4Q03A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q03A00
4L9WA 3FYHA 3SJBA 4AI6A 5LBIA 3LWNA 3T35A 4AWXA 2QAGB 4OK5A 4RD1A 1LS1A 4TL7A 2F9LA 4YXWA 1UEIA 1NVWQ 3BK7A 2OBMA 1COWA 2KSQA 2QE7A 4N1AA 3OAAD 4M9XA 5FL3A 3GLIE 2HT6A 2XGJA 3FOZA 4DLSA 3KQUA 4PSKA 2XZPA 2JJ8A 2F1IA 1Z8FA 2AXPA 3UMFA 1AZSC 4JYCA 4JLAA 4NCJA 1R0ZA 2QNRA 3B1XA 3WP0A 4DLRA 2Z4SA 1ZIPA 4P32A 5IT5A 3P26A 3QF4B 4JSYA 4V0OA 3KQNA 1CIPA 4MRPA 3KXLA 3FWYA 4MRSA 1QVRA 4YMVA 3AP2A 3NXSA 2XXAB 5KNCA 4EQ6B 3BB4A 1W4AA 1ZMXA 2ORVA 1A82A 4A92A 2QA5A 5J47A 3NBZC 4W5HA 1XBTA 4XTRA 4Q7JB 4TQ9A 2EWWA 5L3QB 3AVPA 3TRFA 1XD9A 3AQ4A 5AR1A 3GJ4A 3C5CA 3QKSB 1OHHA 1OV4A 3GLGB 3SYKA 4B3BA 4EPVA 3CW2A 4IVPA 4YXWD 4GMDA 3ICEA 3TSWA 1TF2A 1ONBA 2BJWA 2VTKA 2QG6A 4LI0A 3AF1A 3EASA 2V55B 1JQLB 2AWNA 3DO6A 3LNCA 4I4LA 4IDOA 1SZPA 2Q3HA 1MABB 1RRFA 4QG7A 4Z1MA 2F1HA 1E2KA 4WVFA 5GJVC 3NEYA 3T12A 2BMDA 1D6JA 4WXRA 4DB2A 4S2EA 4Q5IA 3RS2A 4LGMA 1VG8A 1YZLA 2UZ3A 1S4QA 4Q1DA 1N6KA 2QM7A 1YRAA 5GJWC 2IC5A 1XX6A 1KO8A 4AKGA 1E2EA 4R71A 1JQJC 5J4VA 2FE4A 1KMQA 4IVRA 5HR5A 3OIYA 5H68A 1ZUIA 2AWOA 3TQFA 5JMTA 121PA 2Q3FA 4M0LA 2ZREA 2H17A 3T06B 5FBVB 1AK2A 3A1VA 1LS6A 4F38A 4IEIA 1R5NA 2NQ2C 4Q9LA 4GRAA 2D62A 1XCGB 5KHOC 1FNNA 1SKQA 3OEEA 1OXSC 1W49A 2VP6A 5DYIA 2ODWA 4B48A 4RZUA 4DDWA 3I5XA 3IHLA 3K9NA 3R20A 1QHSA 1HQYE 1DVRA 2VH5R 2H57A 2BHRA 1Q20A 5FOVA 1NP6A 3IHWA 2D74A 3H86A 5KDLA 1NSFA 3T1TA 1KY3A 1G17A 3EARA 1LTQA 3QENA 3WRXC 3OFND 2MMGA 2ZE8A 1S1MA 2I1QA 4TYYA 3TE6A 1H8HA 4TYPA 2AFIE 3FE2A 3MFYA 3ZQJA 1KAGA 2CMKA 3NC1C 4HAWA 4C0KA 1G41A 1YZNA 3THXA 5BYKA 1W4BA 1G5PA 3VR3A 3GLGA 1IY0A 1XJQA 5A5GA 2ZYWX 1ESNA 4ASUD 5SZJA 4KODA 2XAUA 2VHTA 4Z8YA 4NTZA 2D4HA 2KB0A 2PEZA 4DVGA 4JL5A 1Z07A 1OXTA 4Q4AA 3U60B 1NY6A 2J0UA 2WIAA 4LBYA 3TVDA 3WHLA 3ZVLA 4EFMA 3CONA 1T9HA 2EFGA 4PZZA 4MRRA 5JWOA 5FTNA 3BXZA 3S1AB 5J40A 3ZYCA 3UATA 1BYUA 3K09A 4MGKR 1W46A 1XZQA 2OCYC 3EAQA 3LW8A 2NO7A 2DHRA 3CRRA 1ZNXA 4TSFA 4PHHA 1NKSA 3A4MA 2DYKA 5EZ5A 1EFTA 1SXJA 1OYYA 2JJ2D 2C9CA 4FCWA 4I1UA 2G77B 4FMCF 5UKDA 2UZIR 4BFVA 1U2RA 2WWXA 2ANBA 2KJQA 4UJ3A 2GEDA 4TMWA 3IO5A 4PFSA 4PSAA 4A6PA 4B2LA 2IBMA 3HU2A 4NYJR 2WJHA 1LB1B 3CF2A 2CLSA 4JT4A 3BFXA 3EX7C 5KSPA 4EJSC 4IRUB 3IPYA 3MMPA 1AQYA 4I1SA 3GJ3A 2CE7A 3C8UA 3V9PA 3IEVA 3KB2A 2I3BA 1XJ0A 4QKQA 4BPBA 2O8FB 3SYLA 1QHXA 3EC2A 2WKPA 1HY3A 2JATA 3AKEA 4BLSA 3QEOA 4YDSA 3GPLA 2QRZA 4ZI2A 1GDDA 2ZJBA 3C15C 5JJIA 4UQOA 1DELA 2X8AA 4D0NA 1DADA 2GCOA 2CVHA 1RPZA 1DO0A 4M8NE 4ABYA 2R2AA 2GILA 3RS5A 1OXUA 5B64A 4W5JA 3UPUA 4B74A 1JJ7A 3GLFE 4KHZA 5FPYA 2NPIA 4JVNA 1E32A 4KVGA 2FMXA 2GHIA 2D7CA 3MUFA 3OEHD 2GJAA 2LKCA 1J99A 2GK7A 1GFIA 5KSYA 4HB3A 3VR2A 1NBMD 2XNDA 3PUVA 2B7CA 1KDOA 3KL4A 1DOAA 5JS8A 1EFRD 3EW9A 4O3MA 2QPTA 1QF9A 3CZPA 2J1LA 1E2GA 3LH5A 4LUCA 4Q1AA 1ZM2A 4OI2A 4MGYR 2H5EA 3WP1B 1SVMA 2D3WA 2ZR0A 1W0JA 2DY1A 2GJ9A 4BFSA 3TSOA 1TNDA 5BN3A 1FFHA 1ZNYA 2J5XA 3PCRB 3ND9A 4L9SA 1HA3A 4U02A 1DAMA 3NBYC 4NONA 5H1YA 4BE7B 5EQTA 3WRYC 5P21A 5HE8A 3K8YA 1FTSA 2OFOA 2QTHA 2O8CA 2IF2A 5IDVA 2EFEB 1BMFA 4ITRC 4AG5A 4TMKA 5JWHA 3QKUA 2QSYA 4HUQA 4HLQB 4NCHA 1N0UA 5D3QA 4KXFB 3LV8A 3VTKA 4X8LA 4B3FX 1NIJA 3DM9B 4TT3D 3DOFA 2FFQA 1E98A 3L43A 1EESA 2REXB 5L3SA 3GP8A 3KTAB 5FUXA 5SZIA 2IW3A 3L82B 3ND8A 3KUDA 4NU0A 5FR2A 1G8PA 1N6NA 2V3CC 1P9WA 1X1SA 4DLVA 2FFAA 3A4LA 3CR7A 1XTSA 4JVSB 3GLIA 5EP1A 1IONA 2QE7D 4CT5A 2ZPTX 3EZ2A 4W5WA 1MH1A 4B75A 2WVJA 3QXJA 3U4QB 1W36B 4RD0A 1XXHA 1FPMA 3BOSA 2NTYC 2EQBA 4IJMA 5FFMA 3JVVA 1E9EA 2P65A 1XEFA 4LYHA 3CH4B 3X1XA 1XMSA 3OAAA 4XVQA 3VFDA 4D82A 4DT1A 3GLGE 1GM5A 3AVVA 2OM2A 2PZFA 4B43A 2ZE5A 5C4GB 3GEHA 4TN1A 4B6FA 4TLAA 2QGZA 2W00A 4V0NA 1E2MA 2C98A 2DFNA 4NP6A 1MO5A 2JLXA 1AS2A 2EWVA 2OT3B 3KQHA 1NI3A 4HDOB 2C8VA 4XJXA 4OKSA 5FUYA 3WNCA 1KI4A 4CEJA 5C18A 1QVAA 1HEIA 3CLVA 2A9KA 5CJPA 1FQJA 5EZ6B 3VHLB 4BFTA 1WB9A 4KITB 1T3HA 1DAIA 2OBNA 1I2MA 4MYHA 4DIDA 3LA6A 2BM1A 5F9FA 2QT0A 1OXVA 4TWZA 1F5NA 1R7RA 3A1TA 4GNKA 3X1YA 2IL1A 4ZKEA 5C4MA 1EX7A 1N6IA 2JLQA 3MRSA 5FOSA 3JZAA 2DB3A 2DFKB 5IK2D 2H92A 1E2NA 1GRQA 1OH5A 1HQCA 1NKTA 3THXB 4C2TA 4CEIA 4HZIA 2C2HA 1E2FA 1QG2A 4GP7A 3IPXA 1HYQA 3LX5A 5DHAA 1CTQA 1VHTA 2OEPA 4G5OA 1IN8A 3AEZA 1T6NA 5FH9A 4DCSA 1U9IC 2DR3A 4CEHB 3K9HA 2GESA 2GF0A 2F43A 4KCGA 1NG1A 3W5JA 2CHGA 3C14C 1W47A 4QGAA 4FMBB 3B1ZA 3L0IB 1JR3E 4CDGA 1F2TA 2IYYA 5HKKD 2ZXUA 1CU1A 3NDBB 3H4MA 4BECA 4XH9B 4HB4A 2XTMA 5FL7A 3WBJA 4D6PA 2F43B 2QGNA 3P1JA 3BGWA 4JIMA 3ICQB 1YZTA 3GLFB 1HE1C 2C9YA 3LX8A 2ONJA 4JKIA 4NPHA 2AK2A 3C16C 2HUPA 2ZR9A 1GIAA 4BRUA 4TLDA 1KZGB 3THYA 3KJIA 1FTNA 3W8RA 1OLOA 2H18A 2QPAA 2WM9B 2QTVB 4UXHA 3DZ8A 3GLHB 1DS6A 3TQCA 4RCYA 3TJZA 4HSEA 3UANA 2JCSA 3K9GA 2QZ4A 3W8NA 3WXMA 4F92B 2JLZA 1KK2A 2NO0A 3MJHA 3FKSA 5AWFC 2H1LA 3REGA 4CGZA 1SGWA 1F2UA 3D31A 3PG5A 3WYAA 1WE2A 4B3DA 4AYXA 1AS0A 2IA5A 2WMOB 3G82C 1Z28A 2LKDA 1VCMA 3AV0B 3V4FA 3HYRA 4NYJQ 3MWYW 3I1FA 4KV9A 3VHXA 4ZCLA 2PZEA 1UJ2A 3OF5A 5BQ5A 3EPHA 4JVLA 1YZKA 3BIFA 5HE9A 3SHFA 