 4XM2A 2OPHA 5JZ9A 1I7PA 3WK5A 2HT1A 3ULKA 2IX3A 1MMFB 3P9RA 5AJXA 1S2MA 2CB9A 1OWOA 2GSDA 4XM1A 3UIEA 1WB5A 1WXDA 3DQZA 5E2AA 4BBZA 2OO5C 3B1XA 3UPTA 3ETHA 3FZEA 1OA0A 1PX2A 4S05A 1ZN9A 2JLAA 4DA9A 4IIEA 3NT4A 3P0JA 4QTUB 1Q17A 3F3YA 5DOZA 2D3WA 4OJMX 2AC2A 1BWPA 1X7YA 4P3YA 3D7RA 3C1AA 4KBGA 5CDFA 1I4TD 4QBFA 2XGGA 1ENYA 4DLKA 1OC4A 3T61A 5DNYB 4DB2A 4PXYA 3IAM1 3S2YA 1ZH0A 2CDBA 3QEJA 2HSWA 2X2PA 4EG7A 4KTTE 3HN2A 2FXIA 3JALB 1YJQA 3OZSA 3R0XA 4JR0A 4PN3A 2HSGA 3B36A 1LW6E 3KWLA 1GCAA 3H13A 4RDCA 2XUKA 4RJJA 3SDZA 3ZV6A 5JYEA 2QT1A 3R23A 4CI9A 2ZIEA 4BWFB 4PNEA 3QFTA 1F48A 2HHHB 3MIZA 3NYQA 4AUNA 3NH9A 1QP8A 1R1DA 5KVVA 4LRSB 2H52A 2JASA 1MJGM 2QW1A 3UFBA 1LPBB 2Y2UA 3T52A 5TLSA 4ASUA 3EF1A 1C1XB 1U9CA 1QH1B 2VF2A 3WDKA 1DRKA 3VR3D 2IEZA 2JDIA 4JC4A 1XTJA 1W0KD 2Q4RA 4FFBB 4B74A 5FQOA 5JS8A 1CUIA 5FBVB 3LQFA 1Y1KE 4LHZA 2GLTA 4WD3A 2HEIA 5KNBD 2OBFA 3HVHA 4GMFA 5DE3A 4LOIA 4PZEA 4AP5A 1ZXBA 1TO1E 1W8DA 4ZOLB 3U3MA 3O3OB 4HDNB 5DP1A 4F1WA 2HA6A 3NWBA 4MTCA 3VVCA 4UMEA 3UEOA 4DW8A 3WO0A 2BH9A 2VHXA 4O3FA 5A1TA 3LIPA 3WWPA 3DMTA 1VI6A 4NCBA 2FZKA 1YWGO 4L7VA 1Q0LA 2P8JA 4JQCA 2G0AA 4ZGGA 2IITA 1LSSA 1Z6AA 1XLTA 2ONJA 2W6ID 4J0KA 4YRGA 5SYNA 2QLTA 2G77B 1TNDA 2R1TB 3A1FA 2F1JA 2Q2NA 9GPBA 3R0QA 2FOIA 1XVTA 3KXPA 3U4MA 3KQQA 2A9KA 4BU0A 2HADA 1P5HA 4UVEA 5GM2A 1ZCBA 1HDGO 1Z9BA 4G1UC 1FDIA 4OM8A 4Y1EA 5CVCA 2BFBA 4WZBB 5B1YA 1A5TA 2A5GA 2BMFA 1F9AA 3VDXA 5FPTA 1USIA 2FHPA 1IDOA 1RLJA 2IEIA 3DONA 3GAMA 2FGJA 2VAVA 3C3KA 1ADYA 2FZCA 3E2PA 4QTYA 2E4XA 2WHPB 4MRMA 4ND3A 4XVQA 1J1UA 3SXPA 4NCXA 3V1UA 1PIWA 3WWCA 2AN9A 2P35A 1ISFA 2G5PA 1N8TA 3JYOA 5BN4A 1COZA 3U44B 4ML3A 1MEEA 3E8SA 4C3VA 1BN6A 2VSYA 4W1PA 4LXIA 3ELYA 3AR5A 4LZOA 1V7CA 2V54A 2WG2A 4HUJA 4I55A 4OQXA 5HIJA 3K0EA 5LUBA 1B23P 2XITA 2X6RA 3OZTA 1J8MF 1C7EA 4DIUA 3MG9A 3VR4A 2OYSA 