4Q03A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q03A00
2PJRA 4GL2A 4A9AA 1N5KA 3GFPA 1G8YA 2JLZA 4NBSA 4MUBA 2PZFA 4EJSC 1NLZA 2OT3B 2O8DA 1XD8A 1QHSA 3I3SR 4POAA 4NCKA 1VDZA 3CX7A 1FNMA 1XWIA 1R8SA 821PA 4GP6A 2VYFA 4L5BA 2B7BA 5L3VA 2OO7A 3N70A 4YQFA 2ZYUX 2JEOA 4R7ZA 4ZO4A 3WYAA 2RGEA 2VRWA 4JS0A 1ZD9A 4PZZA 5KPDA 2AHOA 2W00A 3AUXA 4DCTA 2VIIA 3SJBA 2E9SA 1J70A 3K9NA 3WMGA 3SHWA 2P3SA 1W2GA 3FDIA 3THYB 4FN5A 3K53A 1VKJA 1N6IA 3AKDA 5FUVA 2Q0HA 4PSKA 1FUKA 4IVPA 4CT4B 3DO6A 2EU8A 2QMEA 1N6HA 4WIAA 4AWXA 2B8WA 1BMFA 2ODEA 4FCTA 1XJQA 4Q9KA 2BCJQ 5FBRB 4PC1A 1E2FA 4W5WA 5IF9A 4B32A 3K0CA 2FOLA 3IUYA 3FTQA 3OE7A 3UMFA 3AKEA 1P72A 3HP1A 3NEYA 4BFWA 2JLRA 3KJIA 1KO5A 3QKSA 1VCOA 2IHYA 1RE0A 2J7PA 3QKTA 3GD7A 4JLDA 1Z3IX 1YR7A 2CK3D 5HCNA 4ABYA 1OH5A 3N2IA 4OHVA 3EZ2A 3BH6A 2AK3A 4PPFA 5EP3A 1WQ1R 2IYRA 4YMTA 4LYFA 4QOSA 4JYCA 3MAAC 4KFTA 2N46A 4C4PA 4PAQA 3HJNA 1AIPA 3BFKA 1NVUQ 3W6NA 4R9UC 5BYJA 2R6GA 4QBGB 3MFYA 2DFLA 3HYTA 4NP6A 3QXSA 2F9LA 4A0FA 3L0IB 5JHGB 1HYQA 2YINC 1N0VC 1XD9A 2FFHA 4RD0A 1K8RA 2C95A 3CZQA 2W2TA 2ONKA 2YNMA 4IVQA 5FOUA 4A0GA 4PZYA 3GLHE 1TF7A 4HEJA 1V5WA 1UDWA 3CPJB 3PUWA 2QTFA 3LBHA 1W0JA 4O25A 2I1QA 3NDBB 2YOHA 1ELOA 1KAOA 2Z43A 2QUZA 2DWQA 1TF2A 3UG7A 2OM2A 2AWNA 4YMSA 2BBSA 2TMKA 5KYKA 4IW3B 3BS4A 4EKDA 1P2TA 3ZZ0A 2XJ9A 1OLOA 2WBLC 1ODFA 4B48A 2IF2A 3IO3A 4NYJR 1E4VA 3AB3A 3TW4A 4F7WA 5KDDA 1Z8FA 2QPTA 1GL7A 3T5GA 1AJEA 1G4UR 2XOKA 4AKIA 2V7QA 4DDTA 3FYHA 4IKEA 4TL8A 4IEIA 2J1LA 3L43A 1O3YA 1LNZA 4CRWB 4WW0A 4DCVA 3ZZUA 4TYWA 4A6XA 4D80A 3AF2A 2KI5A 5SZKB 3CO5A 4IDOA 1DTSA 3B7GA 4LRWA 4CT5A 2NO6A 2AKYA 2WMOB 3TIFA 1DG3A 5EUMA 2JJ1D 1R0ZA 1FOEB 4XH9B 3KB2A 4OQMA 3U44A 4UJ5A 1WA5A 1KDOA 2XXAA 4NCJA 3MJRA 5C4MA 4D0LB 3EPLA 3WHLA 