4Q03A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q03A00
4H1UA 3TK1A 4PZLA 1G9XA 2OE2A 1VTKA 2R62A 3B1YA 4GMDA 2QMOA 2CL7X 3PQCA 4CIDA 4B71A 4YMUA 1GITA 1D5CA 5JSZA 3BE4A 4FCWA 2A3RA 4URZR 1J70A 2HLDA 1NMZA 1NKSA 1U8ZA 3LLUA 1P2VA 3MWKA 2C03A 1VMAA 3K0FB 2Z6VA 1SXJB 1IN6A 2QGZA 5B57C 2C2HA 4Q03A 1HQCA 5KYKA 2E9SA 3ZVNA 2QAJA 1UBFA 3R9XA 2OESA 3I32A 5J4LA 4OHYA 1N6HA 4DDVA 1KDPA 3ADKA 4Q4HA 3MJHA 3OIYA 4EPVA 2IF2A 3ND9A 1N0VC 2ZRFA 2WWHA 2ZREA 3TGPA 3CH5A 1DADA 2VHTA 3AF1A 3C14C 3CIOA 4Q47A 1NL3A 3U2QA 2VF8A 4Q1BA 4XH9B 1CULC 4FINA 1K8RA 4ESHA 1GNPA 2XEXA 4XVQA 5BXQC 1Z63A 2OCYC 2QPTA 4PSVA 1CR2A 1R0WA 2F3RA 4PC7A 4XD7A 3ZS9A 3H84A 1CJVC 3C16C 2O8EA 5B58C 3D8BA 4M9XA 3OFND 2ZS8A 2W0SA 1YZNA 2OBLA 1N6IA 3UKDA 5J5CA 4IOMA 2ECKA 4LSGA 5P21A 1KAGA 2JEOA 2GA8A 1DBSA 4B43A 3QPUA 1G3UA 1D6JA 3HU3A 3VR5A 1EFCA 4BQSA 2I1VB 5LB4A 2C9YA 2G0NA 2PEYA 1F2TA 1II9A 3AH8A 4NCHA 1CJMA 4R9UC 1PJRA 4BUJA 4F4CA 2H92A 1HEIA 4S2EA 1KYIA 1Q57A 1F5NA 2AWNA 4PHHA 4E5UA 3GLFE 2X77A 2QBYB 4Q4JB 2HXYA 3I8SA 2BDTA 1UBEA 2WSMA 3CX8A 4BWYA 3AKEA 4HDOB 3LX8A 4I1OA 3BBPA 4NYJR 5EP4A 1UKVY 1XXHE 4A82A 1KJZA 1X8LA 3AP1A 5DN6D 3DM5A 5DI3B 5TB5A 1M7GA 1XTSA 2C98A 3AM1A 4XJXA 1GUAA 2JJ2A 5GJCA 2ZUCA 4PPGA 1BIFA 5JCZA 2VLIA 2O8FB 2QRNA 1TU3A 3KQKA 3PV0A 1G5PA 1M8PA 1KDOA 2RGGA 2BOVA 2A9KA 3BAFA 3DDCA 4BLTA 2IS6A 4I81A 2D3WA 4TMWA 2QMUA 4Z8YA 1L4UA 1WMSA 2NQ2C 3PG5A 5FPKA 1S96A 2WJVA 1FZQA 3GLGB 5DYGA 2OFXA 1DAMA 4QGHA 2ZVQX 4XVUA 1ZNYA 1KK2A 3PEWA 1TNDA 3AV0B 1QVAA 4HSEA 5FBRB 2CNWA 2QT1A 4L15A 5LD2B 4D6PA 1W4CA 4C4PA 2J0VA 3B78A 3KKNA 5JS7A 2KBFA 2NG1A 4MGKR 2V6JA 3Q8XB 4BECA 4EFMA 2A5GA 2ZRCA 1N0UA 5SZHB 1CEEA 3DPUA 5CYOA 4AKHA 1SXJC 2GCPA 4P4SB 2FDCA 2CE7A 1MO3A 2J41A 2OZEA 1G4AE 2L0XA 4IDPA 2ZRLA 5GJVC 5GJWC 1W0KA 3H2YA 1S1CA 2HJGA 4KYIB 3FKSA 2IYTA 3QEOA 1N5LA 1W49A 1ZBDA 1OSNA 4M0LA 3U4QA 3HU1A 2IYYA 4AG6A 1CLUA 2V8OA 2ZJ2A 2FSIA 3O47A 1W36C 2VRWA 3J81k 3DMNA 3NC1C 2RCNA 3KX2A 1KSHA 3W8NA 3OEHA 1VCMA 2ZANA 4URUR 2DHRA 3NVAA 3PITA 3EX7C 1N5IA 2XJ4A 5JHHB 2BEJA 3TR0A 2AK3A 4PZYA 1N6OA 2EU8A 3AF2A 5FPHA 2V4ZA 1RJ9B 4C3ZA 4HB4A 4JLVA 1P6XA 1RRGA 1Y3AA 1VYTA 4B75A 2IYQA 4JSTA 5EQTA 5DNYB 3W6OA 1WBBA 4KITB 3TLXA 1XPRA 4ON9A 1S2MA 5L3QA 2OV2A 1JEDA 4ZKEA 3TKLA 1E2KA 2KJQA 2GWHA 2ZR9A 4D26A 1VG9B 1ZC4A 1KO8A 4IXMA 1GL7A 4TQ9A 1LS1A 2ASEA 4MGZR 1J7KA 1GM5A 4Q7KA 1T8UA 3LY5A 5C4GB 3AP3A 1EGAA 4ZCIA 2GZAA 3OHMA 2RH5A 1XD2B 1JJ7A 1LTQA 4C7OB 1II8B 2P67A 4ARZB 2P6RA 4GP6A 3QKRA 2HUPA 4Y0VA 1NBME 3BH0A 3U60B 2QY9A 1MRNA 3S1AA 1G6HA 2Q3FA 1S4QA 1GAJA 2GBLC 2O0JA 3LXXA 4Q01A 2BKEA 4MH0R 1SULA 5JECA 1KHTA 2GCNA 2ONKA 2BBWA 4C2UA 3OIVA 3D3QA 1AS3A 5KSPA 4A1FA 2OCAA 4DIEA 2GTPA 2JIZD 3GEHA 3HP1A 1FL9A 4DDUA 5AUOB 2PT7A 2RGNA 2VBCA 2OHFA 1BMFD 3LXRA 1OYWA 2W2XA 1LF5A 1QHHA 1E69A 3BJIC 1I2MA 4GOJA 4DKXA 1SQ5A 5GVSA 2EYUA 4OBEA 4IOKA 1P61B 3QSYA 3B7GA 5EZ5A 4QHSA 4DLZA 4RZUA 1P62B 2B7BA 5FBWB 5L8VA 4M1WA 1W36D 1JQLB 2OM2A 1KK0A 3MWJA 121PA 1XEXB 1XXHA 2EWWA 4LYHA 4DLVA 1OT3A 4CEIB 1GWNA 2B8WA 1JPJA 3QXSA 1UM8A 4HLCA 3C5HA 3EPKA 4BLSA 4B2IA 3R8FA 4JVLA 2AD5A 4Q48A 2XOKD 1AS2A 4ZIRB 3GLFA 1E9EA 1N6RA 2OBMA 3QF4A 5EZ6B 4JT2A 3EAQA 3IDQA 1P75A 3RABA 1BS1A 2RKOA 3KUCA 3WXMA 4MKGA 4TSFD 5JI2E 2P5SA 4TQUS 3N70A 5FOVA 2RGNC 4B3FX 3IEVA 2WHXA 3IKJA 2GHIA 4K8OA 4C0SA 2OXCA 4PR0A 4EFLA 3B60A 2XX3A 5B2ZA 1S0UA 3FMIA 1IAQA 2J46A 3PCRB 2CVFA 2W2VA 4WZAE 4BFXA 2WV9A 2JAQA 4YDHB 1M7BA 2ODBA 1KO4A 2CE2X 4QHTA 1S8FA 2CMKA 2IK8A 3SE0A 1XZPA 1FUUA 1WE2A 1ZYUA 3Q72A 2V6IA 4PSKA 1F2UB 3PEYA 5DI3A 3I72A 2WZQA 4QRHA 4C7OA 4BFUA 3T5GA 4NYMQ 1ZINA 4CRWB 4A15A 1OYYA 2BCGY 3WMEA 5CLQA 3GJ0A 1G3QA 2G83A 3EASA 3TUJC 4ACBA 2HT6A 4FMCB 3WP1B 3BGWA 1JXMA 3B1ZA 2B21A 2FH5B 2RGAA 3B9QA 3OEEA 3FMOB 4KSBA 4HZUB 4LX0A 3L0OA 1D2NA 4JLKA 4YMWA 3QG1A 2FNAA 3RC8A 3RAPR 2BWJA 1VHTA 2X2FA 3I61A 2PZEA 4M22A 2BM0A 3OZXA 4F4IA 3MD0A 2WSSD 1UADA 1IXZA 4KXFB 3EPJA 1TQ4A 4F91B 3U3JA 5AUPB 5EXXA 5SZKB 3GEEA 1TF2A 4M21A 3X1ZA 2IWRA 1KI4A 2BCJQ 2Z83A 1KI8A 5ELXA 1AA9A 4AWXA 3SJAA 4QOSA 1OF1A 4HDQB 2RAPA 3BB3A 3QPVA 2AKYA 2IYLD 3U3OA 3U7GA 4Q19A 1QHHB 1WB9A 5E7MA 3PJRA 4DDWA 3WY9A 2BHRA 3B5JA 3DL0A 4OQLA 3KXLA 221PA 3NHBA 1AIPA 4GMXA 4W9MC 2JLUA 3Q7QA 3TIFA 5FOSA 1G19A 1J90A 1K6MA 1R5BA 3EZ7A 4I1UA 4LK2A 1F2TB 1OFHA 4EDHA 4EKDA 1Z6AA 3BIFA 4KJZA 5FR1A 1NVWQ 4F92B 3WHLA 1IQPA 1NJFA 2I4IA 2ZI3A 3FVQA 1E0JA 3LX5A 4KYUA 5JWHA 2JIZA 3QEJA 1P72A 1TL7C 3V9PA 3GLHA 2PX3A 2WJHA 1Q20A 4C30A 4BASA 4PC1A 5TY0A 4OK6A 3EPHA 2V1UA 4MYHA 2IC5A 4BFVA 1OKKD 4X8HA 2NO9A 1U0JA 3SJBA 5JBQA 1R10A 4EPRA 1IN8A 1E79A 1VYUA 1PVOA 2ZSFA 4NYIQ 4GOXA 1HA3A 1ZJ6A 5E95A 4EUNA 3DHWC 4P33A 3CZQA 3CR7A 1OPXA 2F1RA 3AEZA 3T1OA 3TQFA 4RFVA 4TZ6A 4NONA 2IWHA 2FJUA 2XJ9A 4U7DA 4A0RA 2ZS9A 4OQXA 1F3OA 1L7VC 2JJ2D 3KQLA 3L0PA 3ZZ0A 4A0HA 3VR2A 3RSOA 1SVWA 4HAUA 2O8BA 4GT1A 5BQ5A 4OQMA 4PANA 2QQ0A 1TQDA 1KK1A 2XTNA 2EYQA 4Q9LA 2CHQA 3P27A 4O25A 1E2FA 3IIMA 1P5ZB 4LBYA 1OB5A 4TLEA 4DEYA 2O8DA 3CPJB 1AQYA 3L8ZA 