4LKRA 1YRBA 5G41A 4HZGA 2HQRA 1FTYA 2BMDA 5DW0A 3GJ3A 1HXHA 3RRZA 1RJDA 5CT9A 2ZW9A 4D1YA 4F85A 1ATZA 2OA0A 4FFRA 2WEKA 1IVSA 3E9MA 2ZUTA 3EVTA 8ADHA 1ZK3A 3OTOB 2BKVA 7GPBA 1U3WA 3TL6A 3ZR4B 3IEIA 2CJFA 4P83A 4D0GA 2CLSA 2BZ1A 1E3JA 3BTVA 4H16A 3ZJ5A 3AI7A 2QU7A 4N54A 3OESA 3SEFA 3SM3A 3FX2A 3BH6A 1YRHA 3QMWA 2VRWA 3OX2A 4OXIA 4R0MA 2ABWA 3QEKA 4UDYX 3SNHA 4LDPA 1T5BA 2ISQA 2Q3DA 3E2MA 2VTBB 2VL7A 4N48A 1QB8A 4EUSA 2PVPA 1A5SB 2J3IA 2W2OA 2X7XA 4Y2JA 1R9JA 4PTYA 3OPQA 1BDJA 1TJYA 2EJVA 1UCFA 2REOA 3GBPA 4XIFA 3RAFC 5SYMA 1VGQA 4ROTA 1ULTA 1FBNA 1XV5A 3Q85A 5EYPA 4DM3A 4KQWA 4EI7A 2OAP1 2G28A 3I5XA 3TAHA 4PYQA 2PLFA 2VOJA 4W5RA 1HMYA 2WSSA 3H1EA 2VOEA 3R3YA 3KUDA 5TEWA 3L1IA 3U3RA 2WZDA 3DHYA 1NVWQ 3MELA 2NZUG 2PYZA 4LHWA 1P7ZA 2X9GA 2XW6A 2O2GA 3ITDA 3O94A 5JS7A 4LBYA 3COZA 1IRXA 1E6LA 2A8YA 3HA2A 1FDUA 5F73A 1JB1A 5FOUA 4TV8B 5BPHA 1UWLA 1PN3A 3IO5A 3LYLA 1VPWA 2G5TA 4MUKA 1IU9A 1H8HA 1NWHA 1ZIXA 3UYKA 2H59A 2PX3A 2GM5A 1BRTA 1LC3A 2XNSA 3SBOA 4FWIB 1PUIA 2GB4A 4KUEA 4WI1A 2Z1NA 3Q9NA 1PW5A 2GBCA 2WSIA 1F20A 1ZESA 3OMLA 4J4HA 5AKJA 4N9QA 5FBZA 3OAAA 1SUIA 2B5WA 1U0LA 3KDAA 1F9EA 1LU9A 2JLZA 2AC4A 1EDDA 3MINA 3A4NA 4L3VA 5ENDA 4V39A 2BBSA 5EMNA 1NJ2A 2XRZA 2B37A 3RVBA 2EKPA 1AD2A 2AJCA 5EUMA 1V39A 4YO8A 5KI6A 1LVUA 1XMPA 4GZMA 1B8UA 4QPDA 1GG5A 1SG9A 4CGYA 4BQFA 5I47A 2A84A 3U48A 2J9ZB 4GKBA 4G0WA 3WGQA 3EXFB 3WL5A 2WSBA 3MLBA 2W2VA 4F4DA 4ZGBA 1SC6A 2RJOA 4L78A 5E7QA 3H7IA 4CLRA 1T9GS 4R7TA 1KEVA 3OZBA 1EUZA 2PJUA 5AW1A 1JFTA 3ZU3A 2J41A 2V8OA 3DHEA 3I2FA 5IDYA 1NATA 1PWHA 5AI4A 1E6KA 1HFEL 3BK1A 1A4RA 3DS8A 1J8VA 4WZAA 4DMCA 1P74A 2GPBA 1U7XA 5DNWA 3LLVA 4JROA 2WSMA 2XMPA 3K72B 2IU0A 4EKEA 5IXSA 1TJNA 3TLEA 4CTOA 1CYEA 1YR8A 1YZNA 4NZ9A 4EYGA 2I4RA 1P60A 1R27A 1Z5VA 3A6ZA 2PWBA 3H2IA 3B6ZA 1NLUA 2F3UA 3JQPA 3PQ3A 4B31A 4CTKA 2A3NA 