1E2KA 2PX3A 4ASUA 3VX3A 1OXTA 3X1XA 3Q5EA 1HT1E 1UBGA 2OZEA 2IYQA 4M22A 4URVR 3HPQA 4D0NA 1KMQA 5TDHA 2A2ZA 1TU4A 1WCV1 3NC1C 4PC6A 1L4UA 2GEDA 4MGIR 2YOGA 3CR8A 3FMOB 3X1YA 2DFNA 3BB3A 4TTPA 1D9ZA 3EAQA 1JR3A 1SXJB 1IHUA 4G5RA 3ZD6A 1J2JA 4BFXA 5IT5A 1EFUA 4W7SA 5BWMA 4L9SA 3LRPA 1UADA 3L0OA 5BN5A 1AA9A 2EQBA 1VCIA 2PX0A 1X86B 4LJ5A 3EC1A 1YRAA 4KU4A 4TSFA 3W6OA 1BO6A 2IW3A 3A1UA 3K1JA 4JVLA 2QNRA 4LHYA 5KSZA 4DB2A 2O8CB 4US2R 4Q1BA 4I1VA 1U0LA 2PZGA 2WICA 2DFTA 2Q6TA 5F98A 4ZIRA 3QKSB 4NYIR 4Q1EA 1JXMA 4KITB 3QEOA 2IC5A 2QBYB 3AKYA 3HPRA 1QBKC 3U7GA 4RD6A 1II9A 4LHZA 1ZRHA 5E7IA 1BYIA 5LDDC 1JEDA 2QAGA 1U0HC 3V9PA 1E9RA 2A5JA 3T06B 2YKGA 1SQ5A 1SXJA 2UKDA 3U6KA 1T3HA 3O8DA 5LB4A 1IN8A 3IIJA 3UIEA 2W6JD 5HKKA 4KLNA 1NBMD 1UDXA 3C5CA 3U3OA 5FBLB 1OHHD 2C99A 4BLSA 3IEUA 4YXWD 1GNPA 1P3JA 4DXAA 2CL7X 1XX6A 1PJRA 1QDEA 1Z6AA 3D31A 1MKYA 1Q22A 4P31A 3CRVA 3P4XA 1W49A 3I8XA 1FP6A 2ZETA 1I2DA 4HAVA 2LCFA 2ZSEA 3OZXA 4KAXA 2E1RA 2JLXA 1AQYA 2ZUBA 4TYPA 1KNQA 4US0R 1T4GA 1TADA 2QMHA 5TV2A 5EUQB 3AP2A 4Z51A 1G8HA 3DKPA 2ZRMA 2AK2A 2ZAOA 3ZDQA 1XMIA 2X19A 2QORA 3KZ1E 4B73A 5JEEA 3ADBA 3RC8A 2WSSD 1UJ2A 2Y8EA 3GLIA 5FOXA 4UKDA 2OCPA 2HUPA 2OFXA 1Z6TA 1G16A 2NMVA 1JXOA 2WKRA 2QRZA 3R7WA 3QPVA 3M0EA 3OF5A 3D8BA 4C30A 3VR4A 5L8VA 2HCJB 1YQTA 2X1VA 5J40A 3WMFA 4TQAA 3RRZA 1KSHA 2P5SA 2REXB 2WVJA 1GL9B 5CJPA 3DZDA 4Q1CA 2QAGC 5IDVA 4XTCS 5AJZA 5B57C 3RSLA 5KPJA 1KDPA 2ZANA 1NN3A 1M7GA 2RAPA 1NN1A 2FPKA 3QVVA 1YE8A 4O2LA 3QEJA 3KKQA 2ZI7A 4YLGA 3Q72A 4PQRA 5JRJA 2ZYWX 4B44A 3U7FB 4M1WA 1IN6A 3EG5A 2GXUA 1KI7A 3K0SA 2XNDA 3LH5A 1A5TA 3GFOA 3W5IA 1NJFA 3BJIC 2WWWA 4Q00A 2IWRA 2EW1A 3EA5A 3CR7A 3BAFA 1NKSA 2YWFA 4WXPA 1AKYA 1K5DA 1KI6B 3GJXC 1EXMA 3HDTA 4KFRA 2F1JA 3I32A 3IHWA 3TBKA 4RFVA 