2YZ2A 1ZYUA 3IQWA 4BFWA 5JSZB 1CBUA 2RHMA 5EXSA 3D3QA 3PEYA 1OXXK 3DKPA 4BFUA 4D2IA 2ZRKA 3ZVMA 2RMKA 3U7FB 1L4YA 3FDIA 8OHMA 1N0VC 1GZSA 1GRNA 1AIPA 4E07A 4WXPA 1KMHB 4O2LA 2ZSAA 2FEOA 1P2VA 3PUZA 2ZI3A 1IXRC 3VQTA 4Q4JA 2XSZD 2VP4A 4TLEA 3UG7A 3LQRA 1JNYA 3AB3A 1SHZA 2J41A 2TMKA 2V7QD 5E3HA 4RCZA 4P0TA 3U2QA 1K6MA 1A4RA 4LZZA 1GITA 1P61B 2YC2C 1J2JA 2CCKA 1HUQA 3NKVA 4QBGB 4GL2A 1UDXA 4PO9A 4PPGA 3KXIA 3BH6A 3UXMA 1CP2A 3AH8A 4DSOA 2EYUA 4OI1A 3GD7A 2FDCA 2ZRLA 4AG6A 1XP8A 2ZI7A 1Q1EA 2VP9A 3IIJA 3QKRB 4OHWA 3UMSA 4DCUA 3DVLA 3LO5A 1ETUA 1U0HC 3LLMA 4TL6A 1M74A 4EUNA 2BC9A 3C7KA 3L0OA 2OLJA 4Q02A 4A2PA 4WZBE 1DPFA 2CXXA 4KLNA 4FMDF 1N5JA 2FZLA 3K70B 3T5DA 2G1KA 3AP1A 4RJLA 1YE8A 1PJRA 2JLYA 3IILA 4Y0VA 4DDTA 1HH4A 2P5TB 4C0AC 1Q22A 1EG7A 1TQ2A 5E4FA 2IYTA 1N25A 1XMVA 4ON9A 2IS2A 1RFLA 1T5IA 1M7GA 2NIPA 4KYIB 5EP2A 3KQKA 1US8A 2FFHA 4PQFA 3U3KA 5EP4A 1S9HA 1JALA 2VSXA 2ZRJA 2MSDB 2B8WA 4KLZA 4PZLA 4MUAA 2DFTA 1VIYA 1XTRA 4LJ4A 5D3MA 2Z5FA 1I4TD 2PZGA 5KU1A 1G8HA 1ZINA 3B1YA 4V0LA 2YNMA 1YRBA 4IOLA 2WV9A 4FCTA 4A0HA 1OIWA 1VECA 4C2UA 1S0UA 2JDID 3MAAC 3QI2A 2AK3A 2AN9A 3RVBA 4Q21A 2ORIA 2C5LA 2IEZA 4C7OA 4D4MA 1GL9B 2GK6A 2F9MA 4DDUA 4M9ZA 3G5UA 1UBEA 2DWOA 1OFHA 5HZKA 5CDFE 4B33A 2OV2A 3KFXA 4IW3B 1IN7A 2O0KA 3TW8B 1KI6B 1Q57A 2PJZA 4P33A 4B34A 2ZI9A 1ZCBA 1H8HD 3TW4A 4TMVA 1G3QA 3U7GA 3BJIC 3SR0A 1ZD1A 2RH5A 4PAOA 2AFHE 1BMFD 4M1KA 1IN4A 2B21A 1OIVA 3Q3JB 4HAUA 2GXUA 3CH5A 5FPHA 3PUXA 2CL6X 1KSFX 3BC1A 1AGPA 5JECA 5JRZA 3R8CA 4KYUA 4ZO4A 4PPQA 2W6JA 1IJFA 4QL3A 3TSZA 3AF2A 3X1ZA 4ARZB 3QIAA 2OSBA 3AVUA 4M1TA 3CUEF 3U7HB 1FZQA 3WY9A 4V0MA 5C1BA 1LY1A 1MABA 4RZXA 4Q9KA 1JEDA 1XTJA 5FPTA 4ZKDA 4B6EA 4GI7A 1GP2A 3U3OA 2FZ4A 4M53A 821PA 1ZU5A 4O0MA 4D25A 2CBZA 4RVCA 4DWJA 5TARA 4TYQA 2JEOA 4G5SA 2WMNB 3BORA 1E94E 3N5CA 4JLDA 5F9HA 2RCNA 2ZR7A 3I61A 1S2MA 4DLUA 2WPDD 4JKYA 4PPFA 3A37A 2H16A 2V1XA 3LBHA 4DLZA 4QJ3A 3CX6A 3VR5A 1UKYA 4OHVA 2W6ID 2AHOA 2C03A 1KNQA 3RNLA 3WMFA 4HUTA 2VHUA 4MRNA 4QJ4A 4A9AA 4ACBA 1HT1E 1ZAKA 4O25A 1YVDA 1SXJB 4KBFA 2GZHA 4LYAA 3PXGA 3W6OA 4ERNA 2KWIA 2R9VA 5FOTA 4E22A 1AKEA 2Z0MA 3CB4A 2VHQA 4JJZA 1NY5A 2R6DA 2VSOA 3Q72A 1F6BA 2P0EA 1E6CA 2G6BA 2A5FA 5DNYB 1JBKA 4A0RA 1W2GA 3NHAA 3THWB 4PAMA 2XB4A 1Z5ZA 2ECKA 5BN4A 2OFXA 1MRNA 3FMIA 4PX9A 5FI1B 4M9QA 5DI9A 4ASUA 2RGBA 4IEEA 4P4SA 2C96A 1MOZA 4MKGA 3RWOA 3OIWA 1R10A 1LNZA 1NSTA 2RGGA 4ZDIA 4BFYA 1SKYB 3KXKA 1DTSA 1XDBA 2BKUA 2QP3A 3R9IA 4I81A 1M2OB 4US1R 2BV3A 5KO2A 1BIFA 3P32A 1ZNZA 4OHXA 2A3RA 4M1YA 1FUUA 5CK5A 1KO7A 4Q4LA 4RZ3A 3TK1A 4JLMA 3RS4A 1KIMA 4PHFA 3T1OA 2P5SA 1E9FA 4KU4A 2J9RA 1KSHA 2OHFA 2D7DA 2ZYTX 2WJJA 3T5GA 3N70A 3EIEA 2YHSA 4GZLA 2OXRA 4Q00A 4Z51A 1G3UA 2P6NA 5KSZA 3L2OB 4U5XA 3L8ZA 1G9XA 2QAGC 1KI1A 1U0LA 4EIWA 2B92A 2EFHB 5EE5B 3VNUA 4XVRA 4GSYA 4DCTA 3JZMA 1OT3A 2P3SA 3QPUA 2HDNB 3I72A 3LY5A 2A7QA 3CRMA 2Q9CA 3CIOA 3BFKA 4NZYA 4F4JA 2ZS9A 2V1UA 2R44A 3BS4A 4YMSA 5SZHB 3RRZA 4TTQA 5KOYA 2GJKA 1TQDA 5AUPB 3A58B 4B35A 5BWMA 2HV8A 2QRNA 5EE3A 4KFTA 3G0HA 3B7GA 1X1RA 4LWZA 5J5CA 4DHEA 4L4UA 5ANRB 1Z0IA 4GOJA 1WF3A 2RGDA 1J70A 4LOAA 2D2EA 4FINA 3QQ5A 5F2EA 3K0CA 5E95A 3TAHA 1W44A 5JEEA 1IN5A 1IQPA 2YJTD 5FBQB 2WWYA 4XVUA 2PEYA 2REBA 4N3NA 1F2TB 1JPNA 3QPVA 4OYHA 1D2NA 2R62A 3HDTA 4DBLC 5AUNB 4URWR 3GLIB 1QHIA 2ANCA 5KNBA 3RABA 2JJ1D 3MCAA 4M2LA 1NVVQ 4PXAA 3KDSE 1CJTC 2KI5A 1TPZA 1WCV1 1NN5A 2XJ9A 4IXNA 3QXXA 4M1WA 1J90A 1T3LA 2GBLA 5FOWA 5CM8B 3DHWC 4HUQB 2OAQ1 4JLKA 2CLDX 3LXXA 1XTIA 2BVNA 2PLRA 5DISB 5IRCD 2KBEA 3P20A 4UNRA 1VYTA 2BCGY 4L16A 2GCOB 4A2QA 1FX0B 1XCPA 1OPXA 2CLCX 3U7EB 2WTUA 3FMPB 3KUCA 1ELOA 2CJWB 3ZZ0A 4D81A 2HT1A 4BASA 1JB1A 1P9NA 4WW0A 5CDFA 1M7BA 4LC1A 3U3RA 4AKIA 4JL6A 4Z1MD 2ZTSA 2R6AA 4C30A 5C2JB 1GAJA 5FTKA 1VCOA 5BW8A 4B32A 2CHVA 2G83A 2NZ8A 1GILA 3H1TA 2HXYA 2XZOA 2CVFA 1D8TA 1G8YA 4BLTA 1Z47A 4GPTA 1G3RA 2PCJA 4TQAA 5KTYA 1V5WA 1SVLA 3TLXA 3AVXA 1CR0A 5TB5A 4MYTA 1N6HA 4EQ6A 5JZVA 1GG2A 2PMDA 1QRAA 3QKTA 2H7VA 4EJSA 4MDFA 1W1WA 1C4OA 4DSNA 1D5CA 1PZNA 4MGZR 5KNDA 1U99A 4GOXA 1CLUA 4LV6A 3SE0A 1JAIA 1P7CA 4PR0A 2GA8A 3DDCA 5K8UA 4QGHA 3OHMA 5LDDC 3SZRA 1JR3D 4C0JA 5K8TA 3VKGA 5G40A 3I8XA 1KOFA 2ERXA 3I32A 3FMFA 1O3YA 1TU4A 2F55A 1SXJC 1RRCA 2ZRDA 2C95A 4PHTA 3QXCA 1R4AA 3BAFA 1T4GA 4JLBA 5JCZA 3VU9B 4S35A 4B47A 1CS4C 2HJVA 1VYVA 3QE0A 4LJ6A 3IUYA 3QG5A 5LB2A 4RSGA 5CJ2A 3L0SA 3SBEA 2RGNA 1MRSA 4GDFA 4FMDB 2EYQA 3BH0A 1AS3A 3GJ5A 5JI3E 1NIPA 2B6HA 3OFNA 1NMXA 3VU9A 4TLBA 5EUQB 1KK1A 3PITA 3AKYA 1G4AE 4Q7LA 1N5IA 2OE2A 4ZCIA 2IHBA 2FSGA 3KKMA 3I92A 5FI0B 5HTKA 3D6TB 5LB4A 1CJKC 3B9QA 3QY0A 1NF3A 4NYMR 3H2YA 1E3MA 3FHTA 5JLJA 5JCPA 4LJAA 4WZAE 1XF9A 2D06A 4QJ5A 5D3MB 4L8GA 1RYHA 4GFDA 5K8IA 1BS1A 2GAAA 1FX0A 4QGGA 4OI4A 4YLGA 3WYGA 2C99A 3ASZA 2GAOA 3K0FB 5EE1A 5JJLA 4QFMA 4B73A 4G1UC 1KJYA 2VQSA 1E2JA 4Q48A 1XD2B 3O8RA 3AGPA 2HXSA 2WJYA 3O8DA 2WJGA 1N0WA 1DAHA 2W2TA 3BERA 1OH8A 1FQKA 3CNLA 2RGXA 4KJZA 4Q47A 1Z06A 2FA9A 2G1JA 1A1VA 1NVVR 1Z6TA 2IS1A 4NBSA 