1Q3TA 3QPWA 2GF0A 1W4BA 1ZM7A 2C04A 3IPYA 2WWYA 2GXAA 4YLGA 1TF7A 3L2OB 4CT5A 5HPYB 2AN9A 4TL9A 4D81A 2NO7A 2WKPA 2N42A 2XNDA 1A5TA 3KDSE 1IN7A 2V1XA 3CH4B 4Q4AA 1N0WA 4D4MA 1AZSC 2QEQA 2JGNA 3F8TA 3K9LA 4PFSA 5DYIA 1PV4A 1T3LA 4GFDA 1MH1A 2ZSAA 2BEKA 4V0OA 2X1VA 2X8AA 4URXR 4HI0E 1AKYA 3OE7D 3SJZA 4HAVA 4C0HA 3R9WA 4OQFA 3DOFA 2FSHA 1DELA 2WOOA 1G8HA 3CM0A 1OJLA 4JLJA 1E4YA 2ZRNA 1QBKC 1W46A 3EZ9A 4ITRC 1O3YA 4O2LA 2YINC 1E0KA 1P2SA 2ANBA 1MR3F 3SYNA 5LD2C 2ZAOA 1XXHB 3VHLB 2NO6A 1KMHA 4NCIA 3X2SA 4Q4JA 4IJMA 4B3BA 1T0JB 4D4LA 3W3AA 4CT4B 1YQTA 3WBKA 2DBYA 1XEWX 4TLDA 3U3KA 2P2LA 4KCGA 1C4OA 1TQ6A 3K0EA 1Z0FA 4TL7A 3D6TB 1M34E 4V0NA 1LW7A 1OHHA 3RRYA 5C2JB 5BW8A 1G8YA 2GXQA 4O2RA 4ZDJA 2QP4A 1JXOA 1ZUIA 3MFYA 1EK0A 2A7QA 3HJNA 4EQ6B 1WXQA 1COWD 4L5BA 5EP2A 4Q02A 1DG3A 4IW3B 5D3MB 3ZJYA 3THYA 4CYMA 1YZLA 3QKRB 2ZS7A 5CM8B 3W9YA 5GADl 3VR3A 3ZVRA 2OO7A 1H8HA 1U9IC 1Z47A 1R5NA 1JR3A 2QTHA 5CK5A 1RYFA 3FKQA 3VX4A 4CW7A 1P9NA 3QKSA 1CF4A 1CBUA 5HCIA 4LJYA 2ZYTX 4K46A 1L4YA 4HLDA 3VX3A 5FTLA 4MKHA 1NLYA 3GLIE 4PC6A 4M1YA 3ADDA 1KJYA 2R6CA 3SR0A 3A1TA 2J7KA 3QE0A 2WWWA 1T3SA 1XTIA 2IYXA 2ZE5A 4OQNA 1AGRA 3CB4A 4CEJA 1RRPA 4QBIA 2JJ1A 1MO6A 2QENA 1KMHB 2ZI6A 1GVNB 3U6KA 1TAGA 3CZPA 3OEED 1ZD8A 1YKSA 2WMNB 4LV6A 1VG8A 3GLHE 3LW8A 5JLJA 4MYCA 2ZJ5A 1GKIA 2C9CA 4LJAA 4B2PA 2D74A 1Z6GA 1J8MF 2AFHE 4OK5A 3K8YA 2C8VA 4DXAA 3T1TA 3V4RA 3H1TA 1C9KA 1HYQA 1P60A 2A5DA 4RZ2A 5FOXA 4PO9A 4OI2A 2CCGA 2PLFA 3Q9LA 1E94E 5K8IA 4AY2A 4D82A 3QOFA 2A5YB 3U5ZB 1Z08A 3JZAA 4BE7B 1QRAA 2DY1A 3QXHA 2D2EA 3RSLA 3LO5A 5KSYA 1O87A 2YVUA 4B3GA 4DDTA 4IDQA 5FL7A 3QQ5A 4Q1EA 4B3XA 2QRZA 4ZCLA 4TYQA 3IBGA 3Q85A 1G64A 1KY3A 4KBGA 3E2IA 2ODEA 5KPJA 5FI0B 2J59A 2QP3A 4HZIA 4YMVA 4W5JA 4QHYA 3SEAA 3M0EA 3AVWA 1XPOA 1X6VA 3RDPA 1CS4C 1VKJA 1IXSB 5J4KA 3PFIA 2B7CA 3EXAA 3FKSD 1FOEB 1DEKA 4MGYR 4NCJA 2BIFA 4TTPA 3QKTA 4GRAA 3TSOA 1G16A 1E2JA 2DYKA 3TH5A 1NVVR 2PEZA 3IUYA 4RZXA 3RS5A 1OXVA 4FW9A 4CEJB 1D8TA 3WNDA 3L0SA 1X8JA 1UKZA 1HTWA 1U99A 4IEIA 1AM4D 2PL3A 2ZI5A 2CK3D 3EC1A 4NKRA 2WKRA 3LLMA 4FMBB 5CITA 1ZAKA 1XPUA 3DZ8A 2ZYWX 2QQEA 4I4LA 4CGZA 4MA4A 5EE9A 1KMQA 2V54A 4XTCS 1OH8A 1CR4A 2ZSDA 1JR3D 5IT5A 4P4SA 1YR9A 4XWOA 5L3SA 1RRFA 3KKOA 3F5FA 3QG5A 4DEXA 2OAP1 1VHLA 1DVRA 1G8FA 5FUXA 3IO3A 1IONA 3T06B 2BJWA 4ZDWA 1XEXA 5FBVB 2XB4A 1AN0A 1ZUNB 2ZITA 4MDFA 2GAAA 5FI1B 1XTRA 1KDTA 1MV5A 3X1XA 4UNNA 5IHPA 1NJGA 1GTVA 1ZNXA 2QI9C 3REFA 3R7WB 1E1QD 3OAAD 3TW8B 1OHHD 2GJKA 1JJVA 2PCJA 1YZKA 2WPDA 1R5OA 1K5DA 2GKSA 4JLMA 1EFRD 1OV4A 1KY2A 3VMFA 2A5FA 4KU4A 3WNCA 5EXTA 1N5KA 1Z6XA 4A0GA 4NYIR 2SHKA 2NGRA 3WHKA 1R8SA 1YU9A 2NO1A 3UIEA 4AIIA 1WDTA 5AK0A 2C78A 2PJRA 2DB3A 4Q1DA 5E7JA 4WA7A 3I1FA 1NY6A 2IYUA 2MSEB 1FP6A 521PA 4X8LA 1UDWA 2BM1A 4IXNA 1IXRC 2AX4A 4BZPA 2REOA 3A1WA 3BH6A 3EA0A 2D7DA 3LAWA 1LV7A 3DM9B 3JVUA 4DUGA 2BMEA 2BVNA 3NEYA 2WWFA 1UBCA 5FOWA 1Q21A 2PCLA 4H1VA 4RD2A 3WBJA 4B76A 4EPYA 3EPLA 1KI6B 3KKPA 3GLIA 3NEJA 4OHWA 5JRZA 1E9DA 4RY2A 3QF7A 4HZUA 4M1KA 3KQNA 5EP3A 4V0LA 2WOJA 2XOKA 1TTTA 4Z54A 4QJ5A 2CNWD 3R9IA 2QSYA 4C2TA 3UPUA 3SBDA 1XZQA 4RCZA 3HWSA 1R7RA 2VYFA 1G21E 4DCUA 4QFMA 3AVUA 2ZJYA 3ONWA 4UNPA 1RFLA 3FFBA 2QUZA 2ZYVX 3QKUA 4RKEA 4US0R 2Z43A 6Q21A 1MO5A 2CCKA 2IYWA 4EAQA 3PIRA 1TUIA 2G3YA 3UWOA 4KSCA 2CDNA 4A92A 4JS0A 5GVRA 1OH7A 1UDXA 3PR1A 4IOJA 4KFSA 4G3XA 2NO0A 4ILEA 1Z0IA 2W6ID 4L9SA 3EZ2A 4TLCA 4LHYA 1OXSC 4P4UA 3K70B 4TL8A 1EXMA 2YV5A 1Z0AA 3CRW1 3T34A 3VKHA 4AI6A 4Q5IA 2IYZA 3MAAC 1OKKA 3JZMA 5HKKA 2BBSA 5KSZA 3RLFA 3LWNA 1A1VA 3BFXA 1IY1A 2IXFA 5A5GA 2QU8A 2ZVPX 4QGGA 4LYAA 5K8UA 4Q9KA 1HUQA 2CCJA 4ESVA 1ZM9A 3UATA 3TW4A 1Z6YA 4C0KA 4IDNA 1NVVQ 5CIWA 2CVHA 4A2WA 3ZQ6A 1E2HA 4Q1FA 5IF9A 4OKSA 4PHFA 4AYWA 4W7SA 2ZQ5A 3CRQA 4ERNA 4YONB 2OCBA 1SVMA 3B85A 5K8LA 2R6FA 4FMDB 3KQHA 1E2EA 5E4FA 2REBA 1UEIA 3RS2A 4XD7D 1IJEA 1FTSA 1E9CA 1VYVA 1ZC3A 3JVVA 4LHWA 3T5DA 3THWB 1RC8A 4B35A 4LV5B 2ZRAA 4C0LA 4FMCF 1SVOA 4G5SA 3TVDA 4ZIRA 2OLJA 2PMDA 3SQWA 3TRFA 3TVTA 2ZRKA 3GFTA 4PXAA 3NXSA 4GNKA 2WMOB 3AKDA 2ZI7A 4LJ8A 4NYJQ 3LW7A 4DBLC 3T15A 4N3NA 2WJJA 4FWIB 2FZ4A 5F3WB 5JWRA 4JLNA 3SDZA 3NHAA 3CNLA 4B6EA 5JS8A 1W0JD 4FIDA 4RD4A 2NIPA 1YR7A 2HJVA 4F4JA 1G3RA 1NN3A 1A4RA 4JL6A 5FH9A 4V0KA 4BFTA 1UBGA 1VIAA 1HT2E 4UXJA 3EIEA 5CIQA 2ZSEA 4P31A 1FX0B 3NIBA 1EFHA 5CJPA 1EG7A 2P3SA 4OHVA 2G6BA 3I92A 4IEEA 4Q21A 5TARA 2OBNA 2DFNA 2Y8EA 3K0CC 3C7KA 2IF0A 1E2IA 2UZ3A 2J0QA 4DWJA 4UJ5A 1N6KA 2REXB 4YC7A 2IS1A 1ESMA 1P2TA 4DLYA 2FV8A 4ZPXA 1HY3A 4HB3A 4H9GA 4HATA 1VCIA 2IBMA 4IVRA 1VPLA 3WMGA 2GAOA 2FOLA 4OI1A 1G7SA 1T6NA 1KNXA 3A1SA 2A5JA 3LFUA 2BKUA 1E3MA 2P65A 4JIMA 3AF3A 4EPTA 5FTNA 1OH5A 4HUTA 4P3YA 1T3HA 3LVRE 3RRNA 2C9OA 2FX3A 1SVSA 3GLIB 3LH5A 1W44A 5LDDC 1W5TA 3U7HB 1QHXA 2RGXA 1U81A 2XXAB 1QHGA 2IEZA 2W58A 1U9IA 3S1AB 5G40A 3CX6A 2YKGA 1ODFA 5D3MA 3THYB 2R65A 2VEDA 1TEXA 1U8AA 1G17A 1LFDB 3ZIAD 2XZOA 3U44A 2JATA 2V7QD 1F48A 1PUJA 4GL2A 2TMKA 2XTMA 1TU4A 2C99A 2YWGA 5CJ2A 3EIQA 3ZH9B 2IA5A 3MSXA 