4Q01A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
163
Chain Sequence
MTEYKLVVVGAGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords K-Ras
total genus 63
structure length 163
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q01A00
2PLFA 3LQQA 1MV5A 3BD9A 5B57C 3QXSA 3ZVNA 4C4PA 1HEIA 3CZPA 2IWRA 5BN3A 4Q4HA 4FCWA 1Q0UA 1S0UA 1U8AA 2JATA 2YC2C 4WVFA 2ZE6A 1E79A 1R4AA 3PCRB 2FV8A 4NL4H 4JYCA 3QQ5A 3TVTA 5FTLA 4GRAA 4Q4HB 1L8QA 3X1YA 1K8RA 2ODWA 2IYLD 2J87A 3DZDA 1Q22A 1X8JA 4CYMA 2D7DA 1QHGA 2IT1A 3EA5A 4OBEA 4UXJA 3VAAA 1RRGA 1F2TA 1XJQA 2O8EB 1CXZA 2BWJA 4KSBA 121PA 4FW9A 1SVSA 3E1SA 4EFLA 2GEDA 4UNSA 1AZSC 4XVRA 4I1VA 2QPAA 2O8BB 5A0FA 4LZZA 3I72A 3MWJA 3CR7A 2QAGC 4Q66C 1DADA 1ZNWA 2Y8EA 3CW2A 1ZM9A 2FEMA 1AKEA 3CH5A 4KFSA 5KDOA 4HLUA 5KSZA 3VR6A 1IQPA 1TAGA 2AKYA 5P21A 3SYLA 1HQYE 3VU9A 3V4FA 4ZCMA 2LWIA 3EAQA 1OXVA 3ONWA 1P72A 3PUXA 4P32A 4NTZA 2H57A 1HT1E 1FX0A 3ASZA 4TYWA 4PZYA 2IWHA 1SHZA 1OIVA 2XTZA 4Z1MA 4AKIA 2OAP1 1JQLB 1GSIA 4DBLC 4YMUA 3LNCA 4HUQA 2OO7A 3HR7A 3GQBA 4P33A 4A92A 3PEYA 5BN4A 3IILA 4MRRA 2JJ2A 5JBQA 2V9PA 4A82A 1ZRHA 2H1LA 4BLOA 5JCZA 4ZDJA 1GITA 3LBNA 2ZYVX 4MKGA 2ZM5A 3HWSA 1AS3A 1G9XA 1YU9A 4PHHA 4W9MC 1VHTA 4JSTA 4KHZA 4OQMA 1JXOA 1P6XA 1JAHA 4F4JA 2SHKA 2WWIA 1P4SA 3SBEA 1G64A 4ZIRB 3ZGXA 1E99A 1IOZA 1E2PA 2F1RA 3W5JA 2UZ3A 4IDPA 4RD0A 1E2DA 5GJVC 1PLLA 3WYAA 4TLEA 1GNPA 4DT1B 1OHHA 4ZIRA 4XJXA 1Q1EA 4Q7MB 1A7JA 3FMIA 2V54A 4OHZA 1WBBA 1SKYB 4MDEA 5F2EA 4Z1MD 4BECA 2WIAA 2ZU0C 1CEEA 1QF9A 3BRWD 3B13B 2CL6X 2EWVA 2G0NA 3NC1C 3A58B 1PLKA 2JJ2D 5EZ6B 3AVVA 1P2UA 1Z5ZA 2BEKA 3OIVA 1GL7A 2B6HA 4PAMA 1ZMXA 2FPMA 4GOJA 4AC9A 2NO9A 1UPTA 3GLGB 2ERXA 2B8TA 2OLKA 4E5UA 4M22A 4JIMA 2HEIA 4TMWA 2DFLA 2G83A 2D06A 4YMWA 1LV7A 5HPYB 2FZ4A 4PFSA 2FSHA 3TW4A 1N6OA 4R71A 1ESMA 1GL9B 2AD5A 2XOKD 3AUYA 2DFTA 3SS8A 3HDTA 4A6XA 2YJTD 3P26A 5CJPA 3BIFA 4XVQA 5EE0A 2FWRA 3NBXX 4I1SA 3ND8A 2QMOA 3CUEF 3GLFA 1ONBA 1MRSA 1E4YA 2ZITA 3TH5A 4D26A 1TX4B 1DTSA 4Q4AB 3MAAC 3KQNA 3IIKA 3B2EA 5AUPB 4V0NA 1G3IA 3K9GA 4ILEA 3Q7PA 1OF1A 5FOWA 1T8TA 2XZLA 1VHLA 1DG3A 1GIAA 1N0UA 4NONA 3AKDA 2YINC 1L2TA 3DMNA 4JVMA 4KBFA 4BLTA 4QJ5A 1G5RA 2I1QA 1QZXA 4TYNA 4MRVA 1UM8A 2HF9A 3B6EA 3CBQA 1ZM3A 3SC3A 4UXIA 2HXYA 1AZTA 2OE2A 2PJRA 1KI6B 3E5HA 1G8YA 4LHZA 2ANBA 4GMXA 4NMMA 4FXPA 2D2EA 2F3TA 2R6CA 5FBLB 5JCPA 4URWR 3QY0A 4O3MA 1NJGA 1AGRA 2PCJA 5G53C 4D4MA 4Q18A 2JASA 5FBVB 4QJ3A 4ZCLA 5JFGA 1KK0A 4TYPA 2FX3A 1BIFA 2YYZA 3RRMA 3QVVA 5J40A 1BMFA 3LD9A 3LDAA 3I8SA 5D3MA 2R8RA 3KL4A 4UKDA 4IVPA 3UK6A 4JZKA 4WXRA 1F3OA 3T1TA 2QP4A 1Q12A 1N0WA 2IF2A 2O0JA 4NYMR 4DLVA 5CIQA 4AYWA 4UNRA 4URUR 3C5CA 4DLTA 2ZR0A 3FKSD 1MO5A 2WICA 2YOHA 1X1RA 3G82C 3P20A 1NN1A 3RNLA 1J70A 5HCIA 1E94E 3LQRA 2J0SA 1RPZA 1SKQA 2NPIA 5EUMA 2FE4A 5TDHA 3CRVA 2N46A 4Z51A 2YWFA 4AKGA 4J0QA 4LYJA 1K5DA 3GLHA 1GDDA 2LKDA 5FUXA 4LOAA 5GJBA 4B43A 2EFGA 1DE0A 2WHXA 4TT3A 4JLOA 4AURA 1H8HA 1OKKA 1G18A 1JJVA 4LGMA 1BMFD 1M7HA 2BJWA 2KB0A 1MOZA 3KXKA 5BXQC 2ECKA 2Z5FA 3VX4A 2BMEA 5TVKA 3SBDA 4LDJA 1KZ7B 5DN6A 4TTQA 3CX8A 4LJ5A 1PUJA 3U5ZB 1XMVA 1KO7A 4GPTA 2Q9CA 4IKEA 5EE1A 5D3QA 2RHDA 4V0OA 4PPQA 1I2DA 3BB4A 3FKSA 3KJGA 2FG5A 1CP2A 5CM8B 4YXWA 5KO2A 2WKQA 1PJRA 3K0FB 3GJXC 1R8SA 5KDLA 3O8DA 2ZUCA 4M53A 1AM4D 1Q20A 1FMJA 2GETA 1U81A 1XTRA 1E2IA 2YC4C 3IBGA 2XTMA 2ZRBA 3FHCB 4JJZA 1KO8A 4ACBA 4Q00A 3EZ7A 1QHSA 4TWZA 3REFA 1Z6XA 3AUXA 4F4IA 2EW1A 4FMCF 3TR0A 3FB4A 1Z6TA 1OPXA 1G8FA 1W4RA 4I1OA 4URYR 2LKCA 4ZDIA 4CF7A 5HZKA 3IUYA 4KLNA 4TT3D 4PSAA 2E1RA 4MYCA 1NBMA 1CRPA 1AK2A 3K09C 2V6JA 3MLEA 1Z63A 2WBLC 1E2MA 1IAQA 1P60A 1QHYA 2OV2A 2FNAA 4CEHB 5JJIA 1ZM2A 1KIMA 2NZJA 4KO8A 3RRZA 4GNKA 5TMPA 5IRCD 3SQXA 1MR3F 3F0TA 1GKYA 3F3YA 5JWOA 3DOEA 3EZ9A 1N5IA 1XNJA 2XZPA 3LXRA 3SHFA 4MITA 4B76A 4TMVA 4B2LA 2QGZA 4Q19A 2EQBA 1SVOA 4GDFA 2CE7A 2GXQA 5FBQB 5BQ5A 2WV9A 2WOOA 5BYKA 4PHTA 4IDOA 2ZYUX 1QHHB 4RZXA 1KSGA 2OXRA 1BOFA 3KB2A 2H8KA 1CR0A 2RB4A 3PUVA 4PC1A 4PO9A 1KK3A 3RS5A 4IEIA 5AJWA 3QENA 3TR5A 3AGPA 4XH9B 4JJKA 3NEJA 4TYQA 4AI6A 3QEJA 2CE2X 3SR0A 2V7QA 3QKRB 4IDNA 4DJTA 3HPQA 2ODEA 5AJZA 5JZVA 3TLXA 5KPJA 1XEFA 1EWQA 5BN5A 3DM5A 1CF4A 2L0XA 4QL3A 2P5TB 1N6KA 4Q21A 3B60A 4A2PA 3LWNA 1OV4A 3KDSE 1T3HA 1ZVQA 2HJVA 3ADDA 1SXJD 4Z54A 4CGZA 2QAJA 1ZUNB 3L8ZA 1G21E 2QN6A 3FVQA 3NWJA 2HUPA 5DHAA 1W2HA 4F91B 3EG5A 1RIFA 3GLFE 2O8EA 1OSNA 4DKXA 4NYIR 3THXA 4HLQB 4OI1A 3ICQB 2GEUA 2OCPA 3VHXA 2ZRLA 3SFVA 3U3RA 5IF9A 1CKEA 1P9NA 3GEIA 3P32A 1AN0A 3QVUA 4B35A 2IYTA 3PENA 1G8HA 2RGDA 5TXGA 2ZAOA 1ZD8A 3C8UA 1CJTC 2FFQA 3OZXA 1UDXA 421PA 1XEXB 4LBYA 5CB6A 2A5YB 2D7CA 3BB1A 5SZHB 4C30A 4KBGA 3S1AA 4ZDWA 5FOXA 2PMDA 4G01B 3CR8A 3LVQE 4OI0A 1FX0B 2ZRDA 1NVVR 1VIYA 1E2LA 2BBOA 4EFNA 2IXFA 3TQCA 3I62A 1BYIA 2X2EA 3SEAA 2R2AA 4PHFA 4PAQA 2J1LA 2JLRA 521PA 3E70C 1D9XA 1YZQA 2JLVA 1Z2AA 1G3UA 1Y3AA 4QJ4A 3UG7A 2RMKA 3QPUA 3DM9B 4QHYA 4Z8YA 1J7KA 1AQUA 1FNMA 3EC2A 3OEEA 4OHVA 2V4ZA 3T35A 2R6AA 3C7KA 3PEWA 1M6NA 3B9QA 3EIHA 3KUCA 1IM2A 3QKSA 1ZNXA 3AF0A 