4M46A 3STHA 5A62A 3AUKA 3G9UA 2VS1A 4RY8A 1U81A 2WKSA 2VK8A 5K3FB 3M2TA 3I9JA 1SU8A 1LRKA 3GCDA 3HWWA 4KDRA 1DG3A 1OAKA 1R9MA 1SKYE 2D7CA 1Z17A 2GF9A 3I6BA 4IDGA 1ULUA 4LRTB 2ZTVA 1E6CA 1PTJC 2HWKA 3VO8A 2F00A 3NC0C 3WQBA 1B1CA 1CZRA 1BWSA 3O2NA 1A9QA 4EELA 3DTVA 3NHFA 1EINA 1Y3CE 2PEYA 3EYAA 3ROTA 1H2BA 2PL1A 4DLSA 3OU7A 4X5OA 4XEUA 2NO1A 1AKQA 4AWXA 3BIOA 1PDOA 2AE1A 4HX5A 4QOSA 2ZYDA 3RC1A 5DK4A 1Q5PA 4KPEC 2PTHA 3P2IA 4MH0R 1VC2A 1WCV1 1NC1A 2KPOA 1YS7A 1ENPA 1VJDA 2XQFA 4O08A 4YT4A 1CY1A 2GPNA 4J9VA 1NXTA 4ESOA 1QIEA 1J4AA 1NUSA 2DPMA 1JG1A 5BT8A 1UJBA 5JY1A 3VU0A 3TRKA 1SJ9A 1IIBA 2BKUA 4JLDA 2B30A 4FHDA 3ABQB 3HU5A 1FU7A 4Z3DA 4F12A 3N3BC 4KEAA 3EGOA 2Q4OA 2VNSA 4LWQA 5JXHA 4PWZA 3JQ8A 1FFYA 3IPYA 4DRXA 4HX9A 1NU6A 3NRCA 4CUJA 1RMYA 2B3DA 2AG5A 1G5FA 1MO2A 4R1NA 5J59A 4LPSA 3HDHA 2UUCB 2W8ZA 3G8BA 2Q0HA 3LQKA 3NX4A 4KO1S 4ZI3A 4EZEA 1PNOA 3CCCA 4E14A 3V4RA 1K75A 2R8OA 3A4YA 4F6RA 1VIYA 5CB0A 4OSEA 1KI4A 2G07A 3A6HA 1N2GA 1P72A 3M4ZA 3NIGB 2PUDA 1CZLA 1Y3IA 3C2QA 3WGYA 3DH0A 1DPGA 3T9DA 1WZ2A 2ZAIA 3WGJA 2XCOA 1U65A 3RUPA 4DF3A 4OG2A 4RIHA 4RK4A 3VX4A 1ZD4A 4RPCA 4P93A 2YIDA 4X9XA 3ICQB 1CQIA 1H66A 1PQWA 1BVUA 1JG3A 5ED0A 5LJIA 3WDMA 4FN5A 1ZD2P 3A0UA 3B2NA 5D3MA 3TQSA 3B20A 5FNZA 3C8UA 3I5MA 2FW9A 4FPXA 1V8BA 3CVOA 4NZYA 4OGGA 4ESHA 3QVWA 4RF2A 2JFPA 3BOSA 3VR4H 2CFTA 2ZU6A 4M7OA 4RIIA 1C4OA 1JDBB 3KS9A 4RVHA 4C3ZA 2M6SA 2AOWA 4DCUA 4MV6A 1DEHA 4YJKA 1WY7A 4MGYR 3H2KA 2JCGA 5B58C 5BR1A 2NNLD 4HDAA 3QOFA 1WCXA 2DECA 3D31A 4NBRA 5IYZA 3UANA 2XMCA 3KZ1E 4BLWA 2MSWA 3BRWD 4UTVA 1NBMD 3K7EA 3O38A 2ACKA 4KYIB 3TEMA 4B4WA 1P2GA 1C5KA 2YCBA 2EXXA 2ZDHA 3N75A 3V1LA 4UM5A 3PZBA 1Q7RA 2OB2A 3NQ41 2BJHA 1QPGA 5A4FS 3GRYA 4WXHA 3FCCA 4JSTA 1YTLA 4HMOA 1WTCA 1WW8A 2FEXA 3HA7A 3PC4A 4OQDA 1Y37A 2ZJOA 4INPA 4LF4B 1F0YA 3KSMA 1E60A 1Z4NA 3TECE 