4UQOA 1Z07A 1UJ2A 1NVXQ 1WF3A 3RS4A 1ZVQA 2DFKB 3KB1A 4UJ3A 1ZMXA 2EFHB 1OB2A 3GPLA 2WTUA 5FOTA 3K53A 3NG1A 3V4FA 5TDHA 3T1QA 3U7FB 1KO7A 4MRNA 3RS3A 4G0NA 4A2QA 1E0AA 4LGMA 4BLOA 1V5WA 2QPOA 3KJIA 3HYTA 2WAXA 2WJYA 3W34A 3KFXA 1G4UR 4I99A 4FWTA 4WXRA 3KQUA 1DPFA 5H70A 5J4VA 1PLLA 5UKDA 3SBEA 1E2DA 4G5RA 4IKEA 1JPNA 1TADA 2RHMA 3CWQA 4DB2A 2FZLA 4D0GA 3NBZC 5JEDA 2YHSA 4QNRA 4Y0AA 3UMFA 2ZJBA 3F3YA 1YZQA 3W6NA 3KXIA 5FL7D 4TTQA 1E0SA 1N6LA 4ZI2A 1DO2A 4HLUC 3RS0A 1EFRA 3MRSA 3THOA 4B33A 2WJIA 1OIVA 4N1AA 3D31A 2IS4A 4JLOA 3CPHA 3IBYA 1GNRA 1YZUA 1NI3A 3A4MA 2NPFA 4DLRA 2XB2A 2GXSA 1FTNA 1KOFA 4BGDA 2O8DB 1W1WA 4FCVA 4MRRA 1VCNA 5EJEA 1US8A 3CNNA 1E2MA 1M74A 4AG5A 1XU4A 1U8YA 5FPYA 2R6GA 3W6PA 3UG6A 4CEHA 1CIPA 1WQ1R 2ZU6A 3QY0A 4TL6A 2R9VA 2ZJAA 1N5JA 1XJQA 3VR6A 4B44A 2UZIR 1ANKA 1Q22A 4QBFA 2QNRA 2CXXA 3HPRA 2ATVA 1FW6A 4XWAA 1XMIA 2QORA 3ZIAA 1ZM4A 1KI9A 5JEEA 1R6BX 3CLVA 1DS6A 421PA 3U6BA 3DKVA 4GDFA 2J45A 2OXRA 1D9ZA 2AWOA 1GDDA 2N1BA 3NWJA 1I2DA 3QNUA 5AJVB 4AK9A 4DSUA 4BPBA 4XTRA 3QIAA 2IX3A 5BYJA 2Q3MA 3BB1A 3EWSA 2XSZA 3O8DA 4BLPA 3BERA 1SKYB 1WBDA 5CDFA 5CDFE 3ADCA 3ECCA 4JKYA 2OCPA 4NBSA 1AZTA 2HYDA 1SXJE 2HEIA 2KB0A 4BFZA 3HU2A 1G7CA 3UWKA 3ZZUA 2ANCA 3LQQA 3AVXA 2O5VA 4W5HA 1XRJA 2EVWX 3KJEA 1MABB 2W2TA 3N5CA 2BBTA 2FWRA 1XF9A 4FXPA 4ZKDA 2GK6A 2PX0A 3A4LA 1QHNA 4UKDA 2ZRDA 3AF0A 2ZPTX 4N0DA 2QSZA 1GILA 3EIHA 4Q66C 2H1LA 1JAIA 2ATXA 3CX7A 4DLXA 1AS0A 3CRRA 1BO6A 2ZE8A 2ZU0C 1GIAA 1Q1BA 2G77B 4JLBA 4U02A 5B64A 2AK2A 2K5UA 5BYKA 1F2UA 4PPQA 4DC9A 4WVFA 2AFIE 2PMKA 5HE9A 5JSZB 3LVQE 4GI7A 4J0QA 2MMCA 3FHCB 2PLRA 4US1R 1MKYA 5KDLA 2ZRMA 4HLUA 1WRBA 2VPPA 5JZVA 1N6NA 2Z4SA 4NDZA 5AWFC 3ZS8A 4MRSA 1KDRA 1ZIPA 2DFLA 4LJ7A 4RJLA 1G18A 2IHBA 3FB4A 1DAIA 2F55A 1ZU4A 4KBFA 2WIAA 4LRWA 4XSHA 4MGIR 1YE8A 5IK2A 2IXGA 1W47A 1G7TA 4IDHA 4NYMR 4BLRA 2O0HA 5IK2D 3BB4A 4GZMA 2AL7A 2P6NA 3K09C 2EQBA 4PO8A 4WOPA 2JJ1D 1FFHA 5M04A 5FOUA 2AR7A 2X19A 3NBXX 5D3QA 3RVBA 5L3SB 2ZEJA 4FD2A 3TNFA 3MLEA 3C8UA 3OIWA 5FUWA 2QAGC 2NZJA 4EPXA 5TVKA 1WCV1 5DI9A 1MT0A 3FHOA 2F3TA 3R8CA 2VSXA 4DCNA 3MUFA 4IDOA 4L9WA 4QGFA 4X8OA 5FUYA 2WPDD 4ASUA 1S9HA 4JVSB 4D25A 1CXZA 2GVZC 2PJZA 2VP2A 2ZRHA 1H8HD 3IQXA 1QHIA 3OIUA 2B92A 4D2IA 3VNUA 1FNNA 2RGCA 1E4VA 1E32A 2X2EA 4CVNA 1YJ5A 5G3ZA 4LHXA 4OHZA 3B1XA 1XD2A 5JJLA 4TLAA 5FFMA 2YWHA 1NNEA 2WM9B 5CLLA 4PAQA 1OFIA 1Z06A 3BK7A 5AUQA 2O8CA 2QAGA 1P73A 1E2PA 1ZNWA 2PH1A 4DCSA 4DSTA 2ZR0A 1W7AA 4ASUD 2O8CB 1P2UA 2FFAA 2FPLA 3Q5EA 3K70C 3AGPA 2LWIA 2FE4A 2CK3A 3AGQA 3K09A 2ZUBA 3NH6A 2IW3A 3QENA 5DHAA 3VR1A 1NN1A 4BEBA 1E1RD 3P26A 2GBLA 2VHJA 2CJWA 1CR1A 2DR3A 2GJAA 2VP9A 2YYZA 1B23P 4LPSA 3FGNA 4NZYA 3LD9A 4B34A 5AR1A 5JFGA 5EE0A 2GZDA 3THWA 4MRVA 3ETLA 5AJYA 2I1QA 3AUXA 1F6BA 5FPTA 3G0HA 4D0LB 2FA9A 5AJWA 4JLDA 3K0AB 1VG1A 1QG4A 1XP8A 4ZCMA 2BMDA 5KDOA 4C0QC 2GZHA 4Q4AB 2DWOA 2GEDA 5JJIA 1ZW6A 1VG0B 5FTJA 4QC2A 2XNDD 1E9FA 5HZKA 4HUQA 3P4YA 2WWXA 1K5GA 1OFTA 1N3BA 2ZM5A 1UF9A 2J0UA 1LY1A 1GKYA 2QTVB 1ETUA 2ZRGA 3OF5A 5KHOC 1A7JA 1ZRHA 3Q5DA 4HAYA 4IFEA 4ZO4A 1UEJA 2OFOA 1ZD1A 1J2JA 2FEMA 4F7WA 2YJTD 4Q4LA 1NP6A 1GP2A 1P9WA 4NCNA 2IUUA 5JRJA 4DRZA 3NKVA 2JLXA 3SI7A 4GSYA 1NN5A 2C96A 2D2FA 3SOPA 3ZYCA 3THXB 1SVKA 3L82B 3RWOA 3SQXA 3EWAA 5IRCD 3TUIC 2ZIAA 3X1DA 5H8WA 1GZSA 1LS6A 3BXZA 4Q9HA 4E03A 2VHCA 2P5TB 1R0YA 2GVDC 4TYNA 2VL7A 4Q00A 2DPXA 1RW4A 2ZROA 2GDJA 4RFSB 2Z0MA 4PC2A 1TPZA 1SXJA 1I4LD 4CEHB 2H18A 1AJEA 1A2BA 3EARA 1T8TA 3SZRA 4M9ZA 1YR8A 2EFCB 1XDBA 1ELOA 1JECA 1XNJA 2NTYC 4US2R 1RYHA 3CRVA 3QBTA 3DOEA 4TSFA 1Z83A 3KFVA 3AVVA 1EX6A 5DSZA 5K8TA 2R6DA 3CW2A 3WYGA 2JLSA 4B47A 1NY5A 2CL6X 3QI2A 1TX4B 4EIWA 1ONBA 5HCNA 2VP5A 3IPXA 4GOKA 3E5HA 5FUVA 1Z0KA 3ZZTA 2ZRJA 2RB4A 1KI1A 4LWZA 1GKUB 2HCBA 2ORWA 5HTKA 2ZSBA 5HZHA 4EJSB 1Z2CA 2NPIA 1RZ3A 5KSOA 5C18A 2F9LA 1DAGA 4I1SA 4NH0A 2F9MA 3KXKA 3T12A 2CHVA 3HPQA 3TSZA 4MDEA 3AKCA 2O8EB 1IY2A 1UKYA 3ZVLA 2OG2A 2PZGA 4JJZA 3GLHB 5J40A 3UK6A 5L3RA 2KI5A 1RVDA 4TT3A 4A8JA 2FGKA 3VKWA 5LB2A 1NKTA 3WNBA 1JI0A 1FUKA 1H8EA 2ZTSA 1TEVA 2Q3HA 4IVPA 1NF3A 4IHQA 4MYTA 3I3SR 1U94A 1KZ7B 3K9NA 4HYYA 2VSFA 2MSDB 1GRNA 3B2EA 1W2HA 1XX6A 1ZNZA 4Z1MA 3O8CA 1GL9B 1OXTA 3ICEA 4XVRA 4A6PA 1XCGB 3FYHA 1JB1A 2E87A 4HAWA 4TN1A 5EE1A 1KIMA 3FDIA 4LYJA 1QHYA 3DEFA 1NSFA 2G1KA 1NBMA 3ZGXA 3GMTA 4RFSA 1EFUA 4WBSA 1XD9A 4XIGS 4NP6A 2ZI9A 2IYSA 4KHZA 3BWDD 3FTQA 5J4YA 1Z6TA 4Z1MD 4ACAA 3KB2A 4QM7A 1KI7A 3T1VA 3GD7A 5DE3A 1G3IA 3MCAA 1NMYA 5F9FA 2G88A 3L8YA 4S35A 1DAHA 1QVRA 1B0UA 1E1QA 1ZD9A 3OAAA 3HR7A 4HEJA 4KFUA 2J0SA 1KI2A 3KUDA 4POAA 3WP0A 4NMMA 1E98A 2CBZA 5C1BA 4WAUA 1OIXA 1TQ2A 2VHQA 2F1HA 3DKPA 2VQSA 1FPMA 3O8BA 3TQCA 3TUZC 1GOTA 4JYCA 2VIIA 3KJHA 2BC9A 2O52A 3LDAA 4EJSA 4TYWA 1KZGB 4OL0A 3X1YA 2HCJB 4JJKA 1XD8A 3UMRA 1CJKC 1NIPA 3GJ3A 4R2HA 3REGA 3L0IB 1XEFA 3RANA 3A1UA 4AC9A 5HE8A 2JLVA 4RCYA 1TUEA 2F7SA 3B6EA 4QJ3A 2QA5A 1VIYA 1ZIOA 2F43A 2FMXA 4O0MA 4URYR 1S1MA 5EUQB 4PHTA 3PUWA 2D06A 4IOLA 5BWMA 1KKLA 4OI4A 3TAUA 4DCTA 1AKEA 