1E2KA 3RYTC 1AS0A 4GZLA 4FCVA 4Q4JA 4QM6A 3VNUA 3B82A 1CULC 2AR7A 2CK3A 4CEHA 4LV8B 3IBYA 1N6HA 4CW7A 221PA 3VMFA 3N2IA 4OHXA 2ZJZA 1LVGA 4DEXA 4F92B 1IY2A 2WIBA 2ZJ8A 4ASUA 3GLHE 3C14C 5LB4A 2ONKA 3Q5DA 3EPLA 4JVNA 3CX7A 4XWOA 3GJ6A 2C2HA 4RKFA 2JCSA 4KVGA 3I1FA 4RKEA 3TNFA 3ZIAA 2RGGA 3OEED 4I4LA 3QXXA 3T12A 1BYUA 4R7ZA 2J7PD 1W1WA 2NTYC 1EX7A 1R6BX 3U7FB 1KO4A 4I81A 2NPFA 3WXMA 1II8B 5HR5A 1JJ7A 4D2IA 3RANA 3UWKA 3RWMB 3CM0A 4HZUB 1XFAA 3W6NA 1NP6A 3GJ8A 1QRAA 3U61B 3KUDA 4IOJA 2H92A 2OCYC 4GP7A 3VKHA 3BK7A 3ZS9A 3SOPA 3FYHA 3P1JA 3Q5EA 1G7TA 5FR1A 2WJYA 1L4UA 2FGJA 2GK6A 2FEOA 2J0UB 3RS0A 1JPNA 2K5UA 1HTWA 2ZI6A 1JALA 1FNNA 1M1YE 1S9HA 2G1KA 2G88A 4A0FA 4I1UA 4B6EA 2GZDA 1NBME 2QY9A 4JKIA 1F5NA 3AP1A 3W6OA 3DHWC 1ZUIA 3VFDA 4A4DA 3A1UA 4AD8A 2IUTA 4B2IA 1QG2A 1WF3A 2FJUA 1R5BA 3CF6R 2WM9B 5FBWB 3VX3A 1XEXA 2A5GA 2QAGB 1KY3A 4TL8A 3NDBB 2VIIA 1XWIA 3TKLA 2BCGY 1D2MA 2YOFA 3KTAA 3WNCA 4XOIA 4CIDA 3L0SA 1E69A 5KSYA 1R5OA 1XTQA 4NZYA 3T06B 1NMXA 4KLZA 3LBHA 1NN0A 5HKKA 4JBWA 2JLYA 1IXSB 1QHXA 2RAPA 5D3MB 1IN5A 2A5DA 2QT0A 4LY6A 4TTRA 1ZYUA 2ZRHA 4E09A 4TL9A 5FI0B 4OJQA 4HUQB 1II0A 3WRYC 3B7GA 1YR9A 5EXXA 4IEEA 5FPHA 2GJ8A 4OQLA 1U99A 3QBTA 4BQSA 4URVR 1PUIA 1R2QA 2GJKA 1TQDA 1DELA 4LUCA 2PZGA 4QBFA 2CLCX 1Z06A 4ZPXA 3SJZA 3ZZ0A 1IXRC 2XX3A 2GDJA 1XEWY 4MGIR 1XCMA 1XXHE 3NHBA 4RZUA 3T1VA 3TE6A 3P4YA 2OG2A 4HB4A 2V55B 4NYMQ 4UQOA 5FH9A 2JLZA 2QG6A 3GLIB 2JDIA 4QXAA 2C5LA 4B3DA 2QMHA 1P75A 2YWHA 5DH9A 4OK3A 3LW7A 4BLSA 2FOLA 4W5JA 1KKLA 2CVHA 5B64A 3KKQA 3NEYA 3EC1A 1S9DA 4QFMA 4JT2A 5FBRB 1DAGA 2BBTA 1G4AE 1Z28A 2ANCA 2BKUA 3CIOA 621PA 1BH2A 1XU4A 3QXCA 4ON9A 3WBKA 3EPJA 1XMSA 2GZHA 4Q9JA 1P9WA 1N6NA 2J59A 4O2LA 1P2TA 4O0MA 2OCAA 2WJGA 5EE9A 2OM2A 1KZGB 1R7RA 3AQ4A 3BFXA 3GFOA 4PX9A 2WWGA 4PQYA 1YZTA 1DG1G 2IYQA 3BORA 2VBCA 4JLNA 5KPDA 1Q1BA 3X2SA 3HR8A 4HUTA 3CPHA 1YHNA 1R8QA 1G3QA 3T15A 2D74A 1W36D 4KYIB 5EP1A 2ZE7A 4GP6A 4JL5A 4DT1A 1Z0IA 2MMGA 2P67A 3EWSA 3FFAA 4N3NA 5FL7D 1YZNA 4DXAA 5FOSA 4RFSA 3T1QA 4DUGD 4C0HA 2IS6A 4C0BA 1X1SA 3FHOA 3EWAA 3A6PC 4MDFA 1Q44A 3AF1A 1CR4A 1DAIA 3A4MA 3AVYA 3ADBA 4HAVA 5L3SB 4QM7A 4DC9A 3CRRA 4MRNA 3T5GA 4NP6A 4YC7A 4EAQA 3BERA 2QPTA 3M4YA 1ODFA 1L4YA 4MRSA 3OEHD 3ZVRA 4LJ4A 2VTKA 5DI3B 3V9PA 1EFCA 4WIAA 2QQ0A 4NH0A 4DLYA 3K9NA 1WMSA 1KI2A 4LHXA 2E9SA 1YR6A 1GZSA 4Q03A 1KMQA 2NO1A 2I1VB 3CZQA 4AG6A 3AVOA 1KMHA 4N0EA 1MT0A 4A36A 1T0HB 3K8YA 1ZINA 3L43A 4P4SA 3SDZA 1XJCA 2NZ8A 3TMKA 1J99A 2ZRKA 2QEQA 5FOUA 4EPVA 5JRZA 3PEVA 4MGKR 4RY2A 3MG9A 4P31A 3I8XA 3BE4A 2VRWA 3WHLA 2J45A 1KGDA 1ZNZA 2I4IA 1G3RA 4FMCB 3KQKA 1VG0B 2QGNA 2WSSD 2ZREA 1CBUA 4C0LA 4Q9IA 1ZD9A 2IA5A 4ZI2A 2JLUA 1YJ5A 2JLQA 3H4MA 4PO1A 3B78A 3QF7A 3QG5A 5B30A 4QKQA 2A30A 4IDHA 5FUWA 1X86B 3L0PA 4A8JC 2O52A 1XPUA 2IYZA 4DHEA 3RLFA 5KSOA 5FUYA 4DZZA 5HTKA 3OEHA 4OI2A 2BCJQ 1AIPA 1FTNA 2ZSFA 2O8DB 2H7VA 2WKPA 4WOPA 1Z2CA 2REOA 3ETLA 2OUKA 1D8TA 4V0MA 1XCPA 1Q1QA 3A37A 4ERNA 4DB2A 2JAQA 2R65A 2ZS7A 2PMKA 2ZJAA 2JEOA 4QHSA 3RSLA 3W5IA 3TVDA 3PUWA 2JJ1D 4NYIQ 4YMSA 4QBIA 4GL2A 5G3ZA 4KODA 4TMTA 4Y0AA 2VHUA 3N70A 3AVPA 4G0NA 2FH5B 3T34A 2WTUA 3WMGA 1ZCBA 3RRNA 4LBVA 3JZMA 1IN4A 2VF7A 2GJSA 4OL0A 4XWKA 1G20E 1N0VC 2VP2A 2J41A 2QRZA 4FI3C 4GSYA 3SE0A 3PJRA 5DYGA 2LCFA 3U2QA 3LX8A 2IHYA 4HAWA 3RS7A 4DB4A 4D0NA 1OXSC 3NXSA 3U7EB 4A0HA 3IQXA 3KKOA 4PANA 5IDVA 1LY1A 2ZSBA 2OFWA 5BW8A 1M34E 3QF4B 4RSGA 4C0SA 1F2UA 1NVVQ 1T6NA 3B1XA 3AVQA 4OK5A 5DISB 1E98A 3THOA 2FFBA 1N5JA 2FA9A 3PQCA 3MCAA 1PZNA 2ZYTX 3IEVA 1XD8A 2GBLA 2PZEA 4XWAA 2ZRPA 1NY6A 5JRJA 1LF5A 2XSZA 1GILA 1SXJC 4DEYA 3CF0A 1SVKA 2PH1A 3QPWA 5GVRA 1W2GA 3H84A 2QL6A 1U8ZA 1XXHA 1M8PA 2VHCA 4M0LA 1OE0A 1W5SA 1TF5A 2B7BA 4B6FA 2O0HA 1P3JA 4BFSA 5J4KA 1QVAA 4GOKA 1MRNA 5FTMA 5IT5A 3DDCA 1QG4A 2CEAA 2HF8A 3TUJC 2DHRA 1ZM7A 1T0JB 3P4XA 3FWYA 5AJVB 2ZJ5A 5JJLA 1OFIA 3EASA 2R6GA 3D7MA 3WBJA 1II8A 4BFVA 4URZR 2A5JA 1HURA 1ZP6A 1KI3A 3SNHA 5FOVA 4G5RA 5EP3A 3KTAB 2W83A 1VG8A 2NG1A 4HAUA 3RVBA 1ZUHA 2PX0A 1F60A 2XJ9A 1DVRA 1FL9A 4RD6A 1NSFA 4Q9KA 5CJ2A 3K0CC 2C99A 3GP8A 2GVDC 1I2MA 5J5CA 3SQWA 2C8VA 3QE0A 2ZANA 2BBWA 2YWEA 2ZU6A 1MO4A 4TSFA 2J0UA 1OYYA 2BOVA 1Z08A 2JLSA 4P3YA 2WOJA 4IHQA 2GCOB 3AP3A 5TY0A 1RFLA 3AKYA 1XZPA 3OE7D 1E2EA 1FUUA 4QBGB 4L9SA 2P3SA 2QTVB 1G16A 1Z3IX 2EYQA 2W6JD 4MYHA 4U00A 4B3BA 1WCV1 3W9YA 1D2EA 4UNNA 2AK3A 2GCOA 4M1SA 5G41A 1KKMA 1V5WA 3NTUA 3SFZA 1XTJA 2AKAB 2GCPA 4DIDA 2OT3B 3CO5A 2P65A 3K0CA 2RKOA 1QHNA 2ONJA 4B74A 2WJHA 1GKUB 5E7MA 5C4GB 1HUQA 4OKSA 1LF0A 5EXSA 4FMBB 2IYVA 1NG1A 3HU3A 1KDPA 4R2IA 1QDEA 4Q7JB 2EFDB 1W5TA 1E1RA 4FCTA 3GJ3A 2NOAA 2HV8A 2NGRA 4LC1A 1MKYA 3SZRA 4AWXA 1E4VA 4QG7A 5DSZA 5EE5B 4TSFD 1EXMA 3W6PA 1YR7A 3PVSA 2BIFA 1JB1A 1EWRA 2VP4A 1CU1A 1S1CA 2JGNA 4G5SA 1XTSA 3ZD6A 3EXAA 2CLSA 3P27A 4D6PA 4E03A 5JSZA 4JVSB 4ESHA 2JLXA 4IW3B 3R9XA 1LB1B 2DFNA 3CNOA 3HU1A 4Q1BA 2ZI9A 1SVWA 1S3SA 2CHQA 1T3SA 1FP6A 2REBA 2ZRIA 1YZGA 1C1YA 2ATXA 4LBZA 2VP5A 1UKEA 2IX3A 1EESA 3FTQA 4PZLA 4RD1A 2BC9A 1NNEA 2DYKA 3FKQA 5H68A 