4RSRA 1KYTA 3UCEA 5EXTA 3Q6IA 1KZ4A 4N41A 3ONVA 4BO5A 4DV3B 4B73A 2O19A 1FNSA 4RFSA 3RFFA 3QIAA 5IH3A 4YAKA 2K7FA 1OVGA 2B98A 5DLQC 2GK3A 5DWVA 5LCXA 1F38A 4DLPA 1GSAA 2RBKA 3A26A 2QAIA 5J1SB 4Z4CA 2R6R1 2X2FA 3AVQA 4KXFB 4QQ8A 4NNPA 2IHBA 1HQDA 2O54A 3UJ6A 4R1PA 1X42A 3KBBA 5F2EA 1ZGCA 1WS6A 5MGNA 1WOMA 4NK5A 4H6VA 4DRXB 2PKQO 1VBMA 4MQFA 4QC2A 3EPKA 1NQXA 3WGNA 1D6JA 1RSZA 2YVQA 3TCXB 3PEUA 5GV8A 1QDEA 3FNEA 3GAFA 1VGVA 2PX6A 5LJLA 3NOVA 1NBOA 4Z7NB 1CUAA 3AJAA 1EUDA 1MX5A 2AKAB 4L6AA 4FBGA 1Q1NA 3K9CA 3VDQA 2NV2B 2N1BA 2XQGA 3RS2A 2AF4C 2V0CA 4N6GA 3KK0A 1Y1QA 2GF0A 3K6JA 4JBYA 1UEJA 5NLLA 2A7QA 2FSVA 4H1HA 5IPFA 4M0FA 5ERYA 5KUTA 1RWPA 2FEWB 2QX7A 2XGJA 1SEPA 1KNXA 2LCIA 3MRXA 1KZGB 2IPMA 2OV8A 3OUUA 2VUUA 2CMFA 3JQGA 4GLBA 1S3SA 1MJ5A 4XLLA 2ZB7A 2AFVA 4GT1A 4CN8A 4EHBA 1NI4A 1ZJYA 2HIHA 3EVNA 3DJYA 4DLNA 3J7AC 4OU4A 1R7RA 1TZJA 4P58A 2R85A 4PSKA 1OH7A 1QTIA 2KBEA 4TL9A 5HOQA 3OMXA 2GPAA 3BRCA 3DV2A 1USKA 2J7KA 4UDXX 4URVR 3PRHA 4AX4A 5FTKA 5J58A 2COEA 4DR7B 2MYNA 3WA6A 4G4JA 4YCCA 5TQ0B 5CH3A 4XZ3A 3N2KB 3AGQA 3AJ8A 2H2GA 2VLIA 4B6RA 2ZBEA 3WLAA 4A2QA 1RZ3A 3H5VA 3O8OB 4O2AF 3RYHB 5AI9A 1RQLA 4TMKA 2YXLA 2HUPA 2DG2A 3JALA 2XEDA 3S7ZA 3JVDA 2DWPA 4XASA 1CRQA 4GKAA 1Z38A 5F9MA 2DAPA 3EG9A 3U7IA 2ZULA 3Q6MA 2XZLA 1N2CA 2D5IA 4FOOA 3E3AA 3VR2A 3V8EA 1L5HA 4EJ6A 1E92A 1RVDA 1YAHA 2ILTA 3T3HA 4BEWA 3CUYA 4YECA 2BGMA 4DG8A 2YVLA 2Z8ZA 4ZC1A 1LQTA 4IQ4A 1JMYA 5AVXA 5KTMA 1FMFA 2O50A 4A03A 4W1RA 5KNDH 3IV6A 3OPXA 2DWQA 3W5CA 5G4LA 1QWSA 3JR3A 2QQ0A 2DT8A 2VCEA 4N9WA 3UFXA 5K6RA 3O1LA 2B4AA 3UQZA 3RDPA 3CZCA 2YHAA 4C20A 3SF8B 4BV9A 1QRSA 1QH0A 1C9EA 4NLLA 3M6WA 2PHZA 2R00A 4D0NA 5C9ZA 1ECGA 1YI8A 1SD2A 3KLPX 4K40A 2H5JA 4Q4AA 1HDOA 2RCNA 5CTJA 4QARA 1RKXA 1NOJA 3ABRB 1NUPA 3FLMA 5LBIA 3T0IA 3G0OA 1A1VA 4BFLA 4G0VA 1DWUA 1E2EA 3NHLA 2WUVA 