1N25A 1DAEA 1Q1EA 4G5GA 3GLFB 1XTJA 5A0FA 5H1YA 1E79D 5EE3A 1W2GA 4NTZA 2NMVA 1P9RA 1T91A 1NG9A 2FPKA 4M2LA 2AKAB 2ZUDA 3K0CA 3SN6A 3VR4A 1QG2A 3MMPA 5JHGB 1BYIA 1RJ9A 1R4AA 2V55B 1YVDA 3C4JA 2I3BA 2D7CA 4YXWA 4URVR 3RNLA 3N2EA 2ZJOA 5AJXA 3SYKA 4DZZA 2VF7A 2OFWA 4LCBA 5JCPA 2QT0A 1U0HC 4AD8A 2QAGB 2IYRA 4K81B 2QG6A 1KAOA 4P0TA 3CUEF 1Q3HA 4DSOA 4BFSA 3C15C 1X86B 1KSJA 2AD1A 2UKDA 5TV2A 1KI3A 1WP9A 2GXUA 3K0FA 2JLWA 4GPTA 4DLSA 2JDID 2FPMA 4YDSA 5FBLB 1JR3E 3H0KA 3GJ7A 5EXPA 3T61A 1W0JA 4LC0A 3UANA 1IM2A 1XWIA 3AVQA 3UXMA 2OUKA 4DB4A 3IO5A 4NU0A 2A78A 3GFOA 1DG1G 2VSOA 3EC2A 3IHLA 4JL5A 3TE6A 2FFHA 1E9AA 3LBIA 4OK3A 1IN5A 1KO5A 2FG5A 1XJCA 2R44A 3TJZA 4TYPA 2QM7A 1M7HA 3QXCA 1HURA 4A4DA 1P4SA 1DOAA 2QP9X 2EFGA 3EG5A 3M4YA 1BYUA 5GJBA 3VFDA 2CHGA 2Z5FA 1CRQA 1E6CA 1G20E 2FSGA 1KI6A 2YZ2A 721PA 4QM6A 1W0KD 3B82A 5TMPA 2ZR7A 3PVSA 3VQTA 4WZBE 3A58B 2LKDA 2MMGA 1T5IA 4LJ5A 1F60A 1U90A 4LJ6A 3AKYA 2PBRA 4M8NE 5CM9C 4FN5A 4NE2A 2GJ9A 2ODWA 3W5IA 3ICQB 4JKIA 4TMKA 4R71A 2YOGA 5DISB 1G1MA 4PO1A 2ERYA 4TMXA 1CP2A 4YMSA 1N6PA 2XTZA 4PHGA 2ZE7A 4RVCA 4JT4A 5TXGA 3BS4A 2GK7A 3U3MA 2H8KA 1FMLA 3MWYW 3MWLA 2FEOA 3WYAA 4PQRA 5C46F 2IL1A 2QN6A 2JDIA 821PA 2G1JA 3IQWA 2RGDA 4JVNA 2V9PA 1MABA 2RGEA 2GJSA 4KLZA 1YHNA 2QMEA 2IYVA 3K0SA 2WJGA 3P4XA 3LQRA 4MKIA 2YC4C 1JNYA 3T35A 3TR5A 3CO5A 1I4TD 1Z22A 3LBHA 3ZD6A 2KBEA 1KO1A 1RIFA 4E07A 2DWPA 2HYIC 4PQFA 1G41A 2FF7A 3GLGA 3ZQJA 4M1TA 3AQ4A 1W5SA 3RS7A 1UPTA 1GFIA 3G5UA 4CZ2A 4G01B 3VHXA 5JWOA 1W4AA 2H16A 3GJ8A 1S3SA 2YC2C 2IT1A 4P4TA 3A8TA 4B3DA 3LNCA 2GCOB 1KSFX 3V00A 1RKBA 1QZXA 2JASA 2YWEA 2C95A 1XMVA 4WW0A 4JYBA 2IS2A 1U0LA 2FN4A 3K1JA 1NIJA 4L16A 3UG7A 3IEUA 5EUMA 1LB1B 4M4SA 3U44B 4NL4H 1ESNA 2HT1A 3MJRA 1SVIA 2XZLA 2OT3B 1DE0A 2QTFA 3I4LA 3B9PA 3CNOA 1U2RA 4BEJA 2GETA 2H57A 5B30A 5E7IA 2QBYA 1M6NA 4HB0A 2FFBA 2E1RA 5EP1A 3BRWD 2Q9BA 4JSYA 4TYYA 2J87A 4Q1AA 4KFRA 4OHXA 2B6HA 1UAAA 1NBMD 5F9HA 3BFKA 3ND8A 1JQJC 4FMDF 2PT5A 4DLUA 4ZV4A 1OW3B 2O8FA 2A2ZA 2JJ8A 1A2KC 1CR0A 1PLJA 2VHUA 4D4JA 3GJ5A 3PEUA 1DTSA 2OLKA 4V0ME 2F1JA 2IHYA 2J1LA 4UXHA 3A4NA 2LCFA 4PTLA 4QXAA 3MG9A 2OEPA 2YWFA 4WIAA 4C0BA 3LA6A 2JA1A 3B1VA 1PLKA 3FFAA 4KV9A 5J4HA 1H8ED 3VAAA 1GRQA 1T4GA 4JBXA 4L8GA 3RRZA 4AURA 5JJKA 3H4MA 1NRJB 3QVUA 1P7CA 2GILA 1XCPA 2QROA 4TWZA 3C5CA 2ZJ8A 2VA8A 1KNQA 4Q4HB 2J5XA 2VH5R 4TQAA 1R0XA 3SU8A 4E22A 3C41J 1MOZA 4YMTA 2XAUA 2W6JD 1J99A 4F38A 2AHOA 5C4MA 2H17A 1OFUX 1V43A 4DHEA 2CL0X 3AVYA 1WA5A 1KTVA 2GEUA 5IDVA 4U5XA 2HF9A 4PPNA 4XOIA 3VKGA 2JLQA 3RC3A 4URWR 2ZETA 1BMFA 2ZAMA 2QL6A 3ZVMA 4JBWA 3PUZA 1AQUA 3HYRA 3NBFA 4Z8XA 1J8YF 2ZRIA 3GJ4A 2D62A 2G9NA 2XITA 5FBQB 1M2OB 3P1JA 4PQYA 1JR6A 2W00A 4QNMA 4D0NA 1PZNA 1XMSA 2R8RA 4PSAA 1DARA 1XMJA 3K9GA 3QVVA 1C1YA 2IEYA 3NBYC 1ZP6A 2J3EA 3BFVA 1FNMA 3CR8A 3EZ6A 4LC1A 4V03A 4BRWA 1E9BA 1S9DA 5A4JA 4LBVA 5FTMA 5F98A 1YRBA 1QDEA 2NZ8A 2WWGA 4LBZA 4QBGB 2JLYA 1CKEA 2ZRBA 4OJQA 4DVGA 4PAOA 4KLNA 1TMKA 5FTKA 2QE7D 1YZGA 2GNOA 5FL3A 4XWKA 5KNCA 3GP8A 2PZFA 4N0EA 1E96A 1HT1E 5CB6A 1D9XA 2R2AA 4HLQB 1R8QA 4B48A 4Q1CA 4B3CA 1EWRA 4NHOA 4TMTA 1XCMA 3ZD7A 4A2PA 4JL8A 1X8KA 1ZM2A 3B1WA 3NH9A 4A0FA 2Q21A 4IRUB 3E70C 3N2IA 3DO6A 4IVQA 2ORVA 1IOZA 1EFTA 2FSFA 1VECA 2MSCB 4RKFA 1D2MA 3RWMB 3W8RA 2ZXUA 5DLQC 1Y63A 3A6PC 3BC1A 1HV8A 2G0TA 3D7MA 4HB2A 4DLWA 4UNRA 4QJ4A 4LHZA 4UNQA 3QKSB 3KTAA 3U3RA 2CLCX 2WWIA 3KL4A 4BFWA 4TMVA 4ZI3A 3QUSA 4JLPA 2C77A 1NVUQ 1L2TA 1DAFA 1G7RA 2BV3A 4LUCA 4LPKA 3IILA 5LBIA 1OXUA 2CJWB 4EQ6A 4LOAA 1P3JA 1ZCBA 1JEEA 2GF9A 1EESA 4Q18A 1A82A 4I1VA 3VNVA 3OE7A 3A37A 3I73A 5DH9A 4TLBA 3KJGA 3W5JA 2JLZA 2Z4RA 3ASYA 3LV8A 3B13B 2N46A 1S3GA 2AXNA 2R6AA 3CF0A 3SFZA 3AVOA 1NSTA 3CBQA 1KK3A 2VTKA 3FWYA 2F43B 4LHVA 4TT3D 4PZZA 5H68A 4DSNA 1RE0A 1VDZA 4DLTA 4ZDIA 3OESA 4MYUA 2OILA 2JLRA 4UXIA 2NOAA 2HV8A 2KSQA 3PEVA 2ODNA 5AUNB 4MKFA 2OSBA 2CLDX 4LY6A 3O8RA 1AGPA 1Q1QA 5KNBA 3NC0C 4KO8A 1RRCA 5DGXA 3FE2A 2KE5A 1XB2A 2FFQA 3H86A 5G53C 5CYPA 1L8QA 2UVQA 4RZ3A 4LDJA 1NMXA 2Q9CA 4KVAA 3BH7A 1KKMA 3LRPA 4OI0A 1JAHA 1H65A 1NLFA 1UFQA 4DJTA 1COWA 1R2QA 5SZJA 4RSGA 3SC3A 4QG7A 1SGWA 3IIKA 4M9SA 4BZQA 4ZDKA 1T5LA 1E1RA 2CLSA 3DMDA 4R2IA 3WMFA 4HDCA 1DO0A 1X1SA 1E2GA 5KOYA 2P0EA 4AKEA 2P6UA 1GNQA 5DIFA 1W48A 4C9BA 2VP6A 5KTYA 5FR2A 3CONA 5FPSA 3SHWA 5L3QB 4L4UA 2EFEB 4YXWD 2FGJA 3K70D 4M1MA 5JMTA 3EW9A 3R7WA 3UMSA 4DT1B 1SKYE 2WVJA 3KKMA 4PAMA 5EE5B 4A9AA 4R7ZA 2F6RA 5CK4A 4PPFA 2H7VA 1G3MA 1XTKA 4BRUA 1T9HA 4C0JA 1GSIA 2W6IA 1LVGA 1MRSA 2HXSA 3CRMA 3DVLA 3E1SA 3MGCA 3ZDQA 3NDBB 5LPNA 1Q0UA 4MQBA 4Z51A 5HR5A 1Z8FA 1X1RA 2O8BB 1W4RA 1E2LA 3KTAB 4KODA 4AYTA 5EXSA 2JCSA 1FP7A 2YOHA 4IFBA 4JMPA 4UNSA 2DCUA 5DN6A 1XJ0A 1CJTC 4FI3C 2A30A 4A6XA 1ZUHA 4CDGA 3OFNA 4DIDA 3TAHA 2ZRPA 4KVGA 5CB8A 2Q0HA 4M1OA 2VP4A 2J7PD 3DZDA 3G82C 2WAYA 4WXPA 1E9RA 3TBKA 3GFPA 4P32A 5AJZA 3QBVA 4JVMA 4YQFA 1LF0A 4BLQA 8OHMA 2QPAA 3SFVA 2EW1A 3U61B 3F0TA 4MRPA 5G3YA 5SZIA 2GRJA 4JZKA 1YR6A 4C0AC 4XSGA 4Q9IA 3GJXC 1GL6A 1YZTA 3FOZA 