4JBXA 2F7SA 2FMXA 4BFTA 2P2LA 3K70B 1EFRA 5AJXA 3QKSB 1RKBA 1VCIA 1TQ6A 1YRAA 4LYAA 3FMOB 4MGZR 1L7VC 4BWYA 1KNXA 1DAEA 2X19A 3WNBA 1E1RD 2MSEB 4TLAA 3H2YA 4L8GA 3B1YA 1VTKA 2ZSDA 4PXAA 3TUIC 4D25A 3W3ZB 4DWJA 2QM8A 2NIPA 3D8BA 3QSYA 4FWTA 3HJNA 5FPYA 1S3GA 2B8WA 2R62A 4PQRA 1SQ5A 2QTHA 2IEZA 1DARA 1X6VA 1KI8A 2GJAA 1WE2A 1YVDA 3BH7A 3C15C 4DCSA 2D2FA 3GEHA 3PXGA 2MSDB 5CLQA 3U3JA 1EK0A 3EW9A 4Q01A 3Q8XB 5TB5A 3CPEA 4Q7LA 3TAHA 4WZ6A 3VKGA 4JLPA 4IJMA 4G1UC 4M2LA 2G0TA 5SZJA 1AQYA 1K6MA 3HP1A 4BUJA 5LDDC 5LD2C 4LK2A 3EA0A 3Q3JB 4U7DA 3BH0A 3A8TA 1US8B 2C98A 4LCBA 1WRBA 2O8CA 3REGA 1DO0A 1WP9A 2J9RA 4RD4A 3TSZA 4G3XA 4JMPA 4MQBA 2WJVA 4QRHA 2WMNB 2DR3A 3VTKA 4D4JA 1U90A 2QENA 2C9OA 2R6DA 3GD7A 4D81A 2OFOA 1COWD 1Z47A 2EU8A 2IYSA 2C95A 4HSEA 3TQFA 3IQWA 4B44A 5CLLA 2P0EA 3R9IA 1HQCA 1KO5A 4H9GA 4TLBA 3TJZA 4EPRA 3O8BA 1X8LA 2GF0A 4WW0A 2GKSA 4W5WA 2WKRA 1JBKA 4US1R 1DPFA 5J4LA 1AKYA 2GVZC 1E0KA 2X8AA 2F43B 1G7SA 2EFEB 4AY2A 4XD7A 2QM7A 1OB5A 2IXEA 3MJRA 3QKRA 3GLGE 1AGPA 3MUFA 2DWOA 4KU4A 3T1OA 5IHPA 5GADl 4Q4LA 1DS6A 3G0HA 3MFYA 4D4LA 2F6RA 5JI3E 5E95A 3KQHA 4A0RA 3B85A 1RRCA 3I5XA 3K0SA 1GP2A 1SGWA 5UKDA 1OT3A 1VYVA 1F6BA 1G41A 1XBTA 2W0MA 3CB4A 2HXSA 2J46A 1HE1C 4IXMA 4A0GA 5KUTA 1G19A 4L4UA 1OXTA 4EJSB 4PZZA 1OFHA 2CHGA 5L8VA 1E3MA 1KSJA 1Z83A 3FDIA 2C96A 4MUBA 2FSIA 4O25A 4P0TA 5GJCA 3SYNA 1OH7A 1H8EA 1RRFA 1Z0DA 2C03A 4A1FA 3GCGA 3KXIA 1E2NA 3MWKA 1OW3B 3VR2A 3GJ5A 2IYWA 4BRWA 3U44B 3I32A 1RJ9A 1ELOA 4C7OA 1G291 2GRJA 4PC3A 2I3BA 1NLYA 2WPDA 2WSMA 3GJ0A 2Q21A 4EUNA 1FZQA 4LJ6A 1P62B 2AWNA 1W4AA 2XNDD 4HAYA 3RABA 5C1BA 5KDDA 4RVCA 1TTTA 1KDTA 2WWHA 4AKEA 4JS0A 2ORWA 1FP7A 4JSYA 3UKDA 4EPWA 2W0SA 2PLRA 2CHVA 3BAFA 1C4OA 5FPSA 4WA7A 4JLJA 2QPOA 2OFXA 3KKNA 2WMOB 3H86A 4BGDA 1SHKA 4A9AA 5K8LA 1TUIA 4BFUA 1E1QA 4F38A 5HE8A 4QHTA 3LA6A 5G3YA 4URXR 2ZI3A 3QXJA 1N3BA 1ZC4A 4RCYA 3OF5A 2FFAA 4BFYA 4LPSA 4M1KA 4BLRA 3I61A 1NLZA 2FDCA 4AYTA 2X2FA 3CPJB 2Q0HA 3A36A 721PA 4JLBA 3EPKA 2G1JA 2IEYA 3ZJYA 3FPAA 5GJWC 1OHHD 1VG9B 3D6TB 2WVJA 3I5YA 1D2NA 4U02A 5M04A 1LS1A 2QRNA 4Q02A 4BZXA 3LH5A 1NVWQ 3H0KA 3LO5A 1FFHA 4OYHA 1LS6A 4Q1FA 1E79D 2CL7X 5CDFE 1TF7A 4Y0VA 1SXJB 4IVRA 4IOLA 3TW8B 4ITRC 4MKFA 1HY3A 3ZVMA 4A15A 3A4LA 3CH4B 1KI9A 4B3FX 4KI0A 3KKMA 5DYIA 1M74A 4LJYA 2O8FA 2WZQA 3DMDA 4DSNA 4DLSA 3RC8A 3OAAD 3Q72A 4GT1A 2QSYA 2YNMA 4Q47A 3QKTA 3BFVA 3C41J 2ZI7A 3TK1A 4Q9LA 1HV8A 3U3KA 1GL6A 2E87A 1JQJC 1NY5A 3DEFA 2OXCA 2JJ8A 4YLGA 2UKDA 3KJHA 3EPHA 2R9VA 4K8OA 1P73A 5DE3A 5L3QA 3K70D 4PPGA 3WMEA 4EIWA 3G5UA 1XZQA 4KVAA 2W2VA 3S1AB 4EJSC 5FPKA 5JHHB 1SVMA 4OHYA 2HLDA 1NVXQ 4MGYR 2XXAB 5FTNA 4OQNA 3ICEA 3L2OB 4BLPA 4HATA 2WWFA 2VHTA 5AWFC 4N0DA 4M9XA 3EZ6A 3LBIA 1II9A 4K81B 4NKRA 2YWGA 2AX4A 4PC6A 1G5TA 5HE9A 5B2ZA 3UATA 4YDHB 4BFZA 2PZFA 1VMAA 1OH6A 1IBRA 2QP9X 2F3RA 2ZRFA 4D0GA 1G6OA 4FMDB 5EUQB 1D9ZA 1P2VA 2QT1A 2N42A 2ZTSA 4IDQA 4BZQA 4F93B 5E3HA 5FFMA 3NC0C 3OAAA 5CM9C 2G3YA 1U9IA 3AEZA 2CBZA 1D6JA 2CJWA 2VHQA 1T91A 4C0AC 4RFVA 2QROA 2XNSA 4A8JB 3L0IB 1G5PA 4G5OA 1XCGB 1I4TD 5E7IA 4OQXA 4M9ZA 3GFPA 1CJVC 3NH6A 2H5EA 4LHWA 2ZYWX 2O8DA 5CYPA 4ZKDA 2DB3A 2YOGA 3A1WA 1ZCAA 2FFHA 2CL0X 3ECCA 3KXLA 1EX6A 1KJYA 1XDBA 4HDQB 2GA8A 2HLDD 4JLMA 4DLWA 5H70A 4GZMA 2J7KA 4M4SA 3GLGA 3UMRA 1T5LA 4JBYA 1NG9A 4DVGA 1UKYA 1JPJA 2OZEA 2AL7A 1MO3A 1UADA 5BYJA 5FOTA 2PEYA 3GJ4A 1IONA 1VG1A 3FOZA 3LX5A 4OJKA 3IIMA 4F4CA 1IY0A 1E9DA 1UKZA 4HDOB 4M9QA 1U8YA 2RGXA 1T4GA 3LW8A 4YDSA 1JNYA 1KY2A 5C18A 2WWWA 2XOKA 1A82A 4AYXA 2W2TA 2D4HA 4V0LA 1V43A 2ERYA 3K1JA 4Q4JB 2C9CA 3EZ2A 5JWRA 4FMDF 4HZUA 4LJ9A 1H8HD 1KOFA 1OKKD 2FGKA 2GZAA 4RFSB 3ZD7A 1J8MF 1MABA 4QNMA 1DEKA 3MMPA 3IO3A 3PEUA 2RHMA 1E9RA 5AUQA 2GK7A 2NO6A 3TAUA 1CJUC 4CT4B 4BPBA 4TL7A 3QG1A 1X8KA 1XMIA 1Z0KA 4FWIB 3WP1B 4YXWD 3ADCA 5LD2B 2A9KA 3I3SR 2WAXA 4PSVA 4KFRA 1GG2A 3H1TA 1NKSA 4LJ8A 2IC5A 2O0KA 2GBLC 3MGCA 2Q9BA 2VP6A 2DWPA 3D3QA 4B34A 2P5SA 4KFUA 3DVLA 3WY9A 1S2MA 1XD2A 3DOFA 4NHOA 4LV5B 2FF7A 4PAOA 3GJ7A 1AJEA 3VU9B 5EJEA 4TTPA 3NH9A 1XJ0A 3AF2A 4TQUS 1XTKA 4KITB 4KXFB 1YZUA 1NBMD 2H17A 1ETUA 2BKEA 3EARA 2ZE8A 3IHWA 2ZJOA 1ZD1A 5KSPA 3AP2A 4DDTA 1HH4A 3JVUA 3NBZC 1UBEA 2Z83A 4BFXA 3THWB 2ZS8A 2B7CA 1R0WA 5JWHA 3RHFA 4BE7B 1Z6YA 2J3EA 2Q6TA 3AV0B 2BDTA 4ZI3A 6Q21A 4NYJR 1P7CA 2F55A 1UBCA 2DBYA 2HT1A 3O8RA 4ACAA 2PJZA 2ZR9A 3UWOA 2KE5A 4L15A 3W8NA 3GFTA 4OK6A 3TRFA 1Q57A 4D0LB 2PEZA 3N5CA 3W34A 4PTLA 5SZIA 2KJQA 5CDFA 1E2FA 3THXB 1P61B 4LBWA 1M7BA 2KBEA 4EKDA 3CF2A 4RJLA 4LWZA 4CDGA 3MRSA 3QUSA 2NQ2C 1W48A 3QBVA 1WA5A 2D3WA 4DLZA 3QPVA 3OESA 2VQSA 1XP8A 3W3AA 5BWMA 2GESA 4XTRA 1KNQA 2IS1A 1FTSA 4UNPA 1T5IA 2HCBA 2VA8A 1DAMA 1JEEA 2XB4A 4W7SA 2RGEA 2Q3HA 3IDQA 1E2JA 3U4QB 1CS4C 5DN6D 2PT7A 2ZUBA 2J0QA 4M1WA 3MSXA 2ZRCA 5EQTA 1IN8A 3L82B 1WXQA 4DSUA 4I99A 4IOMA 5ANRB 2NMVA 5JECA 3PR1A 3QF4A 4QGFA 1KJZA 1G1MA 5F98A 2IW3A 4NE2A 5B58C 3R7WB 2QAGA 1U0JA 1XF9A 2GAOA 4NCKA 4A2WA 4M9SA 1GNQA 5GVSA 2VLIA 3R20A 1KK1A 5FTJA 3MJHA 1IXZA 4ABYA 3WP0A 1PVOA 1YZKA 3K9HA 