1SZPA 4A82A 2GEVA 3AP3A 3RS4A 2CLCX 5DI3B 1NVWQ 2J45A 1OB2A 5CITA 1W36D 4EPWA 1ZUNB 4GMDA 4L16A 4TLAA 1R5BA 1CXZA 2GBLA 3PFIA 1B23P 2WV9A 1OFIA 1RZ3A 2FGKA 4ESHA 4Q18A 4UNNA 1GZSA 1R4AA 4MRNA 1O87A 4DIEA 4D25A 2FEMA 3BFXA 4NYIQ 5EE3A 3EASA 3WXMA 1E2EA 1E9FA 3V4RA 2PCJA 1XEXA 2PJZA 1XPRA 5EJEA 4M1SA 3B1VA 3TK1A 1CR1A 2F7SA 5DNYB 2P5TB 3K0EA 5FL7D 1G3QA 1D6JA 5B58C 2BBOA 1P75A 5H70A 1XEWX 2Z6VA 4HZIA 1X1RA 1G291 2G1JA 2IYYA 2OLJA 4II7A 2WJGA 3KKNA 1RRPA 2JIZA 5FBQB 3C16C 2IUTA 3S1AB 1NF3A 1XEFA 3VR5A 1ZUHA 1XJCA 4LK2A 4QL3A 1KNXA 4J0QA 1C4OA 2BCGY 3BB1A 1WBBA 4KFSA 4D2IA 1Z83A 1IJEA 4P4TA 5KNCA 1FW6A 4C9BA 4XJXA 3LVRE 1EGAA 4X8LA 5G40A 5D3MA 2IYTA 4HUQB 2C9OA 2CDNA 1N0UA 5IHPA 1T6NA 2GEUA 3LFUA 4IDHA 6Q21A 5JI2E 5DE3A 1XZPA 3BGWA 1W46A 4MKHA 2WJYA 4RSGA 3EC2A 4I1OA 1U98A 1JJ7A 2CVHA 2JLWA 5FUWA 2VP0A 1NY5A 1G8GA 4PPGA 4DLRA 1FTNA 2QU8A 2QENA 3MWJA 4PC7A 4TL7A 5DN6D 5L3SB 4WZ6A 5EE0A 4C7OA 2FWRA 3EW9A 4LC1A 3PJRA 3PUYA 3Q7PA 4TLBA 1W44A 2ZVPX 2VL7A 2O52A 2XTMA 2GJKA 4URYR 1E99A 4CDGA 2HDNB 2XZPA 3SYKA 4QNRA 5FTLA 3B8HA 1FMLA 3KQHA 2YV5A 1S3GA 4H9GA 2ZI5A 5FPSA 3ZIAD 2L0XA 3VKWA 3DKVA 4PO1A 4B76A 4MYHA 2RHMA 2VEDA 3HU1A 1WMSA 5A0FA 4CVNA 5F2EA 2YJTD 1E6CA 5SZHB 1SKQA 2GCOA 2G0NA 2O8BA 3MRSA 1AGPA 2VA8A 4QFMA 1G6HA 1R5OA 1WRBA 4KSBA 4JBYA 2AFHE 3T35A 5KOYA 1IN4A 1RYHA 2IF0A 2XTNA 3IHLA 1G20E 2V54A 2VF7A 1KJYA 2ZJ2A 1Z5ZA 3CF0A 1II8A 3PEWA 3SEAA 4AD8A 1D2NA 5H8WA 1GUAA 4QXAA 1Y63A 3DVLA 4FCWA 3EPHA 4TMZA 1TF5A 1TQ4A 2PLRA 2GA8A 2VBCA 1NKTA 1IONA 3LO5A 3DDCA 2BMDA 4JT2A 3FMPB 1OYWA 3K70D 4TN1A 3WP1B 4R98A 1XTSA 1OFTA 1WE2A 1DEKA 2QSYA 3NWJA 4QRHA 5IRCD 2XNSA 4NDZA 2GILA 3O8CA 1NSFA 1P4SA 2WPDA 3RLFA 4PQYA 3TW8B 3RRYA 1BIFA 4PPQA 1W0JD 2F43A 1T9HA 4RD1A 4ACAA 3B2EA 3P27A 