4Q03A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q03A00
4PO1A 1Z6YA 2OLKA 4M9ZA 1XB2A 1XRJA 2ZRIA 2XZOA 3OESA 4E03A 4LI0A 1ANKA 4CGZA 1CJUC 2F3TA 1N5KA 1CS4C 2F1IA 4Q18A 5J4LA 3EIEA 3RANA 1C4OA 3LXRA 2QA5A 5BQ5A 4AYXA 4BLRA 2KB0A 5FPKA 1W7AA 4D0NA 4ZO4A 4DC9A 5JSZB 3QXJA 3VX4A 2CL6X 3LLMA 2REXB 5AUQA 4RCZA 3P4YA 2H7VA 3Q72A 1F5NA 3T1TA 2L0XA 2DYKA 2WPDA 2GXSA 1MABA 2IYQA 3W34A 2HCJB 2REOA 2C9YA 5EXSA 3U7HB 2D06A 3H4MA 3TAHA 5F9FA 1UBCA 3TIFA 1OE0A 2C5LA 4WZ6A 2IK8A 1SKQA 2ZS8A 1JAIA 1JALA 3BH7A 1G8FA 5KSYA 1ZC3A 4OHXA 3AP2A 4RD4A 3RSOA 1I2DA 1Z07A 1G18A 3TW8B 3ZD7A 1KI1A 2BDTA 2OHFA 3K1JA 5B58C 2EU8A 1ZNZA 1JAHA 2WSSD 1YRBA 3DVLA 4DB4A 3JVUA 1XPOA 2FEMA 2ZI5A 3L8ZA 2GBLA 1Q1QA 4JLDA 2VHJA 2Z83A 5TVKA 3C41J 4EPRA 2BEKA 3RABA 4WXPA 1YR9A 1S1CA 1WF3A 4IFBA 4B76A 2WMNB 1FTSA 2OFXA 1ZCAA 4Q47A 4DCSA 5TMPA 3M1IA 4ZI3A 3QG5A 3NKVA 2VP2A 2P5TB 2XB4A 2BBTA 4LPKA 2KBFA 3PUVA 3K70D 4MGIR 3LRPA 2CXXA 2VA8A 4FMBB 3TSZA 4D2IA 2QRNA 1II9A 3GEHA 1TPZA 2R6CA 1NJFA 1ELOA 4BWYA 1E98A 5GJWC 2OAQ1 4XSGA 2ZI3A 1KK2A 4JL8A 4NYIQ 1MRSA 3K0AB 1ZU5A 1TU4A 5FR1A 5FTKA 4DBLC 1YRAA 2B7CA 1IXRC 2EQBA 2WJYA 3B82A 2D2FA 2FGKA 2W0MA 5DNYB 4A0GA 1Z3IX 5CIQA 1EGAA 2BMDA 3LX8A 3PEUA 1OIWA 2WIBA 4FXPA 4DSNA 4YQFA 1W36D 3LBHA 1W44A 3QKRA 3CRVA 4PHGA 5JHHB 4C7OB 5JZVA 2CDNA 3C16C 5HCNA 4CEJA 2JJ8A 5DN6A 3TLXA 4IVQA 2AKYA 2F1HA 5EE5B 1IN8A 1XFAA 4A0FA 3CRRA 4B2PA 5KDLA 1F60A 2XAUA 2DFKB 2PL3A 2RB4A 3UG7A 4B35A 1H8ED 1NRJB 2YHSA 1G3QA 3J81k 3GLIA 3ZVMA 1KI7A 4P4SA 2QNRA 1KO7A 2R65A 3QKSB 4Q1AA 1OFTA 3A4MA 4OK3A 5JS8A 3QENA 2BKEA 5LB2A 3VR2A 3DKPA 4E5UA 4RD6A 2W2VA 4WZBE 1P9RA 721PA 5GADl 3KTAB 4PPNA 4CEIA 5FOXA 1QDEA 1ZM2A 2FFAA 3FVQA 4PFSA 2PJZA 5LDDC 2VBCA 4MGYR 4ASUD 4C0SA 5K8LA 4LK2A 3BFXA 1YU9A 3CW2A 3GMTA 4G3XA 3LDAA 2ZIAA 4NHOA 4PAQA 4JMPA 1UKYA 2H5EA 3IIKA 2JLQA 5JI3E 5EP3A 1VHTA 3AKYA 1CJTC 3NBZC 4BFWA 1KTVA 2AX4A 2C77A 1ESMA 3MJHA 3P32A 4D0GA 3B7GA 3DEFA 1GL6A 1G21E 2C9CA 4Q9LA 2BCGY 3MSXA 4JT2A 2O8DB 2ZS9A 4DIDA 3V00A 4BFZA 3U3KA 3U7FB 1GRRA 4Q1BA 4D0LB 3GJ8A 5G40A 1UJ2A 1J7KA 4MUAA 1SVIA 3QI2A 5DIFA 1MO4A 2J0QA 2DB3A 1OXXK 4DLSA 4X8OA 1GFIA 3A8TA 5AR1A 1NN1A 1U81A 1Z0IA 3EIQA 1RPZA 2H1LA 1DADA 4G5GA 2XB2A 4ABYA 2JDIA 2RGGA 2W6IA 4FMDB 4LPSA 3UMFA 1SVWA 4ITRC 4QNRA 3D31A 5KOYA 2AWNA 2Q3FA 2GXUA 4BECA 3KUDA 4KJZA 4LBZA 4AIIA 5A5GA 1GUAA 4D4MA 3HP1A 4KLZA 2IUSA 1E1RD 3B8HA 4DHEA 4DSTA 1XPRA 3ECCA 1G19A 5FUXA 3ETLA 4Q4JA 5L3QB 3BE4A 1MV5A 1KSGA 4CYMA 3MWYW 1Z6TA 4BZPA 2HJGA 1W47A 3A4NA 2GZAA 1H8HA 3VKHA 4DLTA 1P75A 2DPXA 2C8VA 2HF9A 2ERYA 5AUPB 1K8RA 1KMQA 2WMOB 1SXJB 3K53A 3FFAA 4M9QA 1E2MA 2G1KA 4R71A 5L3VA 3P27A 1VG8A 4KI0A 4BFVA 1XMJA 3W8NA 1IXZA 1AK2A 1Z08A 2ANCA 1DO2A 1EWRA 1C9KA 3FOZA 2IEYA 4G1UC 1Z6GA 4J0QA 5E7IA 2PH1A 4IXMA 3FE2A 4Q1EA 4TQ9A 3W5IA 1ZNYA 1G5TA 4PPGA 4PQYA 2ATXA 5FBVB 1CR0A 4C2TA 3T5GA 2ZRNA 1SVOA 1W0JA 2IYLD 2NZ8A 5JEDA 2X2FA 1ZYUA 5DLQC 4PSAA 1PLKA 5DGXA 4E07A 2VRWA 1G41A 1GRNA 1ZNWA 3I73A 1II8B 1BH2A 1MO6A 1JBKA 4UNRA 3GJ7A 3SQWA 2NTYC 4JLOA 2IS4A 4LDJA 4Q02A 1X1RA 2G1JA 3KKPA 1XZQA 5DISB 1E2LA 4M2LA 3U3OA 4BLTA 2P6RA 4EPXA 4ZDIA 4EPTA 4D25A 3SZRA 4KYUA 3WMGA 3WNCA 2WJHA 3B85A 1X8JA 2QMOA 5FH9A 3OFND 1XXHA 3K9LA 2Q0HA 1T91A 4TL9A 4JYBA 3VKGA 3VKWA 2ZJYA 2RMKA 3QF7A 3ZVRA 5CITA 1KJZA 4TLCA 4CW7A 2WJJA 1W4BA 2FGJA 4A82A 1N6KA 1TMKA 3OIYA 3EA5A 4LOAA 3CF2A 1MT0A 4L16A 5EE9A 4DDWA 4V0KA 4CDGA 2IYZA 5CM9C 4IW3B 1G9XA 3HR7A 1E9AA 3GLHB 1UKVY 1YZKA 2WSSA 3CWZA 5TARA 2D62A 2GILA 4DZZA 3AVXA 1XCPA 1U8ZA 4DT1B 3Q3JB 5KSZA 2BBWA 2X77A 2PEYA 1GP2A 3QF4B 3DM5A 2JLXA 4OHZA 3BJIC 5C18A 3FHTA 3BH0A 4NYJQ 1RRFA 4TN1A 2HUPA 3EARA 1TTTA 1PVOA 4OI4A 2H57A 2QORA 2FV8A 2ZRFA 2PX0A 3ZVNA 1ZAKA 5H8WA 1OIXA 2F1JA 3AF3A 2JATA 2X2EA 3LW8A 1G3UA 1LTQA 4R2HA 2KWIA 2Q9CA 2ZJOA 3GLFA 1NVXQ 4YXWD 1VHLA 4HLQB 3BB1A 3IIJA 3WY9A 2ORWA 3GCGA 4XVUA 2XXAB 1T5LA 4LHYA 4QG7A 5FR2A 3O8RA 3UKDA 4Q7MB 5KSPA 3U7GA 4C2UA 4HAUA 4HUTA 2DR3A 2GHIA 2B92A 4Q48A 2A9KA 4HLUC 4LRWA 1G291 1GG2A 1KI4A 3LWNA 5J47A 1AN0A 2XGJA 1YJ5A 4Q9HA 4D80A 4OQLA 3H86A 1P72A 4Q1DA 1P2UA 4L5BA 3F5FA 1QRAA 4M0LA 2A7QA 2OEPA 4EFNA 3B9QA 3AH8A 3Q7PA 4V0ME 2O8CB 5JS7A 3I1FA 3L82B 2GCOA 3MLEA 2CEAA 3DOEA 4DLVA 3AUXA 4MYTA 4HZUA 4DEYA 1V43A 2QI9C 5L3SA 4Y0AA 4GOKA 1YR6A 3D7MA 3EPHA 4JKIA 2Z43A 1P5ZB 1H8EA 1XEXA 1PLJA 4B44A 1R5OA 1NLFA 1KYIA 3A1SA 2NG1A 5E7JA 1ZUNB 3LO5A 3OF5A 2WBLC 1T0HB 1AS2A 1E2DA 1YVDA 2BKUA 2ZYUX 3GFPA 2GNOA 1CRPA 2QAGC 1NNEA 3R9WA 2NPIA 1G3IA 1SHZA 2VIIA 3HU2A 3ADKA 4JLBA 4D26A 4GMXA 1SVSA 2WJVA 4OHVA 1P61B 3OIVA 2ZJ2A 4QGHA 2W00A 5DHAA 2QMUA 3CBQA 1KO5A 4ASUA 5KNBA 3U6BA 3CNLA 3K0CA 4PO9A 4XTRA 3KQHA 1GITA 3IILA 1NG9A 4OHYA 4NDZA 4TYPA 5GJBA 2CE7A 2Z0MA 3L0OA 4LHZA 5DI3A 3T35A 3NDBB 4KXFB 1NKSA 3DHWC 3PQCA 5DO9A 2V6IA 3MJRA 4JVLA 2QENA 1ZBDA 1W4AA 3AVQA 3RRNA 3QXXA 1T3HA 4Q66C 3UG6A 1XEWY 2EWVA 2R62A 1M1YE 2YNMA 3FFBA 3PEYA 5CB8A 4QBFA 4MKFA 1B23P 3NC1C 2BJWA 3E1SA 4FCVA 4LJ7A 3RDPA 2PJRA 2WWGA 3PFIA 1SXJE 1QG2A 1U94A 