2BEJA 4LYHA 2EVWX 2JA1A 3HU2A 4QOSA 1XPRA 4B48A 3UXMA 1C9KA 1YZLA 1NMYA 1GAJA 3NVAA 4RCZA 5TARA 2KBFA 1JECA 4TQ9A 5C2JB 2IHBA 4YMVA 2CDNA 4KSCA 4LPKA 3U3OA 4US2R 4GFDA 3M1IA 2PCLA 4IXNA 1A5TA 2CNWA 3K53A 1TUEA 4DLUA 4EPYA 1M7GA 4BRUA 2IS4A 4EQ6B 2FU5C 2A3RA 3SI7A 4BZPA 2QBYA 2GILA 2VO1A 3B8HA 3CWZA 2BMFA 3ZS8A 1UFQA 5JSZB 2GXAA 5C46F 1NMZA 4EDHA 4G5GA 3AVUA 2Q9AA 2ATVA 2AWOA 4LC0A 2CCGA 2V7QD 4Q7KA 1Z22A 4KJZA 5JI2E 3QKUA 2F1HA 2UZIR 5DHFA 1Q1ZA 1UJ2A 1W44A 2CK3D 2ZJYA 3VR1A 3JZAA 5L3QB 5G40A 1WBDA 4C2UA 1P9RA 1N2CE 3VHLB 3VNVA 1OFTA 1TEVA 1BO6A 3ZYCA 3QNUA 5JEDA 5L3VA 4CEIB 1VPLA 3NBFA 3THYB 2ODNA 4ASUD 3R9WA 1MH1A 2RGAA 1UEIA 1SXJA 2IYXA 2REXB 3IO5A 1FQKA 3OIUA 4MYTA 3W90A 3F5FA 4KCGA 3IKJA 4C0KA 4CRWB 3ZLJA 1XMJA 4LHVA 1GRRA 2HYDA 2XJ4A 1E6CA 2IL1A 3GEEA 3Q9LA 5AJYA 4HEJA 2VL7A 1XD9A 2DY1A 1KI4A 3BGWA 4Q9HA 3Q85A 5JEEA 2QI9C 4TMXA 2BM1A 2W6IA 4WXPA 1UDWA 2CNWD 1RVDA 1TF2A 2AK2A 2AXNA 1E9FA 4HLUC 4CEJB 2VEDA 1E0AA 1OH5A 2NO0A 1XX6A 3AVXA 4D4KA 3ZH9B 3D31A 1DAHA 2CCKA 3L0OA 3SYKA 2RGNA 4OHWA 5EP2A 2J5XA 2OLJA 2ZEJA 4QGGA 1ZU4A 3GLHB 4G5QA 4X8HA 5DI9A 3K70C 5DO9A 4KYUA 5C4MA 2ZRMA 1KYIA 1G4UR 2GHIA 5LPNA 5FPTA 1G17A 4Q4AA 4XSGA 1FQJA 2BMJA 3U7GA 3U4QA 3ZDQA 1TQ2A 5CITA 1HE8B 2Q3MA 4P4SB 4LHYA 1ZJ6A 4M1OA 4NPHA 5AUNB 5CB8A 3CNNA 3PITA 2HYIC 3K0AA 3PFIA 3ZZTA 3EIQA 1DO2A 1RC8A 2FN4A 2ORIA 1XEWX 4B32A 2RGNC 4DDWA 2AN9A 2Z6VA 3WRXC 3VQTA 2P6RA 1RRPA 4FINA 4KFTA 3K0FA 3EIEA 1P2SA 4ZV4A 2WWXA 3BWDD 2W6ID 5H1YA 4B2PA 1F2TB 4UXHA 5EXTA 4HAZA 4EJSA 3ZVLA 2ZI4A 1CJMA 3BXZA 5F3WB 2O8BA 2C04A 4B33A 3BBPA 3AB3A 3NHAA 2R6FA 2GXSA 4Q1DA 2CVFA 1UBGA 4B73A 3PUZA 4TLDA 4ARZA 1DAKA 4CZ2A 3AKEA 1UBFA 2B21A 2JIZD 1GFIA 1RJ9B 3LLUA 5SZKB 5F9HA 1KJWA 2N1BA 2OEPA 2ZRJA 2ASEA 2QTFA 2BHRA 1KAOA 1MABB 3UMSA 4DDUA 2YHSA 3MWLA 1NIJA 2RH5A 2BV3A 1ZIPA 2EFHB 5KTYA 1VECA 1LNZA 2ZR7A 3QXHA 3V4RA 4L5BA 2VH5R 3FGNA 4PO8A 4P4UA 2WAYA 2IUSA 2VF8A 1NI3A 2BBSA 4L16A 5E4FA 1KTVA 3X1WA 2ORVA 4P4TA 3ZIAD 2QBYB 3NDPA 4DCTA 2G9NA 2GJ9A 3LRPA 4ESVA 5AR1A 1T3LA 2J0VA 2J7PA 4RD3A 5HCNA 1GM5A 4LJAA 3GPLA 5JS8A 1JR3E 1IJFA 1F2UB 4Q1CA 4B3GA 1FMLA 2XEXA 1S96A 1CRQA 1AS2A 2OSBA 3B1VA 4NCHA 3B5JA 3W8RA 1ZM4A 3X1ZA 1VCMA 1NKTA 2O8CB 4QC2A 1E2QA 2JIZA 2HJGA 2JDID 1ZIOA 2OBMA 1I4DD 5AUOB 3OIYA 5H8WA 2JLWA 4M8NE 4PPFA 3KB1A 1VIAA 4GOXA 2ZAMA 4RZ2A 4GMDA 3GLIA 5J47A 1DOAA 2Z43A 5HZHA 3DKVA 3C5HA 1OYWA 2ZETA 1W7AA 3NIBA 4TN1A 1YQTA 1ZC3A 3ZZUA 1XTIA 3FFBA 1R10A 2C77A 5EP4A 3IPXA 4WAUA 4DIEA 1KO1A 4ZCIA 3AVTA 1XRJA 3PG5A 4V0KA 1MO6A 3TSWA 5KYKA 1TQ4A 2IXGA 1KK2A 1GWNA 1W4BA 2Z0MA 1A2KC 3RRYA 3UPUA 1GUAA 2G77B 4C9BA 1VCNA 4XTCS 2EWWA 2FPKA 1G7RA 2CMKA 3KQUA 3BC1A 1UAAA 1B23P 3K0EA 1NSTA 2HCJB 1S1MA 3VR3A 3RS2A 1Z6GA 4AG5A 3DO6A 3CRMA 2G6BA 4M1TA 2QU8A 1KDOA 1G3MA 4F7WA 4HAXA 1EG7A 4MKHA 4X8LA 3SJBA 4YQFA 3B9PA 5DNYB 5HKKD 4Q48A 1GRNA 3U6KA 1W46A 3IEUA 2IS2A 2VSXA 4C0JA 1YR8A 2XXAA 2EYUA 5JJKA 3I73A 3CKLA 5KNBA 2QNRA 1J90A 1E0SA 3IIJA 1SKYE 5DIFA 4XSHA 4TZ6A 1WB9A 3MWYW 4HZIA 4TLCA 4B75A 3SJAA 1ZNYA 4YMTA 1IN6A 4PQFA 3VR5A 1Q3HA 3FE2A 2FSGA 4NBSA 1RZ3A 3GMTA 4HB0A 4UJ5A 5ELXA 1SXJE 1VCOA 4D80A 2A78A 1CLUA 4TYYA 1TU3A 2F1IA 2OCBA 4LYFA 1T9HA 3AGQA 5DI3A 2KI5A 1IY1A 4DSTA 3RDPA 1IHUA 1YKSA 3PIRA 3RSOA 2GF9A 2QSZA 2XB2A 1Y63A 1PLJA 1TPZA 2HT6A 3CRQA 3AM1A 4TMKA 4DLXA 1U9IC 4C3ZA 2PL3A 2RGBA 2WSSA 1N6RA 3FMPB 3DL0A 2OILA 4NCIA 4B3CA 4M1MA 4FN5A 4S2EA 1ESNA 1ANKA 2W58A 3U3MA 1G6HA 4BASA 3BB3A 1KSFX 1JI0A 4EFMA 3CWQA 4EQ6A 2R44A 1NN3A 1NLFA 1R0YA 3R8CA 2ZSAA 3WHKA 2AHOA 8OHMA 1JR6A 4N1AA 4ZDKA 1U98A 3QOFA 4PC2A 3EX7C 4B3XA 2X77A 1IJEA 5FTKA 1TADA 3M6AA 2IYYA 3NG1A 3I92A 4V02A 5FL7A 5FR2A 2Q3FA 4DUGA 2FPLA 3KQLA 4XIGS 1KI6A 1SZPA 5DGXA 1E2GA 2GWHA 3U6BA 3ZQ6A 5FI1B 2PX3A 1P5ZB 1UF9A 1W49A 2W00A 2XZOA 4WZAE 1S8FA 2VP9A 1E32A 4JLAA 4ZO4A 3O47A 2DWQA 4CEJA 4E07A 2AD1A 4JVLA 4KV9A 2RCNA 3B1ZA 1OXUA 2V1XA 3U60B 1R0ZA 1XPOA 3NBYC 4NCNA 4OI4A 3J81k 3A1SA 1ZU5A 1W36B 3QEOA 2V6IA 1M2OB 3HPRA 4PR0A 2D62A 4M21A 1OB2A 1QVRA 1E9EA 1F48A 3V00A 1BS1A 3TBKA 4HYYA 3JVVA 1N5KA 3LY5A 4PC7A 1DBSA 2YVUA 2A5FA 3EZFA 3CLVA 3DKPA 1VDZA 3KFVA 3LFUA 3LV8A 2IUUA 1JR3A 2HDNB 3A1TA 5F9FA 2EFCB 2ZPTX 4V03A 2C9YA 4MYUA 1HYQA 2ZI5A 4HDCA 1T8UA 2BJVA 2ODBA 3ASYA 4LV6A 1VKJA 5KNDA 2CJWB 4LSGA 3T5DA 5DLQC 2VHJA 3N2EA 3AF3A 4QGHA 3GLIE 2IBMA 1EFHA 4ZKEA 3FHTA 2VYFA 4LJ7A 1QHHA 1B0UA 4Q1EA 1I4LD 1Z29A 1TL7C 3M0EA 4NCJA 3SHWA 4TZ0A 1N6PA 1U0LA 4DCUA 4H1VA 2MMCA 4PHGA 1E9CA 5LBIA 4X8OA 5K8TA 1E9BA 4QBHA 2WWYA 4CT5A 4UJ3A 1RE0A 3CRW1 3L8YA 1US8A 5K8UA 2QE7A 4DDVA 4YONB 2PBRA 4BLQA 2YV5A 4QNRA 2JJ1A 3LLMA 4DCNA 1A1VA 1Z0AA 2FSFA 1JR3D 2OESA 2TMKA 3BJIC 4X8MA 1Z8FA 3WNDA 5KNCA 1UEJA 5EXPA 3KFXA 3BOSA 1PV4A 1TU4A 1U94A 1GRQA 2WJIA 3SJCA 4RZ3A 5E7JA 1IN7A 3MD0A 5K8IA 4JT4A 2H18A 3WMFA 4D82A 3NKVA 4BEJA 2VP0A 1FW6A 3BFKA 2CXXA 4AIIA 2WJJA 1YE8A 4GI7A 1WQ1R 4DLRA 2DPXA 4MUAA 4PPNA 5A5GA 4LRWA 1O3YA 1WDTA 2ZXUA 3OIWA 5EE3A 2ZS9A 3A1VA 2Z4RA 4JLDA 4MH0R 1N6LA 3R8FA 1HT2E 3RS3A 2GTPA 5J4HA 4HB3A 4UNQA 1FPMA 