2VEDA 1WMSA 2Q9BA 1P73A 1E2LA 1W4RA 5KDOA 4XD7A 1P3JA 1ZIOA 4Q1EA 1NJFA 2R6GA 3VMFA 4WA7A 1I4LD 4URUR 1IN6A 1U8YA 2ZJYA 3GFPA 1ZD9A 5FOUA 4LBWA 4D4KA 4PZYA 3J81k 1COWD 4K8OA 1XMIA 3HU1A 2EVWX 4C0LA 3E1SA 4PHGA 3EPJA 1N2CE 1KJZA 5FUWA 4FW9A 2WHXA 1C9KA 1Z0AA 2WOOA 1WDTA 4H1UA 1GNQA 2OZEA 4M22A 4QGFA 1W7AA 2GJ8A 5KYKA 2WSSA 2O8EA 4BEBA 3ONWA 2A5GA 1E9CA 4UNSA 4F93B 3R9XA 1ZC3A 1H8EA 3Q5EA 3RS7A 2X2EA 2WPDA 3F0TA 3NDPA 4Q4JB 4AYWA 3K70C 3W9YA 1Z0KA 2O8DB 1TQ6A 2CE2X 1G20E 2KBFA 4OQFA 5EE0A 2G3YA 1HV8A 2QMEA 4HAVA 4HAXA 4OHYA 4FD2A 2P6UA 1G7TA 3B6EA 1VG9B 3HPQA 3IBGA 3LAWA 4G01B 1IHUA 4G0NA 2N46A 1M7HA 1ZBDA 1IY2A 4WAUA 4AC9A 1R5OA 3F5FA 1A7JA 1E9BA 5KUTA 4QOSA 2F6RA 2MSCB 1G7CA 2BIFA 2BM0A 2ODBA 2XTNA 5DI3A 5B2ZA 4KAXA 2HLDD 2FX3A 4IOMA 4JYBA 3UWKA 2XOKD 2O8FA 1QBKC 3ADCA 3CBQA 2GXQA 1FMJA 4M1OA 4BZPA 1Z6AA 4QBHA 1QHNA 1UBGA 1B0UA 2ZVPX 3CO5A 2RKOA 3LRPA 2ZEJA 3BFVA 4BFZA 1R0YA 4QHSA 4XIGS 3TUIC 1LFDB 5JSZA 1IAQA 2FFBA 2QUZA 4QNMA 3T15A 2O0JA 1RKBA 2OILA 4Q9JA 2J3EA 1EX6A 1GKUB 2CJWA 4DUGD 1NN0A 2ZYVX 2OCPA 4DSUA 3TH5A 3B9PA 3K70D 1Z2AA 2V4ZA 3QJYA 4EKDA 5KPDA 3MWLA 3E70C 3WMGA 3CF6R 2PT7A 4DLWA 4PO8A 1XWIA 4EPXA 3MWKA 3SFVA 2PH1A 2OFWA 5FTMA 2VP5A 3EZ7A 3T1VA 5JWRA 1CR4A 3R9WA 3LBNA 2A5JA 2CCGA 4UXIA 4FWIB 1E2QA 2JAQA 5AJVB 3RC3A 2GEUA 1Z6GA 1WP9A 3B82A 1P75A 4RD2A 3QSYA 4YMTA 1OYWA 2JLWA 4E03A 1ZP6A 1Q3TA 4DEYA 1M6NA 4Z54A 1RRPA 4AK9A 4KO8A 3Q7PA 5K8LA 2IHYA 2VO1A 1NRJB 1J8MF 4X8HA 3U44B 2C9OA 1E2IA 3TIFA 2WSSD 3EA0A 2REOA 3GFTA 2J7KA 5DN6D 3QKRA 1JJVA 1I4DD 1ESMA 4MGIR 3CX7A 2G0NA 1LW7A 2G0TA 4P4TA 1G64A 2AXNA 3EWAA 3FGNA 3AF3A 5KSOA 5GADl 1JI0A 2NOAA 4FXPA 4XSHA 2R6CA 1W48A 1KI8A 1X8JA 2QMOA 1VCIA 1G7SA 2C78A 2FU5C 2ZI4A 2X19A 4EPYA 3B5JA 3NIBA 2BBTA 2O8CB 2BMEA 2MMCA 2QN6A 4URYR 1OIXA 4POAA 1SULA 4AIIA 2WICA 3TUZC 5CITA 1WBBA 1DG3A 4CEJB 1YR8A 2ZAOA 2IT1A 4WIAA 2QENA 1EK0A 3ZD6A 2NGRA 4D80A 4MKHA 2BMFA 3QBVA 1VG1A 3HU3A 1AQUA 1E99A 2WOJA 3ZS9A 2VYFA 1OB2A 1A5TA 1TEVA 5H8WA 1AJEA 1K8RA 1TADA 4D4LA 3C5HA 5TXGA 1ZM9A 4I1VA 4P31A 2GNOA 2VIIA 1US8B 1NMYA 1BH2A 1KI7A 2WKRA 4Q01A 3SC3A 4M1MA 4CW7A 2VLIA 2ZANA 3QG1A 1KI9A 5GJBA 1NLYA 2ZJAA 3UG6A 1QHYA 1M34E 1W4CA 1SVOA 2QI9C 4HAYA 2E87A 2ERYA 4BLPA 1LVGA 2BJVA 2R65A 4DIEA 1WA5A 3AM1A 2GBLC 1MR3F 2ZUCA 4TMTA 4BQSA 4NL4H 2VP0A 3DL0A 2O8BA 3KKNA 1Q0UA 3AF0A 5FUVA 2OXCA 4JT2A 2PCLA 4KBGA 4BLRA 5AJXA 2BCJQ 3BH7A 1XPRA 2NMVA 2FSFA 3VR4A 1ZNWA 2ORWA 2QQEA 3GMTA 2IEYA 4LHYA 4XTCS 2J87A 2VHCA 4X8MA 5TVKA 3EA5A 5DYGA 2W2VA 4D4JA 3SU8A 1R0XA 3GJ6A 4BZXA 2W58A 2QORA 4X8OA 4LBVA 1FP7A 4QM7A 1GSIA 2AD1A 5IK2A 2BOVA 2O8BB 5IHPA 4CF7A 4LC0A 3RWMB 1SKYE 1KDRA 4TZ0A 4RD4A 5HCIA 1N6RA 2HEIA 5CM9C 3ZD7A 5EJEA 5KPJA 3D7MA 5E7IA 4MKIA 4R2HA 4CIDA 3EPLA 1DO2A 1F60A 2Z4RA 3MG9A 3QPWA 4XD7D 2W83A 1WRBA 4F4CA 3UWOA 1RJ9B 2PJRA 3H0KA 4QM6A 5FPSA 3SQWA 1II0A 1MT0A 3RS0A 5B30A 3RAPR 3AGQA 4A0GA 1E2HA 1GRRA 3SNHA 4PANA 3UMRA 2J7PA 3HP1A 1KGDA 3P4YA 1RC8A 3CR8A 2VHJA 1Z08A 2ZUBA 1XXHE 1GWNA 3SJCA 1V43A 1X86B 3OEED 2DPXA 2FWRA 4M21A 1P5ZB 2DWQA 2WAXA 2ZI5A 5JFGA 4EPRA 5GVSA 5E7MA 4B3XA 4BLQA 3CPHA 2RGAA 4RFSB 1EGAA 4KSBA 2G88A 1L4UA 2W2XA 4IDHA 3VR1A 4PAQA 1R8QA 2OLKA 5FBWB 4R98A 2F3RA 1KHTA 2OCBA 2RGNC 2X1VA 3IGFA 1GL7A 2XITA 1YR7A 1VPLA 1Z6YA 5FOXA 1O87A 3IDQA 5C46F 2IUTA 1U0JA 5FPKA 4P4SB 3LVRE 2IUUA 2YOGA 2GF9A 2W6IA 4IFEA 4RD6A 3GLHA 4KI0A 4AKEA 4O2RA 3DOEA 1CKEA 4HLDA 1S3SA 4QBIA 3Q85A 4LYFA 3PVSA 3O8CA 3RYTC 1U90A 1OKKD 5EUMA 2BDTA 5GVRA 4JS0A 2WJIA 3KJGA 4TTRA 3RDPA 5A4JA 2CNWD 1S3GA 2QEQA 1WBDA 1CXZA 1TUEA 4TYNA 1Z0JA 1E0AA 1UBFA 3LLUA 4WZ6A 1RE0A 5JHHB 1J7KA 3GCGA 4D0GA 1CRQA 3QXHA 1DEKA 1H8ED 2GKSA 3IQXA 1UKEA 4HAZA 1GOTA 1PUIA 2Q9AA 2H8KA 1Q3HA 2FGJA 3A1SA 5EXPA 1VMAA 4MUBA 3D8BA 1QDEA 1AM4D 3GQBA 4HLUC 4I1OA 4NE2A 1JEEA 2I4IA 3U44A 4V02A 4LHWA 1I2DA 4NCKA 2N42A 2CCJA 2R6FA 2ZITA 5BN5A 1YZQA 1NN3A 1E1QA 5JEDA 3EC1A 1NL3A 4B44A 4CZ2A 4TMZA 1YQTA 2AR7A 2ZRIA 2ZJOA 1Q1BA 3GEIA 4BRWA 4DCNA 1U9IA 2ZRMA 4IDPA 4IHQA 2IYRA 2F7SA 1T91A 4L15A 2E9SA 2QT1A 1TMKA 1KI2A 2YWFA 3ETLA 4U7DA 3SI7A 2Q0HA 1A2BA 5EP3A 1KAOA 3FTQA 3CWQA 1SQ5A 1G3MA 1E0SA 3CF0A 3WBKA 3GJ7A 3QF4A 3N2EA 4PTLA 3KKQA 5BYJA 3W90A 1A2KC 1XCMA 1E0JA 3W3AA 5DIFA 4NHOA 3RRNA 1D9ZA 1MV5A 2IXGA 5J4HA 3DPUA 1EFCA 1OSNA 2WSMA 2IYUA 3KKPA 3LXRA 3FVQA 1TQ4A 5HKKA 1RW4A 1ZM7A 2EW1A 1CF4A 3AUYA 2JLRA 2O5VA 3WYFA 3ZLJA 1CULC 2JGNA 1VTKA 2NPFA 3FKSD 3QNUA 4GP6A 4XSGA 3AKCA 1W0KD 1R2QA 5E7JA 2IXEA 4OK3A 2QPOA 4KVAA 4P4UA 1SXJE 1X3SA 4LV8B 1X8KA 2P2LA 4Q66C 2F1JA 3OIVA 3SHWA 2V9PA 2J0VA 4EPTA 3FFBA 2QU8A 2ZSEA 5CLLA 3U6KA 2GZAA 3I62A 4NMMA 2FSIA 1WXQA 4LPKA 3FHCB 4Z8XA 2ZSDA 4GMXA 3SYNA 2B7BA 4F7WA 2GJSA 1OH6A 2JLVA 4URXR 2ZQ5A 3OE7A 4LDJA 2IWHA 621PA 1XEWY 3TMKA 4DT1B 4V0KA 3GJ8A 4TSFD 2VPPA 2YKGA 1QG4A 2GCPA 3T34A 3O47A 1G4UR 4LHVA 2E1RA 3B85A 3IKJA 2XZLA 5LD2B 3BB1A 1QHGA 1ODFA 4TYWA 4JBXA 2ZM5A 5CYOA 3CPEA 3THYB 2ZRNA 5CIQA 5IF9A 4GT1A 2IYWA 1KI3A 2XEXA 3L8YA 4OQNA 5AUOB 1R6BX 1Z6XA 4W7SA 1P6XA 1KSJA 2YINC 