2IUTA 3I5XA 3RRMA 3U4QB 2ZE6A 4DUGD 3U7EB 3AF4A 4LZZA 1ZM3A 3P32A 3THXA 3I8XA 4LV8B 5BN5A 3AP2A 1Z0JA 4A8JB 2ERXA 1MO4A 5DO9A 2YOFA 4QBHA 2HF8A 1KGDA 4KAXA 3FPAA 1JBKA 4LI0A 1BH2A 3R20A 4TZ0A 1KJWA 2WICA 4ARZA 4LYFA 1OE0A 3CF6R 1ZCAA 5KU1A 3I5YA 4DT1A 3TMKA 4B32A 4F93B 1SKQA 2F1IA 1R0ZA 1G8PA 2BMJA 3EA5A 2ZI4A 1FMJA 3AB3A 1RPZA 1G6OA 3FMPB 3PUVA 1IBRA 2HLDD 3W3ZB 4QL3A 2VO1A 4TMZA 1IN4A 4FCTA 4B74A 1AK2A 2W0MA 4HAZA 3GQBA 4D80A 1PUIA 1QHSA 3SNHA 3K9HA 4M9QA 1HH4A 1HE8B 4BZXA 3GLGE 1OIWA 1U98A 4AKGA 4Q7LA 1Z29A 3CKLA 4KI0A 1G8GA 4RD1A 3CWZA 3PUXA 4EJSC 2BMFA 1US8B 3SS8A 1NN0A 3AVPA 4LJ9A 4OYHA 1OH6A 2ONJA 3B8HA 1LNZA 3EZFA 2QGNA 2HDNB 4LBWA 3CF2A 1CRPA 3GCGA 3GJ6A 3RYTC 2CEAA 3KZ1E 2O0KA 5KO2A 1GG2A 3LBNA 4BFYA 5KPDA 2DFTA 2H5EA 4KFTA 1BOFA 3VTKA 1NLZA 2GESA 3M1IA 2FU5C 1SVLA 1XEWY 2EWVA 3AUYA 2YNMA 1TF5A 3K0AA 1T0HB 1XBTA 1M1YE 2WSSA 1YRAA 2XSZD 5KDDA 5KUTA 2GEVA 1IHUA 2Q6TA 3BD9A 5BN4A 2BBOA 2B8TA 3SJCA 3VU9A 2WIBA 3WRXC 4JBYA 1FQKA 1ZU5A 5F2EA 3SHFA 5J47A 3QF4B 1CTQA 4U00A 2C5LA 3BORA 4W5WA 2D4HA 2RGBA 4PX9A 4Q7MB 2J0UB 3I62A 2VP0A 3HR8A 4GP7A 4A36A 1D2EA 3Q3JB 3AVTA 3HDTA 1JALA 2W83A 2J9RA 2XGJA 4HUQB 3P20A 4M53A 3WYFA 1I4DD 4GBMA 4LJ4A 4X8MA 1OLOA 4RD6A 4NPHA 4DCVA 1FX0A 1N2CE 1X3SA 2QM8A 3QXJA 4G5OA 1GRRA 4G5QA 4MITA 1OXXK 3M6AA 1HE1C 3ZLJA 1E9SA 3ASZA 1SZPA 4Q7JB 3ADBA 4A8JC 2QMHA 4EFNA 2BJVA 1Q44A 1XFAA 2ZJZA 3SYLA 3FHTA 2LKCA 1SHKA 2IXEA 4WZ6A 2V3CC 1BKDR 4Q9JA 2GJ8A 2XNSA 2KWIA 3A36A 4D4KA 1QF9A 4TTRA 2QZ4A 2XXAA 1SHZA 3OEHD 1E2NA 1Q1ZA 1G5RA 1II8A 1Z2AA 4V0MA 2QE7A 3NTUA 2GCOA 4JLAA 4PC3A 2EFDB 2IUSA 4NCKA 4B2LA 2WBLC 2J7PA 1G5TA 1DAKA 4AKIA 1IJFA 1E99A 2V7QA 5G41A 3TSWA 1IY0A 1UKEA 4AYXA 1KSGA 3IIJA 3RHFA 4QGAA 2RHDA 1Z0DA 2WKQA 3Q7PA 5DHFA 2XZPA 5E3HA 1W36B 3X1WA 3PXGA 4R98A 4MUBA 3A1VA 1EX7A 4HAXA 3IGFA 3FMFA 1CU1A 2DWQA 5KNDA 3QJYA 5ANRB 4G1UC 3PENA 4CEIA 3KKQA 1NG1A 2ZYUX 1XTQA 3QXXA 3BOSA 4EPWA 4QKQA 4CF7A 4O3MA 2OAQ1 4M1SA 3W90A 1FQJA 4ABYA 1E2QA 1II0A 4II7A 4RD3A 1Z28A 1Z3IX 3NDPA 3PUYA 1HQYE 2RMKA 4RD0A 3WRYC 3IHWA 3VU9B 5HKKD 4E09A 4B6FA 2W6JA 1VCOA 2ORIA 621PA 3L43A 1G291 1Z5ZA 2Q9AA 4GZLA 1SXJD 3CPEA 4OJKA 1CJUC 4V02A 5L3VA 5JI3E 1Q12A 3GEIA 2AXPA 4MUAA 4B73A 5BN3A 1EWQA
chains in the Genus database with same CATH superfamily
1HLDA 1IQ0A 4TX1A 3ISVA 3TK1A 1NPYA 4RK1A 2FPSA 5DN9A 2YIVX 2ZAYA 5IT0A 3B1YA 3H9UA 3F3KA 3L8MA 1MENA 3PQCA 2PUTA 3WLKX 4CIDA 5I7RA 2R5NA 2OCLA 3PGA1 1D5CA 3WSVA 4GLJA 4MVJH 3BE4A 4PTZA 3RQIA 5JSZA 3EA4A 1WV1A 2JFGA 4LZPA 4GPBA 4KGVA 1V1MA 1YJBA 4R8KA 5E38A 1BDHA 2ZJ0A 3FOFC 1OILA 3K0FB 1SXJB 1IN6A 4G5HA 4EMTA 4G0WA 3V1YA 3M6VA 3S2EA 1ADYA 2HEGA 5KYKA 2E9SA 2QAJA 1V48A 4F60A 3GA0A 3R9XA 1D0IA 4C5CA 3CF4A 5J4LA 5BNFA 4DDVA 4F71A 2NP6A 4PX2A 2IF2A 4L4XA 3IP7A 1PQUA 1UC9A 1QK4A 3AL3A 5B1EA 1ECPA 2QY6A 4FGWA 1DADA 3CW8X 3AF1A 4FC7A 5DU2A 2V45A 1DXYA 3CIOA 1YQEA 4Q47A 3BSSA 4XB6B 2KYRA 4ZT3A 2Z4TA 3C8HA 2NN3C 1I33A 4GQIA 3JWGA 4Q1BA 1CULC 4F06A 5K1ZA 1EJBA 5HYVA 4LF8B 3RTCA 1T8PA 3H2HA 1H3NA 1CNEA 1GN9A 2RHBA 3BKWA 1Z17A 4AECA 4XVQA 5HGJA 3RRBA 1Z63A 5B2EA 1KZ6A 3EXG1 3OKAA 3TLKA 1CR2A 1R0WA 1QG6A 2F3RA 2J4DA 4HGNA 4WERA 1NFQA 2PGDA 5F9MA 3ZD9A 3HWX1 3D8BA 2O7VA 4QJIA 3LXUX 5BSHA 2DVMA 1N6IA 2A9OA 2D13A 3HWWA 3O2NA 3O3NB 3UKDA 5IUJC 3SGLA 2ECKA 2Q6OA 3OM9A 5P21A 3GUUA 3HA2A 3K4QA 1IWOA 3KG2A 1TM7E 1TK9A 2VQ3A 1M0EA 4Q93A 3SLKA 5E2IA 2JD2A 3UPDA 1EUCA 4DJEC 3DFKA 3MTEA 2G0NA 5E1BA 1I7QB 4BB9A 4Z4QA 4MS3B 1TT7A 1W19A 3TSCA 5TPWB 1B26A 1PJ3A 3AH8A 1MG5A 5CFZA 1SAYA 2H92A 2NXJA 4S2EA 2X9NA 3QUBA 4BJ1A 4E5UA 4R81A 3LDHA 3MCWA 1TFRA 3D0KA 3SPXA 5IMSA 2UU9B 2CMFA 1UBEA 3H4VA 4LY3A 3CX8A 3AKEA 1BN6A 2FTKE 3OUUA 3TW8A 4DMKA 5EP4A 3FTFA 3DGEC 4P1ZA 4A82A 1KJZA 1X8LA 4NMWA 4K6KA 4MEBA 3RG2A 4OLFA 4BO2A 2B1GA 2C97A 4WKPA 4DV7B 2C98A 1BDMA 3WHPA 2ZUCA 2CXNA 2VLIA 4RS4A 5T57A 4R8LA 2QRNA 3KV3O 1FLNA 4ZEVA 3PV0A 3UH1A 4FILA 3G5LA 3QK7A 1M8PA 1KDOA 1ZVMA 1IPEA 2ABWA 2BOVA 2I3GA 2VT3A 3DDOA 3J7TA 1EQAA 1WU8A 1Y82A 3G2QA 5ALLA 5F5LA 3P96A 4G0YA 4BLTA 3MCUA 4I81A 4YT8A 3MWDA 3B20A 3Q6IA 1DMRA 1O89A 3I37X 4N0QA 1I0ZA 1L4UA 5EPEA 2NQ2C 4BC1A 2ESRA 2HU2A 4X85A 3KAQA 3OM1A 5TS3A 5SYNA 3HJHA 3ANXA 5FPKA 1DQNA 2HGZA 5KWJA 5DYGA 4QGHA 2NADA 2ZVQX 4JI0B 3RCBA 3HDGA 4BLWA 4HQOA 1BKSB 4QTZA 3AV0B 3BDAA 1QVAA 4YJ3A 5FBRB 4ZJZA 2E49A 2QT1A 2GGSA 3QU4A 1AC5A 1W4CA 3G89A 2H4HA 2WWRA 3B78A 4D6PA 5AYVA 3AW8A 4NS1A 3CTMA 4MGKR 3B7PA 4EFMA 2PJUA 3WGUA 4C6TA 3EPPA 1M6VA 1PSWA 5SZHB 3DPUA 4AKHA 4ZAFA 2YVKA 1JB9A 2DC1A 4CE6A 4P4SB 2FDCA 1G4AE 3A04A 1ZA1A 1WCIA 2F00A 3H2YA 2HJGA 3QW2A 1ACJA 2IV7A 2R66A 3BEDA 4XFDA 4P53A 4B5LA 4RTMA 1W49A 3FZNA 2B8EA 3HU1A 5K4AA 2H1FA 2V8OA 1DCFA 3O47A 2D4AA 1W36C 1HWYA 2VRWA 3KZKA 3J81k 3NC1C 3K8ZA 5HJ5A 1LPMA 4HGOA 1S7CA 1I7LA 1KSHA 4HQNA 3W8NA 1VCMA 3WAKA 1ZLXA 1LXCA 2G6TA 4KN5A 4QVKA 4NFYA 5DLEA 1Z56C 2WVGA 3HFJA 3I6MA 3TECE 4KN8A 3TSAA 3WWZA 3JV7A 4U2EA 5FPHA 2V4ZA 4FYXA 3B89A 5JNUA 4EATA 2X0RA 5F76A 1VKOA 3HS3A 4B75A 3D8RA 4JSTA 