1LFDB 4IRUB 5CK4A 5A4JA 3LVRE 3WYGA 3T61A 3PUYA 4B71A 1NJFA 3UMFA 1SULA 2A7QA 2QE7D 2XSZD 2QMEA 1G7CA 2ZVPX 1BKDR 2ZVQX 3IGFA 4W5HA 4XVUA 2UVQA 1R0XA 4R2HA 3IPYA 1OIWA 4HI0E 2IYUA 4DRZA 1JEDA 1HA3A 2XTNA 1KHTA 2IK8A 1NL3A 2F9MA 1RYFA 4PSKA 3E2IA 4BFWA 1J2JA 1QBKC 2OBLA 1LTQA 2BVNA 2YZ2A 4AKHA 3UANA 1E9SA 1H65A 1JXMA 2RGCA 4FD2A 3Q7QA 4NDZA 3KJEA 2DCUA 1FOEB 4A6PA 4CVNA 2BM0A 4C2TA 2XGJA 3U44A 1O87A 4MKIA 4C7OB 2Z4SA 5J4VA 2QP3A 2FZLA 3A4NA 2ZJBA 3UIEA 3GLFB 5J4YA 1EFRD 2ZIAA 1W36C 1EFUA 2XAUA 4FIDA 5KHOC 3O8CA 1GNRA 5AK0A 4TMZA 1KMHB 3THWA 1D5CA 2GNOA 1OH8A 2ZRNA 4K46A 821PA 2AFIE 1XXHB 1CIPA 2ZRAA 5FL3A 3LAWA 2ZROA 1AA9A 1RW4A 4BEBA 1DAFA 1K5GA 1KI1A 3CNLA 1NN5A 4OQFA 1XB2A 2AFHE 3I4LA 2GAAA 3QJYA 4IOKA 3BH6A 3OE7A 4C0QC 2ZRGA 2W6JA 1X3SA 3CX6A 3C4JA 4KAXA 5JS7A 1S4QA 3IHLA 1CJKC 4WZBE 3ND9A 4GBMA 1KAGA 1KSHA 2F43A 1A4RA 3X1DA 1VYUA 2QORA 1U0HC 4MA4A 1ZBDA 1KI7A 2P6NA 3AH8A 2OAQ1 2YKGA 2ZUDA 1ZAKA 4Z8XA 3OFND 4JLVA 1VYTA 4DSOA 2A2ZA 1J8YF 1Z6AA 5CK5A 3C16C 1Q3TA 1NIPA 2KWIA 3HYTA 4JKYA 1W47A 1E2HA 1N5LA 2IYRA 2CCJA 4LI0A 4JL8A 2IF0A 3B1WA 1COWA 1EFTA 1R5NA 4R98A 2P6UA 2AXPA 4TQAA 3K0AB 2ZJ2A 3RC3A 3VR4A 3ZQJA 3THYA 3AVWA 1UKVY 3FMFA 4R9UC 1OXXK 3TGPA 2MSCB 2GXUA 4II7A 3R7WA 4XD7D 2DFKB 4IVQA 2H16A 1FUKA 1GKIA 2C78A 3UG6A 3AF4A 2VSOA 1GVNB 1CTQA 2F1JA 3KKPA 4NU0A 3KX2A 3KJIA 4JL6A 2QQEA 1OFUX 2VPPA 3OFNA 5L3RA 4B47A 3RWOA 1ZW6A 1CR2A 2F9LA 4QGAA 5JMTA 4TL6A 4Q5IA 1LW7A 4A2QA 5IK2A 1W0KD 2NO7A 4JYBA 1OIXA 2ZSEA 1NVUQ 1KDRA 1CR1A 2QMUA 1E96A 1NF3A 3QI2A 4O2RA 2CLDX 1Z07A 2QA5A 4S35A 2GCNA 5LB2A 4US0R 1A2BA 3K09A 1Z0FA 2V1UA 4L9WA 4H1UA 3CONA 2X1VA 1OJLA 4E22A 1N25A 5TV2A 3SN6A 2OBNA 1W0JA 1E0JA 1H8ED 2VSFA 2GEVA 1W4CA 1TEXA 1YRBA 3RS4A 4DCVA 1U2RA 4NYJQ 5FUVA 3TSOA 2V3CC 3F8TA 1JAIA 4A8JA 1OLOA 1TMKA 3OHMA 2QUZA 5KU1A 3HYRA 2WPDD 1RYHA 2QZ4A 3KZ1E 2OHFA 4HB2A 2XNDA 4CEIA 4JLKA 3QIAA 3TUZC 4POAA 2W2XA 5KOYA 2ZE5A 1TNDA 2ZQ5A 2B92A 4M1YA 3ADKA 2BMDA 1NRJB 4EPXA 1E9AA 4U5XA 4ARZB 1G8GA 2PT5A 1N6IA 3WYFA 3DZ8A 5JHGB 3TIFA 4EPTA 4MRPA 5IK2D 1W0KA 1G8PA 3BS4A 2KSQA 1Q21A 1SVIA 2V8OA 4IFEA 5CYOA 1QHIA 1GTVA 2O5VA 3PV0A 4HLCA 3X1XA 1SVLA 3K9LA 1E1QD 4Q1AA 4V0ME 4IFBA 1GOTA 4WBSA 3U7HB 3RAPR 3LXXA 3VKWA 4AK9A 1W0JD 3DPUA 4RD2A 4HLDA 3AKCA 2XITA 5JLJA 5L3SA 5EZ5A 1EGAA 1Z0JA 3SU8A 2O8FB 4LX0A 1XD2B 5CIWA
chains in the Genus database with same CATH superfamily
3A10A 2RBKA 1NUHA 3JX9A 2AZTA 4H3HB 1YMQA 3GL9A 4HYQA 2OA0A 3EIOA 2H1OA 4C4PA 2BFBA 4DN6A 3CZPA 3IKVA 1OPRA 3PD0A 5ESXA 5SYAA 2IWRA 2O07A 4M1ZA 1C9NA 1BNCA 1LK7A 4IS2A 5JPIA 4C7KA 1BFUA 3SEZA 3UBTA 1R4AA 1HLFA 3PCRB 2FV8A 5LBUA 4ND8A 4D46A 4GRAA 3FPEA 4Q4HB 4XW2A 2C88A 4OXIA 2IYLD 3M33A 1VPWA 4BE4A 3DZDA 5I4BA 1RXIA 2RAFA 2V7WA 2UV8A 4MZXA 5KYWA 1N8SA 2FEAA 4J9VA 4MV5A 3SBOA 3T4XA 2BWJA 4MWOA 121PA 4FW9A 4NENA 1SZJG 2WIGA 2XGMA 2GEDA 1X2BA 1M2KA 5EKSA 1GTSA 1AZSC 3KLPX 4I1VA 4XVRA 4LZZA 4LSZA 2W6NA 3N2ZB 1P4GA 2O23A 2R1VB 2E82A 5KDOA 2Y8EA 1A2QA 3SJUA 4J1SA 4JJGA 5T5QA 5KSZA 4U6QA 1IQPA 1TAGA 1JR4A 4RVOA 3MLBA 1PWEA 1XFDA 3C3YA 3V4FA 3VU9A 2HIGA 2R00A 3BIWA 3WKCA 1X9IA 2JH9A 5B2EA 1P6QA 2YVKA 3L4BC 3WGHA 1G8JA 1PJ4A 3L7YA 1M73E 4TYWA 3OM0A 2RH8A 4K7JA 4DF3A 1NPDA 1SHZA 4P22A 1UDAA 1RI1A 3H65A 4Z1MA 4ROSA 2OB2A 2G5TA 1D4FA 1GSIA 5TX7A 4LF6B 3C3XA 3HR7A 2B2XA 3GQBA 4A92A 4KHPB 3PJDA 2NP6A 1OTYA 5JBQA 4BLOA 2H1LA 4EI9A 4ZDJA 1LBQA 4ZT6A 2HMVA 4ZVUA 3A3NA 1Z16A 4BP1A 1SUWA 2O3SA 2ZYVX 3FNQA 4KQXA 5T41A 5K6RA 4PHHA 1G9XA 3GXBA 4D56A 4U2KA 3HDGA 1I7NA 1VHTA 2GNAA 2Z3WA 1JXOA 2NVOA 5E9AA 1JAHA 3VR5H 2SHKA 2WWIA 4F4JA 5IWAB 4J76A 2ZYGA 1SOMA 3AI2A 5JSYA 1RXUA 2YRXA 4GD3Q 1IOZA 4PONA 2D13A 1QK5A 3ONEA 4ZU6X 3ACCA 1NI5A 1DKRA 1R6XA 3KT3A 4IDPA 3VR6D 1E2DA 4GKAA 5AOBA 1PLLA 3WYAA 3U0VA 4CETA 3DR5A 1YRQA 1E7SA 2XWQA 4BP9A 2OL4A 4DT1B 1OHHA 2PV0A 3FW1A 4ZIRA 2C2BA 6REQA 4F2HA 1ZK0A 2AOTB 2QTCA 4RQTA 4HDMB 2V54A 1SBTA 4CIVA 4XIFA 3DO8A 2L19A 4MDEA 2ZIFA 3Q40A 2PLAA 2G7ZA 4Z1MD 3JYQA 1ZH0A 3O2QB 4JC0A 4FE3A 4R3WA 2R6R1 3W2GA 2G0NA 4IXTA 1QFZA 4W6ZA 1TZMA 2P4SA 2JJ2D 3E9QA 2QYTA 1R37A 3G17A 2YWJA 3LBYA 4IIGA 2B1RA 1P2UA 2NSLA 5C5CA 1RM0A 3MWDA 1OGIA 4YP5A 3OIVA 2X40A 1L5QA 4PAMA 4AJ4A 4ZOLA 4MVJF 5CYGA 3F74A 2ERXA 5BSKA 1SRRA 3HVRA 1E8DA 2DSNA 5LMZA 2R8ZA 2H2DA 4JI6B 4YUXA 2G83A 4IWYA 2YRFA 4FR5A 5HPYB 1BCSA 4IBOA 1LBSA 3GNLA 4GP9A 4N3AA 2DUWA 4PGAA 3AUYA 3SS8A 3WLTA 1QRRA 1QYIA 3NWOA 1PGOA 4U2CA 4CM4A 5TPZD 3NALA 4HL6A 2YJTD 4YHBA 3QJGA 2NT4A 1J2RA 3SHVA 3TKAA 3HACA 1NUAA 2PIAA 4I1SA 1GPUA 3H9JA 3ND8A 3CUEF 5IN4A 4UBIA 1NMEA 5ITVA 3TH5A 2C9MA 4FFPA 1TX4B 2ZSHA 3KQNA 3N53A 3HG7A 2BF4A 4F1WA 1M2FA 2B1IA 4JB0A 3USES 2E55A 1CUCA 2FW6A 4ILEA 4N3CA 1JE1A 2IKSA 4I55B 1T8TA 2XZLA 1M9NA 2WFLB 1VHLA 2ZXEA 4KBFA 2J30A 4NAVA 4CKWA 4MB2A 1NURA 2A9VA 2I1QA 1QZXA 2UU9B 3B6EA 3CBQA 4P4NA 3ZU2A 2OE2A 1AZTA 2C8LA 1CZKA 4GX1A 3E5HA 3RJZA 1G8YA 4NMMA 2WUWE 5IJ9A 2F3TA 1P1BA 4KXWA 5DCYA 2GZ1A 4J2TA 3ASUA 4IIVA 1QGYA 1YRYE 1M6YA 1UPUA 1AGRA 2PR2A 2V7VA 2PCJA 3MAGA 1L5OA 5ITSA 4Q18A 