1FL9A 2VF7A 1G16A 1KYIA 2IUSA 4KFSA 3VAAA 2YWGA 1ZUHA 3A36A 4HLUA 5J4YA 1NLZA 1Q21A 5FL7D 4RY2A 4TL8A 3MSXA 1TEXA 3QVUA 1E1QD 1CR2A 3I73A 2Y8EA 1HURA 4GOKA 3PUYA 3X1DA 4IXMA 3IO3A 4FMCB 4AURA 3BE4A 3DZDA 4IDNA 3KJHA 1S96A 4EFLA 1KKLA 2YOFA 1Z22A 2BEJA 1KDPA 1N6OA 4A8JB 3M4YA 4P3YA 5EXTA 4BGDA 4RKEA 1E79A 1OFTA 4FN5A 1QHHA 4M1SA 2JA1A 3N2IA 1FW6A 1LF0A 2ZJ8A 3GLFA 1EFRA 3NTUA 4DZZA 2CEAA 2ZYUX 1Q44A 3K9LA 4U00A 2WWGA 1GTVA 2QL6A 2WKQA 2GEVA 5J4KA 1NG9A 4Q18A 4Q4AB 3MD0A 3K1JA 3EZ9A 1S9DA 3X2SA 1IJEA 4PC3A 1GKIA 2ZAMA 3K53A 3GJ0A 2ZRAA 4RZ2A 4J0QA 1E9AA 2AKYA 2G9NA 3ZH9B 2GVDC 2QM8A 2QP9X 3PJRA 2Z43A 3TBKA 5KDDA 1Y3AA 5HCNA 4OK6A 1E9RA 3PV0A 2JLUA 4A15A 3SDZA 3A1UA 4ZPXA 3EZFA 1OFUX 4FI3C 1M1YE 2YWHA 4R2IA 1XEWX 2ZVQX 1X8LA 4TLCA 1W36C 5CB8A 1AGRA 1W0JD 2EFCB 1U81A 4JLPA 2WBLC 3U61B 2ZRPA 3A4NA 1PUJA 1G5TA 4K81B 5LD2C 3K09C 5FBRB 3P4XA 1Z0DA 1YR6A 4LK2A 3DKVA 1R0WA 1K5GA 2BEKA 4CYMA 5G3YA 2Q3MA 4NCIA 3B60A 1T3SA 2IF0A 4A2WA 2V54A 1NNEA 1CJUC 1JAHA 2JJ2A 1KDTA 2CK3D 2QMUA 2PBRA 5CB6A 3HPRA 3ZS8A 2JDIA 1T8TA 1KMHA 1DG1G 3LFUA 4R9UC 2HF8A 4ZI3A 3AP3A 5G53C 1E1RA 4DRZA 2ZRBA 1N6LA 3EIHA 4LRWA 3Q5DA 4C0BA 1ANKA 2J0UB 4A82A 4LHZA 2HLDA 3R7WB 4HEJA 4C3ZA 2OBLA 1SVWA 2ASEA 4XOIA 3AVWA 3TKLA 2J7PD 2W6JD 2ZROA 2NO6A 4MDEA 4DLTA 3W3ZB 2GTPA 1RRGA 1CR1A 2UKDA 1L2TA 3AVOA 4QHYA 2RB4A 2O8EB 3EG5A 4NYIR 2AX4A 4HLCA 2IYLD 1EFHA 1IM2A 1ZVQA 1B23P 1DE0A 4BUJA 1D9XA 2JLSA 4OQXA 5JI2E 3SJAA 2GXAA 1Y63A 1BO6A 2BBWA 1YZUA 2LCFA 3ZGXA 3T61A 2HJGA 2WAYA 2Z6VA 3NC0C 1SVIA 3A6PC 1KK0A 4JSTA 4TMXA 4US0R 4YONB 4DLYA 2J0QA 2BWJA 4JBYA 4URZR 1R5BA 1QZXA 2IYSA 1CRPA 3QVVA 5JJKA 3SFZA 3SN6A 2QY9A 2FH5B 3E2IA 3K0EA 1NVUQ 4PQYA 3K0AA 2XTZA 2W0MA 2XNDD 1LV7A 1GUAA 3QXSA 2OAP1 2VRWA 2ATVA 4Q03A 4I99A 4IOKA 3JVUA 1L8QA 1TTTA 3B2EA 2BBOA 2OCAA 3I8SA 3NVAA 1CJMA 1JR3A 3ADDA 4FCVA 1L7VC 2FOLA 1VIAA 1XJCA 4EJSB 3SOPA 4KFRA 2XSZA 4QNRA 3WHKA 1BOFA 1OJLA 2OG2A 1BKDR 3QOFA 3RRYA 2GVZC 2XX3A 4OL0A 4H1VA 2OO7A 4OBEA 5JHGB 4Q4HB 2WWIA 3KX2A 5DN6A 1Q12A 2YVUA 4B3GA 2QSZA 3CRW1 3IIMA 1MO3A 3K0AB 4M9SA 5A0FA 1DAEA 4UNQA 5FR1A 1E9DA 4NDZA 4D0LB 3T1QA 3TR5A 3I4LA 4A4DA 4B3CA 2ZSFA 1E2PA 2NO1A 3CRQA 3V4RA 3ZIAA 1N5LA 3W6NA 1NN1A 1PLJA 1OFIA 4OJKA 2DCUA 1P62B 1MO6A 4TQUS 1TF5A 4G5QA 2MSEB 2ZJ5A 1YHNA 3SEAA 2PX3A 4QC2A 3UKDA 3M1IA 4A8JA 1N6PA 1ZU4A 2QAJA 4ESHA 3MJRA 5L3SB 4TTPA 1NBMA 1P2TA 1NVXQ 1EXMA 2FG5A 2CHQA 1Z83A 1DBSA 1E96A 5DSZA 2FV8A 4OQLA 4NKRA 2NZJA 2ZJ2A 1G1MA 1XRJA 2J45A 1G3IA 4DC9A 1F48A 1P4SA 2NO9A 1UF9A 4A6XA 5AK0A 3CPJB 3IBYA 5CYPA 5JS7A 4V0ME 5L3QA 4HB2A 4MA4A 5G3ZA 3RC8A 4C7OB 1OB5A 1D2MA 3B1WA 1J8YF 5TY0A 2BMJA 1XD2A 2ZI6A 1U98A 1HE8B 1C1YA 3EPKA 2P6RA 1E4YA 1ZW6A 2DWPA 1KK3A 2WWWA 3OESA 2OUKA 3NBFA 4TT3A 2SHKA 3ZIAD 3WNDA 2GCNA 2ZRFA 1UEJA 5HPYB 2EFDB 4FWTA 4UJ5A 1E9SA 3CNNA 4ZIRA 3GEEA 3MWJA 4Q9IA 4MKFA 1NJGA 1W0KA 3PEWA 3SQXA 4CEHA 1II9A 4YMUA 2X77A 1TX4B 3U3MA 3FKQA 3HYTA 1OE0A 4BLOA 2Q6TA 3WMEA 3A1WA 4ZCMA 1AN0A 3EIQA 4MQBA 4UXJA 1IXZA 1KJWA 2VSFA 2ZRCA 2FNAA 3B78A 5FTJA 4BFXA 4R7ZA 3SJZA 1GKYA 3M0EA 3RLFA 2FPKA 4RFSA 3RSOA 1FNMA 4Q7MB 1SVSA 3KFVA 2V8OA 4XWKA 1MKYA 1VG0B 3EZ6A 3QUSA 4KSCA 4LJYA 4LJ5A 1ZRHA 3NH6A 1OF1A 3AVQA 1PVOA 1G19A 2ZRGA 3B1VA 4N0EA 4TZ6A 1XNJA 2ZIAA 3NBXX 4C4PA 2PX0A 4DSTA 3NHBA 4DLXA 3CNOA 4ZDKA 1XD8A 4JLJA 3ZVNA 2Q21A 4MYUA 1II8A 2XOKA 2A5YB 4BZQA 3AVYA 1DAFA 3K0FA 3FFAA 1KZ7B 1GNRA 5DGXA 4L5BA 3C41J 4PC7A 3FB4A 5CK4A 3C4JA 2HCBA 4MITA 3HJNA 3THWA 1UAAA 4E5UA 1TUIA 3LDAA 3E5HA 2FGKA 2ODEA 3LD9A 3PENA 4HDQB 1XTQA 4MH0R 4DUGA 2GXSA 2YOHA 1PLKA 2ZUDA 5AJYA 4A8JC 1E79D 2XNSA 2A2ZA 3W5IA 1KO4A 4G3XA 1R8SA 1VYUA 2KE5A 2FPMA 3QBTA 1G291 3EWSA 4C9BA 1XPOA 1KO5A 3RANA 2ZU0C 3Q7QA 1Z0FA 3ZDQA 1T0JB 4IKEA 4B76A 4TL9A 1RVDA 3L0PA 1BYIA 1UKVY 4HDCA 2J59A 4LJ7A 4OI0A 1EWQA 2ZE7A 3TUJC 3TR0A 2HCJB 3RHFA 4ZIRB 3ZJYA 1OKKA 221PA 3I5YA 5JBQA 1EFUA 2DBYA 3CX8A 4UNPA 1YR9A 4EPWA 5EE9A 4DEXA 3IEUA 3VR6A 1G8GA 4V03A 4US2R 1VKJA 1E69A 1Q1ZA 2NG1A 5DH9A 4PPNA 3NH9A 3PEUA 2ZETA 4Q1BA 4QBFA 4A0FA 4GZMA 2Z83A 4C0SA 2VL7A 1UDWA 2F1RA 4JBWA 5CLQA 4IOJA 2QROA 2YYZA 3QF7A 3W6PA 3LQQA 1XEXA 4LX0A 4LPSA 4YMWA 1LF5A 3VKWA 3Q8XB 4DCVA 1N3BA 4LSGA 4RFVA 3VKHA 2WJVA 1X6VA 5G41A 2CK3A 1E2DA 2B8TA 1XTKA 3AKDA 3RS3A 1YKSA 2ONKA 2QAGA 3IIKA 3P27A 1OHHD 2I1VB 3S1AA 1E1RD 2GETA 3BRWD 4Q19A 5FTLA 1TL7C 4DJTA 3VX4A 2AL7A 2IS6A 2GDJA 1DARA 2N1BA 2J46A 3OEHA 2JIZD 2GRJA 3F8TA 4C0HA 2FEMA 4E09A 1RYFA 2FF7A 2ZE6A 1SHKA 3CWZA 1CEEA 4Q4HA 4IFBA 5ELXA 1TU3A 3CM0A 4LHXA 1NBME 1P60A 3SS8A 1G6OA 4EDHA 3KB1A 1XMJA 2BBSA 2ZS7A 4M4SA 2PL3A 1G6HA 3OIUA 1ZUNB 3WNBA 2XB2A 4ILEA 2GZDA 5F3WB 2P67A 4B71A 1F2UB 5AJWA 1G21E 3BBPA 1PV4A 2ZU6A 1H65A 2ZJZA 2K5UA 1W2HA 2BKEA 1TAGA 2FPLA 3PQCA 4ZDWA 4BWYA 1P2SA 1YU9A 4CVNA 5L3VA 2A5DA 4NYMQ 3RSLA 4RKFA 4PC1A 1UM8A 2PLFA 3KKOA 4NYIQ 3TVTA 4LV5B 2V7QA 1U8AA 2AKAB 4YQFA 4G5RA 2VF8A 5B57C 3ADBA 2XXAA 2IYZA 1RIFA 2CL7X 4LJ8A 2IWRA 3DEFA 1IOZA 5DLQC 2JIZA 4PO1A 2IS4A 2FJUA 1KO1A 3DMNA 2XJ4A 3NG1A 4XWOA 