2F8SA 1G4UR 5KJ1A 2VRCA 4PNHA 3PQCA 4MGIR 4M21A 4IYJA 1U2GC 1RWMA 4KWEA 4N6OA 5M2QA 5G1PA 2VJKA 1X80A 4MYCA 1UKCA 4H27A 4NKRA 3RANA 4B75A 3UAYA 5FQNA 1A7KA 1J5XA 1KO5A 1M2JA 2JS7A 2D4AA 2W4IA 3RFXA 1AGXA 2PRKA 1TM3E 3TGPA 1PFVA 5DM4A 3F3KA 3RABA 1XWFA 1G8MA 4MQ4A 4FCCA 1JEDA 3T3EA 5CAEA 4PLTA 4JEMA 3QWHA 5AK0A 2QL9A 4BN4A 1PDVA 5ALHA 2PUTA 2O5EA 1QORA 2AMYA 3BT7A 5LQMA 3T3NA 4KRGA 4Y6QA 2C5BA 3QA9A 1ARZA 4J7CA 1KSFX 2O7SA 4XYLA 1PU2A 3EMDA 3U81A 3HEBA 4R2JA 1QG2A 3JQ7A 4CQMB 4EECA 5JWRA 3ZHQA 1GRCA 3DA8A 3W6NA 4RFLA 4OXYA 3NFYA 1Z47A 3ORFA 3Q72A 4IQFA 2IH5A 1N5KA 4E07A 2DKNA 3CF2A 4PS0A 2ZREA 4ZN6A 2HHAA 2IBMA 3U49A 4OGLA 5FPHA 4IIJA 2RMKA 4CF7A 1GLVA 3TVTA 1GN9A 3DD5A 2C0QA 1C8KA 2UVPA 2DWCA 4GXNA 2HRZA 2IYTA 4EJMA 4PSUA 4JUBA 5CK4A 1XB2A 2EFGA 1Z7GA 1ZGGA 1GL6A 3WLFA 4M7PA 4FNAA 1E2NA 1FP2A 3AILA 3GJZA 5KJEA 3JD0A 1HEIA 2VYVD 3NYRA 3WOHA 4N5LA 1FNNA 3ZLVA 4CXMA 4O29A 3TIXB 1JWLA 3GT7A 4OQFA 2XGSA 1NXXA 2BBWA 4WNIA 5FI0B 1QBKC 1WWKA 4RF4A 2OOSA 4WNAA 4HDOB 3BF7A 2YMLA 2FA9A 1BA2A 4TN1A 2EG5A 4ILKA 1VG9B 4X1YA 4B8WA 1SFRA 2F8MA 3JYPA 3D4PA 4RPJA 3ZBPA 4B7CA 1R6AA 2B7CA 2XB9A 1GAEO 1WU8A 3HWSA 5EQJB 2B99A 2XE8A 3C6YA 4X71A 3SFZA 3OZCA 3S7TA 3ZHCA 3GP5A 2GZRA 3B1WA 3O8QB 1NXVA 3D0RA 3KYCB 5ES3A 5HSGA 4KLCA 3EBPA 3C24A 4P9NA 5CLQA 2HJVA 4L5CA 4Z86A 2V9CA 2JGDA 5G1OA 3KT8A 2F7SA 9LDTA 1ILWA 1ZMRA 2VWGA 3OPVA 4MX8A 5LZ5A 4A16A 10MHA 1N5MA 1ZKMA 2R60A 3FDXA 1T3GA 1F6BA 4IZOA 4LUCA 4PBTA 3RO7A 3DXXA 4JR2A 1TCAA 4AN0A 3A1VA 4PRYA 1G8PA 4TTQA 1N2CB 1UOOA 3ASVA 1ABFA 1NRWA 3JD2A 4HNGA 2WNIA 4NHOA 4QFBA 5E6RA 3B1KA 1KRWA 4H6XA 2EBWA 3AG5A 3ROEA 3NYWA 2QR2A 2J9YB 3VMFA 5AKKA 2ZJ8A 4FWBA 1OAOC 3R3JA 3P9IA 2QG9A 2WV9A 5K05A 1OTHA 4G8BA 2ID4A 1G55A 3IPXA 2YDYA 3I2YX 3X2SA 4BMXA 3KELA 5FWYB 3PQ6A 2RGCA 2FDCA 1X87A 2ZSIA 1GTZA 4MB2A 4MVCA 4QUAA 1G6KA 