1Y6FA 2WJZB 2JASA 3ORHA 2EJVA 4EWLA 1MCZA 1J1ZA 5IP5A 1BVUA 1PJQA 5CCEA 4UPVA 2HREA 4TYPA 4FFMA 3K30A 3LSTA 1SR8A 3N2GA 4MI1A 4Z7JA 3GGSA 4KGDA 4UKDA 2V7GA 4TUYA 1BDJA 3TSYA 3OCJA 4HDRA 4JBHA 1TKBA 4IQ8A 1O6GA 4O59O 1D3AA 2VPQA 2IHNA 4OKIA 4WXRA 5B3JA 1XU7A 2QP4A 1Q12A 2BFMA 2Q5LA 3NNNA 2O0JA 4WKCA 5LA6B 4AYWA 3TG8A 3KYDB 5I5GA 3U1BA 4LWPA 1VSTA 1WQ4A 1N0IA 3HS3A 3WGYA 1MO5A 4QUAA 4A73A 2WICA 2OENG 4MSUA 1E59A 3G82C 1NN1A 5DLEA 4LYGA 5AVOA 4B6QA 1E6UA 1V1MA 2QN8A 2HRBA 1RPZA 1SKQA 4G36A 4B0OA 1PFQA 2ZULA 4K1LA 4QQFA 2FE4A 5TDHA 3D1VA 1ORVA 5FWDA 1M0WA 4RPLA 4Z51A 3T1YB 4QAQA 8GPBA 1BVYF 4QDKA 4LYJA 2QG9A 5IDYA 5CFZA 1SPBS 1T8RA 3JYNA 5D1NA 5LP6F 1Y9AA 1Q0QA 1P1FA 3LGAA 1PE0A 4MK4A 4CTMA 3OIGA 3ZE0B 3L7IA 4BMYA 2PUCA 1OKKA 1T8PA 1G18A 5FUVA 2YIMA 3B7PA 5BXQC 4OLAA 3F67A 1JUDA 1H5UA 4F12A 3DTYA 1UR5A 4RETA 4DYDA 1A9XA 4PLGA 3ZBUA 4GI3A 1M6EX 1KZ7B 4R41A 4RV9A 5CNMA 4CWAA 1PUJA 5JCOC 1T9GS 1KVTA 1JFVA 1DP4A 4IKEA 4X97A 5EE1A 2RHDA 2VJOA 3PPXA 4PPQA 1EGHA 2FW0A 3FKSA 3KJGA 4N0MA 5CM8B 4C5AA 4E7OA 3VC7A 1BC5A 2WKQA 4MDHA 1PJRA 1BU8A 5DFAA 1NASA 1R8SA 5KDLA 3HGTA 4D9NA 4YY3B 3O8DA 4D1YA 1XTBA 1Q20A 2J3HA 3C3EA 2DGDA 1P0IA 3WLLA 2GETA 4INAA 1HE4A 1EWKA 4JI7B 1Q0TA 4XGKA 1U4SA 1EVJA 2CLHB 2Q8NA 4UVIA 3IERA 3NOVA 4FFBA 4L2IA 4BX2A 3TL2A 4Q00A 1QHSA 2GEFA 1MA3A 1D5WA 4NATA 4UD2A 3REFA 4M83A 3FB4A 3C1AA 5ICSA 1Z6TA 4ZOEA 1G8FA 1SCBA 5L45A 3QEBZ 1T8WA 2LKCA 4ZDIA 5GQSA 3VZDA 3VVMA 4DMRA 4UDOA 4XVHA 4MYCA 3G9XA 2V7UA 4M98A 2YZKA 2QNIA 2RGYA 3DD5A 4HJRA 2O5EA 2WBLC 4PX3A 1EMDA 1QHYA 2BEVA 2YV3A 1PT6A 2FNAA 2RI0A 4CEHB 5JJIA 2GDZA 5IRCD 2ZVJA 2ZYAA 2YWRA 2FG6C 1CB0A 3F0TA 1DBQA 1RYDA 3ISJA 2V5VA 4LK3A 4QPJC 1RM4A 1F7UA 4B2YA 5KMGA 1JKFA 2HKIA 1Z2DA 2QGZA 3GN1A 1PL8A 3OCZA 1DIAA 4Q19A 1CY2A 2CE7A 2GXQA 5BQ5A 4A0SA 3NCTA 1WKVA 4JD5A 3SR3A 1Y33E 1I0ZA 2XUIA 2ZYUX 3ZY3A 5BR4A 3EIXA 2I6GA 2O06A 1QIDA 3COVA 3OZGA 4QJIA 3QX9A 2H8KA 1HLDA 1CR0A 1XZKA 2P4UA 2RB4A 4N7BA 4PC1A 4PO9A 2FUNB 3TR5A 3QENA 5JASA 4ZO7A 4JJKA 4I0WB 1DQSA 1TVCA 3JD3A 1NYLA 2C3MA 3W9UA 1KBZA 1ZHFA 3EDQA 4AX4A 3QKRB 3R3XA 4IDNA 4DJTA 4IG9A 2SKDA 3LHDA 4MCHA 5IUKC 2O7QA 1BW9A 3EG9A 3SF8B 1E3JA 4FQ8A 4RELA 4ENWA 1CF4A 1Y8RA 1SU4A 2D00A 2P5TB 1N6KA 3Q10A 4Q21A 4Y7CA 3B60A 5F64A 4TXHA 1VMIA 4D9FA 5HRUA 3KDSE 2ZTVA 1BH6A 1NDUA 2W2PA 1W85B 1KFKB 3P0RA 1U02A 1YUBA 3I9JA 3KXPA 3PWKA 1SXJD 1WZCA 3GG9A 2QAJA 3TRJA 1FY2A 1ZUNB 5EPEA 5DWDA 2J9FB 3EVNA 3FVQA 4DS3A 2FW8A 2HUPA 2XF2A 3EG5A 1A98A 3GLFE 1OSNA 4KOEC 2HIAA 2ZRLA 4LI3X 4WXMA 3SFVA 1DKOA 1QGAA 5AMXA 4O4HB 3QVUA 4B35A 2E4UA 2HADA 2MSNA 1G8HA 1R27A 3QGMA 5TXGA 4C4SA 4F2WA 3EN0A 3L79A 3P9YA 2FFQA 2WUEA 3DNFA 5AKXA 3TLGB 3AY7A 2VQEB 3TAXA 3U1VA 3DDUA 2PUFA 1JSRA 2D7CA 2EARA 1H6AA 5SZHB 2WJ6A 4WZAA 3UAWA 3R3VA 2IPLA 3NPMA 3LCVB 4PGMA 1RU3A 3JVEA 4WNYA 5BYAA 1TJ4A 3LVQE 4BGUA 1FX0B 2ZRDA 4MYRA 1SUFA 1OTXA 1P0CA 1K1EA 1NVVR 1X14A 4OGKA 1WW2A 2GAFA 2VH1A 4YLYA 4M9CA 4EFNA 1BYIA 1P5RA 2CDBA 2X2EA 2I91A 4PHFA 2J1LA 1C8BA 3NR2A 2JLRA 4IUDS 3AR4A 4P34A 1NW3A 1YZQA 1Z7GA 3L18A 4LXQA 5F73A 4KACA 3ZK7A 2C5HA 1X1BA 4CM3A 4QJ4A 4LDZA 1WETA 3MFQA 3G2PA 4QHYA 4Z8YA 3PGVA 1J7KA 1AQUA 1FNMA 3OEEA 4LJLA 4LY9A 4IIJA 3ZCXA 3T7AA 3H5OA 1GPBA 2V4ZA 2CB0A 3T35A 2R6AA 3R6WA 4K0RA 4PM4A 1RKVA 2QRPA 3OZTA 4GZ6A 1M6NA 4KIWA 3PEWA 3W4IA 1XROA 4KWTA 2VQFB 4OL9A 1E2KA 2IIQA 4P36A 4KMMA 2OOKA 4FJ0A 4JP8A 3ACBA 3VYRB 4E5DA 4Q4JA 4U39A 3DHNA 2EZTA 3IR7A 4O1MA 4M0DA 4R0MA 3VNUA 2AR7A 4FNGA 3MTEA 1RPTA 3IELA 2C1EA 4YAFA 5ALLA 3TNYA 3KYBA 5F2OA 3B89A 221PA 4CW7A 1ZQ9A 2WYHA 1WU7A 2JCYA 4E14A 1LI5A 3HJCA 1LVGA 4Y9SA 5HM8A 3IHKA 5AI8A 4GQAA 3ZWKA 3RC7A 2I4OA 2JGEA 5HRCA 4JVNA 3CX7A 3LK7A 5DNAA 3ZGYA 4XWOA 4KVGA 3BWBA 1HSZA 1ZEJA 2YUIA 3I1FA 3KL2A 4MJ7A 2G17A 4RKEA 2O2CA 4RH1A 5LZ5A 2B4AA 1A5SB 1P4AA 4MDYA 5BW6B 2VTDA 3SYTA 1E4EA 1TLFA 5LDHA 1BYUA 1ZD5A 1N3LA 2YYYA 2XVYA 2X0JA 3JATA 4JGGA 4JUCA 4ISCA 2ECOA 4XUDA 1WV0A 2HPAA 5AXBA 4FKZA 3ZN2A 4J3JA 5BMVA 3U7FB 2NPFA 3WXMA 2GN2A 1II8B 3WGOA 1TQHA 4PINA 4UTPA 1JMKC 3BE8A 1A72A 2V6FA 4D2IA 1JFSA 5AVVA 3TFOA 3UWKA 3SVLA 1B3RA 1Z4IA 2XQVA 5A5EA 4EY6A 4MYSA 2POQX 4IEFB 1XYGA 1N8KA 1ZCFA 2C2KA 2NXCA 3KKKA 3RPEA 3U61B 4QRIA 1W85A 4EHHA 1IXYA 1RXWA 4XFJA 1RZVA 2FPXA 4MPDA 3RJTA 1Y48E 3WRVA 3SOPA 3LUGA 3P1JA 1G7TA 1POWA 3NC4A 4KXVA 3H1AA 3OMLA 4P82A 2PBZA 3GB9A 1N1MA 4PSUA 1L4UA 2GK6A 3NM6B 2HMTA 1FNNA 2G1KA 3GZJA 1KR5A 5KJCA 1PR4A 2WE8A 5BRAA 2QY9A 1R0KA 5C31A 4I9HA 2VDMB 4FS3A 4BQRA 4H18A 4A4DA 3M89A 4RJKA 2IUTA 2G4VA 3W5SA 2XMRA 1QO0A 2FJUA 1R5BA 3CF6R 3CLTD 4P58A 1Z6PA 3UWDA 5FBWB 3VX3A 1XEXA 2X8WA 4H6XA 4QO7A 5JYDA 2QAGB 2FF5A 2GQ0A 2R60A 4WL0A 3TQTA 4MHSA 2WB4A 3Q98A 1XWIA 3WGIA 4J1TC 3IBSA 3VVLA 3TTVA 1NPYA 3KTAA 4AY4A 4ZXFA 2UUOA 1E69A 1R5OA 3EZNA 4FC6A 4NZYA 1NMXA 4QWMA 3UC5A 3UGQA 3LBHA 2JAWA 1UC9A 4XWYA 1NN0A 4EX7A 5BWNA 5HKKA 3H8SA 3HZOA 2BZGA 2XOEA 3HJRA 1WHSB 2QX9A 2RAPA 3FNEA 5H3HA 2A5DA 4YRAA 3IV7A 2HK9A 2ZRHA 1IWPB 3IPRA 2QTTA 1W1UA 3WYDA 3MB8A 2QJFA 4TL9A 3WISA 4JAVC 5FI0B 4OJQA 1UFKA 