2YOHA 2CJWB 1H65A 4HSEA 1Y3AA 3AVWA 3RS2A 3IEVA 4ZV4A 2FN4A 4WAUA 2AFIE 2B6HA 2Z6VA 1CTQA 3QEJA 1C1YA 1N6LA 2AKAB 1XDBA 2VP9A 4I99A 1JJVA 4DCTA 1FOEB 1XJQA 2BCJQ 3THWB 2VSOA 3K0EA 4JT4A 4ZIRA 4Y0VA 4LHXA 1RVDA 5LB4A 3ADCA 1Q57A 4Q9KA 1P9NA 4RD0A 1KI6A 3TKLA 1VG0B 3NH6A 4HYYA 4AI6A 1N5IA 1TQ6A 2VH5R 2F43B 1E1RA 5JECA 4KVAA 1S1MA 3GQBA 5D3QA 3G0HA 3SFZA 4HDOB 2GRJA 2BBOA 3WP1B 1AJEA 3QKUA 1N25A 3U4QB 3SN6A 1DAMA 4JSTA 1FQJA 2NO6A 5EQTA 5A4JA 3FKQA 2ATVA 4JL6A 4ZPXA 1KK1A 3NVAA 5J4YA 2B8TA 4DB2A 1UKZA 3CZPA 2XNDD 1F3OA 2H8KA 1KZGB 2XJ9A 1U0JA 2AL7A 2OV2A 4GPTA 2JJ1D 4QRHA 5TY0A 2DWPA 2J7KA 4YMTA 3RNLA 3MWKA 2Q3MA 4GMDA 3CX7A 3WRYC 1ZW6A 4QOSA 3NEYA 3PUWA 1MABB 2ODEA 2OBLA 3EPKA 2O52A 2GVZC 2ORVA 2VHTA 1IAQA 1TUEA 1TQDA 2FE4A 1IQPA 1E79D 4O25A 4QHTA 5FUVA 3BBPA 2QPOA 4F93B 2IYVA 5CDFE 4FN5A 1Q21A 1WMSA 1RJ9A 2P6UA 2V55B 3BGWA 3ADBA 3DM9B 3X2SA 4QL3A 1DARA 2JIZD 3GLHE 1E9CA 3F8TA 3SC3A 2FH5B 3TR5A 4DJTA 1KI8A 1PJRA 1G7RA 1ZD8A 2KJQA 3QE0A 1JB1A 3TQFA 4DCNA 2DCUA 3S1AA 1UBGA 2OAP1 2VP5A 3T06B 4B73A 4M21A 1LNZA 2XJ4A 1Q12A 2JEOA 4GI7A 5BW8A 1JPNA 1XTKA 4PSVA 3TVDA 1DVRA 2HV8A 3LAWA 2PMKA 3FHOA 5GJCA 4LJ8A 2AFHE 4TZ0A 1OJLA 1X1SA 2CCKA 5C2JB 5KYKA 1OXUA 3OFNA 4QBGB 1OH5A 3CO5A 4JLAA 3BORA 4TMWA 1NJGA 2PLRA 2XNSA 1OPXA 3TAUA 3ZZUA 1YZTA 3A1UA 3HJNA 4M53A 5JWHA 2RGDA 3T1QA 1ONBA 3W3AA 1KHTA 4MRVA 1R6BX 3M4YA 1D9ZA 5HCIA 4M4SA 3BB3A 3EG5A 1ZUHA 1N5LA 4QJ4A 3P4XA 4HB3A 4TYQA 3MFYA 5EZ6B 2C03A 2SHKA 5CJ2A 3UMRA 5AJVB 2ZS7A 3FMOB 1CF4A 1BIFA 1GAJA 4A15A 3TRFA 2RGCA 3AEZA 4S2EA 2O8BB 5HE8A 1UDWA 2NOAA 1E2FA 4BLSA 4QGFA 1NI3A 4KSBA 3QKRB 4NONA 4TMTA 4R2IA 2NQ2C 5G3YA 5JRZA 1L4UA 4URWR 1KSFX 2ZJ5A 3RVBA 2J7PD 2J0UA 5H68A 1E94E 2VF7A 1G4UR 3ND9A 2A3RA 1EG7A 4BFTA 1AZSC 3EX7C 3A1TA 421PA 4I1SA 1Z6AA 5FI0B 1OYWA 4RFVA 4D81A 3EPLA 1R10A 4BZQA 3GLIB 4IKEA 4P4SB 3OEED 2IYYA 1G8HA 3MUFA 3PVSA 4YXWA 4LJ9A 2IYTA 3RS4A 3LX5A 5B2ZA 3K0FA 4GZLA 4PC7A 4CEHA 5EUQB 3KUCA 4FWTA 1RRCA 2HXSA 1E2QA 1DG3A 2QAJA 3QEOA 1T3SA 1MO3A 2PT5A 2ZYTX 2HDNB 1R8SA 1CRQA 1G16A 2CCJA 1E2JA 2J5XA 2GAOA 4MKGA 1G5PA 1G6HA 1SGWA 3B60A 1W5SA 3FYHA 2CVFA 5DI9A 1MR3F 4URXR 1J2JA 2Q6TA 1N0VC 4A2QA 3DMDA 4C30A 2RHMA 5DHFA 4A2WA 2AHOA 2X8AA 4L8GA 4LBVA 4CRWB 3U6KA 1RYFA 4BRUA 4NTZA 4OK6A 2J1LA 4MH0R 3SOPA 1G8YA 2QMEA 2YWFA 5B64A 1AIPA 3Q8XB 3GLGE 2O0KA 5EZ5A 5FTNA 1TF2A 2G83A 4NKRA 2NPFA 2J3EA 1IY1A 1DAKA 1M74A 3DZ8A 3HU1A 3HPRA 4G0NA 1A1VA 1QG4A 2AD1A 3AF4A 3IHWA 4HB2A 5FOWA 4D82A 4YMVA 3VNVA 3T61A 1VYUA 4M1MA 821PA 1EFTA 2D3WA 1YR7A 4NYIR 1KJYA 2R6AA 2D4HA 2GJAA 4ON9A 1TADA 2YJTD 3KKMA 4TMXA 1OFHA 2GEDA 4JLPA 1JEEA 5HZKA 3I4LA 3EASA 1FQKA 3RC8A 3X1YA 2QPTA 1BYIA 1YZQA 2C9OA 2OCYC 2WWXA 1NMXA 3NBYC 5J4VA 4F4JA 2OFOA 3EWAA 2IYXA 4F4CA 1KZ7B 5LD2C 2XOKD 1GSIA 2IX3A 1NN3A 5AJYA 2GZDA 1CXZA 4P4UA 2D7DA 4MRPA 3A1WA 3AV0B 1N6OA 4Q4JB 5M04A 1IN7A 2P2LA 3SJAA 4GRAA 2ZYWX 1QHGA 2ZRDA 1TEXA 2UVQA 2V4ZA 3RS5A 3RLFA 1WB9A 1WRBA 3KZ1E 3CNNA 1SHKA 2BMEA 6Q21A 2MSCB 2V6JA 3PJRA 1NVVQ 4L15A 2V9PA 3H84A 5KUTA 1TNDA 3CONA 2FZLA 3SEAA 1HQYE 1N0UA 1Z28A 2ZRBA 1IY2A 2FF7A 4GBMA 4C0LA 1Z0KA 1EFHA 3U3JA 1W0KD 2H17A 4O3MA 5E3HA 2I4IA 1A4RA 4MKHA 4OQXA 2ZYVX 3U44A 5KPDA 1F2TA 2IW3A 1SKYB 1NMYA 5GVRA 5HE9A 1COWD 1XMIA 1M7BA 1ZRHA 1OFIA 3P26A 4PHTA 2A5JA 2ORIA 2NMVA 1P7CA 3E5HA 4JL5A 2XTZA 4C0HA 3C7KA 3LXXA 1MRNA 1P4SA 3EZ7A 4RSGA 2G6BA 4LUCA 4OI1A 5FBWB 3QIAA 1VDZA 4KFTA 3GJ3A 1QVAA 4BPBA 5AUOB 2J0VA 1NBMD 2P3SA 2C04A 4C9BA 3CB4A 1XEWX 5FL7D 4HAZA 4ARZA 1GKIA 2FSFA 1NMZA 3NIBA 4XVRA 1NLYA 4G5RA 1JR6A 2OLJA 1RKBA 2DBYA 4PR0A 1US8A 2NO1A 3CUEF 1OH8A 5KSOA 2ZI7A 3IUYA 4DWJA 3KB2A 4JJZA 2XNDA 4FIDA 4ZDKA 2JJ1A 4PC6A 5DYIA 1HEIA 2VSXA 3F3YA 1F48A 3MGCA 4NCKA 3A58B 1XXHB 2A5DA 3TSOA 1J99A 4DIEA 3PITA 1Z06A 1ZP6A 5DE3A 5CK4A 2W0SA 4JBXA 1E99A 4B47A 3RS3A 1FW6A 1E79A 2QN6A 4KFSA 1K5GA 4H9GA 4PANA 4DDVA 2WWYA 3CLVA 4M1OA 2QT0A 4HAVA 1JJ7A 2G77B 1CIPA 2JIZA 3C8UA 2QUZA 1NN0A 3BIFA 4G5OA 5EE3A 3VTKA 5KU1A 4NYMQ 3L8YA 1FL9A 1UEJA 2P67A 3KJGA 2A5FA 1S3SA 1NY5A 4LYAA 3A1VA 4DCUA 3IKJA 1QHYA 5GJVC 2ZJBA 1G8GA 3EC2A 1I4TD 3MWJA 1OSNA 1EK0A 3O8CA 1BKDR 2BM0A 1OT3A 2ZRGA 4S35A 3ZZTA 4OJKA 2CL0X 3AGPA 3NHAA 3TUJC 1R0YA 2FEOA 4FINA 3D6TB 4LJAA 2ONKA 5KDOA 2EYQA 5C1BA 3GLIE 2V1XA 4L9WA 4QJ5A 4MRNA 2FSHA 4RKEA 3VX3A 2IYSA 1D9XA 1M7HA 2ZR0A 2QBYA 2HLDA 3B2EA 1KDTA 1X3SA 1TQ2A 4LCBA 1LS1A 2YYZA 1LS6A 4A8JB 2WSMA 5JSZA 4MDFA 1X8LA 1CU1A 2ZRPA 1HT1E 2QSYA 1J8MF 1GWNA 3CM0A 1UADA 1E32A 4Q03A 5AWFC 4C0QC 1T8TA 2WWHA 3OHMA 2F3RA 1DELA 3P1JA 2GK7A 4KHZA 5P21A 1QHIA 1AS3A 1JR3D 3OZXA 4IOJA 3B1YA 4RY2A 1GNPA 4KBGA 2C96A 5FBLB 3IIMA 1OHHD 3WMEA 2OESA 3KQUA 3ASZA 4UQOA 3TBKA 2GF0A 3MMPA 4EPYA 4ZCIA 3AVTA 1NSFA 4M22A 1UDXA 3DKVA 5TV2A 3AUYA 3MCAA 3QUSA 5SZHB 2J7PA 4FD2A 4E09A 1G17A 4HZUB 2ZRMA 1XTIA 3CF0A 5L3SB 2CLCX 3A36A 2R6FA 2YWGA 1JQLB 2EFHB 3U2QA 1KO8A 2ZR9A 4GDFA 1XEXB 4LV8B 1OV4A 3CPEA 4PXAA 1AKEA 1OXTA 1T3LA 1KNQA 4Q4AB 5CK5A 3SHWA 4B33A 3OEEA 2IA5A 4GL2A 1E6CA 3NTUA 3B5JA 2OBNA 