2R8RA 5J4LA 1SVKA 1JECA 1IXSB 1TF7A 4B2PA 3MLEA 2IX3A 3DM5A 1IY1A 1Z3IX 4QXAA 3UIEA 4DB4A 3BB3A 3CZQA 1KI6A 3U3JA 1EWRA 2WWHA 4URVR 5BXQC 3U6BA 4B2IA 4HI0E 4II7A 1E0KA 3R8FA 2UVQA 1KNXA 1M8PA 4JZKA 1D2EA 1PLLA 5TDHA 1N5KA 4HB0A 1T8UA 5DE3A 4AD8A 5JRJA 2O0HA 4ARZA 3LBIA 721PA 5HZHA 4K46A 2A30A 1MO4A 3TNFA 4F4IA 3MGCA 1NMZA 4Q1CA 1YZGA 2QMHA 2FN4A 1VHLA 3LVQE 5B58C 4ZDJA 1VDZA 2QP4A 3O8BA 3AVTA 2AD5A 4Y0AA 1YJ5A 3GJXC 2IYVA 4AKHA 3DMDA 1GNPA 1ZD8A 2V6IA 1G18A 3V00A 1E4VA 3PUWA 1XU4A 5DI3B 3QKSA 4DXAA 1Q1QA 2QQ0A 4AYTA 3K0SA 1JPJA 3EXAA 4OHZA 1U8ZA 1W36D 5CIWA 3CRVA 4LY6A 5AJZA 1P72A 3ZZTA 1RJ9A 1ZC4A 3LW7A 1Z2CA 2VBCA 4DKXA 5DHFA 3X1WA 2IYQA 1T5LA 1UBCA 3TAUA 4WOPA 3F3YA 4OJQA 5L8VA 4CT4B 1G5RA 1U94A 1SXJD 4JLNA 5TV2A 2J0SA 1ZM4A 2JASA 3PIRA 4HZUB 2ODNA 4Q9HA 3KTAA 2IYXA 3TGPA 4PQRA 2C04A 2A78A 5M04A 2EU8A 4JVMA 4AY2A 4PC6A 4PSVA 1IBRA 1UFQA 2JJ1A 2VA8A 4LJ9A 1VCNA 3GFOA 4KFUA 3U4QA 2PT5A 4JJKA 3VNVA 2CNWA 2O52A 4FIDA 1XB2A 2QBYB 3U5ZB 2VP2A 3NEJA 1KY2A 2W0SA 4HZUA 4N0DA 4MYCA 1GL6A 4LCBA 4WBSA 4QHTA 2LWIA 3ZQ6A 1W5SA 4CRWB 4JLVA 1G7RA 4GBMA 2FSHA 5GJCA 1Z63A 2IXFA 2ZS8A 3FPAA 4ZV4A 2F3TA 4Q7KA 1XFAA 1DAGA 2WIBA 2YV5A 1FMLA 1ZJ6A 1GVNB 3AUXA 3KZ1E 5H70A 3RRMA 3THOA 2HYDA 4DDVA 4UKDA 2YC4C 5DO9A 4F91B 3KQLA 2QTFA 1JXOA 4RD3A 2ATXA 3ZZUA 1XEXB 3H84A 4OQMA 3FHOA 4YC7A 4MRVA 4JLOA 6Q21A 2OESA 1ZCAA 3HWSA 4ACAA 1JXMA 3I3SR 4W9MC 4D26A 3VX3A 3B13B 5L3RA 1QHHB 2V6JA 4HATA 5TMPA 2HYIC 1RZ3A 1XPUA 1UKZA 3ZVRA 4BEJA 1P2UA 4NH0A 3B8HA 2PMKA 2ZRHA 1HTWA 3PFIA 3R7WA 4EAQA 4CEIB 3AF4A 1KTVA 5SZKB 2RHDA 3ASYA 2RGCA 1OW3B 1AA9A 4A1FA 1AZTA 3QEJA 2CDNA 4EFNA 2X2FA 2YWEA 2GWHA 1ZM3A 3BWDD 4QRHA 1XZPA 3GLHE 4IVQA 4IDQA 2RAPA 1HT2E 2HF9A 4Q1FA 4UNNA 1KKMA 4G5GA 1FOEB 4LYJA 1FUKA 1NLFA 4JL8A 1Z29A 3ECCA 4C0QC 1FP6A 521PA 2O8DA 1S8FA 3PEVA 3Q9LA 3KJEA 3SBDA 3HR7A 2WZQA 3OZXA 3HR8A 4HYYA 3K0CC 2D2FA 1F3OA 1P9RA 1JR6A 3CKLA 3M6AA 4JMPA 2ZSBA 3FMOB 1T0HB 4YDHB 4PC2A 2RGEA 4H9GA 4LBZA 4NCNA 1OH7A 3PR1A 421PA 5FBLB 1K5DA 5AUQA 2L0XA 1W5TA 1G8FA 2C77A 2WWFA 3BD9A 1AKYA 3A8TA 3NWJA 1S1CA 5EXXA 5F98A 4XWAA 1UADA 2DFLA 2IK8A 3W34A 2QBYA 2CL0X 4A36A 1WQ1R 1CJVC 3ADKA 3UK6A 4ESVA 3REFA 1II8B 5LPNA 1KSGA 3OE7D 1UPTA 1XXHB 1DAKA
chains in the Genus database with same CATH superfamily
5CCDA 2EKLA 1LJ8A 1F2VA 3LWNA 3F4LA 4KXQA 1TK9A 2QAGB 5LBIA 4RD1A 3T35A 2FG7C 1PT7A 1LS1A 3IBTA 2NT3A 4TL7A 2F9LA 2WHEA 2LPMA 2W2KB 4L5AA 3KCQA 3NYIA 4G0XA 3U0VA 4CM8B 4UUPA 5JV5A 1HKHA 4QYIB 4CF4A 3LYAA 4RJIA 3JYHA 2KSQA 5AQEA 4CBVA 2NUTB 4WH0A 2XQGA 1WQ3A 4NATA 3RIMA 3ISVA 4YJ2A 2R1VA 1Z45A 2W8BB 2WP8J 3FVRA 1F7UA 2AJLI 2DTEA 3PX7A 1N8SA 2GO7A 1Z8FA 2P9BA 2OO5A 1HE4A 5KOHA 1I7DA 4NY1A 3BTVA 5EZQA 3AUJB 3ENVA 1PT5A 5IT5A 3OA0A 4V0OA 2E6KA 1MXHA 2WTNA 3KXLA 1UC5B 3G0DA 4C05A 4OV6B 3IRUA 5L51A 1EGVB 3DT6A 3SQNA 1PS9A 4J3JA 3GBPA 1D6NA 3BDVA 4BNYA 5JAOA 1J8DA 3LGAA 3WYNA 1DBQA 3PQDA 4C7VA 2ORVA 1A82A 4A92A 1RDFA 3EMDA 3LUAA 2ZUUA 4EHDA 1VGVA 4YDQA 1ZR4A 1U1IA 4MV6A 2BH9A 1QYDA 4Q7JB 5IC5A 3BILA 2ORYA 3ZV5A 1COZA 3CTMA 4YRFA 1E2UA 2EWWA 1AXRA 3OCCA 4YJ3F 1QO7A 2XCLA 3AINA 1QYRA 1KL7A 4L8VA 3GJ4A 4RH3A 3C5CA 1OHHA 4HDKB 3GLGB 3ZI4A 1TYAE 3CW2A 2YWCA 1VKRA 4QU8A 2O6LA 4QWWA 4R1UA 4EVQA 3TSWA 1ONBA 2QG6A 2YHIB 2QTGA 4R69A 4NLLA 4DMCA 1DC5A 3LNCA 3EXEA 3PPYA 3PGLA 2Q6IA 2BUCA 2FMHA 3I52A 3HB9A 3L4BC 5SYAA 5CGZA 1ZRSA 3M6UA 2F1HA 5JD5A 4TLMB 2DFVA 4WVFA 1XVUA 4PFJA 1O96A 4TT8A 2FOXA 2WJ4A 2PKEA 4TUYA 3P45A 2BMDA 3H5OA 5KVAA 5KNLA 4BNMA 4CLEA 4DJFC 4WXRA 5KQMA 1YL6A 1JFVA 5DNAA 2NZUG 5BSKA 2RGRA 4DB2A 2KS6A 5ADHA 4G9GA 3CH6A 3GARA 1I5EA 1JSZA 3JPYA 1DOHA 1MA3A 1XLUA 1NT2A 3ZWCA 1MMFB 4EUKA 1L5ZA 1UPBA 4ZVVA 1SB9A 4KR0A 3WRXA 1SD1A 3G79A 3EPPA 3Q40A 1ND5A 1HYGA 1YS9A 4CQMD 3P9NA 5CVCA 3RVRA 2JFOA 1ZS9A 2C9BA 3O4VA 1T1RA 3DTVB 3OIYA 5H68A 4U6QA 1TA0A 2R2GA 4X1KA 2AZ4A 1E3SA 4OFZA 4U7FA 3ZLTA 5JO0A 3J81A 4MEAA 1M8FA 3TO5A 4XM1A 1SUDA 3MHPA 3OHPA 1YA8A 3P2JA 1PBTA 4F3CA 1YBFA 3RWBA 4GZ3A 1QV6A 1ZCJA 3G8DA 5DGIA 1KEEB 4KMRA 2FR0A 3OM0A 1ZH0A 4AJ9A 1G1AA 1NVMB 1CS0A 1M2OA 2I3DA 5DYIA 3WL7A 4B48A 4ETMA 3U16A 3PQ7A 2V0NA 4ALJA 1BDHA 1ODKA 1H6AA 3AESA 3K9NA 3OY7A 2H59A 3R20A 4UM8B 5HG0A 4I7EA 5FHQA 2F3PA 4BFLA 2FLVA 1ABFA 1DVRA 4INPA 3H86A 1LPBB 2H1HA 3N0XA 3EZGA 1T9AA 3T1TA 2D59A 1QAOA 2CLKB 4MX8A 5A2QA 3MBKA 3OFND 3W2FA 2ZE8A 4ER6A 4C0QC 2C7PA 1YFKA 2I1QA 1T29A 2AZXA 4TYYA 2BH2A 4KKVA 4C6SA 3L0DA 1AT1A 1E5QA 1JU3A 1LDMA 1ZH2A 1EK5A 2AFIE 3FE2A 4FBLA 4YAEA 2ZWMA 3SBXA 1ITZA 1SZDA 2CHFA 3NC1C 4HAWA 5HP4A 4WK4B 5EQDA 1BWRA 4BNVA 4Q7QA 4DVJA 3R6GA 3VR3A 3IAAA 3IDFA 2XI4A 2IE8A 1UPCA 2CJFA 2D1RA 4H17A 5GOTA 5A5GA 1ACLA 2RFLA 4JQSA 4KODA 1AHPA 5B4UA 4ABTA 1UL1X 4CM1A 4YASA 2KB0A 3AESB 1GZVA 4DVGA 1CYDA 1NOKA 4JL5A 4TQGA 4MB6A 4QDZA 5CX1A 3FSGA 5AICA 3ISJA 1JSXA 1NY6A 2GYWA 4FE3A 4HOYA 3TVDA 3CVOA 5HBGA 1T9HA 2EFGA 3LS2A 2QN1A 4FZVA 3MMZA 4MRRA 1Y7LA 3BXZA 3T7IA 5ERXA 3T8YA 4ZVSA 2DQYA 2WF7A 1W46A 4HUTA 1PW5A 1NXWA 2NO7A 5EWJA 2FHSA 1D4FA 4TSFA 