2Q9BA 3FVQA 1ZNXA 3SJCA 2R2AA 5LPNA 2FMXA 2QROA 3CRW1 4UXHA 2XXAB 2D2EA 2HJVA 3FFAA 2EFDB 4JSTA 4OJKA 5AUQA 5JWOA 2IBMA 4OI2A 3OIVA 2OESA 2CCKA 3WNBA 1E79D 3WRXC 3EIEA 3RS0A 5DIFA 4BQSA 4UNQA 1EFRA 3LBIA 4N1AA 3U3MA 4HZUA 4PO8A 1NIPA 1PLKA 1XXHA 4UNSA 4BASA 2REBA 1N5LA 1LF0A 4M8NE 4TMWA 2BV3A 4BWYA 3MCAA 3RAPR 3LX8A 1EFHA 1RJ9B 1QHNA 2LKCA 1Q0UA 3RANA 4Z1MA 1OKKA 2QE7A 4JSYA 4ESVA 1F2TA 2ZXUA 1JB1A 2WJHA 4Q4AB 2G88A 2PBRA 1CF4A 5IK2A 2ODNA 3BXZA 3LNCA 2NPFA 4ZKEA 3RC3A 1NN5A 1T3SA 3EIHA 1E2HA 4XVUA 2REOA 3GLFB 1GM5A 4XSHA 4PC3A 5C4GB 2ORWA 3BFVA 1G3UA 1GG2A 2CE2X 4KFUA 3A1WA 5KDOA 4X8HA 3ASYA 3DEFA 3LLMA 2OBLA 2YYZA 3UMRA 4AYTA 4C2UA 4XOIA 2RGNC 4FINA 2ZSBA 3K09A 3IEVA 1HEIA 3E2IA 4GP7A 4MRSA 3ICEA 2IL1A 3WYFA 1XXHB 2QBYA 4B47A 1SHZA 1XEWY 4DUGD 2WTUA 4MRPA 1JR3D 5FTMA 2JLYA 2CL6X 4DLSA 5L3QB 2V55B 4Q19A 4CW7A 3SYNA 3HU2A 2HYIC 2RKOA 3MUFA 3UXMA 3GJ6A 1E2QA 3H1TA 1E9SA 4TYQA 1DELA 4M1OA 5AR1A 2VSFA 1ZM9A 2GAAA 1ZUIA 4BRUA 1RPZA 1LS1A 2GZDA 1ZINA 3IKJA 1GRQA 1QHGA 5HR5A 4LI0A 2AKAB 4I81A 1N5JA 4D4KA 1UKYA 1ZM3A 1H8EA 3MSXA 3PVSA 2KB0A 1HV8A 2VHQA 5CDFE 1E2NA 4Z8YA 4EDHA 1NLFA 3FPAA 3TGPA 1E1RA 2Q9CA 1ZD1A 2FF7A 3AQ4A 2P6NA 2ZE8A 5FOWA 1W47A 2H8KA 4B34A 1GILA 5KTYA 4JL6A 4D4MA 2KJQA 2WWXA 1II8B 1N0WA 3NHBA 4M1KA 2D7DA 2KE5A 3EWAA 1N6KA 3CZPA 1NMYA 2CE7A 2FG5A 4EPVA 1M7BA 2WAXA 5EXPA 2X8AA 2GZHA 2XTZA 4JJZA 1HQYE 4NE2A 2NZ8A 3T1VA 4FCVA 1IY1A 1NSTA 1Z6GA 4OHYA 2IS1A 1Z0FA 4E07A 1RC8A 3PQCA 3CIOA 1N6LA 2B7CA 2KBEA 3TVTA 2GETA 5FH9A 1Q20A 4HAXA 3U3RA 1F6BA 4HLUC 3OFND 4LBYA 2ZQ5A 1CJTC 1U99A 1S96A 2UVQA 1QHIA 3U4QB 2C04A 4EAQA 2VQSA 2FDCA 5EP1A 1UKEA 1E2LA 2WZQA 1Z29A 3KJGA 4IDNA 5K8LA 4B3XA 1TPZA 1NNEA 1QF9A 2ZRPA 1GSIA 5CJ2A 1E98A 1CRPA 4U02A 3EIQA 4GSYA 1OF1A 4V0NA 