3CRQA 4QM6A 5BN5A 1ZU4A 1IXSB 4LYHA 3TVTA 2QP4A 1QHHA 1DBSA 1GOTA 1R0WA 2IYWA 2WVJA 5H1YA 1A82A 4B3BA 4B3GA 2WZQA 4WXRA 1FNMA 1AQYA 1D2MA 1IY0A 3AQ4A 1M2OB 4YDSA 3K09C 3I92A 4A0HA 4FMCF 1YZUA 3ICQB 3U7EB 2JLZA 4R9UC 4D4JA 3EZ9A 5DYGA 5HTKA 2WKPA 3AKEA 3V4FA 4TWZA 2ZUBA 4Z1MD 2VEDA 4OI0A 1QZXA 4DUGA 3IBYA 4HLUA 2J45A 4NYJR 4JLKA 3A4LA 2VO1A 3NXSA 4BFUA 1E2EA 2IHYA 4AYWA 1E0AA 1SVKA 4JKYA 4TLAA 3EZ6A 3W6PA 5EXXA 2EFEB 4Q1FA 1ZIPA 1IOZA 2ZJZA 1IN5A 3O8BA 4PX9A 4US0R 1XTQA 2IEZA 1JEDA 5DSZA 3JVVA 3THYA 3PENA 3GFOA 3I62A 2GESA 4C7OA 3G82C 4Z8XA 1BS1A 4OQMA 4M1TA 2O8FA 3V4RA 2FFBA 1AZTA 1T6NA 3L0SA 1EWQA 2ZRCA 1PUJA 4R7ZA 3ZYCA 2AXNA 2FSIA 1SKYE 1E0JA 1RC8A 4EJSB 1IHUA 3UANA 4ZIRB 5D3MB 1VYTA 3QVVA 1G8PA 2QG6A 3REFA 3KXLA 5BWMA 2O8EB 4OK5A 5SZIA 2JLRA 1VG9B 2ZVQX 5KO2A 2RAPA 2QAGA 1KI6B 4AURA 121PA 2N42A 2XOKA 3PCRB 2RHDA 4OL0A 2QEQA 3PUYA 5JEEA 1KAOA 1NF3A 2CHVA 3QPVA 2IF2A 2RGNC 1E2GA 2DY1A 2AK3A 2AXPA 2RGBA 4TT3D 2ZRKA 4XTCS 3SE0A 1YQTA 2QM8A 4Q9IA 1RW4A 1HY3A 4DLXA 5JJKA 5AJWA 4E22A 5F3WB 4GOJA 3A6PC 4OJQA 4MYUA 5E95A 3WMFA 4X8LA 1LF5A 1XMSA 5BN3A 4XD7D 3UMSA 3KQNA 1FMLA 5IHPA 2V54A 4OKSA 3TUIC 5LBIA 1XXHE 1Q0UA 1W0KA 2ERXA 4BFSA 3SJBA 2YC2C 1W46A 2ZVPX 1ZIOA 5FFMA 3L43A 3W6NA 1CEEA 1XD8A 1E2HA 2IC5A 2O8DA 1COWA 5HPYB 1FFHA 5KDDA 1HQCA 1W2GA 2A5YB 1U98A 4AG6A 3ZZ0A 1RJ9B 1KMHA 2PCLA 4P33A 4G01B 2DFLA 2ODBA 3WYAA 1JI0A 2WOOA 3X1ZA 2VHCA 1FX0B 1PUIA 3SNHA 3T1VA 2Q21A 4ZDWA 2HF8A 4N0EA 1AKYA 2CE2X 1E4YA 1WA5A 2ZSEA 1MKYA 3KKQA 4TSFD 1KDPA 5HKKD 1E9EA 4A0RA 1WQ1R 4EPWA 4UNPA 1NBMA 1VKJA 3SBEA 4K8OA 3EW9A 1CP2A 5FL7A 2JLSA 4PQRA 4A9AA 3CPHA 3X1XA 2AWOA 4EUNA 1D6JA 4N0DA 4A2PA 3VU9A 5CLLA 4U00A 3OIWA 1Z0AA 2OBMA 1R7RA 2F9MA 2J46A 1E0KA 2R2AA 3LW7A 1G6OA 2XSZD 3CX6A 3ZQ6A 2LKCA 4IXNA 3REGA 3TQCA 5L3QA 1VMAA 3TNFA 4B2IA 2X19A 4QHSA 3FKSD 2FFHA 2BBSA 2QL6A 2Z4SA 4UNQA 3RS7A 3GLFE 4NU0A 1EX6A 1RZ3A 2D74A 1L7VC 1ETUA 1LB1B 1T8UA 1ZNXA 2R6DA 2GJSA 3UPUA 4OQFA 4QBIA 3NEJA 4OHWA 3AVYA 1Z83A 3KKNA 3X1DA 3OEHD 4L9SA 3I5XA 1M34E 1KI9A 4B3XA 1LY1A 3EIHA 1G20E 4RVCA 4XIGS 4TL8A 3FMIA 2RGXA 3I72A 3UXMA 3SI7A 221PA 4WOPA 3SJZA 1S2MA 3UWOA 3AVOA 4KAXA 4URUR 3BWDD 1TAGA 3I5YA 2OFWA 1A7JA 1KOFA 3QVUA 5CYOA 1DS6A 4V02A 3THXB 2ZJ8A 1Z6XA 3DPUA 5AJZA 3WNBA 3VAAA 1KSJA 4TLDA 1W48A 2EWWA 3GJ6A 2JCSA 3GLGB 3AVVA 2J0UB 3FGNA 3BD9A 3GPLA 2N46A 2YZ2A 3IO3A 4B74A 3TW4A 1G5RA 2QSZA 5JCZA 3SU8A 2WWFA 3UWKA 1J8YF 2YINC 4LX0A 1G7SA 1E9DA 3EA0A 5FPSA 1SVMA 4U02A 2JGNA 4CEHB 3L0IB 3ZH9B 5AUNB 1EESA 4AK9A 4W9MC 5C4GB 5KTYA 1DOAA 2QU8A 1R5BA 1RFLA 2AD5A 2WAXA 1BYUA 4A8JC 1M8PA 4PAMA 4ESVA 2GCNA 2C78A 4UNNA 5K8UA 3BK7A 1HYQA 3EZ2A 4O2RA 4YMSA 4F7WA 3T15A 1JR3A 4KFUA 5H70A 2ZE7A 2EFGA 1IJEA 2IT1A 2RGAA 4JLVA 3ZD6A 1RRPA 1OHHA 3IPYA 3N2EA 5DH9A 2AN9A 1VIYA 2MMCA 1HUQA 5J5CA 1IJFA 1TU3A 2WOJA 3RWMB 4Q7LA 3GEEA 4HDCA 1AQUA 4YMWA 3AKCA 2ZI4A 3NBFA 4QXAA 3L0PA 2VYFA 4G5SA 4B71A 3RC3A 5CLQA 3PG5A 4HZIA 5E7MA 5GVSA 2B21A 2LKDA 2IWRA 1XPUA 2GJ9A 4N1AA 4U5XA 2XITA 1VCIA 2FDCA 1SXJC 1P2SA 4HB4A 3BFKA 3QF4A 2JA1A 3LBIA 5E4FA 2D7CA 2VPPA 1E69A 1MO5A 5HR5A 1J90A 1CKEA 1E1QD 2GTPA 2IXFA 1G7TA 4C4PA 4MITA 4FW9A 4KITB 2W2XA 1OFUX 1BOFA 3FTQA 4DRZA 2OO7A 1E3MA 4MKIA 2P6NA 1WDTA 4NCNA 4WIAA 1W5TA 3R7WA 4B75A 2FFQA 1E2NA 1IBRA 2F6RA 4W7SA 1S3GA 3TH5A 3WBJA 2EVWX 4X8MA 2G88A 2DHRA 3QBVA 1E9BA 2CL7X 5G3ZA 3KKOA 4A6PA 4LV6A 4UKDA 1NN5A 4TZ6A 4Z1MA 3B1VA 1YE8A 5CB6A 4EQ6A 3CF6R 4D4KA 1F2UA 3BH6A 1UM8A 4KO8A 1NIPA 2WKQA 3MRSA 4PZZA 1X8KA 4FMCB 4X8HA 1FP6A 3SR0A 1LW7A 4DLZA 2ONJA 4ZDJA 5FTLA 4Q7KA 4KYIB 521PA 3NWJA 2JLVA 2ZTSA 2GVDC 2OXRA 1N6PA 4V0NA 3VHXA 3WHKA 2BOVA 1IM2A 5BYKA 3N5CA 4PSKA 4ZI2A 3PV0A 2QROA 1DG1G 1N3BA 3NBXX 1HH4A 2QQ0A 2O8CA 5IK2D 1OIVA 2HLDD 4JVSB 3AP1A 3THOA 2JLYA 4DEXA 1GIAA 3QOFA 1R0ZA 5SZJA 4JLMA 2IXGA 1Z0JA 4BLPA 2R44A 1S0UA 4GZMA 5EP1A 3LFUA 2V3CC 1KO1A 4EJSC 3LY5A 1YKSA 2F1RA 4LGMA 1GNRA 2PBRA 4IDNA 4JBWA 4NL4H 1P60A 2O0JA 1QHSA 4TQAA 1LFDB 2GETA 4JBYA 2WWWA 2Z5FA 3GD7A 5ELXA 2CK3D 4PQFA 1NSTA 1Q22A 1SQ5A 4UNSA 3AF1A 4BEJA 4CEJB 4TT3A 4BLQA 3QJYA 3HPQA 1U8AA 4TYWA 1EFUA 3NC0C 3TK1A 2F9LA 4MRRA 1GILA 1XTRA 1SULA 3I8SA 3EC1A 4GP7A 3KXIA 4Q4HA 2BIFA 1WP9A 5AJXA 2KSQA 4LHVA 4MUBA 1OKKD 1CR4A 1PZNA 5SZKB 4XD7A 2ODNA 3FDIA 3IBGA 3WXMA 1FNNA 4M9XA 4FCWA 3OIUA 1NP6A 5UKDA 3I61A 1MH1A 4KCGA 4QJ3A 3R9XA 4IOMA 4ZCMA 4QHYA 3D3QA 4FCTA 1GL7A 2OXCA 4F92B 1XMVA 2FNAA 1JXMA 3QPWA 4KV9A 3KB1A 1P62B 1UBEA 2FJUA 3NG1A 3NHBA 4TL7A 1P73A 3QXCA 4LYJA 4CEIB 1FZQA 1G3RA 4PHFA 2FZ4A 4HEJA 1YR8A 2GA8A 3IEUA 4C0BA 1VIAA 1Q3TA 1S8FA 4OBEA 5JJIA 4W5HA 2ECKA 1UFQA 2MSEB 2CMKA 2REBA 1NKTA 2ZU6A 2PMDA 5EJEA 2CNWD 2RH5A 1EFCA 1RYHA 1XTJA 3THWA 4LV5B 5TB5A 5HKKA 4TSFA 4DUGD 1OLOA 5L8VA 4GSYA 2VHQA 3BRWD 3IQWA 1CULC 3CKLA 3ZS8A 1OW3B 5FOTA 4A4DA 4DKXA 1OB5A 4KSCA 3PXGA 4LBYA 2G0TA 1NVVR 2ZAOA 4XH9B 3WYFA 3FWYA 1AM4D 2GJ8A 2OUKA 1BMFD 4Q19A 2F43A 3I32A 2C2HA 1T9HA 2NO0A 2QTFA 2XSZA 3AKDA 2ZITA 4PC3A 3U5ZB 1HTWA 3ASYA 3NH9A 2ZANA 3FKSA 3C14C 3ND8A 4LY6A 