3CC8A 4PHHA 4N8DA 3H6HA 3U4HA 3ELUA 5DP2A 1SXJA 3EGIA 3UJBA 1OYYA 2OBFA 3U3ZA 3WV5A 1MU0A 4I1UA 4MR7A 4W8HA 1NV8A 3C45A 3OE1A 2UZIR 2O2ZA 3LO8A 2YASA 2GEDA 8ABPA 4MKXA 4A6PA 1BSVA 1F1JA 3FCUB 2XGSA 4ZJPA 2D54A 3HU2A 1C9JA 1LB1B 2Y99A 4M8LA 3VYUB 1UH5A 2HWKA 3BTOA 3ZCVA 4J0DA 1IK4A 3N07A 4IRUB 1SCUB 1O9HA 3MMPA 3MRVA 4UULA 4CNBA 1G20B 5JSQA 3GJ3A 3C8UA 1U1CA 1JHMA 4MVCA 5FQOA 1JKJB 3H4TA 4CKWA 1GTG1 5A1JA 4PWZA 3BX1A 2XQJA 4QKQA 4S1TA 3WLTA 1GCGA 2HXGA 5FV7A 2O8FB 5C8ZA 1NVAA 2W43A 4JFAA 2XZDA 3F2VA 4TWRA 3AKEA 2FRXA 3WRWA 4FHDA 4EATA 4OHMA 5J5VA 2ZG6A 2QRZA 5LQSA 1M8GA 2XRYA 1NBHA 5CLIA 7YASA 2P90A 3BE6A 3VVBA 1GDDA 4IIHA 2XCOA 2WUVA 1X1DA 1KYZA 5AK5A 5IASA 1ZXLA 3TRKA 4P3XA 1XCLA 2GCOA 5HQTA 3PSHA 3P5SA 4M8NE 3WQSB 2R2AA 3JARB 4ZTUB 2V97A 3ZY5A 1ZJYA 3K2BA 3DDNA 1Z5GA 1B7GO 3GZNA 4MWBA 3CRNA 3FWHA 3TZBA 5K20A 3REQA 2NPIA 1WUIS 3GDOA 1E32A 4KVGA 4H15A 4QXQA 1UBUS 3OEHD 1JILA 4YCBA 3TW8A 1J99A 2GK7A 3RVMA 4A7PA 4HB3A 3EDRA 3VR2A 2OGSA 1BU5A 2B7CA 3ZWKA 5LQKA 1E0DA 4JP8A 1T4MA 3KL4A 1Z0UA 4P7FA 1FUIA 3EW9A 2H9IA 2H63A 1Y98A 3A04A 4L8FA 3KL2A 3CZPA 4L75A 1E2GA 4X44A 5IVDA 4X85A 1HRDA 1ZM2A 4HGPA 4JKOA 1MJNA 1M83A 4OI2A 4UARA 4YJ3B 1E5VA 4RADA 5E1MA 5LZ4A 1Q19A 1E77A 1W0JA 2R4UA 1I4OA 1W85A 5BN3A 1W5BA 2J5XA 4MS1B 4BL5A 3WNVA 2MYNA 5BY2A 4L9SA 3CVJA 3MW8A 1HKUA 1DAMA 3VGJA 2XUHA 4BO8A 3D5TA 3OZFA 2Z8YM 3GZNB 3WLLA 3EAFA 5F7JA 3K8YA 2OFOA 4G0WA 1NRIA 3WIDA 1BX1A 4H60A 4E30A 2ST1A 1ZX1A 1Z2PX 4FLEA 5BSHA 2ZB4A 4ITRC 4AG5A 1YQGA 3D3EA 5FV4A 3B1JA 5AKHA 5TNXA 3FWKA 3O7MA 4FR2A 1I01A 4C5BA 3K9FC 1QCCA 3CV3A 4FYJA 4WK6A 4NCHA 3UCEA 3FMVA 2XT6A 3Q3VA 1N0UA 3GLTA 4KXFB 3CB2A 4B3FX 2QUKA 3D4NA 4B09A 2FFQA 1E98A 1OXMA 1QO0A 2AEMA 2FPSA 2Q28A 2REXB 3MGGA 2GB4A 4R84A 1C8LA 1KOLA 1AN9A 4BN0A 3GP8A 3DVSX 1NNI1 3L82B 1WJGA 2G07A 3KUDA 3I6QA 4NZOA 5FR2A 5SZIA 4KXYA 3M5DA 2V59A 3A4LA 3KQPA 3TNJA 3CR7A 4MAAA 2ASVA 2K2QB 2ZZMA 5CPFA 4ZT2A 1UKAA 2QE7D 1FXWA 2V7BA 2DOKA 4H7KA 2QW1A 4LMAA 2WVJA 3QXJA 4W5WA 5TGDA 4DRYA 1TK2A 3PTZA 3M70A 1H2WA 4R54A 4H6PA 4YRLA 3ZU4A 4L07A 1FPMA 4BJHB 4PFQA 2A14A 2NTYC 4Y9DA 4XX0A 5CM2Z 1YVEI 2FPWA 4PWYA 3B8EA 2O1XA 5CP8A 5F64A 2W70A 2QR3A 1GGEA 4M7RA 4YIKA 3LC2O 3KZMA 4GX0A 3VFDA 5HCUA 1C1DB 3L8HA 4D82A 4DT1A 5LOVF 4J0HA 4EVSA 5JY6A 5AW7A 4NXNB 5EHIA 3U40A 2ZE5A 3GA0A 2BMWA 4QUEA 1KDVA 1XTVA 3AHJA 1MC1A 4TN1A 4I9UA 1ENPA 4LEIA 1OZAA 2VR1A 2R00C 4GP9A 4NP6A 2JLXA 3RAFC 1UPAA 2QL7A 1V3TA 4IBOA 4WKOA 3V9AA 1AS2A 2EWVA 2OT3B 1IHYA 5LZ8A 2I76A 1U2ZA 4GMFA 3AJEA 3NETA 4MRAA 1NZDA 4OKSA 1N75A 1RQRA 5FUYA 4LOKA 5D7NA 5JNVA 1Q7CA 2PWYA 3TD9A 1QVAA 5C18A 5EZ6B 1TEZA 1L5QA 1ZG3A 4BFTA 3R9XB 2C54A 1WB9A 3MTEA 3H3XA 4GMHA 5HF5A 3M89A 4KITB 1OTXA 1T3HA 4BY9E 4U9UA 4DV3B 1DAIA 4TLBA 1I2MA 2XE7A 3E3LA 3KR2A 4DIDA 2QTBA 4HFRA 4HVCA 4QFCA 2WB4A 1T2AA 4J0KA 4EKGA 4F1KA 4GX5A 2WHPB 1R7RA 3A1TA 4GNKA 4XIYA 4ZOBA 4ZKEA 3TOVA 1H2EA 2HA5A 4G85A 4QLOA 4AFNA 2JLQA 1O0CA 1JVSA 3MRSA 3OFVA 4JEIA 1GQ2A 1L8XA 3AJ8A 5J2UB 3UK7A 3JZAA 2O5CA 2ZBUA 2HBYA 3I6MA 3IT0A 5IK2D 5KQSA 4OU4A 1OH5A 1HQCA 5J9FA 3THXB 4KDEA 1E2FA 1T8RA 2NYUA 3IPXA 3LX5A 1O6BA 1E1CA 5FULA 3RYHA 3V6LA 1MX9A 3UT6A 3BFPA 1GAEO 1KAQA 4ZOLF 3UOWA 2JI8A 4BJ1A 1V1RB 2GESA 2GF0A 5FLXA 4BB9A 1ND6A 2A9JA 2QTAA 3DDZX 1SKMA 4KPYA 3PZRA 4BQOA 5CH5A 4X62B 1PO7A 5JNWA 3B48A 4FMBB 1D1PA 3K73O 5JFTA 3AR2A 3N2GA 5E1BA 4TS3A 3VR2D 4CDGA 4MCJA 3TW6A 3PFKA 1QIDA 4O63O 4TPKA 3NDBB 1CU1A 2P75A 4ZVTA 4DF3A 4MP8A 2XTMA 4F0JA 3PQFA 2EBWA 4UM9B 3RYCA 3O8QB 3H2SA 2GYVA 2WUWE 3BGWA 4JIMA 3I9KA 2O0LA 4LY0A 4RLSA 5JAMA 5K4AA 4YRAA 2TS1A 1EJ2A 4N12A 1HDIA 3LX8A 1UJMA 4GW3A 4PRKA 2AK2A 5JPIA 3UBTA 2PX5A 4R9VA 5EJIA 1MAHA 2YRFA 3LT0A 4BRUA 4MUFA 1KZGB 1YC2A 3HDJA 5GV8A 3DNPA 3KJIA 1BJRE 3EWIA 5IKXA 1GLGA 4ZZIA 5B1YA 3RTDA 3VZRA 2WM9B 4FR0A 4AXXA 5IBCA 2O2JA 4MQEB 3GLHB 1DS6A 4UDNA 4OGWA 1CB0A 2PLWA 4YP1A 4HSEA 1M6YA 2EQAA 2QX6A 1LZLA 2VJNA 3B51X 2JIBA 3G2KA 4EGQA 2QZ4A 3W8NA 4W5OA 4B84A 3HFJA 3MJHA 3ZKAA 5KNBD 2JZCA 3FKSA 2H1LA 3JQGA 4DHWA 1EIZA 4QPJC 1SGWA 1F2UA 3TIVA 3WYAA 1WE2A 3X3HA 1NYTA 5ENDA 5AD1A 1ZVMA 1XRLA 1Z28A 1REQA 3TKYA 3UC9A 3MB8A 3N7AA 4H3HB 3V4FA 3HYRA 4MLPA 1J06A 1DXHA 5I9BA 3SHTA 3UAYA 2XA9A 4NYJQ 2DCMA 3D7KA 1UJ2A 1T1IA 1WP4A 4ZCLA 5I01A 3EPHA 4IL5A 1YZKA 2VDLB 1JAZA 1RAIA 5DGTA 2JH3A 2B5VA 3FSJX 3O2NA 3H42B 4A2CA 3WLJA 4CTKA 1CETA 3NONA 3G5TA 3D2CA 1JWLA 1RYDA 1OXXK 2ZBVA 5LA6B 2WLTA 4ENVA 1N9KA 4BFUA 3JQQA 4ID3A 3UOAB 1SOUA 4W1PA 1RU3A 1N32B 1Y6ZA 2RMKA 4QD3A 5AHKA 1L4YA 1NX9A 5BYAA 4WA8A 4KRGA 5CLHA 3IXQA 1GRNA 3OG9A 1JUDA 3TAXA 3E8SA 4UUAA 2GD6A 4E07A 5EHZA 1H4VB 3ZNPA 5LMUB 1DBVO 3F5DA 3L0BA 2FEOA 2QJOA 4KB5A 3FCEA 5BXYA 4V39A 1OC2A 3JAWB 1YCFA 2XMCA 2I78A 4I55A 1GNLA 5CNKA 1Y8QB 1XDGA 1P1IA 3B20A 2VP4A 1IHOA 4TLEA 1LNSA 3I58A 1L5MA 3NYWA 1OAOC 4BAZA 4PG8A 1SHZA 1XTPA 2TMKA 2JLCA 1CF9A 2DQ4A 4OJMX 5FEMA 3VNSA 4B31A 3KSAC 3BE8A 1QB8A 1VL8A 5E3HA 5IJWA 2PJUA 4NOLA 1A4RA 4LZZA 1EFVB 2YC2C 3IUQA 1OU0A 5FWAA 5U4XA 3RO7A 3CZMA 1MJFA 4M83A 4HQLA 