3M5DA 3ZY5A 2GBFA 4L73A 1GEGA 1BMTA 4GWLA 3WRYC 2R3SA 4I9GA 5LNK6 4DQ0A 5AKKA 4DLAA 4IEEA 2NV0A 2BDEA 1N3IA 1ULZA 4JT9A 4KAFA 4P2GA 5EI5A 3WG9A 1P5JA 2P9HA 3OZRA 4H1HA 3UC9A 1QO0D 2PM8A 4Y7DA 2CLCX 3U7JA 3WMXA 1BXRB 2V6GA 3DE3X 3PQ6A 3S8EA 2C2MA 5B7PA 5BUZA 4OOEA 1I3KA 4KNYA 3KU1A 2JHAA 4MGIR 4CKBB 1Q7EA 1ISJA 3CS3A 1O9HA 2H0QA 4IFTA 2P9GA 4PLVA 4RZUA 3TE6A 2G76A 2VZLA 4TWRA 5HBGA 1OZGA 2PKCA 3AG5A 1NP3A 4PWYA 4OATA 2ZZNA 1FSZA 3BTOA 2PRKA 3CH6A 1TTHA 3JQCA 4B3DA 5C53B 1UUFA 3D5EA 4W4TA 4WERA 3SHTA 4BLSA 1CDOA 4WXYB 5ADWA 2BZ1A 3S55A 1XK7A 2UUPA 3GNTA 3RC2A 5K05A 4C14A 4CG1A 1QTQA 3SYRA 3R9KA 1GG5A 3L7AA 2Z9BA 4QFBA 3CVOA 1PDVA 3C3PA 1V16A 3F2VA 2X76A 1K6EA 5JXJA 3NCHA 3QXCA 1RADA 1XNQB 4C76A 3OM9A 1NNLA 4NV3A 2FMTA 1JHQA 4Q9JA 5ALIA 5LA6F 3T95A 2O20A 4BNLA 4YR7A 4UAJA 5LZ2A 3QVLA 1ZO8A 2GCIA 2WJGA 4ZPJA 4YT4A 2OM2A 5F2NA 4R0NA 3BFXA 2UVDA 3GFOA 4PX9A 2CN1A 3LO8A 1HL3A 4EL5A 5K3OA 5H02A 5LUAA 3EDYA 3LBFA 3WAGA 4FLMA 2DTXA 1SB8A 2JC3A 2XD4A 4F71A 1SUDA 5KPDA 4JBLA 3KT6A 2FQ1A 3OJOA 2HK6A 9MHTA 1ZKMA 1KC3A 2YDYA 3T15A 1P7WA 3M2PA 3IA2A 4NECA 3E22A 2ZUTA 2ZE7A 3PX3A 1XA4A 2EJWA 4TRNA 2FQQA 5EXEA 2MMGA 2P67A 4KZKA 3PC3A 1M1NB 5FOSA 4AP9A 3T1QA 1D6NA 4C0BA 3EWAA 3M82A 2Q5FA 4CL2A 1YOVB 1QQTA 1SUBA 1Q44A 3OO1A 2BFCA 5L51A 1IVNA 4LMRA 3PQEA 3A4MA 3HCFA 3I9NA 4RSMA 3ADBA 1H66A 4KP7A 3H11A 1BGVA 1UWVA 5TQ0A 5K45A 5L3SB 1W88A 1O96A 1JJIA 1JPVA 3CRRA 1ZMRA 2NW6A 4OHKA 1TZCA 2FW1A 2VHEA 3BERA 4GHWA 2HJSA 3M4YA 4GAEA 4J75A 3RC9A 4MR9A 4GL4A 2OXFA 1ZVKA 1S3IA 3RSSA 1L1FA 3V9PA 1W93A 1EFCA 4P80A 1ZMBA 1NE2A 3N76A 2HHJA 4RW0A 1T1EA 2OD9A 1CUAA 3K9NA 1DEOA 1KI2A 1LZLA 4NI5A 4Q03A 3JSXA 5TMEA 3X2EA 5JIBA 5LVAA 4AG6A 1CUBA 1P7YA 2NO1A 3CZQA 1UZLA 3AVOA 3EBLA 4O4IA 1J24A 5JO9A 4CIWA 2DKFA 3R41A 2GO7A 3KHKA 4A91A 5IX8A 5L9AA 1MT0A 3V8PA 2C31A 3C48A 3WWCA 1ZINA 3ETGA 4B4KA 2ACEA 1SBCA 2X4IA 3Q8LA 3REQA 4YFVA 3DJFA 1EQAA 3SZOA 3BYZA 5IEJA 1T0PA 4QX6A 3LY8A 3C5EA 1O9BA 1K0UA 1KGDA 4FMCB 1N2CB 1VG0B 1TO1E 2ZREA 2FP4B 1HOTA 3UKOA 1UJBA 2JLUA 1F0KA 3QHQA 2W70A 2OFFA 3WL6A 2I3DA 2VDQB 3B78A 10MHA 1C3OB 3WLNA 3SXUA 1ETHA 3EGEA 2ZXFA 1FTQA 2IZ0A 3RLFA 4DHEA 5C81A 4MI3A 1KU0A 1G6Q1 2XYVA 1X1DA 4MVXA 1JMYA 3BQMB 3P9SA 4MQEA 4UEQA 5ESDA 4HWRA 1V5IA 1VPTA 4NAHA 5E1BA 5IJ9B 1QKJA 3IEIA 4WOPA 1Z2CA 3HK2A 3WLEA 1S3FA 4ERNA 1XZEA 4GPIB 4K6OA 4PF1A 1V8DA 3CJQA 2PMKA 4HMOA 4MICA 4UOQA 3TF5A 1RQRA 2FG7C 5DTMA 3HO8A 4B3TB 3SYMA 4BVGA 1OU4A 3B3GA 2UZ4A 3WJ7A 2I6XA 3HKBB 4RXTA 3WSTA 5D6NA 1JKJA 4NYIQ 4QBIA 3MWDB 4GL2A 1YB1A 2VYND 2XRMA 4KODA 3VPCA 4ZI7A 1E20A 3BBLA 1XTZA 3HCCA 1ECLA 4OQQA 1QH9A 4EF5A 3OOWA 2F64A 3U13A 3WMGA 4OGLA 1NRXA 1Z7WA 1ZS9A 1U6KA 4NV0A 2GJSA 2WZBA 4YRSA 3F90A 1GU7A 4WY2A 4GSYA 1ZVJA 3BXPA 2RAVA 3SE0A 2BSAA 2PMFA 1BGXT 3D6NB 5H82A 1QQ7A 5HVNA 4HAWA 4H1WA 1HOXA 1N9ZA 3FBWA 3NXSA 2VKTA 4GVXA 5AXDA 4BNXA 4YUAA 5C7IO 4TVSA 1LY1A 1BEEA 5BW8A 3VHQA 3CE9A 1Z12A 3UO8B 3B1XA 3A3YA 3AZPA 4O4HF 4DLPA 2PE5A 5DISB 2DCMA 4Y18A 1BJTA 1HLGA 1XVLA 1EK6A 1QGZA 1QIJA 3HDVA 3KSUA 1UP4A 2GBLA 2H2AA 2R68A 2WHRA 5JRJA 2C42A 3OEWA 3UYKA 5C80A 2XSZA 2ZAIA 3F49S 4BIIA 5LXTA 1SXJC 4N3GA 3WOHA 3RAFC 1B3BA 3HKDA 1DOHA 3PRHA 4QYSA 1H6DA 2BKLA 4LSMA 4COOA 3R0IA 3NHPA 1H4VB 1U8ZA 1SOAA 1AVTA 2R48A 1OI3A 4I9FA 1MC4A 1T4MA 1M8PA 3QYPA 4UTZA 4YBZA 4ZC8A 3UA3A 2BYTA 4MB6A 1E3WB 4CQMA 2B7BA 1FP4B 3BG5A 2W22A 3FRJA 3JASA 2NUTA 4BFSA 3CU5A 5J4KA 4JXZA 5COBA 1H4QA 4BAGA 1KS2A 1YULA 3H6KA 5FTMA 3DDCA 4FQ5A 1LSOA 4HAOA 2O8VA 4MO2A 5BY2A 1UBRS 1TKAA 2RCYA 2DHRA 2FDRA 2C7QA 2A9QA 1AK9A 3FWYA 5AJVB 3I83A 4YO7A 4BY9E 4FYWA 2GTHA 5IYZF 3SC2A 2QMZA 1WF6A 3M70A 4DJJA 2IH5A 1VM6A 4YQYA 3D7MA 4JEMA 3PXAA 4EFDA 4G8CA 1GCOA 2PGOA 3AJ9A 1FYDA 3R1IA 4JDUA 2A5JA 1RPJA 4BBAA 3E05A 3MTBA 5FOVA 1Z37A 3UPTA 3CLSC 1NOIA 4PIPA 2NG1A 2GD2A 3WWDA 1Z25A 4JQZA 4ND8B 1NSFA 5I9BA 5TGDA 2C99A 3GP8A 3OCVA 5J5CA 3N0VA 4N01A 4K6MA 2A33A 4YQZA 4DILA 3EVBA 1T5BA 1VE6A 1M8JA 3NONA 3G0IA 3A1NA 2HDHA 1SXHA 4I8XA 4U1RA 3C85A 1D8AA 1XZPA 3OE7D 1ESCA 2P2ZA 3NASA 4QBGB 1JAXA 1B8PA 2I6SA 1EU1A 3FUTA 3PNVA 4L9SA 4U00A 1DBWA 2RH4A 1TVMA 1WCV1 3EQ6A 4AVYA 4DWOA 2F4VB 4IO1A 1JG1A 4XXHA 4REOA 2QL7A 2GCOA 1XTPA 3GA7A 4M1SA 1NYQA 4NEHB 3CMMA 5BV0A 4H4DA 4BV3A 3IUJA 3NTUA 2GCPA 1Z8DA 1SCKA 1RWPA 2BLNA 2P65A 1Y4ZA 4IQFA 4B74A 1F7VA 2WJHA 1GKUB 1REQA 1XQVA 3SCZA 4G8JA 4F3RA 2JARA 1HUQA 4YAWA 4B84A 5CX1B 5H9WA 1C9JA 2IYVA 1NG1A 4RENA 2YL2A 4AROA 1D7OA 1P7ZA 1XHFA 1J06A 4R2IA 3AHIA 1JT9A 5REQB 1L9KA 3RUCA 3PNYA 1ZOOA 1E1RA 2OO3A 1WVGA 4Q3KA 2Q6OA 3SMVA 2VJKA 3NGMA 4ZI7F 3GJ3A 5ITZB 2NOAA 2PU7A 3N8HA 1P3DA 4AN1A 4AWXA 5ITWA 4WMLA 5DX8A 3I9LA 4QQRA 4UD6A 1I3LA 4EG0A 2HBQA 1EXMA 1U8UA 3MTJA 3W6PA 5DBGA 4BNGA 2H9YA 2X8LA 3RJ9A 1JB1A 1EWRA 4RTQA 2IY7A 3DTVA 3MINB 4JY7A 1XTSA 3ZD6A 2JLXA 2CLSA 2JGDA 2VK1A 3NIWA 4ESHA 3IAM1 2AYXA 4H6PA 1DL5A 4H7FA 3HO6A 4IW3B 1LB1B 3NHUA 4XCXA 3WE7A 2Q1WA 1NQVA 1JE0A 4AY5A 4D44A 4HDSA 2ZI9A 2VRNA 3QOXA 3OOJA 4REQA 3G8AA 3AIIA 4TS1A 3WQQA 3MOSA 4R1NA 4Z0HO 1NM5C 4BB9A 4KJXA 3FTQA 