1VSTA 1O96B 2WSLA 3BHIA 3HUEA 3SSMA 4BC0A 1N3LA 3SYRA 2C3YA 2EJBA 2O07A 2QX4A 3JTEA 3TLXA 4UZSA 3I4FA 1S2MA 4KIGA 3IAS6 3NYQA 5JDCA 1XPRA 3H2KA 1JEDA 4CM8B 1E2KA 2O2DA 3D3NA 2H1CA 1ZOLA 2F8LA 4IXMA 1KO8A 4TQ9A 5DULA 4NC9A 4UEJA 3X44A 1TJ3A 1J8VA 4HVAA 3IDFA 2QTWB 4V1CA 4GC9A 3ND5A 5F51A 1WJGA 4WJKB 2FUEA 2GHRA 2VRNA 3CSSA 2QKYA 3IH5A 2PQMA 1PS9A 2RH5A 4HFNA 4LXGA 1JJ7A 1TW3A 1EFAA 4C7OB 5M5BA 3KKZA 2P67A 3SE7A 4ARZB 4CM1A 2HMSA 4GP6A 4EI9A 1N2SA 1X7YA 3FVRA 3O4HA 3C24A 3QKRA 3BH0A 4Y0VA 4NG4A 4BKMA 2QY9A 4ECAA 4DA4A 2P9BA 3O3MB 3DUFB 4REQA 3IT0A 4JI3B 1JDBC 2AJCA 2JHCA 1SULA 1QGUA 2I3AA 1KHTA 2GPSA 1L5FA 1MBZA 2ONKA 3MGAA 2BGWA 1N8SA 3D3QA 2BUBA 5CDGA 2JIZD 1OU0A 1OAAA 3KIPA 1SHJA 2BGTA 4KWHA 4OQPA 5T4HA 1FL9A 3BF8A 4ND8B 4U0KA 1Y7PA 4MQUA 2GZ2A 5AUOB 5F1OA 2IP4A 2R8PA 4M1EA 3LXRA 2XLCA 2Z5GA 3DO8A 3K6JA 2W2XA 1QHHA 4ZYUA 5EJ4A 3O93A 3T0GA 2B3TA 3N8GA 4OIMA 3V1LA 2UUPA 4IOKA 1P61B 5ENDA 5SY4A 3B7GA 1NNUA 3BYZA 3DB2A 4K6MA 1T8SA 5H3CA 4TSKA 1IEXA 2O8VA 4M1WA 3AWIA 1O57A 1JQLB 1ML3A 3ENKA 3KYJB 1PDVA 3V8MA 4W8HA 3QVSA 3B6KA 2WF7A 4HQLA 4G2TA 3I5UA 1OT3A 4LA4A 4UEKA 4CEIB 1J8DA 3QXSA 4HLCA 3OD5A 2ADMA 1GUZA 5FRDA 5ALFA 3EPKA 3D02A 4B2IA 3L3BA 4OH7A 5B58T 3R8FA 4L4ZA 5ITWA 1K6IA 2QVGA 1N32B 1P0PA 1RWBA 2ECFA 3E05A 1QG0A 4JT2A 3EAQA 1Y98A 1P75A 1XCOA 2NSYA 2O2XA 2V7TA 3H5LA 3IDQA 4FEEA 2CJXA 2WEKA 1XI2A 4JCCA 3HJUA 3SSOA 4MPJA 5EJGA 2HO5A 2VXBA 4HMOA 4MVJP 1R64A 5FOVA 2TECE 1J0EA 3MQ2A 1GTL1 1EXWA 2GHIA 5GONA 3JSAA 2OXCA 3RTDA 4B3FX 1LLUA 2DBZA 3TO5A 3B60A 2XX3A 3RKRA 3TZEA 2JIOA 3O7WA 2GBCA 4WZAE 5DGHA 2FDXA 2WV9A 5DKFA 4QU0A 5FA6A 2JAQA 1NUUA 5LZ7A 4QHTA 5ADWA 5KX5B 2D0PB 2CMKA 2R25B 3QNMA 5LLDA 3ROMA 3FYCA 1EHIA 4N8SA 4TRNA 3RVJA 4FFNA 3PEYA 5DI3A 3A9WA 3I72A 4R31A 1N0IA 1I9GA 3T5GA 5BT9A 1ZINA 5E2BA 4BGVA 4BFUA 1OYYA 1HYBA 1UJ6A 4CRWB 4A15A 2YV1A 4E1BA 2AYXA 2ZYSA 4UHHA 2QG4A 3DZCA 5CLQA 3SHTA 1NURA 3FVVA 2G83A 4CTJA 3NHUA 4IG4A 1U3CA 2NSLA 4WZBA 1E92A 1U28C 3TUJC 2HT6A 1XA3A 2X15A 4FMCB 1GUYA 4UHJA 1JXMA 4ACBA 3PGMA 1VLJA 2B21A 3B9QA 3AB7A 3OEEA 3JQ9C 2NT3A 4KSBA 1Z5PA 3PXBA 4LX0A 4YMLA 1D2NA 3IKLA 3AI2A 4MO9A 2C8LA 4IM7A 4GQBA 4PW0A 1O0SA 3I61A 4EG6A 1YC2A 4IIJB 2PZEA 3LX4A 4M22A 3DLTA 3ZJUA 2BH2A 5IARA 1N75A 2XMZA 3OZXA 5BQXA 3NBAA 4DY4A 3M89A 1QFZA 1AD2A 1UADA 4FLMA 3EPJA 1GCAA 3GCXA 3N2YA 4JR1A 4AB1A 1H69A 3EGIA 4QTUB 3K5HA 3AJAA 1L6RA 1MB4A 2EL9A 3L05A 5I3CA 1TF2A 1ECCA 4AY6A 1USGA 4M21A 4R6XA 2IWRA 2BCJQ 4KR3A 4Y2JA 5AVYA 1FQOA 4LZJA 5L7TA 4PRZA 4NU8X 1ML4A 4AWXA 1GPBA 1OF1A 4HDQB 3NTVA 1Y1RA 3BB3A 3QPVA 2X3FA 1QHHB 2A9FA 2M98A 3PJRA 3F97A 2A58A 3WY9A 5E8RA 1D2CA 3ELBA 4LKRA 4OQLA 2R7MA 5KZMB 3KXLA 1YS7A 3NHBA 2DH6A 4DA0A 3O84A 4W9MC 2GM3A 3R9XB 1JLRA 3UJCA 5FOSA 4I1UA 1K6MA 2EG9A 1R5BA 2NACA 3BWCA 3T99A 3WIEA 1F2TB 4LDRA 1Z6AA 4OHKA 1SUFA 3RQSA 5HRCA 5IDWA 2I4IA 3PL5A 4KYUA 4LE2A 4RY9A 1Y7HA 4CDNA 1P77A 2IY9A 4RVDA 3ZR4B 4QZVA 1CZUA 3MBKA 3BDIA 1PWHA 2L82A 1FBNA 2WJHA 3IEXA 2FFJA 3RHSA 4BV8A 4DC1A 2FK7A 1JN0A 3HU5A 1K9SA 4X1IB 1DX4A 5F2KA 3RUFA 4PC1A 4BASA 2DPLA 1WHTA 1VL1A 1KJ8A 1G4HA 1O9HA 4FLFA 2HRBA 3MGKA 1DUVG 4G24A 1V9LA 3A7EA 4MYHA 2BF7A 4RL4A 3EPHA 1K63A 2NO9A 2I7TA 4H35A 3AF5A 1R10A 1UFOA 1N2CB 2NYAA 2OQIA 1CW2B 1ESEA 2FVXA 1E79A 1SXHA 4ZAYA 1RQNA 1T6XA 2C29D 1PEAA 4WTOA 3OJ0A 1ZJ6A 3RVDA 3AEZA 2F1RA 4JMLA 3TD9A 3OKFA 1BHSA 1FTWA 1TGYA 4H0CA 4LYYA 2V7UA 4NONA 3SX0A 3E0XA 5CD1A 2FJUA 4M8SA 2ZS9A 2XGOA 4OQXA 3AEYA 2J9ZB 3OH8A 1SBIA 1V25A 5J2UF 1SVWA 3AKZA 3RUPA 4HAUA 4MULA 5JYBA 1NX6A 5BQ5A 2D5BA 3FY4A 1IBSA 4YRBA 3G9TA 5KBYA 3HY3A 2X7HA 1TQDA 4HN2A 1VYHA 3OU6A 1UAGA 3P27A 3GVPA 4MEAA 5DM2A 3IIMA 1P5ZB 1J6UA 4LBYA 3RVMA 3VC3A 1JGTA 4TLEA 3ZY3A 5C1IA 4WVLA 2GNAA 4DEYA 5CT4A 1BFUA 3L8ZA 5K09A 2GF0A 1W4BA 1ZM7A 3L7DA 5DSXA 3ZNPA 1T6BY 2WWYA 2EKQA 3ONNA 4ZQGA 4A2CA 1XAJA 3RC2A 2AN9A 4TL9A 3H6HA 2WKPA 1S2IA 3L7IA 4IIJA 2V1XA 2CFIA 4I50A 4IH9A 4Q4AA 5T6BA 5EVJA 1AZSC 1UZMA 2OD7A 1AGYA 3B3GA 3K9LA 1QCCA 3BMQB 4GXQA 4IILA 1JKJB 4GFDA 5D6OA 4RJKA 1XNRB 1I51A 3ZDZB 3UB4A 5F3DA 2BFMA 1VPVA 3DOUA 3OE7D 4G9BA 3UKOA 4ZVTA 3FG9A 2X8JB 3N9IA 2FSHA 2O57A 2YYSA 4Q0MA 1G8HA 3EZ9A 3T0FA 1UJMA 3LUHA 5IN5A 3D6MA 4ZCRA 1E0KA 3E9DA 3H5OA 1G42A 2AVDA 2ZAOA 3WQSB 5IBQA 3D8UA 1XXHB 3VHLB 4EJ2A 2BFAA 5EHNA 1NPDA 4IQ4A 3AL0C 4JGBA 4ZANA 4WK2B 2PFSA 4QQ8A 1VBMA 4WEOA 2P6OA 3PXAA 1U65A 4LN1A 5A4AA 3U2QA 1HDEA 3W3AA 3QEKA 4PGFA 2P27A 4RYLA 4A5SA 4GPEA 3O1IC 4DV1B 1QYWA 3H8VA 4G8CA 5DCYA 3O38A 4OUDA 1Z0FA 5EUCA 1M34E 1YC5A 3FPHA 3GT7A 4QLOA 4V0NA 4XPIB 3VR4D 4E6PA 5ADVA 5JH7A 3EGXB 1VJDA 2O2IA 2ZZKA 2F67A 1M1ZA 1Y6JA 1G8YA 1CRZA 2GXQA 4AX4A 1CR6A 2HY7A 1KIAA 1I0IA 2UVDA 2UVPB 1J97A 1FP1D 3MFYA 4KXUA 1EHYA 1YQGA 3GU3A 4IDDA 1COWD 1JJFA 5AP9A 3FWZA 2RCYA 5D3MB 3ZJYA 4CL3A 1YZLA 2CLIB 2BMVA 3M83A 4O5AA 2A7XA 1CDDA 2R1TA 3C7CB 2G4VA 1R5NA 1N3IA 3DJYA 5CK5A 2Q9UA 4MUIA 4R9RA 4NBNA 1EXVA 3VX4A 2QQFA 4TV8A 1U8TA 3DMHA 5LNK6 2QL9A 4JVOA 3BXGA 5HCIA 5BYBA 3K6RA 3ISTA 2WP8J 4EKYA 4PC6A 4U4AA 4UREA 1AY0A 