1VPDA 3G0GA 4JVOA 4ZCRA 1TO1E 3BH6A 5F4ZA 3TM4A 5CTJA 2AJBA 2QVZX 4FPXA 4C7BA 3GLVA 1N5RA 2XE4A 5CFOA 4P93A 1A7KA 4B81A 2WLSA 1DIBA 4RE5A 2H2WA 4RS4A 1I1OA 2L69A 7GPBA 4CKYA 3IIJA 3QKRB 1BJKA 2QXYA 2JZOA 3DVLA 3LLMA 5SICE 2P40A 1CY2A 1QWSA 3UB2A 2CMFA 3L0OA 3OTGA 4PGFA 3VDNB 5IZCA 4Q02A 4A2PA 2ILVA 2C4HA 3ZGYA 1N5JA 2FZLA 3KCNA 3K70B 4FDVA 3T5DA 3COZA 4EYGA 4DV7B 1GUYA 3OX1A 3OZWA 1ESEA 4I08A 3O4IA 1JHDA 3N8GA 1B41A 3TI9A 2JLYA 1FPQA 3IILA 4Y0VA 1CE8B 1IZYA 1K98A 2P62A 3WQQA 1TQ2A 1XZGA 2IYTA 2BZGA 3R3ZA 1N25A 3A25A 4L08A 4AB1A 2XB6A 1XLTC 3KP1A 4ON9A 3H5WA 1GLNA 1RFLA 1T5IA 1YMUA 4OQQA 2H1VA 1KF0A 1M7GA 1US8A 2NPOA 1A98A 3M6LA 2HFJA 3KB6A 4B7UA 1PZXA 2B8WA 4KLZA 5JSZB 2DFTA 1XTRA 3KKZA 4LJ4A 1V1MA 2SICE 4BEWA 1LJUA 5AHRA 3U5TA 1I4TD 4DFDA 4OB7A 3U17A 1C50A 1R6UA 5I7FA 2YNMA 5IH7A 3HKCB 1MB3A 2FPIA 1EK2A 3WAKA 2BJHA 2LDXA 4G9EA 5P8WA 4D9FA 2ZOSA 5K0CA 3EIWA 3HABA 4C2UA 1U0FA 1FUYB 1KQ3A 3OZBA 4ZO9A 2AN9A 2PNJA 3RJ9A 3R6WA 4LGVA 3EEYA 5IBRA 3L5KA 3QEBZ 2W2MA 1WCWA 2CFSA 2V9ZA 5JZSA 1A9XB 4OAPA 4L3WA 1GL9B 1I1NA 1RLJA 4S1PA 3UJCA 5AK6A 3ZV3A 2XDAA 1RP7A 2SKDA 1Z2OX 2DWOA 2BDEA 3FPKA 3V8QA 4MULA 5DT9A 4CM9A 4GNRA 1A9SA 1AC5A 1PK7A 5FP0A 1IN7A 4NFHA 1ESZA 1P0MA 1TCAA 4FT4A 3P96A 4OQZA 2PUCA 2IHVA 3KALA 1G6Q1 4FR5A 1VHJA 2H4WA 1H8HD 2VVTA 2IHNA 5C32A 4K6GA 3U7GA 4CLRB 4NXMB 2C2BA 1WWKA 4G97A 4RAQA 1E7YA 4PVDA 4CQLA 2EJWA 1IN4A 1PVVA 3RRBA 1SU6A 1OIVA 3QHQA 2AG6A 2PLNA 3GGJA 1DCKA 1JZTA 2VK2A 2XOXA 3AJ9A 4BCCA 5JECA 3AUSA 3DOIA 3VSDA 3ZHBA 4E1VA 4ZO4A 1F3LA 2J6BA 4MIOA 1SC3A 3SMVA 4QUHA 1BA3A 3IJEB 1IJFA 2PYZA 4FJ1A 3IMGA 3RLIA 2OB2A 3AVUA 3VPBA 4GVLA 4BNZA 3HBJA 4V0MA 4EG7A 4Q9KA 5FA6A 4WL0A 2I34A 2LIPA 3QKIA 4B6EA 2XT9A 1L3IA 2MIIA 1GP2A 1L7XA 3FTNA 2B1RA 3FLAA 2LW7A 3GY0A 3IHTA 3HA2A 4ZI5A 1ZU5A 4IJ6A 5CDHA 1Y8ZA 4HC4A 3N8NA 4G5SA 2JHGA 1PFKA 1E5DA 3URKA 3N5CA 4QXOA 3SF0A 3EBLA 4QFBA 4YAOA 2B34A 1J2TA 1UOEA 4RABA 5ES4B 2IGBA 3I61A 1ENYA 3KTDA 4IJVA 1FJXA 1SBTA 1WB4A 1IK6A 1T25A 1ZH4A 1SUFA 2H16A 2JBWA 2HJHA 1F38A 3IFSA 3OTIA 4KEAA 2X8JA 1QF6A 4WFIA 1QYVA 2C03A 3SXUB 4YTEA 3P2YA 3WMFA 2VHUA 5DF1A 3FZGA 4A9AA 4C6TB 1HT1E 1UK6A 4E32A 4O25A 2ONZA 4WQMA 5BNIA 1J9ZA 1S2NA 2ZWIA 4MUHA 5IM5A 3RI3A 1NF2A 1NHWA 3IUMA 2Y0DA 1O54A 4J2TA 3ZCXA 4KQMA 3ESDA 4GVPA 2BFOA 2CLMB 3L8EA 3CB4A 5I9NA 2UUBB 2HPAA 1Z2NX 3A2NA 1XTZA 1B74A 3ZXSA 4ER7A 4JQCA 1E6CA 2G6BA 1JEQB 1RQNA 1T9KA 2BFMA 1A2OA 2A5FA 4X1KB 1C29B 3THWB 1IBMB 2XB4A 2ECKA 1UBNA 4YAFA 5FI1B 2D0DA 5DI9A 3NAZA 4ASUA 1UT6A 4IEEA 4CR7A 4P4SA 3STYA 2C96A 4OCZA 1ZH8A 3RWOA 3LQ4A 3R3VA 4N7MA 1V8BA 3PQ5A 1NSTA 2IFTA 2RGGA 4UU7A 4YQYA 5H81A 1SKYB 4ZDIA 3D6MA 3GFFA 4IUDS 5HF9A 4CETA 5JO9A 1CS0B 1G42A 1M2OB 3NTRA 4ND1A 2JLAA 2Q7XA 1R4NA 1LQUA 1HRKA 1BIFA 2BV3A 2R47A 3IP9A 1ZNZA 3A3PA 1VPEA 3MJVA 5LA6F 4EUHA 1L9KA 2I8LA 3P19A 4BXOB 2H65A 4RZ3A 4JLMA 1M2GA 2C4UA 2M1XA 5ER9A 1V48A 4NS1A 2FMIA 1WCIB 2J9RA 3I6IA 1PKXA 1P80A 1U0RA 2WJJA 4K6OA 4KIGA 4QDJA 3EIEA 3T5GA 3UH0A 3HI4A 1VPTA 2FUG1 4Q00A 2P6NA 4YX9A 1NBIA 5KSZA 3JZIA 4U5XA 2W6ZA 1PR9A 1I1QB 1G9XA 1ILEA 2V7PA 3RBXA 4UMVA 2Q5HA 2EFHB 3CEHA 3NRCA 5IKOA 1IUKA 4GSYA 4DCTA 3A32A 4FDLA 2EL9A 3OE5A 2BISA 2P3SA 3FOFC 3Q2KA 3AY7A 5I7AA 2VF4X 2HDNB 5CA0B 4X3PA 5EKXA 1V16B 2F8LA 1E6EA 3CRMA 4OXRA 2QB5A 2Q9CA 3AIKA 4G81A 4RTPA 4Y1RA 3S99A 4CT0A 3CIOA 1UWCA 2PL9A 3BFKA 1FNBA 5HIIA 5IZ4A 4Y18A 2V1UA 1ORRA 2OPBA 1VIDA 5KQPA 2P1DA 1YE5A 3AW9A 4TTQA 4UEJA 3U4CA 1TQDA 2HM7A 5KOYA 4B35A 5BWOA 5HILA 4KUHA 4R2XA 5EE3A 4RELA 3G0HA 2I2WA 4YYEA 1MW9X 1YB6A 4LWZA 1QG0A 1OCEA 4K2AA 5IFKA 1N3LA 2H54A 3A2LA 4L4UA 1PTJC 1RAHA 3PNOA 1A88A 4IXWA 5ANRB 1LBIA 2D2EA 1V8OA 2F17A 4FINA 3WRYA 4UUOA 5E6UA 3OTHA 5G02A 4BVLA 5I7HA 2HOQA 4D3DA 2LE0A 3OFSA 5GPBA 2CXHA 4TTTS 2XDYA 4XVUA 5EIBC 3D3NA 4F1JA 2REBA 3M4ZA 4JJ7A 1P7WA 1VJRA 3Q7RA 3QEKA 4Z9XA 3GCDA 1TTPB 2ZJ1A 4UHCA 1JTFA 1B93A 5AUNB 3GLIB 4I4IA 5FBZA 2Q49A 1XAHA 3UFXB 1VHDA 1QGOA 2IRWA 2JJ1D 2EJVA 1RMTA 2JGIA 3OPYI 4X5OA 1AXGA 2BGJA 2I65A 3RM3A 3B5IA 3OT1A 5AFSA 4M2LA 4BQPA 2Y1XA 1EB9A 5HMMA 3RARA 1N2SA 2E89A 2BFDA 2Q4DA 3FBTA 2KI5A 4ZV9A 3WOVA 3ZLVA 4OH1A 5CHYA 3T7CA 2ESRA 2VI5A 3JWGA 1U80A 1WXGA 1M2JA 1ZK2A 5KTTA 5KYXA 3EMVA 1DQRA 3OCJA 4IHJA 5FLYA 4ZK2A 4NJOA 1G2QA 3LXXA 2M6KA 4D6YA 2BVNA 3IQZA 2PLRA 1DIOB 1P5RA 2KBEA 4HNAB 3BD8A 4UNRA 2BCGY 4L16A 1E4EA 5C9ZA 2GCOB 2I9KA 1XCPA 4N54A 4MV9A 4AXBA 2CW5A 3UY4A 1A04A 5EJAA 5TF0A 3ZZ0A 4D81A 4ZU3A 4Z7NB 3EXFB 2YTZA 5CDFA 3GVXA 4BASA 5HOEA 1G59A 1M7BA 3D5EA 3CGGA 2K4MA 4JL6A 4OO3A 5DNVA 3U3RA 4AKIA 1WXEA 4C30A 1VMEA 5ILOA 2QRVB 5L7TA 1GAJA 2FEAA 1VCOA 2IX9A 3JD4A 4KIJA 2YJGA 3AL2A 1GILA 1FTWA 4TSRA 4CMGA 4DIFA 4F9FA 2P9ZA 5KWJA 4BLTA 5AI8A 5JSKA 4GPTA 1KWGA 1OZ0A 5CXXA 3E7FA 1DEHA 2G8LA 3KHKA 5CA1A 3Q4GA 2TMGA 1OX6A 3BRWA 1U7DA 2WU4A 4PM4A 1C9YA 4BGIA 4Z7OB 4MVJP 5DBHX 3FLBA 5ECWA 4KFCA 2I6XA 4EQ6A 1TCCA 3C7AA 5TMBA 4UNIA 3UQZA 4E31A 5JJBA 3ANLA 2H7VA 4BMZA 4FT2A 4LZNA 2G1UA 3LY7A 2QD3A 4KWTA 4KYTA 2NZXA 4AO8A 4DSNA 1Q6YA 1IXKA 