3U4QA 1QF9A 4FI3C 3SYNA 3CRMA 2PLFA 2UZ3A 2WM9B 1G4AE 2QBYB 4MGKR 2IHBA 1Z63A 4TMKA 2OM2A 4JYCA 4HUQA 4W5JA 1ZUIA 5J40A 3B9PA 3OEHA 2GXQA 1XD9A 2ZRLA 1L2TA 5KPJA 4HLCA 1MOZA 2PCJA 3PUXA 3LV8A 4BGDA 3OAAD 1DAGA 2O0HA 2V7QD 4PPQA 5EXPA 4IDQA 2W6JD 2IS1A 3BB4A 3HDTA 3RRYA 4DLYA 4KLNA 1JPJA 3LD9A 4QFMA 4AKIA 3CPJB 4ACAA 4I1VA 4DDUA 2FX3A 4RFSA 2FOLA 4BRWA 1GTVA 3QXSA 1E2PA 3RYTC 1IN6A 5FPHA 2I1VB 3IPXA 4XWKA 4L4UA 4GP6A 4TLEA 2RCNA 3LVQE 4B6FA 3AF2A 4K81B 2J87A 3M0EA 2RGEA 4TTPA 1ZM3A 1V5WA 4AY2A 2ZSAA 3C15C 5CM8B 3ZDQA 3K9HA 1Q20A 4NCHA 4RKFA 1DAIA 4XJXA 2QY9A 3R9IA 4NE2A 2PEZA 3RS0A 2ZI6A 5JFGA 4P4TA 4DVGA 4M9SA 4AKEA 4B3CA 4TLBA 4QNMA 1X86B 2ZROA 2IUTA 3VR6A 1N6RA 3BOSA 4ESHA 1QHHB 2ODWA 1GRQA 1D8TA 2ZEJA 5FTJA 1KIMA 3Q9LA 1KY3A 3KXKA 2N1BA 4LHWA 3P20A 4NYMR 1U9IC 2ZSFA 1NIJA 2QQEA 4LWZA 2H92A 1FP7A 2H18A 4DLUA 2IYUA 4IDOA 3RAPR 3KJHA 5JJLA 3W8RA 1GVNB 3JZMA 4HB0A 1XNJA 2ZSBA 4LJ4A 5FPYA 5JWOA 4Q21A 3CR7A 5A0FA 2CHGA 4AG5A 4RD2A 3H1TA 5C46F 3GFTA 1KI3A 1W4CA 3W6OA 1E0SA 2O8BA 2EW1A 2VP4A 4P32A 1NVUQ 1XD2A 5F2EA 2QRZA 2ZUCA 4AC9A 1CJVC 2E9SA 3THYB 1UBFA 1A2KC 4P3YA 1GDDA 2ZRAA 2FA9A 1DAHA 1O3YA 4RZXA 2O8FB 1EXMA 3GP8A 1II0A 4BUJA 3SHFA 3CWQA 4IVPA 1E1QA 5F9HA 2QPAA 1E9FA 1UPTA 1Z2CA 4P31A 3UK6A 1SXJD 2FU5C 2XTNA 5IF9A 4JVNA 1KI2A 3MG9A 2WIAA 4PPFA 1TQ4A 3OE7A 5JHGB 4AD8A 2QAGB 1KAGA 3N70A 4IDPA 4W5WA 4Q00A 1D5CA 3HU3A 4LBWA 3LVRE 2GF9A 4Q1CA 4CT4B 5B30A 1NVWQ 4H1VA 2HT1A 4II7A 4TMZA 2WHXA 2WV9A 5C4MA 1KDOA 4LYFA 3K09A 3SQXA 3ZS9A 3HYRA 2QP3A 5FOUA 2GBLC 4RZUA 1LF0A 3U61B 1XF9A 2XTMA 2WKRA 3KQLA 2VP0A 3DDCA 5JBQA 4EAQA 1E9SA 3AGQA 4O2LA 4P0TA 3KJIA 3K70B 4EKDA 1JXOA 2KI5A 2OG2A 5FBRB 2EFDB 4FWIB 4I1UA 5IK2A 3B1ZA 1D2NA 1U90A 4HAWA 1AGPA 1Q1EA 5FUYA 1G3MA 3GLFB 2DFNA 2ZUDA 8OHMA 3CIOA 4YONB 1B0UA 2F55A 1KK0A 2IYRA 3QPUA 3B1WA 1UKEA 1Z8FA 5FUWA 4A36A 3K0SA 1S96A 3BERA 2XEXA 3E70C 3QQ5A 4JJKA 5ANRB 3WYGA 4B3FX 4KU4A 1S9HA 2ZREA 4UXIA 4UXJA 2NGRA 2JLWA 3VQTA 1EFRD 5HZHA 1KMHB 5FI1B 1FMJA 1GL9B 2DWOA 3RRZA 2P0EA 1TF5A 5IRCD 4BASA 3CX8A 3CH5A 1W36B 2VHUA 2CK3A 2C98A 3A37A 2VQSA 2Y8EA 2YC4C 1N6IA 4JIMA 1U0HC 3TJZA 1KKMA 5BXQC 3C5CA 2GCOB 3AB3A 3MAAC 1R0XA 2HCBA 1DE0A 2NO9A 2Q9BA 3L2OB 4XWOA 4IEIA 3EZFA 3EXAA 4HDQB 2VLIA 3RWOA 3VU9B 1ZINA 2MSDB 4JSYA 1OKKA 2BMFA 3ZLJA 2CHQA 2JJ2D 3G5UA 1ESNA 2RGNA 4Q4LA 4ACBA 5FOSA 1U0LA 2OCBA 2Z4RA 4B34A 3QKTA 4TL6A 3ZVLA 4NH0A 4A6XA 5CIWA 5IDVA 1XX6A 2WJGA 3B1XA 4Q01A 1Z29A 3CNOA 4JLJA 4MQBA 2G0NA 2XZPA 3FHCB 3HR8A 1I4DD 2FWRA 4TMVA 3TR0A 2QE7D 3K8YA 1VCOA 4CVNA 4GOXA 3LH5A 5FTMA 3PEWA 3X1WA 5K8IA 4V0OA 2QT1A 1UAAA 1G7CA 1GKUB 2BEJA 3LQQA 4A92A 2LWIA 3IO5A 3KFXA 2CNWA 1L8QA 5DI3B 4OYHA 4Q5IA 4C0JA 2FSGA 5JRJA 3H2YA 1CBUA 2IUUA 1OYYA 2A2ZA 3DL0A 3WBKA 1OH6A 3K0AA 5EE0A 2ZE6A 2BC9A 3H0KA 1D2EA 3SFVA 3VMFA 2ZRHA 3BXZA 1W4RA 2P65A 2ANBA 5EXTA 1BMFA 1TL7C 2G3YA 4JVMA 1ZVQA 2QTVB 2ZR7A 2CBZA 1U99A 1Z0FA 1F6BA 2WWIA 1ZD1A 5J4KA 5JCPA 2B7BA 3V9PA 2PT7A 4C3ZA 1G64A 4C0KA 1KO4A 1ZMXA 5EP2A 4AKGA 1XTSA 2J0SA 1DAFA 1CJKC 4XWAA 4WA7A 2MMGA 2ZM5A 2OILA 1YZNA 3C4JA 2ZRJA 2RKOA 1ZM9A 3LNCA 4IHQA 3O47A 2IS2A 4Z51A 4CT5A 4CF7A 1GNQA 5EE1A 2GCPA 3QKSA 1U2RA 2AK2A 3OAAA 1XEFA 4JLNA 2V7QA 4BLOA 2A5GA 2OZEA 5FOVA 4AKHA 2W6JA 4LZZA 4XOIA 2OE2A 5LPNA 1M6NA 1SZPA 3KTAA 2CLDX 3VR5A 4QGAA 5EP4A 1T5IA 5BYJA 1VYVA 4F91B 4EFMA 2HYDA 4ZCLA 4TQUS 4D4LA 5JLJA 4H1UA 5AK0A 1KNXA 1KY2A 1QHXA 1Y63A 1R8QA 1AA9A 3KX2A 4IOKA 2UKDA 4NBSA 2IS6A 3BAFA 3T5DA 3UIEA 2E87A 1UF9A 4JZKA 3Q5EA 1T0JB 4XVQA 4YC7A 4TTRA 2IXEA 4LJ6A 1ODFA 3B78A 2HEIA 3BFVA 3DMNA 5KNDA 1NG1A 4Z8YA 3WP0A 4UXHA 4V0MA 621PA 3RHFA 3PIRA 1Z5ZA 1DPFA 3AF0A 1R2QA 1XZPA 1KJWA 1XJ0A 4D6PA 4EFLA 4EDHA 3SS8A 3RSLA 4F38A 3W9YA 1HA3A 2YOFA 2GAAA 4PO8A 4I81A 4PZLA 1Q44A 3VR4A 3R7WB 3FB4A 4C0AC 4QM7A 1Z47A 1N0WA 1R5NA 2IWHA 3FPAA 4GFDA 1M7GA 1DAEA 4NZYA 4HAXA 1PLLA 1XU4A 3QBTA 4IEEA 3KQKA 2HXYA 2WICA 3VR3A 4PC2A 3R8CA 3S1AB 4A8JA 1N5JA 2GEVA 4N3NA 4EQ6B 1F2UB 4O0MA 2IBMA 3CRW1 1KDRA 2BVNA 3WNDA 5F98A 4ZKDA 2X1VA 3D8BA 4MRSA 3ZIAD 5TDHA 2AR7A 4LC1A 2PZFA 1KK3A 4PAOA 4B2LA 1J70A 3T34A 1NL3A 1QHNA 4WZAE 1FUKA 4QBHA 1O87A 1N6HA 1Q1ZA 1QVRA 4HI0E 4QC2A 1Z2AA 2ZE8A 3EAQA 4UJ5A 4RD3A 2VF8A 3U60B 1N2CE 5FPTA 4OI2A 2JLUA 2GKSA 2VP6A 4DLRA 4BEBA 4YMUA 1FPMA 2YVUA 4POAA 3IQXA 3PUZA 1EX7A 3F0TA 1RIFA 1JQJC 2WTUA 3ADDA 3KFVA 3Q85A 2QZ4A 4M1YA 1W1WA 2ZAMA 1WXQA 4YDHB 4WW0A 1TF7A 1TX4B 1OXSC 1IONA 1DEKA 1SXJA 1RRGA 1XP8A 3JZAA 5KHOC 2VTKA 2QMHA 2CLSA 4AYTA 1N6NA 4Q4AA 3QXHA 3T12A 2OCPA 4ERNA 2WPDD 2ZQ5A 1ZC4A 1K5DA 3N2IA 3ICEA 2IL1A 1A2BA 4QKQA 4I1OA 4NCIA 2OT3B 1IN4A 4LJ5A 1A5TA 3GJ5A 2Q9AA 1AS0A 3DZDA 2A78A 1NBME 3SDZA 4ILEA 4EPVA 2HJVA 3AP3A 5LD2B 2HYIC 1HE1C 2BM1A 1Q3HA 4LC0A 3AM1A 1CLUA 4M8NE 4JS0A 3B6EA 1YZLA 2GZHA 4Q4HB 2ZJAA 1II8A 3PR1A 3DO6A 3E2IA 4CIDA 2OSBA 2QGZA 1I2MA 2I3BA 1UEIA 3HYTA 3K70C 2V8OA 2KBEA 2FPLA 3MWLA 1E4VA 5CYPA 4AWXA 3K0FB 4K46A 4RCYA 4WVFA 4KODA 4PC1A 4CZ2A 2FG5A 4PZYA 1P2VA 4YLGA 1LV7A 1T4GA 2FPMA 1I4LD 3SYKA 1DO0A 