5COBA 5E7QA 3QY9A 3IAHA 3L49A 4NG5A 2PQ6A 1XE3A 3JYNA 2R60A 4GPD1 4WQMA 3ZTWA 3ILHA 1K7YA 3ZLTA 4EA7A 3EVTA 2IYXA 2ZE5A 4GZ5A 2BTQB 5FQOA 1EFVB 4ZWNA 2QENA 2C2MA 1REQB 1KMHB 3QVJA 4P58A 5C5CA 3ZLVA 2H4ZA 1ZPDA 3HXTA 3ISJA 4IHKA 3LA8A 5FNZA 1HL7A 1RTKA 3JTMA 3GGJA 3P7MA 4GX2A 5CVUA 1O6BA 3RC9A 1ZD8A 1YKSA 4ZYZA 1VG8A 5EVCA 1V9SA 5TPZA 4UW9A 2VJMA 3A1FA 2NO5A 4BMZA 4DKJA 1XVVA 1RADA 2D1RA 3BMOB 1W59A 4YN3A 2E5LB 4EF4A 4B81A 1Z34A 4DFDA 2Y4NA 4OK5A 1VE9A 4FOOA 2HNAA 2D5CA 2RAFA 2NVOA 2H9YA 4DXAA 1XL0A 3KPJA 1TM1E 2A5DA 2ZWOA 3P94A 3F71A 1VP9A 1GGKA 9ABPA 3PPVA 4N41A 3HP7A 4G36A 5KMGB 2QRKA 1I1OA 3Q9LA 1E3WB 5KYYB 1K66A 2Y9PB 4MKZA 1F8UA 4AM8A 3JRWA 4PZAA 1ONPA 1Y3DE 2ISSD 4OHBA 3TN7A 2FRDA 3R3XA 4X41A 3QKIA 3LQ4A 1TYAE 2PL9A 1IEQA 2FPXA 4X44A 3GDOA 1GLNA 3QXHA 3OQVA 5C7YA 1RXCA 1EQ2A 4A16A 5EWJA 5KJFA 4DDTA 4IDQA 3CXUA 3TRDA 5FL7A 3QQ5A 4Q1EA 1VSUA 4B3XA 3Q4GA 4L51A 3ZOZA 4BGEA 3U26A 4BVHA 2BFFB 2ZXEA 3T3IA 3ENZA 1KY3A 2PQ2A 3Q85A 1R6TA 2H11A 2PZLA 3HB4X 3VSCA 2QP3A 3ILYA 5FORA 5BWNA 5KTNA 1WNFA 3PGJA 2YXLA 4N6OA 4PFKA 4ZEXA 5D5HA 3RFTA 1QB8A 1SOVA 3HKBB 4K9LA 3WWDA 1BE6A 3T3EA 4E94A 4Y6RA 4IIYA 4QDKA 4OLHA 1JDJA 4BGIA 3AVWA 3RDPA 1EWKA 2OBFA 2EJTA 3U1TA 2BEUB 2DKOA 1C9NA 1YDGA 2B7CA 4XDGA 3ZNOA 2WV7A 4EO7A 3FOEC 3FKSD 2JHAA 2NTVA 1FOEB 1DEKA 3AEQB 4G4SP 4YRCA 1DKQA 3A6KA 3QKTA 4GRAA 4R2MA 4TTPA 3TSOA 3GJTA 5IBRA 1TJPB 2JIDA 3PZRA 4P7BA 3TH5A 3UAGA 4KAFA 5HKAA 1IVNA 2HLHA 3DFMA 3UK7A 1UFKA 5IDQA 5JNSA 3IUYA 3P45A 3DUWA 5IJWA 4QOHA 3DJFA 1OXVA 2QL5A 2HX1A 4ENSA 2L42A 4YMIA 3STWA 4BB5A 3L0SA 4LW8A 1X8JA 2E5WA 2KPOA 5DLPA 1U99A 3F5SA 4O2BB 4B0OA 1J21A 2B1RA 4HEA1 1N1MA 1NYTA 1QO9A 2WYVA 1XVIA 2LDBA 3AR6A 2OQRA 1V0JA 2OQ2A 2XWPA 3I0ZA 4R4JA 2CK3D 1G5HA 3EC1A 2HB6A 4FI3F 4CIYA 3GPCA 3F49S 3LP6A 4WUTA 5F73A 1H2YA 5CITA 3F6RA 3CJTA 3DZ8A 3SZMA 2QQEA 4I4LA 1Y8RA 4IR7A 3MMNA 4N12A 4DZTA 2XDYA 4DMRA 3B51X 3I9MA 1JIIA 1M1YA 4PU0A 1J2TA 4YCBA 4NJEA 2QX8A 4N48A 3B6ZA 4HDNB 1JR3D 1HFKA 3UMJA 3GLIE 3RE1A 2QXTA 2CYCA 3K5IA 3PDIA 4UUQA 3KKOA 1IMJA 1VHLA 3LNTA 3MD9A 1XKLA 2C3OA 2XVMA 4D9EA 6ADHA 3A6FA 4ZYVA 4O63O 4JHLA 2BJWA 3TTXA 2A14A 3PLAE 2XB4A 1NBWB 3QU2A 4IHJF 3GAMA 4QQRA 2XKKA 4MDFA 1PZFA 4P3PA 4LRSB 9ATCA 5IZCC 4LKOA 1X42A 2HW8A 5IHPA 1NJGA 2X23A 3R7WB 1RAGA 1I10A 2VXOA 1XVLA 1BCRA 1TM5E 2C5BA 2R97A 2PCJA 3G2LA 3TZBA 4B8ZA 4EY5A 1JDNA 1R5OA 2NMVA 4J2HA 1MVOA 1T1IA 1X7GA 4JLMA 3HCFA 4RV5A 4XB1A 3VMFA 4BCDA 5BWOA 1RACA 2EWMA 2VCYA 2ZYDA 5L4SA 5IUNC 1N5KA 2VYCA 3FIUA 3WGJA 3ZXXA 2SHKA 2NGRA 5K8LA 5IC5A 2JLCA 1YU9A 1EK6A 1U28A 4PLTA 3RYHA 3B2NA 3ZI0A 1HE5A 4AIIA 4F1WA 1KH2A 2IIBA 3OO1A 4QDZA 2FZ5A 4C6RA 3I1FA 3ORSA 4G0MA 4RKQA 1QF6A 2W93A 5FPQA 1QJ4A 5IAEA 3IQZA 3IQIX 1B2RA 1IH8A 3GEDA 3GGOA 4GP9A 1IBKB 4Z4IA 1JBEA 4DMLA 2VDVE 1G21B 1NMQA 1LV7A 2UYGA 2E4ZA 1XCLA 4CL0A 3DM9B 4FGJA 3K96A 4AJOA 4NARA 2YY6A 1CY4A 3Q12A 2HHJA 3NEYA 2W42A 1XLTA 4KMMA 1Q21A 2PCLA 4H1VA 1GZ4A 4GZ3A 4NEHB 3A31A 3WBJA 4B76A 1KI6B 1C50A 3KKPA 3LT1A 4OHWA 4YBZA 4WFKA 1P5RA 2P91A 1UJBA 3AJEA 4YCCA 5IMBA 3VNQA 1B4DA 3KQNA 3WL3A 4QOEA 2R11A 2P2NA 3M9XA 5FUQA 3LUAA 1XUOA 1BROA 4QJ5A 4QGBA 1QORA 5CT5A 2Z1DA 4GKVA 3CVYA 1PX2A 2IV2X 3PE4A 4X62B 3QLVC 2OAEA 4RELA 3KUXA 4BX0A 5FBKA 3FUCA 2FCAA 3TG8A 1TO1E 1ZQ1A 1ZJJA 2OECA 3F2IA 4D4HA 3FFBA 4FMPA 2QUZA 2WM8A 3U7RA 1HO3A 1VZ2A 1Z7BA 4FHEA 5TQJA 4LFBB 3E7PA 4YP5A 4B84A 2FW9A 2MDTA 3KZVA 2WU3A 2OFFA 3C2QA 5H3HA 1OH7A 4IFTA 2FKAA 1UDXA 3PR1A 3ER9A 1EFKA 1X9IA 4ILEA 4XYGA 4A26A 1Z0IA 3BWXA 3IODA 3AERA 2QR2A 4NPCA 3RVSA 3L4BA 4EKEA 1GQSA 5BUCA 3W4IA 1LRKA 1JE0A 1K4MA 4X9XA 2YV2A 4XE5A 1FVFA 4U8GA 2QRVA 2IP2A 3T34A 1T3ZA 2A1UB 5CAEB 2Y77A 3GK3A 1JAXA 3L9XA 3GFFA 1VGRA 2OPBA 4M0MA 3FNEA 3NEPX 4MSUA 5CX1B 1A1VA 4PG5A 1GYPA 3BFXA 2P11A 1YHZA 2GN8A 3GIDA 2ACKA 3RJ5A 4EHHA 2OVFA 4KNVA 3J7AC 5JMOA 4U2DA 1SQ0A 1V95A 4OXNA 3UATA 2J33A 1AHHA 4RTQA 1GO2A 4BQNA 1ST3A 5AKIA 3ZX5A 5LYYA 4Y1RB 2M6RA 2UZ1B 2ZB7A 4OUKX 4A2WA 2EKBA 4OA5A 1WB6A 2DF8A 5EJAA 4PHFA 4XQEA 3CRQA 3OPYI 4X1KA 3SICE 1Q7GA 3OA2A 4AZSA 1Y34E 2HA0A 5E4FA 1Q95A 1MX3A 2HD4A 2WVAA 2ZYGA 5CLIA 5ALIA 1VJRA 1UEIA 5EIAA 3G0DA 5HDBB 1F7VA 3EEOA 1FTSA 2HBQA 1ZC3A 4TKUB 3EGDB 2OV8A 5AKYA 2OV6A 4TXHA 1BDIA 4B35A 4LV5B 3SEZA 1JHYA 1SVOA 3FPGA 3TVDA 5IT9A 4LIPD 4ARIA 1VPTA 1EKXA 2XZTA 2PMDA 2MWMA 4LVOA 3WWOA 4LJLA 4WBNB 2ZYAA 2I2FA 4ZI7F 3G6WA 3GRFA 2Q6IA 3IB3A 1XQ6A 3MINA 4X63A 4O1HA 3AKDA 3MFQA 2ZI7A 5JZOA 3DE0X 3JXEA 3LW7A 1WVMA 1IM5A 1W581 3CKYA 3ITNA 4J3FA 4R16A 1HLPA 1ZKDA 3FJYA 5LBUA 1C3OB 3GRZA 2C0PA 5F3WB 3HLKA 4JLNA 1Z38A 7REQA 5JWRA 3CNLA 2Y1XA 3FWPA 3TQHA 5JS8A 3KO8A 4GR4A 4ZYLA 3A2KA 2NIPA 3D1JA 3G8BA 1G3RA 3A28A 1KP9A 3OX3A 3DWFA 1A4RA 5FH9A 4V0KA 4CI0B 1DBIA 1QIDA 1ODCA 2AJTA 3EWNA 4UCQA 2OY0A 3V3KA 3R2JA 4MUEA 2ZCJA 3SS7X 3P9IA 5AOVA 5CJPA 4TLMB 3RTGA 3F5QA 3VSAA 1AKTA 3ONDA 3UFXA 4CMHA 3EB9A 3I9LA 2D0OB 5ETJA 4K9SA 1E2IA 2J0QA 1T5HX 1NXVA 3BHNA 2JANA 1N6KA 3HKCB 4LOKA 4UJ5A 3CT6A 3BMNB 1NGSA 5D51S 3SG0A 1P2TA 1T3GA 2BZ0A 