3Q8XB 1LNQA 5DM1A 1ZYUA 4LZNA 3HUFA 1WHSA 3C3CA 4XGQA 1Z6XA 5E6UB 2V5UA 2OLEA 2RHCA 2PH3A 2CXHA 4PGHA 5KWJA 4CLXA 4PPGA 1AHIA 1S4MA 3QVKA 4OI4A 4RMJA 4L4YA 3TWOA 3G2PA 5ALYA 2OV2A 2QPAA 3KJZA 4PYMA 4Q7MB 4TS1A 2A9QA 1N5IA 3BB1A 4MV8A 1IN8A 3MTIA 1R0SA 4WLVA 3BQMB 1XLUA 3HL4A 4YBZA 4WW0A 3GRPA 1A7UA 4IRXA 4ND1A 5CTAA 2DXIA 3PE3A 4Z51A 4BUJA 4OFBA 5HRCA 1WMAA 2QTMA 3ESZA 3M5CA 3RSQA 1UQTA 1K7FB 3QPBA 3W79A 5I9LA 1E7MA 3FTQA 3TBKA 4ZAFA 3FPCA 4JBHA 4WKOA 3WBKA 1AKMA 1WAMA 2MSLA 3CLUD 3QX8A 2UU9B 4UUPA 3MK31 4MPRA 1FFSA 3HKBA 3RNOA 4DR5B 4E5MA 1BKSB 1T9CA 1VG0B 1C7FA 3E5MA 1XX6A 2XLBA 2C88A 3MSCA 3U4DA 3BD9A 2NGRA 1SMKA 5FOQA 4A0SA 4MQEA 1UJNA 3ESXA 2QK4A 2VDKB 4E3WA 2ZJBA 3HM9A 5K8TA 2GN9A 4UUNA 1DAEA 2JGRA 4MWDA 5HMMA 2IZ7A 3D8HA 1Z07A 3V4VB 1QLHA 1DB3A 2GPWA 2BHLA 3RUIA 3PJRA 5D6NA 3CTMA 4D41A 1FLVA 3E9ZA 4MLZA 3ZIAD 4Q3BA 5KYYA 3UHJA 4DM4A 3JWIA 3EVDA 5D51S 3F6EX 4LNAA 1WU7A 1QKKA 2LRHA 4OXKA 1ODIA 2LDXA 4EHKA 2GR9A 2GYWA 2ZYSA 2H17A 1QFSA 2BDTA 1ADCA 1D1SA 2IOQA 2IXAA 3GFTA 4GW3A 4MR8B 3AR9A 5FI1B 4C7JA 4DIEA 2FSHA 3V2UA 1BS2A 2GXUA 3K32A 3KNZA 3F67A 3KZCA 4EENA 5JAOA 4ITVA 4I46A 5LD2C 3NBUA 1RHRA 1OH8A 5JLJA 1TUGA 5IS2A 3K5WA 2FP3A 5JDIC 2GCNA 4Y9TA 1IJBA 2HWUA 1NPYA 2PFKA 4U5QA 2PGDA 3IC5A 5CHYA 4WY2A 3CRVA 5A4DA 1WPXA 3WMFA 5DGIA 2WR8A 4B47A 4AIIA 1YL7A 4ZVLA 3H6GA 1QJCA 1XDZA 5GGXA 4FSHA 4W4TA 2FCAA 4TKMA 2ZQZA 3L5OA 1VYHA 3LPCA 1FTNA 1PZNA 1VZ3A 3WK7A 1XA0A 2BKLA 3OJWA 1L7QA 3O3NB 3AF2A 3LL4A 3SZLA 3DOEA 4GX1A 1MV8A 2QLJA 3VHXA 1TA4A 1SVLA 1UODA 2OSVA 2QUZA 3BWDD 4AZTA 2HMWA 1U9IA 1RM0A 1RADA 1WP4A 3ESCA 4PXAA 4YMIA 1U2DC 1MIOB 3W3AH 2V8BA 2MT9A 3GIWA 1OF1A 3O2JA 3PU6A 4IDPA 4Z2AA 3DZBA 4BP1A 2UZ1B 5CYGA 2QYOA 1G42A 3QPVA 2UZ0A 1XWIA 3KKEA 1RC8A 4PQRA 2OD7A 4PLYA 2FB9A 1YTUA 3PHIA 4EUEA 5CW2A 3U7QA 4WOBA 1PS9A 4DLZA 1N92A 3F9IA