4KVGA 1Z22A 1E2KA 4TYNA 1HE8B 2WAYA 3RRMA 5G41A 2YOGA 1EFRA 2PZGA 3W3ZB 4URVR 2Q3HA 2YWHA 1RE0A 1WCV1 4Q7JB 2BMJA 4M1WA 2E1RA 3Q5DA 4IJMA 2GXAA 3NDPA 4RZ2A 2JASA 1OB2A 1HV8A 3T1OA 2DWQA 4WBSA 4MYCA 4M1KA 3WHLA 4DSOA 4EJSA 2FPKA 2HT6A 4HATA 5JMTA 3I3SR 1VG1A 5D3MA 3R8FA 2O8EA 1GKYA 5CDFA 1W36C 3B13B 3BS4A 4TTQA 4IVRA 3QNUA 1ZM7A 2GDJA 1L4YA 1Z0DA 3W5JA 3TGPA 2CVHA 3GLHA 1NLZA 3ZQJA 4A1FA 2BHRA 2FMXA 2R6GA 5B57C 3KL4A 1SVLA 5KNCA 2LCFA 4V03A 2JJ2A 3I8XA 4DT1A 4IDHA 4DXAA 3LLUA 3CH4B 1CR1A 3CR8A 2ZSDA 3ONWA 3AVUA 1OF1A 1YZGA 2BV3A 2YV5A 4B32A 5DN6D 4Z54A 1ZJ6A 2QTHA 1X6VA 4DSUA 4URZR 2QE7A 2ZI9A 1P6XA 4G5QA 4HUQB 3ZJYA 2R9VA 3GJXC 5FBQB 3VHLB 2P5SA 1ZCBA 1Q1BA 2QP9X 5JWRA 3WRXC 4NP6A 1CR2A 2WJIA 3M6AA 1PV4A 3OE7D 4EIWA 2C95A 4HAYA 3CZQA 4DLWA 4F4IA 2GWHA 4PTLA 2ZXUA 1NY6A 3K0CC 1JR3E 4B48A 3U3RA 2XXAA 4URYR 4M1SA 3VNUA 4QGGA 4NPHA 2XZLA 5TXGA 1K6MA 4I4LA 1VCNA 1XBTA 2PX3A 1FTNA 1YHNA 1WBBA 2ASEA 3GJ4A 3QG1A 4RFSB 4B43A 1DTSA 1ZM4A 2BJVA 2YWEA 4ZKEA 2CCGA 2B8WA 3LA6A 1W2HA 4LJYA 2GJKA 3DOFA 4HLDA 2XX3A 3Q7QA 2ZU0C 1FX0A 3TSWA 2ZPTX 3LQRA 3VR1A 4GT1A 1VPLA 2NZJA 2H16A 3EPJA 3R20A 2GEUA 3QSYA 1XJCA 2JAQA 2W58A 2KE5A 1W49A 4RJLA 1KSHA 2W2TA 4BFYA 4PHHA 4RZ3A 4MYHA 3TUZC 1JNYA 1KGDA 2QM7A 3HWSA 3U44B 2EFCB 1QBKC 1F2TB 1LVGA 5IT5A 4GNKA 2PZEA 3U3MA 3UATA 4US2R 3KDSE 1G1MA 2J9RA 3IHLA 1HURA 3LBNA 3SBDA 5EUMA 1AGRA 2O5VA 1WE2A 2ZETA 2IF0A 4BFXA 3GJ0A 1P2TA 5G53C 3ZGXA 1WBDA 4FMDF 1HT2E 2W83A 4US1R 1TEVA 2C99A 1GM5A 2J59A 2F7SA 2A30A 4B6EA 2V1UA 1FUUA 2G9NA 1OH7A 3VFDA 1E96A 2R8RA 2JDID 2W6ID 4IOLA 1E9RA 4ARZB 4MGZR 4BQSA 2UZIR 4IFEA 1JECA 1TUIA 3C5HA 1GZSA 3BC1A 2J41A 4TYYA 1E2IA 4R98A 1VECA 1US8B 3TE6A 1R4AA 2EYUA 5JI2E 4KFRA 4DDTA 5BN4A 4OQNA 4IRUB 2BWJA 3KJEA 3K9NA 1XCGB 3MD0A 1XD2B 2OCAA 1OXVA 4RD1A 2D2EA 2DFTA 4KBFA 5CJPA 1P3JA 2TMKA 3THXA 4V0LA 2NO7A 2I1QA 5K8TA 3O8DA 2GK6A 3IGFA 1S9DA 4B3DA 5J4HA 1XWIA 1H8HD 1XCMA 3K9GA 2ZE5A 3GLGA 3PEVA 4MDEA 3FMFA 4UJ3A 2CJWA 3EWSA 3TMKA 3SYLA 1CJMA 1ZD9A 4LSGA 4BZXA 1U8YA 2K5UA 5FL3A 4NMMA 1S4QA 1VCMA 3SJCA 3FMPB 3GEIA 4XSHA 4BE7B 2QGNA 2VSFA 1BO6A 3QY0A 1VTKA 3IDQA 2NIPA 1U9IA 4Q9JA 2VL7A 3W90A 4DCVA 4U7DA 4NCJA 3AVPA 1P9WA 3ZIAA 5L3RA 2YKGA 1KKLA 1W0JD 4MA4A
chains in the Genus database with same CATH superfamily
1JIKA 3IQZA 1NRWA 4GKVA 1HFEL 4QT0A 4QXQA 2LRHA 2ZRIA 3RF7A 4CQMD 4IEFB 3GA0A 4I6GA 3VHRA 4DIKA 4HVCA 1AGXA 3KZVA 5BQOA 1N5RA 1V45E 1XJ5A 4TTAA 4E21A 5BQXA 2H2AA 4QUGA 4BWVA 5ITSA 1CS4C 2YZGA 1YWGO 3GNLA 4Q18A 2XTAA 4EMSA 4DIBA 5IARA 3ZV4A 4U2FA 3LQKA 1YS6A 2ZJFA 3WGHA 3VKUA 3FRIA 2Q41A 3RANA 3GJSA 1N9KA 3LXRA 3AETB 3CO0S 4LNAA 4BLRA 4UE6A 4C6TA 1Y8AA 3OU6A 3QTTA 2BFEB 3B3JA 5ERGB 3QXJA 4NCXA 1ZMOA 1FDVA 2CL6X 1JFFA 1SBZA 4IP0A 4PLVA 4AN0A 1PJ4A 4BP3A 3BXOA 2YHUA 3P4YA 1FFYA 1V7ZA 4MR7B 2H7VA 3GLUA 2VN8A 1JU9A 3HNRA 2ZBEA 2DYKA 5JZMA 4Q3CA 4PONA 1G2PA 3ZXXA 4AJJA 2YH2A 4D79A 1D0IA 3H4MA 4HNHA 4OUDA 4BYMA 1UBCA 1PG2A 2OBFA 2C5LA 1D0SA 4FEAA 4HWOA 4PFJA 2PL9A 5BQFA 5KSYA 5BNFA 3RSOA 4D3ZA 3MOSA 1Z07A 5AOBA 3H8JA 1X1CA 1JJFA 3PGJA 4PEVA 1JKFA 1CUGA 3LT4A 1PT7A 3AF5A 1JAHA 1W88B 2WSSD 4OHBA 4XUGB 3HCOA 1OAOC 3B7PA 4BKQA 5KTKA 1XPOA 2EG5A 4ZO6A 4ZA2A 1N2HA 1JEQA 1H2BA 3ESZA 3M33A 2Z83A 3UWDA 5CFQA 1E7SA 1YDEA 1E3WA 4YK7A 3FOBA 4EPRA 2YV3A 5FWYA 4WXPA 4YI5A 1FU4A 3W2EA 3DG9A 3KZCA 1TW3A 1S1CA 4B76A 1XP5A 4IFBA 2VDVE 3I3OA 2OFXA 1ZCAA 4DCSA 3MS7A 2PRZA 3PBKA 4NECA 4PM4A 4PV7A 5TMPA 4IWYA 4IHJB 2VT6A 3OZRA 3QG5A 1A8HA 2P5TB 2VP2A 1YBFA 4IUYA 4MGIR 2YJ3A 5J43A 5C4IA 1CY7A 1FVXA 3NUGA 3QVSA 4FMBB 2QUHA 4AY5A 1PDOA 1EI9A 1YASA 4G23A 5EIWA 5AJHA 2H6EA 1II9A 2PD4A 2C9DA 5TRTA 4O2BA 1E66A 1NJFA 2PZBA 1NRIA 4PTYA 5I9SA 4JGIA 1ELOA 3CZAA 4X20B 1E1KA 5GJWC 4WNAB 2QOEA 2LV8A 3QM1A 1MRSA 4IAOA 4DLPA 1TU4A 5FR1A 4QEZA 5FTKA 1CF9A 2Z2YA 3OX3A 4M9CA 3H8WA 4EY8A 1M3SA 2Y1DA 2GPSA 3R6TA 2B7CA 3B82A 2D2FA 2NM0A 5EFOA 5DNYB 2P11A 4P84A 2H1SA 4R2LA 3BWMA 3U7QA 4A8PA 5LC1A 1XFDA 2TMGA 3PEUA 1MP0A 2PXCA 2WIBA 2JNWA 2LNDA 1PR2A 3WDKA 5B1IA 1QTIA 4KQMA 2COKA 4PHGA 4D9BA 5JHHB 2P6MA 2OVFA 3NTQA 3NT4A 2V6BA 4B7XA 1GFZA 5DNVA 2JJ8A 4PN7A 4W5RA 2X0EA 1F5SA 2J3KA 5K8CA 1PWYE 1XFAA 3CRRA 3HC7A 1F60A 4KMRA 5CB0A 1W30A 4MQEA 2VQ3A 4RAOA 1HL7A 1NRJB 3G9QA 5KVSA 1FB5A 2C5GA 4CKBB 3KDPA 2C54A 4IVNA 5B12A 3J81k 3ZVMA 1KI7A 3ZLVA 4P4SA 2WYWA 3QKSB 1TD1A 1ORDA 1H2ZA 2WB4A 4OK3A 3L7YA 3NETA 5JS8A 3C24A 3QENA 2BKEA 3GZNA 2YVQA 1EEXB 1C9NA 1MUUA 3DKPA 2JBWA 4XUEA 4NR0A 1Z4LA 5GIPE 1P9RA 5GADl 4S12A 1ZNQO 3F6SA 1V37A 4X7RA 5HILA 4CEIA 1L8LA 4IX9A 3UC5A 1QDEA 2JAOA 1NUAA 1JHXA 1G8KA 1XQ9A 4Z5XA 4PFSA 3VDRA 3EE6A 4MPPA 4MQ5A 1NXQA 3HRKA 4ZT5A 3L5OA 1ZITA 1W8DA 4ASUD 4DUYB 4MQUA 4GWGA 4XM2A 1IMOA 1MTZA 4G3XA 3GMTA 4YRTA 3TM4A 2VBIA 2JLCA 3IOBA 2C9BA 3JYQA 4AF7A 5IFKA 3TD6A 5IXSA 5IXYA 5LQSA 4WK4B 2H5EA 1Q1NA 5BN3B 5AKLA 1WSDA 3AEKA 4LMRA 5EP3A 1VHTA 5B4TA 2AI2A 2ODQA 3WV5A 4BBJA 4UQPA 2AX4A 4WKGA 5KOHB 1U4SA 1ESMA 1TD9A 4A16A 4DKJA 2QV7A 2CEKA 1SHLA 3URKA 3HYLA 1U8XX 4ZRMA 