4C4ZA 2FWMX 1PZNA 1JQBA 4YCNA 3QX3A 1TT7A 4GOXA 1CLUA 3MEQA 1JAIA 1P7CA 1O6CA 2ZPUA 3QVJA 2PWAA 5DHPA 1N78A 1AKQA 1JR3D 4ROTA 3FFWA 1HSZA 3GUYA 1JLLA 4PYKA 1KOFA 3I32A 5G40A 3FR7A 4BMVA 1FNDA 3VJMA 2Z3ZA 1SXJC 2VOEA 4X41A 1JDJA 4E7PA 2XBUA 3CIFA 2ZRDA 1SKAA 4PHTA 3NGMA 1ZK3A 1T4GA 1LFAA 1P44A 2IU4A 1G98A 4S1OA 4S35A 3R8XA 3K9QO 5JCZA 1CS4C 2HJVA 1QZ3A 4JUAA 1FLAA 2V4MA 2FW9A 1IRXA 3DMHA 5HKLA 4AZVA 1MRSA 1ESCA 3HHPA 4BZWA 1AS3A 5A7HA 3GJ5A 3ONVA 2B6HA 2VHWA 4IJWA 1NMXA 1RM3A 5CB4A 2Y0CA 2E0IA 2VDKB 3VAZA 4F9TA 5LC1A 1KAEA 4ZT5A 5BV8A 2BZ1A 1M1YA 4ZCIA 2IHBA 3LZCA 3RRJA 1T5DX 4YB8A 1QGAA 1SD2A 1XELA 2I71A 3LL7A 5AVRA 2FUNB 2HSDA 1PWZA 3PUHA 3MWDA 3QY0A 5DSTA 2G5CA 4Y30A 2CUTA 2IE0A 5DCYA 4IILA 3DLHA 3ZXIA 3AILA 3LGSA 5ALRA 4EI7A 2D06A 2P2SA 2HEGA 3NUGA 2OA0A 2VAWA 4O4JA 1H85A 1K0FA 3CA8A 4YUVA 5CB0A 3MRTA 4EABA 1BS1A 3FF4A 2GAAA 2O59A 1Y7PA 3NVMB 3TOXA 2C99A 2ODQA 4HPWA 5JAQA 2QLLA 5ALQA 4BN4A 4E33A 2GRAA 1GA1A 5JALA 4G1UC 2VQSA 1NONA 3WK9A 5HRCA 4Q48A 2SECE 1J6UA 4RTQA 2HXSA 3M3PA 3OUUA 2VYND 2RGUA 2WJGA 2IBTA 4ECAA 2A9VA 1E9VA 2PUEA 4CMAA 3E9ZA 1FQKA 2B1JA 2Z98A 3SQLA 4KJZA 4OA5A 4WT7A 1O57A 3OX4A 5C5IA 4UFPA 1G6KA 2ZM6B 1A1VA 2IS1A 3NTLA 4NBSA 5AP9A 3HO8A 4LXUA 3F49S 1WDWB 1WSDA 2DPYA 2WTMA 2H4ZA 3EQ6A 4M37A 4XD7A 5TQ2B 5EHNA 4ZGWA 1KVSA 3ZZNA 1NJFA 2XE6A 1XMPA 3EAGA 1KYVA 4JUIA 1Q0QA 2N0SA 4Y6QA 1K89A 1IN6A 3W1WA 2NW6A 5AM1A 1ZD9A 3DR3A 5BT8A 3GD5A 1JFFB 3PPWA 3Q0TA 1NW4A 4W8GA 1W9MA 3W9UA 1I3CA 3AONB 1C3JA 3ZOZA 5KMGB 4XDYA 1L4MA 1PF7E 2WQZA 2C8LA 1N2CE 4K6KA 4P6VF 2YZNA 4EELA 1NURA 2IZOA 1O95A 1WDTA 2X58A 4M22A 2GD2A 5CIYA 3LOUA 2GJ8A 1U0NA 3T7KA 1Q2UA 1ECPA 1WHSB 4GXQA 5KYKA 3LX6A 4EG1A 3TQOA 4BEBA 1A7UA 4GM4A 2C3MA 1E9CA 4MEBA 4UNSA 3IAEA 1ZPDA 4NQRA 1EWVA 4Q4JB 5TSDA 2OQVA 5KC9A 3H17A 4P1ZA 4BAGA 5L6LB 3LC0A 1A9QA 3Q3GE 2OXEA 2V7VA 1TQ6A 2KBFA 3ELYA 4FCCA 2PRSA 4OQFA 3O8QA 3QJ5A 4W1QA 1ORVA 3DB2A 4LXQA 1AKRA 5F1OA 4FD2A 2P6UA 1I0IA 1VLVA 4JHXA 3UWSA 3IS3A 1G7TA 2HDOA 3B6EA 3MWFA 3RUCA 3S0JA 2BTEA 1SQGA 3HO1A 5JARA 2D8AA 4G0NA 3EFOB 3MFQA 1ZN7A 2N46A 2ZT5A 4I3FA 4XM2A 4N40A 4ZFNA 4AC9A 5BUSA 3UKOA 4D3ZA 4BU0A 2F6RA 3AZPA 1G7CA 1CP3A 3KQVA 3PFFA 4PONA 4XLTA 1SHLA 4DDHA 2LDBA 5C1OA 1QF7A 3ADCA 5C8YF 4DR1B 1E1DA 2GXQA 2ZRQA 1FMJA 1IB6A 2I0FA 3E05A 1Q0PA 4UHDA 2EXXA 4BZPA 4IDAA 4QBHA 1QYIA 4OG2A 3O7WA 3CO5A 7ABPA 1U7HA 2D1FA 2X14A 4MW2A 2AA3A 2ZEJA 2FETA 4UHEA 5BNTA 5EJ8A 2UUAB 1R0YA 4QHSA 2C92A 1T3GA 1IAQA 4MIEA 4IQ8A 3S5UA 3T15A 2NU6A 4RW0A 2C5HA 1B1CA 2INGX 1K92A 1AGXA 3H18A 3Q5GA 4FYYA 4AICA 8ADHA 3AEUA 3HVRA 3JCZA 4DUGD 2PGDA 4R51A 1XLVA 2OCPA 3LCUA 4RPHA 3TS1A 1QS0B 1R37A 3RIYA 1C5KA 4FYWA 4O2AA 5K8JB 2HLPA 3CMMA 1KBQA 1KFEB 4HR7A 4YT8A 1S8OA 3WKDA 1K6XA 2PT7A 3EGDA 5EESA 1FP1D 4DLWA 1QGYA 4JT9A 2AJDA 2ZBPA 1XWIA 3GK3A 1MV8A 3DV0A 3G68A 4LZPA 4QEKA 3SFVA 1CIJA 2ET6A 2VP5A 4P4GA 1K75A 3T1VA 1J22A 1CR4A 2J9ZB 4Y0NA 3ZBQA 3QLJA 3ZDFA 4RTMA 3LBNA 5TGTA 5EJ4A 4O1HA 3TEFA 1MJGM 2UYGA 2IDZA 1E2QA 3CLUD 4LYDA 1I14A 4UXIA 3F6BX 4X93A 3DZHA 1BRTA 4D92A 5AJVB 1Z6GA 3OPXA 3AZOA 3RU2A 3B82A 3NOVA 1P75A 4BUCA 4D8UA 4YY3B 2I3GA 4KE9A 5COQA 5HQJA 5SY6A 1OYWA 1Q14A 4KNVA 4PANA 1FXWF 1WW2A 1Q3TA 2GBPA 2OL4A 1SBHA 4AK9A 2QZ9A 3P9RA 3Q7PA 2JGEA 5JC8A 2RK6A 5JY1A 2IPAB 4J2OA 5LL6P 1BDJA 4M55A 2PR7A 3LIIA 4X8HA 2OHHA 1YMQA 3AM3A 1N7IA 4DMHA 3CXUA 3L4KA 3DTVD 5F5NA 5ALKA 1U8XX 4TKZA 4L73A 5HZMA 3EA0A 2REOA 2J7KA 4M7WA 2DWUA 2P6PA 4GPBA 4ENQA 3QKRA 1I4DD 4MGIR 3MZ0A 3TKAA 2IOFK 3CX7A 2AW3A 2HMVA 5BV1A 3AEYA 2XYVA 5A4AA 1P1HA 1S2DA 1DMSA 2CB0A 1T10A 2IUYA 4X7RA 3FGNA 3HRKA 4Q3DA 3EIUA 5K0LA 3IV6A 4BNNA 4DCGA 2RAFA 3VZQA 4BVKA 1W48A 1A5AB 3B6MA 3GF4A 4UE6A 5FFNA 4BJ5A 5DBOA 2QUBA 1S01A 3CUUA 1VM6A 2FU5C 2ZI4A 3RFCA 4X1YB 3V5NA 2BBTA 2O8CB 4BJ3A 3EGVA 1KERA 1H22A 4HGOA 4URYR 1KQGA 1RFGE 1SULA 4NABA 4B6RA 5IDQA 1QO9A 2GZ1A 3DE0X 3DTTA 4AIIA 1H4QA 5IJAA 2PNFA 3P9PA 3LQKA 5E8RA 5CITA 1HYEA 2OQIA 4UTXA 2NO5A 3UT5B 5A4KA 5LKRA 1WBBA 4WIAA 3ONDA 3K6SB 2NGRA 5C4IA 4D80A 2B4QA 4MKHA 3GVPA 5IAEA 2AC4A 5BR7A 1U31A 1E99A 3ZS9A 3D5QA 5JCXA 5KTNA 4UQLA 1TEVA 5H8WA 2UXDB 4UDYX 2BY4A 1E60A 4I1VA 3ZE6A 1US8B 3SC3A 1DBRA 4CW7A 4NQZA 3A6KA 1DG9A 5H3CA 1NLYA 4FS8A 3QWFA 1SUPA 1W4CA 4EM6A 2H9YA 2PN1A 4LJSA 2VTBB 2ID8A 2WDZA 3PWZA 4E88A 2E87A 2ERYA 3C0KA 3U4DA 2BJVA 4ONEA 2R65A 2TRSB 3EPRA 4FNOA 4KQJA 4AJ1A 1P18A 1SK9A 1WA5A 4ITVA 3VUFA 1HXHA 2GBLC 2PFKA 2OQRA 5ICGA 3AM1A 1Y4UA 2V8BA 5AK4A 4BQSA 1T26A 4QODA 5FUVA 1U3TA 2R8EA 3H83A 2GKGA 2HDWA 3FSEA 1B43A 2I6UA 2PCLA 3MJTA 4G4IA 5EPOA 2QX9A 2DBRA 3D3JA 3IX7A 4PCAA 1X9GA 2X42A 3GH3A 4HVTA 5TEWA 3HWWA 3ZD8A 4E5NA 3NATA 4LWQA 3B6IA 2NVBA 3O6VA 4XTCS 1C3LA 4DW8A 1CQWA 2W2VA 2Q41A 3NBUA 4O4IA 3HNRA 3SU8A 3T52A 3GJ6A 1NQXA 4WESB 2L19A 1P1RA 2NTVA 2QT9A 4E5MA 5BORA 3SOZA 4QM7A 5HXAA 1BH6A 1MGPA 3QUTA 4A3SA 5BMVF 1CDDA 5IHPA 2O8BB 3RWMB 1KDRA 1OFVA 5HCIA 1N6RA 4JI5B 1EM8B 5CM9C 4C06A 2QM0A 5C5DA 1VLZA 1ULUA 3T3PB 4DV6B 1D0VA 4HG2A 4HK4A 4HN9A 4I4TB 1H2ZA 4PV7A 5KPJA