3GARA 4QUHA 4H35A 3P5SA 4H7PA 4BJ3A 1GCUA 2GN9A 4JBXA 3OWOA 3N8DA 1UXHA 1A88A 3B70A 1T13A 3LF1A 3LI2A 3TX6A 2NACA 1VCIA 1JEYB 4LYAA 2PUJA 1SC6A 2WP0A 4D4IA 3AR6A 2HSJA 4BWYA 1JFTA 4AMVA 4P8RA 5ICFA 4WNCA 1TIPA 4RDIA 2PKEA 4KE7A 2X19A 5EQFA 5A6VA 5K6AC 1FDTA 2Q6KA 3WNBA 1G55A 4QOGA 1GNSA 2MSEB 5AKYA 4TLAA 5JNRA 2F8MA 1FDWA 3S8MA 2JI7A 1QJCA 2ZSDA 1RFGE 2I9PA 4JN6B 2EF0A 4DWJA 2BTQA 3COYA 1WZIA 3IXLA 4F6CA 3OOHA 4Y6PA 1VL0A 2LBPA 4KUGA 1JHDA 3ICEA 1E7RA 4KNVA 4LE0A 4P92A 5L3ZA 5K2MA 3NANA 1GADO 2HMUA 4PQRA 1CHNA 5E2BA 4DC1A 1ZLXA 2XECA 5JARA 4OFZA 1DARA 3BH7A 2GJAA 3IQHX 1QC5A 1YVDA 1QKKA 2O5RA 3KB8A 4OJTA 2WQZA 3BREA 1YV9A 3AY0A 3V1YA 5CNKA 1FB5A 3EW9A 3KE8A 4YP6A 1DAOA 2O3TA 5TE9A 3T4UA 2B7LA 4IJMA 3GAAA 1RQLA 4G1UC 5IVKA 4MGEA 2BGLA 2P75A 3PWZA 4TMFA 1AQYA 2C5GA 1FPQA 2QR2A 3OE5A 1EXVA 2C7OA 1H2BA 5LD2C 1L4LA 2C2GA 3EA0A 4QQNA 3TZEA 5BSEA 3MEQA 1UT5A 3FJ1A 5NULA 1US8B 2C98A 5AM1A 1WRBA 3V1KA 2YMLA 1DO0A 2J9RA 2R8BA 1NZFA 3C1OA 4RVNA 3REGA 5GTDA 5L7WA 3CXUA 3H2ZA 2CXPA 1RACA 3HDQA 2A1TS 4UVDA 2PMBA 2CC2A 2DR3A 1X1CA 3PQ8A 1U90A 3RFXA 2C9OA 5AVTA 1FLVA 2NXWA 4L1KA 4QOFA 1VRWA 2ZB8A 4CMEA 4POOA 1K7CA 1QGED 2PG3A 3IQWA 4B44A 1EUZA 1GEEA 4KOAA 3DBLA 2VHWA 1YMVA 3LPDA 3OC0A 3EFOA 2Q4DA 2R7NA 4H9GA 5J5AA 4EPRA 1RHKA 5CVEA 4TRMA 1SURA 4GG1A 4RIHA 4YLEA 4DIFA 4W5WA 1USUA 2I71A 2XNCA 1L8OA 3WSWA 2AOXA 3ORFA 4WASA 3VI4B 3QLVA 4AY2A 5H3LA 5FD8A 1Y9EA 3LE8A 4A03A 3CZ5A 3STXA 3M9XA 1AZLA 1SBHA 1B76A 4FI3F 1H1TA 4EEZA 2PSHA 1GDHA 4MW1A 3ZWYA 5BSMA 2REQB 3ZZ1A 1RJEA 4CTJA 1IE3A 3RAEC 3G0HA 2XUOA 2ONYA 4D4LA 1IZZA 4CM1A 2H7CA 1W76A 4RTRA 1Z36A 4XLZA 3BCRA 1UBTS 3ER6A 4QA9A 1RRCA 3NP9A 4K9LA 1GP2A 1FTYA 3OE4A 5A4DA 1PEAA 3F9RA 1V45E 1ZBQA 2VFAA 1V2HE 4D74A 3IVRA 4Z53A 3I5MA 1INLA 4UUMA 1LJUA 4TYMA 1XBTA 2X41A 3U1TA 1HE1C 4RY0A 5LOVF 1OGJA 1LVUA 1MGPA 1ORHA 2I5PO 1Z2NX 2DX7A 1X3LA 1DLIA 1OFHA 3KFLA 1F3LA 3TIFA 3HQ4O 3SYNA 4TKVA 3Q9UA 4C6RA 3LFTA 3RRFA 4BTVA 2G7MC 1Z7EA 3PD7A 1HFEL 2C4MA 1PSWA 3PEEA 4LQLA 2XBMA 3GCGA 1E2NA 5BSRA 1JDJA 1K7SN 2XYHA 2BI8A 1ODCA 1TUGA 3PRJA 4JELA 4BRWA 5ICMA 1EB8A 4ZCSA 1ELOA 1GCGA 1U11A 1I32A 2I3BA 4G65A 3GJ0A 4AJNA 1DRUA 2RI1A 1J0XO 1DAPA 1U8XX 5KDDA 3UMMA 5JR3A 4K26A 5GM2A 3B36A 4WECA 2YTZA 2WWHA 3M2TA 4BLUA 4AKEA 4E12A 1QVVA 3L41A 1KFCB 1D1QA 1T9KA 1VP9A 1WPXA 2ORWA 3ETDA 4JSYA 1O4WA 3AO0B 4LZNA 3HNRA 3DV0B 2PLRA 3EUEA 3D4PA 2EX4A 4DG9A 1M2VB 4M49A 5CTJA 1DXHA 1X2EA 5DGCA 5B12A 1T25A 1ZRSA 1OBVA 3H86A 4MV7A 4S12A 4BATA 4A9AA 3UMBA 5J43A 1SQSA 1ECFA 1W19A 3U39A 1TUIA 4N0PA 1USIA 1RQXA 5G3YA 2GCGA 4BJ1A 4B7XA 4X7BA 2ZUSA 3EHDA 1N3BA 3SQDA 4CV1A 2JEZA 5A04A 3OF5A 5I51A 2UXCB 1BTOA 5JT1A 2Z5GA 5CGQB 5E6SB 3CCBA 3TTSA 3VPGA 2ZWAA 4KQ2A 2FDCA 2AJLI 2XYRA 1L3IA 1WABA 2X2FA 3IMGA 2Q0HA 1SHTX 3G2HA 3IX7A 4JLBA 3TR6A 1ZHOA 1G21A 2RB5A 1XN4A 2IEYA 4FONA 5DK6A 3R9XA 1TZ2A 4J49A 2X7HA 2FPOA 5KJ1A 1I4OA 3EPPA 1HWYA 2P6MA 2PZMA 3ENNA 5DTIA 1ZFNA 4B1FA 2V03A 2ZYDA 4PG4A 4JI0B 4Q02A 2R85A 2Y6VA 3LO5A 3OZUA 1FFHA 1UK8A 3G2LA 1QNFA 2W4QA 5CDFE 1SXJB 1KKUA 2FZGA 3TBHA 3B53X 4X41A 3AR5A 2QY6A 3A4LA 5DRYA 1BDMA 3LHIA 4PVCA 3CTPA 4Y1FA 3ZW7A 2H1IA 5BVHA 2PWPA 2JVKA 2UUBB 2VNHA 2AFVA 4FHEA 3H13A 2ZTUA 4GQBA 3KKMA 4F6RA 1NUTA 3PXUA 1KOJA 1U9JA 1HYEA 3EY9A 5BNWA 3GZNB 3OM8A 4JUBA 4LJYA 4YDRA 3RC8A 3I04A 5AJTA 1X15A 2B30A 1R3UA 3OAAD 2XUQA 3A9VA 7MHTA 4EO7A 3GC6A 3C41J 3OT5A 3TK1A 3EY4A 1GL6A 1BS9A 2E87A 4YLGA 5FB3A 2OXCA 4IWNA 3UENA 4BVKA 3UH1A 5THKA 2EGUA 1Z5PA 2I03A 2QVYX 3KJHA 4YRCA 3TX2A 2R9VA 4K8OA 1P73A 1PG2A 1CV2A 4U9IS 3JQGB 4KXUA 1OCEA 1RAHA 2Q2OA 3JQQA 1KYVA 5AW5A 3S70A 1WS6A 3WMEA 5JHHB 1I1OA 2ZP1A 3M6MD 3AR9A 2QRJA 4PCLA 4WTOA 3EJ6A 1DC8A 3ZJ4A 2HK7A 4M0EA 1YVPA 4HATA 1FTGA 2TMYA 5F21A 2WWFA 1K0FA 3T3DA 2O59A 2G82A 1EFKA 5JXHA 3NJ8A 1I4EB 1YE5A 4N0DA 4OHMA 2OBFA 2BGJA 4FEAA 2H3EA 1X7ZB 5HE9A 5B2ZA 2WUVA 3BILA 3MA0A 4YDHB 4GYJA 1KY4A 4ZT3A 4BFZA 2J3LA 1VMAA 2QIOA 3OTWA 1OH6A 3JZDA 1IBRA 2ZRFA 3JQBA 4D4GA 4FMDB 5DCWA 3UN1A 1XCOA 5CIYA 1P2VA 4BZQA 2AJBA 3TQOA 2Z08A 3AR3A 1L4HA 1ZK3A 4NPCA 1PJ3A 1IJKA 4X1IA 2CBZA 4GPZA 1YXMA 4C0AC 1WXIA 4ZEMA 4A8JB 2QROA 3ROEA 2VATA 3IE0A 2GARA 1G5PA 2TSYB 1YDEA 4K9NA 5IARA 4D0SA 4G5OA 1XCGB 4V24A 3GZTB 1FDOA 4ZD6A 3U4DA 3UTCA 1SKMA 3G89A 4CI0B 4OQXA 1QYXA 1QZ3A 1X1AA 2R8XA 4Q0MA 4E30A 4EKGA 5LYJB 4U6NA 2VJAA 4FMPA 1SKBA 2DB3A 2YOGA 4QBTA 1ZCAA 1Q0RA 3ECCA 4CFZA 5IANA 5BR1A 4ZTUB 1JYEA 2RK4A 4HDQB 2GA8A 1MVOA 4JFRA 1Y9DA 3NW9A 2J7KA 4HQKA 4W7IA 1GNTA 1BVRA 4IWXA 1NXTA 4JBYA 2I4LA 5EZYF 1Z5NA 2AIRA 1UKYA 3KD3A 4X6UA 4M7PA 3D8RA 2PRSA 2O50A 4L74A 3A9SA 5FOTA 2WG2A 1TT5B 3GJ4A 4GYKA 3KLMX 3ZCPA 3WIEA 4OJKA 4TSKA 1QORA 2XKJE 1Q2UA 3CT4A 3IIMA 1IY0A 1E9DA 2PZ8A 1ISPA 1O95C 1T4GA 5DYGA 4D26A 4PWZA 1SUPA 1RQ7A 2X9LA 3NHRA 4YDSA 1ULSA 3RR2A 2CBGA 1WNFA 2X9NA 4YA6A 1IRIA 4S3MA 5AIAA 3Q1KA 3GCWA 5JNWA 3HADA 5LSAA 1PEDA 2D4HA 4LISA 4V0LA 5GZ3A 2FPIA 2ERYA 4U7TB 1GGMA 1P4JA 4Q4JB 5IMSA 2C9CA 3EAGA 3QVWA 4G23A 3ZWMA 4LJ9A 1KOFA 3LRXA 2FGKA 4L0DA 4MVWA 3P71T 3ZD7A 5CA0F 1