3OJLA 4RMNA 5U4XA 3GA7A 3GLSA 3H5IA 3H0EA 2YV1A 1E3JA 2ZS9A 2RD2A 3AI7A 5DLPA 1LQTA 4OM7A 2ICAA 2JLBA 1GRRA 3ANTA 4Q1BA 3K1YA 3LHFA 1DZ3A 1IUKA 1SWVA 1UJ2A 1USWA 2IQIA 3LYLA 4NLLA 4XIFA 2R00A 5EIOA 3I6IA 3WDLA 4BQFA 1SD5A 3ESQA 1SVIA 3GGSA 4L27A 5DIFA 4EW2A 1QP7A 3JAWB 3IQDB 4D4GA 4DLSA 3ZQKA 3C8HA 4B3HA 1XAGA 1ICIA 5K3EA 1U81A 1JV2B 1XKLA 2W6IA 4FMDB 2EQ5A 1SVWA 1VM6A 5FBKA 4QNRA 4KX5A 3GNQA 5CG2A 2AWNA 4CU2A 2AOUA 2C4MA 1ZCZA 3N8IA 3KUDA 3SF0A 2BEVA 4LBZA 4MVCA 5D8DA 4D4MA 1L7MA 1DKPA 4HGYA 5JIBA 1WB5A 3BZWA 3JQBC 2C61A 1UOQA 4OQYA 4C6HA 3TX2A 4EG7A 4Q4JA 5I9TA 1JEOA 3LUBA 3S8EA 4OFWA 1FDSA 4ZOAA 3TD2A 4BZPA 1TZ2A 3B89A 3JW8A 1W47A 3A4NA 1HMYA 1R6DA 3IAHA 2H08A 5T4BA 1JBQA 4C4TA 2GZAA 3DL4A 3TNYA 3PL5A 3VKHA 2DUNA 4IIUA 3ZCXA 1SB9A 3OOWA 3PNKA 3FUXA 3M6FA 4GWKA 3ED1A 4MKXA 2C8VA 4QUDA 2QLBA 3DHYA 5AUPB 1K8RA 2ZBGA 4MTCA 4R05A 2OM6A 5FTWA 5LZ5A 4BV9A 4QT4A 4YLYA 1E2MA 2G1KA 1UOPA 1VG8A 3IUSA 3W8NA 4LJRA 4R8RA 1Z08A 3D0OA 1PNQA 2ANCA 1DO2A 1JKXA 4N65A 5IZCC 4F4UA 4ND6A 3G6WA 2PR7A 3FE2A 3EUWA 3W5IA 2ZXEA 1KEUA 1ABFA 1FX1A 2OXTA 3STWA 1XN1A 3OTOB 5TQ2B 3DOIA 1QAOA 1V3VA 2GAFA 3T5GA 2B6NA 4NU8X 4RSMA 5E9WA 1COZA 3BN3A 3M6LA 5LU8A 4L4ZA 4HN2A 3U19A 3HL0A 2C4NA 1ZYUA 2X2FA 4LMPA 1VBFA 4CQMA 4PSAA 3DWIA 4N5NA 5CLGA 3WK7A 1J2EA 4BMSA 4C7BA 4P6VF 4F12A 1OZ0A 1DIBA 1BDJA 2WHPB 2NQTA 4ZVOA 1GRNA 6NULA 3LQ2A 2HK6A 2G72A 3SY8A 5KKCA 4WFIA 1JBKA 3NBQA 2EX4A 2AYZA 1J8DA 2F48A 3ICOA 3E8SA 3T7AA 3FAKA 4AO6A 4MR8A 3CJRA 4BKRA 4WSOA 2HCRA 4HX9A 4YJFB 4DA6A 4U7GA 4QEDA 4BLTA 4NJOA 3LA8A 1LK7A 1N2SA 3PHBE 4ZDIA 1P7VA 2ZT8A 3SZRA 5IFLA 3WMGA 4BJ6A 1USUA 2Z08A 1DAOA 2AMLA 2QN3A 4WN3A 2VQDA 4PLGA 2WQZA 1NU8A 3RLIA 2HU5A 5FH9A 2C42A 5JXJA 1XXHA 3C3AA 1P2FA 2Q0HA 4TL9A 1QO9A 4JYBA 4R1OA 1N7GA 1RI5A 4CIYA 4KXUA 2XH8A 3BL6A 3QF7A 4X44A 4GIBA 3FOAA 4R68A 5EIAA 3TFQA 2JIDA 3W3AD 1KJZA 1VFPA 4CW7A 4HYTA 1GDHA 3OMXA 4A82A 1QBGA 1TMKA 3OLQA 3EA5A 1EM8B 4OGKA 5J1TB 3CF2A 3N74A 1W96A 3RTDA 2VK2A 4C7JA 4CDGA 4JT9A 3HR7A 3LSTA 2PS9A 1SCIA 2WU0A 2OYSA 1SG6A 2ZFUA 2WSSA 4JU9A 4DZZA 1ONPA 1V9CA 1X3LA 3PNMA 3SC6A 4JZYA 2R8PA 3R9KA 3G2JA 2EZUA 1RWQA 1VSTA 4DT1B 3AVXA 1UP6A 4ZPJA 3ZHBA 4DWWA 3IOMA 5KSZA 3KLMX 3AR3A 3STUA 2ZJ7A 3DM5A 3TIXB 5LZ4A 5JDIC 2B0JA 5C18A 3PJEA 1NBIA 3BH0A 1EK5A 3VNAA 4CIAA 2HUPA 2OPBA 2QMZA 1GQFA 4GOND 1DKMA 2BAGA 4ENSA 4FJ2A 1I36A 3FNBA 1M2NA 1K92A 4D9CA 3ZVNA 1NNSA 1BN7A 2B1GA 2OO5C 1IZYA 4PYLA 1NMEA 4LMBA 4Z3DA 1ZQ1A 3MAGA 5JNVA 1LTQA 1O6ZA 2WFZA 3P9KA 2C4VA 2X6RA 3L7OA 2ATIA 4FKMA 4I2NA 4EA6A 3MXOA 4TGLA 3RVKA 1J0XO 1GG5A 3AY0A 5ETJA 5L6MB 4XX0B 2H3EA 5FR2A 3UKDA 2PQMA 1ZBQA 3VZDA 4HUTA 3QVKA 3HEAA 2GHIA 2HPZA 1H0SA 2I62A 4M86A 1L5LA 2B92A 1UBJS 1KI4A 1G20A 2JHCA 4LVUA 4XWYA 4ALJA 1OU0A 1YJ5A 3C97A 4A7PA 4D80A 5B1DA 1A50B 1P72A 2PGOA 3PKIA 3LLVA 5LMCA 1NTRA 1QRAA 2F3PA 4JEIA 3WLMA 4A8HA 4DADA 2H1OA 3VPHA 1A9XA 2HHJA 1CUSA 5FD8A 1LBSA 3BE6A 1LUAA 3I1FA 4PSCA 1WUJS 2GCOA 2JEYA 1SO8A 2OV3A 1YT5A 3FLAA 3AUXA 3R5FA 4MYTA 2W9XA 3OKCA 4R2MA 4YALA 4DEYA 1FFBA 4GGMX 4IMIB 1RKXA 3UV7A 4BAZA 1FIUA 1YL5A 4UOQA 4GOKA 4QTYA 2WMYA 5L9AA 2MINA 5AHKA 2Z2JA 3H9JA 2QJWA 1E5VA 3H11A 1W2WB 2O50A 3NM4A 4IILA 3WZMA 1WXHA 3SF8A 3ZY2A 4CKCA 1NLFA 2K6GA 3TOSA 3UAVA 3GPIA 3LO5A 4TLMB 3JARA 1JGTA 1C7JA 1T0HB 3RTGA 1AS2A 1SH7A 1ULSA 1LPPA 2XVYA 4DARA 2GNOA 2YJZA 4XVHA 3T7DA 1R4NA 3R9WA 4PFQA 5K0SA 3GRZA 4D26A 2QDKA 1U31A 3HDYA 3WRXA 4KFCA 2WJVA 1SRQA 5DHAA 3GVCA 4OX9B 4KIJA 4ASUA 3U6BA 1ZSNA 1CEXA 3K0CA 1RLIA 4XTRA 2JVKA 4CKYA 2VATA 1ZA1A 3IILA 1XL1A 2Q3LA 3A6JA 1E1CB 2MTBA 1XTBA 4NDZA 4AP6A 4V3CA 4EEKA 3UJ3X 4ZJZA 2CLOB 3DHWC 2V6IA 5BN4B 3DGEC 3MJRA 3KUUA 1JHPA 3RHZA 3EISA 1JA1A 4QXMA 1XF1A 4NZPA 2J4CA 2E0IA 4FCCA 1XEWY 4Z4FA 3V33A 2JAPA 3HE3A 4KQXA 3FFBA 3PCXA 3P2JA 2O06A 3V8MA 5AJTA 4QBFA 4FBGA 4OHMA 2W48A 4JC0A 3O8QB 4MKFA 3B9BA 4KREA 1B23P 4MRAA 4FCVA 2PJRA 2YHBA 5FX2A 4WFKA 4YGYA 3PWKA 4LAFA 2YOHA 1UDBA 1WS6A 1L4NA 2CJWB 3FN4A 5JG7A 4E51A 3GB9A 3FOCA 4XGKA 5DM60 1WABA 3LP6A 5A2QA 1RI2A 3Q7RA 3BM5A 2Z6VA 3QEJA 3Q1LA 3WNVA 4Y1GA 1L1EA 1O54A 3AHEA 4RO0A 4NEGA 1IM8A 4X5OA 4MP8A 4ZIRA 1O95C 2HW8A 4YGXB 2GKGA 4NAUA 2NSHA 4O3FA 2EP8A 5EESA 3P96A 3GGDA 1P9NA 4RD0A 1M6VB 2WTAA 5EWLB 3TKLA 3DTVB 1VG0B 3K5WA 3T9EA 4L3VA 1CUAA 1FC0A 3NH6A 5A0VA 2CXNA 3DT8A 4AI6A 1VLHA 2QZPA 3O74A 3E0XA 2F43B 1U7ZA 1ILWA 3GQBA 5D3QA 1KEWA 2F8MA 1GZ4A 3PNPA 3QFTA 3RTCA 1S2IA 3UMYA 3IR7A 1ISIA 1AJEA 5C1OA 1I3LA 4M88A 3U4QB 1JR2A 4LYGA 1NU6A 5C32A 3A32A 3NFYA 3PE4A 4B46A 1C3OA 3I23A 2VJMA 3K16A 4JL6A 2VI5A 1KK1A 4L5CA 3PFGA 3NVAA 2G82A 4M60A 5EHGA 5HG0A 5LQJA 2OWEA 4NV3A 2B8TA 3OE5A 2C82A 2C29D 4E2FA 1TO1E 1V11A 1NW4A 3OQ1A 4KRXA 2P69A 1PK8A 2PVCA 3CZ5A 3WJ7A 1KIAA 3CCCA 4HX2A 2BF7A 3EVGA 1RSZA 4KWEA 2ENWA 1KZGB 2XJ9A 2XQGA 2AL7A 4GPTA 2WJWA 1ORWA 3ET4A 2C3OA 3OCZA 3RNLA 4A5SA 1LLQA 1DC7A 1IE3A 5G4KA 5JVDA 3WRYC 2R1UA 2Q29A 4QOSA 2DQKA 3TG8A 1MABB 3N5KA 1WZEA 1RWNA 1EK6A 2IODA 3VA7A 1Y1SA 2ACWA 5EYPA 1EGVB 2O52A 3EPKA 1VFNA 3RYIB 4EHNA 2QYTA 