2FV8A 4F56A 1RBQA 4EG0A 2WF8A 1HY3A 1UM9B 4FXOA 4H6PA 1V4VA 4U5QA 1VCIA 4W9NC 2IBMA 3KR9A 1OZAA 1VPLA 1IDOA 3L6RA 4Q3EA 3EY9A 4EYEA 2GAOA 1J1IA 1OROA 1Z0SA 2PXAA 3IA7A 1FMCA 3T38A 1LBQA 3E61A 3LFUA 2R8ZA 3EXHA 4AJEA 4I4TA 3IE0A 2HQBA 4JIMA 4L5IA 3GNLA 3D2BA 4X97A 3JQAA 1UFVA 2PYIA 4P3YA 3UK0A 1QZZA 3RRNA 1DRKA 1SVSA 4OFZA 3L0YA 1IWPB 3NT5A 1MB2A 2O2SA 1WXHA 1N57A 2XCUA 3V33A 3E3NA 4ENVA 3V4OA 1TQ8A 1QHGA 2W58A 5B4TA 3KZCA 4TVSA 4ENTA 4H59A 3FWHA 2QIPA 3DTVA 4UBLA 3THYB 3TLMA 4HXYA 2NPOA 4M49A 3B38A 1KF0A 1ZD5A 4XASA 3N05A 4B40A 5JJCA 1OH5A 1Y6GA 1C0EA 2C8KA 2XRYA 1F48A 3BA6A 4FVTA 3PYLA 1N33B 3EIQA 1G6Q1 3IS3A 4L4SA 1SBNE 2PG3A 3HM2A 4ATNA 3QWAA 4LXTA 4YLEA 5KVSA 5EZYA 2ZT7A 3R5XA 2NUAA 5AKLA 1EM8B 4IKOA 3NNSA 3B3QA 3UAOA 1OB2A 1PR6A 3GPLA 5HNKA 2VHXA 2WU4A 5FOTA 3NG1A 3V4FA 1PFWA 3QOYA 4PS0A 3U4HA 3U7FB 4MRNA 5I8ZA 1VXRA 1YB5A 2B4RO 3ER6A 1M2KA 1Q19A 3KJIA 4MUXA 4WGFA 3WWCA 5LIPA 3LC2O 3W34A 4U7JA 6REQA 4EL0A 5ES4B 1G4UR 2WIJA 5C80A 3VDRA 3OOHA 4YAJA 1TT5A 3KQUA 4BB6A 2AE2A 3DLIA 3T3GA 3IA2A 2P8SA 2XCSB 1K92A 4DQ0A 3SBEA 5JAPA 1BOOA 4XEUA 2IBTA 5JSQA 1W93A 2QIOA 2RGRA 5TEVA 1TM4E 1TADA 2RHMA 1UAYA 3NFRA 3R7BA 3UQYS 4AJNA 4Q3BA 4CFZA 4D0GA 1GTSA 2UUAB 4G0VA 1Y9JA 4ARBA 3A3PA 2JHFA 2BFCB 5JEDA 2ONCA 1TAUA 1QX3A 5L6LB 1W5EA 4KREA 3VVMA 1QC5B 2BTOA 1G9TA 1LI5A 2NWQA 4ZI2A 3A4TA 1OAOC 1TKCA 4FB5A 1EFRA 2NUTB 3THOA 2BFEB 3NP9A 3L4KA 3TLEA 1HNNA 2WJ6A 3VZBA 4DIFA 3I9FA 4N1AA 1RJFA 1OX4A 1BE1A 2PPVA 3D31A 1UBRS 4LTNA 4NFHA 3O8QB 1XR3A 4JLOA 3CPHA 3IBYA 4X71A 1YZUA 3PJFA 4N0MA 3SHVA 3T9DA 1JKFA 1HYHA 1JZQA 1HMYA 3K92A 3OHPA 5KSWB 3BULA 2O8DB 4J43A 1W1WA 2HMYB 3OQ6A 1Z4OA 3D6VA 1E2MA 2EDCA 2VJLA 4O5OA 3NM4A 1IIRA 1U8YA 1ILEA 4QULA 1RKQA 3IPRA 2R9VA 4JYPA 2ZJAA 1YWGO 4B44A 2WJWA 1BE0A 2UZIR 3RYFA 1ANKA 4I4NA 3RUDA 3OF3A 5K0BA 2HSWA 3WICA 3S1SA 1I80A 2CXXA 2ATVA 4N5LA 2PGIA 4N76A 1YVPA 4DF3A 1KI9A 5JEEA 1R6BX 3TOCA 1MO2A 2CV1A 3SDSA 1KJIA 3DKVA 1EJ6A 5I7VA 5ER9A 4D3FA 2GPNA 4AKSA 4URFA 3WLAA 3AM5A 4R1UA 1ULTA 1A27A 1GDDA 1XLUA 2N1BA 3C3JA 5AJVB 3RRXA 4AK9A 4F92B 1AKRA 4S05A 2IX3A 4NICA 5A4KA 4KZKA 1UBNA 3N39C 2V7VA 4ZC8A 4BVEA 1SKYB 3EBOA 2FPOA 4H17A 3CSUA 3H16A 4JKYA 4UFNA 1K86A 4S2UA 5FEUA 3GEMA 2HYDA 1ZIXA 4RLQA 1A1SA 5EMJA 2DR2A 4LF7B 3AUJB 2RBEA 3UWKA 2QVZX 2Y0PA 3ZZUA 2RI1A 3JPYA 3TGLA 3UMCA 5JY6A 2EVWX 1YB6A 3KHSA 2PS0A 3DWEX 3VPAA 4OJNA 4F3YA 1XF9A 1FNSA 3FIJA 2ILTA 1E18A 3LY7A 3MJTA 3A4LA 1JFSA 5A0VA 1QYRA 1CFJA 2B25A 2XB9A 4PX3A 4XB2A 2AOUB 4P4LA 2QSZA 4A8TA 4QT4A 2HADA 1KYWA 4H7EA 4GM4A 4RQAA 2HZBA 2QMQA 1VXOA 1M76A 3DL7A 5EEHA 1MIOB 1XU7A 2XLBA 1HT3A 5TQVA 4Q3OA 3C3MA 1JQAA 2G77B 2WYHA 4FKBA 4RPGA 4U02A 5E6SB 3WL4A 4EVRA 5B64A 5JXJA 2QX9A 2O8DA 1NHWA 2C61A 1F2UA 1JT2A 3HSSA 3T95A 4B17A 5J2TA 3LBFA 2NNLD 1ZAYA 2VSNA 2NZUG 4KVFA 2PIAA 5H02A 2AFIE 2DSNA 2AUNA 2PMKA 4B3HA 3A6HA 3OOJA 4H31A 5ALGA 4GI7A 3DVQX 1XYGA 2REQA 4DCOA 2Q4DA 1OGYA 4RTOA 1WUTA 5J5AA 2NUTA 3HXKA 4YPOA 3G5AA 2ZRQA 4YJ2F 1WRBA 2VPPA 3O8NA 3SP1A 4NDZA 5AWFC 2HU8A 4CKEA 1LK7A 1SK8A 4LWQA 1XA4A 4MRSA 3ZQ4A 2AG0A 1ZIPA 2DFLA 4P93A 3FPJA 2E2WA 3PWTA 1UT8A 2BE7A 4GYWA 1G18A 1Q0LA 4L28A 4RJLA 5LWQA 4YO7A 4WUVA 1ZU4A 4KQGA 1IWBB 3GWGA 2G36A 3EJWA 1PHRA 3PFFA 1FF9A 4XSHA 5G2OA 2IY8A 2Q4RA 2Q3EA 2AR9A 2J3JA 4F5ZA 4MJXA 1I32A 1W47A 2GASA 1CS0B 2IDJA 2VLBA 4WDQA 5CT6A 1Q0PA 1FU4A 3EQ9A 1NDQA 3KPUA 1BS9A 4K1XA 3F6YA 4B09A 3CT4A 4U9HS 2JGLA 4WOPA 5ECWA 1OPRA 2AC2A 2AR7A 4LFCB 4KIJA 5L3SB 1U2DA 4XI9A 4FZJA 1CQWA 3E27A 3SMVA 4NHEA 4D42A 4WBNF 3TNFA 3MLEA 4D92A 1JE1A 1D1QA 1EYZA 2BKAA 2A3NA 3OIWA 4KMRA 2BUCA 2PKQO 3E22A 4HNHA 2FQQA 5B53A 3UAZA 4EPXA 1AUQA 1NI4B 2YHUA 1WCV1 3D2LA 5KWIA 4Z6KA 3M1LA 5ALNA 4S04A 5E2AA 2IHKA 4ES6A 3WQHA 3DE3X 2GAIA 4X8OA 3BIJA 5FUYA 5EPOA 3DMPA 3ZGYA 1OWMA 2JLBA 5ADUS 4TM7A 1WPGA 2BFFA 1KC1A 1YCHA 2KMLA 5BRNA 3KSBC 1IVYA 1K4YA 2VP2A 2GVZC 3SKYA 1ADCA 1FYWA 3OZBA 4BNKA 1MP0A 2G76A 4J0HA 2LCIA 5IXSA 4FBMA 2RGCA 2X2EA 4C43A 4D8UA 3ZEAA 4CVNA 5B6IA 4ILKA 4EH1A 1QVVA 4H0NA 1AA6A 3DZJA 4PLGA 1XXLA 4V0SA 2OD9A 2PWPA 5ALWA 5LNK1 1T6YA 4OHZA 1OYVA 3DBRB 1TMYA 1AZLA 1XD2A 4BP1A 4C5AA 3IMCA 1VDMA 4UUAA 5LC1A 3G0CA 1NNEA 2XYPA 4PZEA 1DFIA 2CNKA 5CLLA 5TGDA 1Z06A 2IXAA 4IUDS 4MUGA 2O8CA 5BQ3A 1N2GA 1E2PA 1ZNWA 1A9SA 1KDVA 1EE1A 2EZTA 2I62A 3M2PA 2ZTLA 3NB0A 5LP6C 1PYOA 3GVCA 2O8CB 4FGUA 4FLEA 2VNSA 4GXNA 4CCAA 2FPLA 3ENNA 2MSLA 3LT0A 4UTVA 4BTLA 1GZ5A 1INLA 1YS9A 3D7RA 3LXMA 1PT6A 2I54A 1L1QA 5EHQA 2FE4A 2V59A 1Z39A 3N8HA 2QRMA 2ZUBA 1ZEMA 1BVRA 2IW3A 3RTBA 1E1RD 1Q6ZA 2E4YA 2HRDA 3PDHA 1S7GA 2WT9A 2WK1A 3UJAA 4HDMA 3COZA 2DR3A 2YYZA 1CEXA 2VP9A 2BMWA 3M5DA 4AY4A 2HA7A 5IJ0A 5BORA 2HIAA 4Q3NA 1ZKMA 3LD9A 1G6KA 4OQQA 4IUYA 1DI0A 3LE8A 5AR1A 4S1TA 5EE0A 1CIJA 3U49A 3L7NA 4MRVA 3WIUA 3ETLA 3MHPA 4K5QA 3U4GA 4NFLA 3DMYA 1GA1A 1WHSB 1V37A 3QH4A 2R7AA 4ZCQA 4INAA 1PRYA 2BGMA 3OG9A 3T4UA 2A4MA 5AJWA 1I30A 4EB6B 1U02A 1QUEA 1B42A 2ZIXB 2FEXA 4NZPA 1NBEA 5LVAA 3Q8MA 3FROA 3FCYA 4Q4AB 2M1ZA 2DWOA 2GEDA 3O3CA 5SY9A