2FE4A 3A9TA 2GK4A 4O25A 4UHJA 5FUVA 5CVVA 1MX1A 5CDFE 5EPUA 1Z4KA 1ADGA 1RJ9A 2V55B 1MQ9A 4KR9A 1K27A 1QDUA 1X8XA 3TQOA 4ZYWA 4YCJA 3X2SA 4IG9A 4PBSA 1DARA 1Q84A 4QL3A 4AP9A 4D9NA 1DC6A 3F8TA 1QWOA 1PJRA 2JKZA 3PKZA 4EO4A 2WR8A 1FRVA 3PJFA 4Y18A 2KJQA 2AV6A 1T8RA 2HMTA 3QE0A 3FF4A 4DCNA 2NNWB 1UBGA 2VP5A 2HA2A 1FP1D 2IGTA 1U6IA 2XJ4A 2IDMA 4KQKA 3PSAA 1JHOA 5BW8A 3O1JC 3RK0A 1XTKA 1CUIA 3GPCA 4KUGA 3WGYA 3HJGA 5HSGA 4WQMA 3UWMA 1U02A 4H77A 3L46A 3D7NA 1R27A 2CLKB 1EM6A 2AFHE 4LJ8A 5D87A 2G76A 4Y2QA 3V8PA 4BB9A 1CYEA 4ALMA 4WL0A 1FUEA 4AQDA 1WBJB 1WCWA 4J6EA 5I7AA 1B0AA 1PT5A 1Z5UA 3O95A 4LZOA 5JNUA 3V7WA 1E0DA 5TQVA 4F72A 5KYUB 1OBOA 1XRLA 4BVGA 2VJNA 4WN9B 4B09A 4X6XA 2GYUA 4ZT6A 4ZN6A 1F06A 1YZ3A 4RTLA 1BCSB 2X76A 2UZ4A 3JZDA 3DVSX 2QSUA 3GBPA 2NU8B 3T1QA 3ZBPA 1ONBA 3W3AA 1KHTA 3K8QA 5A7FA 3MUNA 1PKEA 1R6BX 2YS7A 4ITUA 1D9ZA 2FPRA 5A5VA 1LU9A 4R69A 1PBNA 2B35A 4KQJA 1ZUHA 2A0KA 5BW4A 1N5LA 4QJ4A 1QS0B 1EG2A 3MFYA 4BIIA 3DLCA 2EDCA 5LP6B 3DNMA 5FCDA 1CF4A 1CQJA 1BIFA 1GAJA 3QE2A 2XVMA 3FY4A 3C7AA 3QUCA 2XUHA 4ISCA 1XDUA 3CUVA 3TRFA 3JAMA 5HE8A 5FI3A 2A9VA 2PT6A 2C5BA 3RSGA 4BLSA 1SBYA 2VQ6A 1AF7A 3QKRB 4MW6A 2JGMA 1AUXA 2I03A 3SMQA 1LJ8A 3UXHA 2I4TA 5D5PA 3L9XA 1OTHA 1Z4MA 2DBVO 5G3YA 5JRZA 2PX6A 1XZ8A 4KN9S 5I4IA 2SICE 5BWLA 3F67A 2DR0A 2J0UA 1YGPA 2VF7A 1FXWF 1RRVA 3IMFA 3ND9A 2A3RA 4NZZA 5SY9A 3EX7C 2AIRA 5EG5A 2ZJ6A 2DEUA 1ZY2A 5BR1A 4A27A 1F0KA 1V5EA 4ZCPA 5JO0A 1PGOA 3LBAA 3OZEA 1Y48E 4UTNA 4JROA 3NWBA 4WEOA 2RI1A 1P77A 4LJ9A 3TRJA 3V7FA 3HM2A 4PC7A 1T0UA 2OL4A 2Z6AA 4N5IX 3G0CA 2WF6A 1IBSA 4EVQA 1Z17A 1ACLA 2XUIA 4P5EA 4WHMA 1DBQA 2PT5A 4XGIA 2HDNB 2P9GA 1R8SA 1U0GA 2CCJA 2ONYA 3R0IA 2GAOA 1NWHA 4YT5A 1G5PA 4IRXA 4ZK6A 1NC1A 2P41A 1P39A 3PQDA 4URXR 1J2JA 1T26A 3EC7A 4JDPA 2Q6TA 5JANA 5K0FA 5A4DA 3E9NA 5DHFA 4B0OA 4X91A 3P97A 4S05A 2FG6C 1LSOA 5EJFA 4CM9D 4YEDA 4KPUA 2X8AA 4HEA1 2VYCA 4S1NA 4CIXA 1GZ6A 4L2IA 3WGUA 1P0IA 1UBNA 3LECA 2QMEA 2ZOSA 4UU0A 2Q4TA 3Q8XB 3FFWA 1RDFA 2CVPA 3AQIA 3TIGA 2MYTA 2COEA 2EKPA 1ZK1A 5TMBA 5CFLA 1TEHA 1IY1A 3JALB 5JRDS 4IJVA 1P2GA 3PHLA 1GR1A 1Y6JA 3IT3A 5AW6A 2QYOA 3EYWA 3HPRA 4G0NA 1IAVA 4IIBA 2DAPA 5FOWA 5H02A 1AB6A 2HPAA 2QUBA 3T61A 821PA 2D3WA 2GS9A 3HCDA 3KE8A 4QATA 3FWZA 3ZXYA 2D4HA 2GJAA 1RMYA 1J9GA 3KKMA 3WYBA 3N1UA 4ZYLA 1AQNA 4MVJM 3D4NA 4QD3A 1BSVA 3F2IA 3WKBA 3I4LA 1CPYA 3ORQA 4JOSA 1I7DA 5A04A 3RC8A 4QICA 2FHSA 3MW8A 4DIFA 1XLUA 2C9OA 2OCYC 2PSJA 1NMXA 1R6UA 1XTZA 3DXZA 4I66A 3RAGA 5J4VA 3KYIB 5KI6A 2B8NA 1H66A 2XOKD 1HNZB 2WSBA 1MC4A 3NDJA 4NDNE 1CXZA 2GZMA 4DBLE 1FMFA 1SXPA 1TK9A 4M7OA 3AV0B 3J80A 1ZN9A 4OF4A 5FO0A 5M04A 5KAMA 2RGRA 1URPA 4JENA 4HXGA 5B53A 2HPVA 4EAAA 1IN7A 4B3JA 3HUDA 4GRAA 3U1TA 3FPGA 5I01A 2ZDQA 3ZG6A 5LQKA 1QHGA 2ZRDA 1WB9A 1NA5A 3RS5A 1HTBA 4GI1A 4WLOA 4BVHA 4PGGA 1L5OA 2CZQA 2PJDA 3ANYB 4Y2YA 2OOSA 3U5TA 2FJ0A 1NVVQ 3CSSA 3ROFA 3IV6A 3RYFB 4ZMSA 3H84A 5KUTA 2X8BA 4B4UA 1EPUA 5HS4A 3VH2A 3BIJA 1QHFA 2ZRBA 1IY2A 3QZUA 4GBMA 3HGTA 2BTQB 1V25A 3M34A 3U3JA 1FLDA 1TC1A 4X93A 5KINB 1TJPB 2RG1A 1CZKA 2X42A 5E3HA 4YV7A 3NMUF 5A2GA 3T9FA 5ECWA 2I4RA 4G86A 1ISMA 3INRA 1DBPA 3PPWA 3PWSA 2QUJA 4PLTA 1U0NA 4R84A 2IFTA 1UKBA 3EDYA 3P26A 1SMKA 5FOQA 3BMNB 4OKIA 4PHTA 1M6EX 4XVCA 5KYYB 1C5KA 2Q3CA 4I55F 4QDUA 3E5HA 1U2TA 4DJ5X 5C7OO 1NDQA 1J97A 4C0HA 3LXXA 4O1IA 3KNZA 5FJJA 3CW8X 4ZVNA 5IC5A 1N2BA 1YCFA 2JS7A 4GVLA 3UICA 3LWDA 1GTMA 2BM8A 1VDZA 3TECE 3SLRA 1KIFA 4RA6B 1QUFA 1W4ZA 4W5OA 1QVAA 5SYMA 2EEPA 1SC1A 4BPBA 4FHZA 1GPDG 1LLUA 1X9GA 3DT9A 4FI3F 4B83A 4UTOA 4C9BA 4E15A 4OXQA 3ZR4B 1U5BA 3AR7A 1NMZA 2PWYA 1L7QA 1NLYA 2QN1A 3SXPA 5ICSA 2QW0X 1H3NA 1PW5A 1US8A 2IVFA 3CUEF 4O6VA 3IUYA 3U9LA 3AXSA 4KVFA 2I7TA 3KB2A 4JJZA 3SQMA 4OXIA 3U4DA 4F56A 3E3MA 4PLWA 3A11A 1UC4B 2IZ1A 4KSYA 1I7SB 1NPDA 3AHFA 1J5PA 3MGCA 3PNLA 4UUMA 3PSHA 5C9ZA 2A5DA 2XA2A 3V48A 3PITA 3WQHA 1EE1A 3D43A 3KKEA 5HZMA 2FUEA 1QIJA 1IQ0A 3CVOA 4XDHA 4B47A 2FX2A 3RS3A 4ZJYA 1O5TA 3H5AA 4KFSA 1K5GA 5E4JA 3BIOA 4QFBA 3CLVA 4D3YA 4G84A 1F8YA 2G77B 1CIPA 4UD6A 3Q9UA 4FFSA 5EE3A 4CR6A 3VTKA 4FZ3A 4X3OA 3NUQA 4MCIA 5DM2A 1FL9A 3R0VA 5IMBA 3RIGA 3KJGA 4PF1A 2A5FA 1S3SA 3JQQA 1M5TA 3G2NA 3ZWOA 2FCAA 1CNEA 1FBNA 4CGYA 1G8GA 3LDFA 1ZK0A 3EC2A 4JWTA 5G0VA 3B20A 5CXSA 1EK0A 3OIFA 3FCAA 3MRXA 3BE8A 2BM0A 1NJ8A 2TMDA 2ZRGA 3FZGA 4HRAA 4S35A 5D2CA 1RM3A 1QYIA 2VTBB 3WI7A 3AGPA 1E7WA 1G5QA 1R0YA 4P7JA 2FEOA 3G7UA 4XGQA 3AOEC 3TYXA 4HT3B 2PX2A 3AY6A 2EYQA 5KDOA 3QVWA 1XN4A 1E63A 2ZBVA 3DEHA 3GLIE 5JJ5A 4YRRA 2FSHA 3OJFA 1CNMA 2O0MA 3PPVA 1F1JA 1D9XA 1POWA 1OGJA 3DZKA 1QCCA 3F49S 3H2HA 2O07A 4RLFA 1YB6A 1X3SA 4DV3B 3FJ1A 1E6EA 3NXKA 1UZNA 4HTFB 3VNRA 4ZARA 1YBMA 2BFEA 2GO7A 3HWWA 3WE7A 4J16A 4ZK2A 2O20A 1CU1A 4OHKA 3I2FA 5CFOA 1J8MF 2AMYA 3DZGA 1UADA 3IAXA 3HO6A 4O2AB 4Q03A 4B40A 1SPXA 1NW6A 1KDZA 4DCOA 3AHJA 4FOPA 4RPGA 1UXJA 4NSNA 5P21A 5CFNA 1CUJA 2HU2A 2YICA 3EN0A 3HB1A 1QC5B 4IOJA 5DP2A 2WQ7A 4MGEA 5G0UA 3UK7A 4HMPA 1NQWA 3WMEA 3EQ8A 2CFIA 1DFHA 3TBKA 2EGGA 1MFZA 2MSLA 4ZCIA 1NKVA 3GT3A 1NSFA 1JLLB 2HREA 1WWKA 2GCIA 2WNIA 5H83A 2NZVG 4XYBA 5SZHB 3GJYA 5FV7A 4N0MA 3IH5A 4HZUB 2ZRMA 4NNOA 3CF0A 4GQAA 1CB0A 5E6RA 3ZVKA 1O57A 3FBTA 1W88A 4K9LA 1S2GA 2EGHA 2ZSJA 1YBVA 4M1EA 3IHKA 4BQRA 5ITVA 2CNNA 2Q7XA 1ZHHA 1ZD5A 4Z9FA 2Y99A 1ORIA 1OV4A 3WLTA 3L6UA 4AUKA 1FFGA 3MQ2A 5CK5A 3E22A 1H9BA 4IDCA 4B33A 4WEQA 4AO7A 1T35A 3CRQA 1HWYA 1UZUA 2FUCA 1IXKA 4HC4A 5DB4A 5JNLA 1GYQA 4P93A 4TXMA 1ZU4A 1VE1A 1IXSB 1XZLA 1CERA 2HNAA 1A77A 2QP4A 2TECE 3F6RA 4PE5B 1GOTA 4A10A 1DDOA 3LTNC 3FXAA 4LTMA 4HGRA 3I9OA 1WL8A 3GJTA 2P9TA 1FNMA 2DE0X 1MV8A 5CVTA 4XASA 1AQYA 3C6BA 3RJMA 1N75A 4LJKA 2UYCA 3I92A 4I36A 1QYXA 1SCDA 2Y1FA 4FMCF 1YZUA 1OZAA 4R9VA 3U7EB 2OD2A 4R9UC 4D4JA 4ERXA 2L42A 2O1EA 3E2PA 5DYGA 4CM9A 2JLZA 5TF4A 2AC4A 4WNAA 4YP5A 1OBVA 4LIPD 2ISQA 3IUPA 3PUHA 4KYTA 3KZMA 3KT8A 2D59A 1Z6PA 3L7DA 4IG4A 4F5WA 1A9TA 2VO1A 5M2QA 3EAGA 1E2EA 3N2LA 2YIDA 4OHUA 3DE0X 3H7IA 1TM5E 1SVKA 4K2AA 3W6PA 3N2YA 1CK4A 1TFUA 2BLLA 1ZD4A 2EFEB 2RIPA 3AU9A 3G88A 3RSQA 4DILA 1V1RB 1JSZA 2ZJZA 4YRSA 1FU8A 1M9NA 2IEZA 3CZMA 4H17A 2W71A 3JVVA 1KYXA 3L7KA 4IIXA 5DSZA 3GFOA 1JMVA 2GESA 4JB8A 4OH7A 3TE7A 2PZKA 3RJZA 3N87A 4XJTA 2Q07A 1G9TA 4GR9A 5KHAA 2OCIA 2RHGB 4H2DA 1BS1A 4HJRA 4M1TA 5FADA 4M0DA 4B17A 1ZN8A 1B15A 1TJ4A 4P2BA 4FFNA 3TRDA 3UMGA 4V1CA 5JJBA 1EWQA 4FR2A 2HD4A 1S3IA 4NMLA 4ZO9A 2PGAA 3OZVA 4U7WA 5EMMA 1XDWA 1FVHA 4NY1A 1RC8A 5DCYA 3UANA 4AO8A 1GGHA 5BWMA 4MI9A 2QTAA 3NHFA 4L75A 4WGGA 3WFZA 4AS3A 3OPMA 2P2ZA 4HDNA 3ROQA 1Y81A 2PWBA 3AESA 3NAZA 5AK3A 3UTDA 4LVOA 3LCMA 4ODIA 3DDNA 2JVIA 1NVDA 5HDBB 2XOKA 1N5DA 1AUPA 3VBEA 2RHDA 2A6PA 2P79A 2FKAA 4YIKA 3ZE6A 1PZEA 2YHIB 4N7MA 5EWJB 1E1YA 2AR9A 4D97A 4I5FA 3KK0A 1S8NA 1YSCA 3GUZA 1XCLA 5K01A 1JA0A 2AK3A 3ZDRA 2GYYA 2JCVA 2VNKA 3GXBA 3TIVA 4F2WA 1AO3A 1Z8DA 2QM8A 5GOZA 3KVRA 2D6FA 4JI2B 5DHSA 2DUUA 4K8RB 1ISFA 1AHIA 2DOKA 3FCUB 2QYHA 3V1UA 4EKEA 1KJQA 1WXWA 3A6PC 3MJVA 1MJ5A 3OH8A 1E7MA 2ZYIA 3L6RA 2LE0A 4GWLA 4LMAA 1CVIA 1YAHA 5E6UB 3RKSA 4F3RA 2PL1A 1FMLA 5BN3A 3KQNA 3QSGA 2W8BA 4TUYF 4FE7A 1K8YB 2APJA 1OYOA 2F64A 2WAOA 3BHMA 1WULS 3ELBA 1R4ZA 5KOHA 4FOLA 4LDNA 1BCRB 3J7TA 2GKOA 4ZI7F 4OP1A 2M6LA 1T13A 4P4NA 3L43A 1CWUA 4IXWA 3L93A 3GP5A 5IUNC 2IC5A 1RLJA 1SIOA 1QQBA 5HPYB 4RJJA 1T5DX 4JB3A 4EOGA 1U98A 2IYAA 3AIMA 3OSZA 5KMGA 3D6HA 1KMHA 2CVZA 4JIGA 4EGCB 2P2YA 3EZXA 5IAKA 2WOOA 4HH0A 1MBZA 1HLFA 2OCXA 3M9LA 4Q6WA 3TW6A 3EZNA 3T1VA 3U17A 4H7HA 2HF8A 1AKYA 1E4YA 2ZSEA 4LNUA 1BGXT 3GVXA 3H2SA 5HIKA 3HEMA 4ZTUB 3E9DA 4A0RA 2OKCA 5K0LA 2C4WA 4YX9A 1CP2A 1FLVA 1CRLA 3TTXA 4XR4A 1QGDA 5G0SA 1TA9A 4A9AA 4YCNA 4GRIA 1MORA 4YQYA 5HCUA 5K4AA 4EUNA 1VJ0A 1D6JA 2G5PA 4HK4A 2PGJA 3T7IA 4A2PA 5EGNA 3PFKA 1V8BA 2R7NA 1XE3A 2OBMA 1R7RA 2F9MA 2J46A 4R7GA 1E0KA 2R2AA 2XA9A 1G6OA 2W98A 2XT0A 3NM5A 4MPTA 1FFWA 1QR6A 2PA0A 1QLWA 3DJYA 3HGMA 3LC2O 3NV7A 2XD4A 2I7CA 4YCMA 1Q1AA 1TM2A 4JI5B 3FKSD 3FOEC 3RS7A 4DQ0A 1EXNA 1R64A 1N36B 3GLFE 1RZ3A 2QM0A 2WP0A 1LB1B 5CXUA 4Z4EA 3C70A 3M2TA 4OQFA 3OF3A 5GQSA 4H7DA 3JYLA 5I7SA 1Z83A 1RHJA 2VDWA 2Y1GA 4PYQA 2WHRA 4EI7A 2WI8A 2XNCA 1M34E 3P71T 1KI9A 2Q2WA 4B3XA 4C14A 1WLYA 2GA9A 2ZSIA 4V24A 4AB1A 5LYJB 2YXLA 4TL8A 1NXSA 3UXMA 3HJTA 3LCUA 4KYVA 4BNJA 1UXGA 3UWOA 5J2UF 4KAXA 3TGWA 3BWDD 3DWFA 2P9JA 3CHYA 5A4FS 5FYQA 1JZTA 4Q3LA 3WV4A 3HFSA 1Q0SA 2OPHA 3GUCA 3M4JA 3N39C 5CYOA 1EVLA 3I01M 3ZHVA 5JCOA 3THXB 2I2WA 1TA4A 1OWOA 5AJZA 1NE2A 1UP4A 2GNPA 3GZTB 3QV2A 3P5SA 3FSRA 2EX1A 1WMEA 4TLDA 3GJ6A 3R0JA 3H3XA 4IS2A 2BY4A 5D51S 2HXGA 2ZIUB 2QLTA 3B3FA 2N46A 2RGYA 3HHEA 2WIKA 3NNDA 4H18A 2GM5A 2HLPA 4CLHA 2WHPA 4J0GA 5AW7A 1SUWA 4PYRA 1Q15A 3UWKA 3DQQA 5FHRA 2PRYA 2QR2A 3F4KA 5A02A 4LX0A 1ZJWA 1G7SA 3H5LA 1WOYA 4F5EA 1UMCB 3N8KA 3A2MA 3PA6A 1SVMA 1DXYA 1DDGA 1EB9A 1RXIA 2P35A 3MGBA 2Y1LA 4XOUA 4KR2A 4CEHB 1QH1A 3KALA 2CBXA 4YJFA 5EKDA 3ZHRA 2NXNA 3IUNA 4TWIA 3H1EA 2D2IA 1DOAA 2VF4X 1Y4UA 3GWZA 4RVGA 2FN8A 2QU8A 2PGNA 4KB5A 1R5BA 5ALNA 3HWX1 3ZK9A 3AG5A 1RWOA 4A8JC 3ZCPA 5JQGB 3FNFA 3ANSA 2C78A 2QLFA 3KSMA 4WOJA 3EZ2A 3NATA 3HZOA 2FYTA 4YJ2F 4KFUA 4L4YA 2EFGA 4INOA 2RGAA 3G0OA 3QVMA 1EU1A 1PDWA 4CG1A 2K7ZA 2VXOA 2YXBA 5DH9A 3ACBA 2VFAA 2Z4TA 4KN5A 2WOJA 4L28A 4YMIA 3GEEA 1MAAA 1EM8A 2DULA 1VLMA 1ZPDA 4HDCA 1Z39A 4WTOA 1F8UA 2Q1SA 3A27A 3AI2A 4X94A 1ILEA 3NBFA 2X0RA 3T7EA 3L0PA 1EYZA 4MWGA 2X0NA 5BXYA 3Q7TA 4B71A 3MTAA 5ISMA 5CLQA 1TUBB 5LMZA 2IOQA 5ES3A 3S8YA 1GG9A 3O4HA 5IC4A 2ST1A 4R4JA 4YAGA 2A35A 5BYBA 1XPUA 2AZMA 2P78A 3A6GA 3UNXA 1AA6A 4HH1A 2OBBA 3CE6A 4LY0A 1SBNE 1SXJC 3CLHA 3BFKA 2WLSA 3GR6A 4HB4A 1Y80A 2JA1A 2PANA 4MLDA 4RMJA 4F45A 2ZZNA 1N2GA 3DNFA 3E7FA 2FQXA 2CKDA 1XZEA 2WD8A 3BIWA 1MO5A 1UBUS 4HQ6A 5B4VA 1D04A 2GTPA 1CQPA 1OX4B 1Y4SA 2IXFA 3CT6A 3P0HA 1CUUA 2H1CA 3DCYA 3O3CA 2IDKA 3UCFA 2W2XA 3ZWVA 1VJCA 5GAJA 2DPYA 3DB2A 4L6IA 4MKIA 1WDTA 1W5TA 4EYSA 2F8TA 2FFQA 1E2NA 1IBRA 2F6RA 3TH5A 1JT9A 2DSTA 2WFMA 3QMVA 5M34A 3UTCA 4BKPA 1W5EA 5F77A 3KKOA 3PI6A 5G3ZA 5DHPA 3A6DA 1NPTO 3BEOA 5C5IA