4NTZA 3ZQJA 3O8RA 1A2KC 1T8TA 2RB4A 3U7EB 1G8FA 2ZJBA 4IOKA 1WP9A 4HB4A 4MITA 3BE4A 3THXB 3MLEA 3GJ3A 1Z08A 1ZCAA 3QKRB 3PV0A 3KL4A 4FXPA 1G5RA 2OV2A 1UFQA 3AVVA 3IO5A 1DADA 3BERA 1T8UA 1VG8A 3DL0A 3WRYC 3QG1A 2WIAA 3WY9A 3CONA 4D81A 4TMTA 1E9AA 3SFVA 3AM1A 2XAUA 4O0MA 4DEXA 2HYDA 3KB1A 3Q7QA 4MKFA 2GF0A 3NDPA 1D2EA 2NPIA 1EK0A 1XTKA 5C2JB 1U8YA 4DIDA 3B78A 3VU9A 2ASEA 1AQUA 1U94A 5B2ZA 3NH9A 2W6ID 3KQLA 1W36C 5A5GA 4FMCB 4WVFA 4Q1AA 2Z83A 4DT1B 2ZRDA 1C9KA 4D4JA 2H5EA 3MWYW 5FOTA 5FPHA 3NHAA 5FPTA 1N6RA 3QENA 5CYOA 1E2IA 4QM6A 1KZ7B 1ZIOA 1EG7A 5BQ5A 1SVMA 1Z0DA 3SJZA 2XEXA 2J0UA 3K0AB 1A2BA 5EXSA 2Q3HA 4Y0VA 1VCMA 5H68A 4XVQA 3GEHA 4TMXA 1P60A 1W0KD 2AD5A 2ZVQX 1L2TA 3QPUA 2JAQA 3U60B 4JLBA 3MGCA 3P1JA 2CMKA 3PG5A 4ITRC 2NZJA 1XRJA 1FMJA 3K0FB 4V0KA 4KSCA 1GKUB 1Z0KA 2DHRA 4GOXA 4NYJQ 5J4YA 1MV5A 2BWJA 1DAHA 5EZ5A 2DY1A 4PQFA 4DEYA 2F3TA 3QY0A 1UF9A 3KUDA 1CBUA 1UEJA 2BMFA 4P0TA 4B71A 1KJZA 1CS4C 2V6IA 4M9QA 3E5HA 2QT1A 4JLPA 4TZ0A 3B13B 1P9RA 2QTVB 2QSZA 3C8UA 1E4YA 2R6DA 4NH0A 2JLSA 3CNNA 5FL7A 2PCLA 5JZVA 1CEEA 4PXAA 1OV4A 4OBEA 3QF4B 4B33A 4OK6A 2OCYC 4HB0A 3IPXA 1VTKA 2GK6A 2JIZD 3JZMA 2ZR9A 4IOMA 2BBTA 2ZPTX 1GTVA 2D06A 3CX6A 1FL9A 2XSZD 3NTUA 5K8UA 3UKDA 4DCNA 2J46A 2OAQ1 4KI0A 2DBYA 4RD2A 4IJMA 2VHJA 4AURA 2WJIA 2ZJ5A 1FZQA 3WNCA 5GJCA 4ACBA 3T61A 3KTAB 2W83A 4D4LA 5KDLA 1AK2A 4EJSA 3W8NA 4B2IA 3KUCA 5CYPA 3VAAA 2OFOA 3F0TA 3A58B 3THYA 3FOZA 3CRQA 3RABA 5JECA 5JSZB 2JDID 1XMJA 1XB2A 3TMKA 3CBQA 4F4CA 4M21A 2ZM5A 1VYUA 2PT5A 1S1CA 2R62A 2FN4A 3DM9B 4HDQB 4A6PA 4C2TA 2AD1A 1CJVC 3KXLA 1KY3A 2VP6A 3Q9LA 3L8ZA 4HATA 1GP2A 4LHWA 4C3ZA 1L7VC 2GJ8A 1KYIA 4URWR 2CL0X 1F5NA 4BZXA 3PR1A 1Z2AA 1US8B 4XVRA 3A1VA 3M6AA 1LW7A 3SBEA 1HH4A 1G3IA 4UQOA 1TU3A 4IXNA 3KJHA 5KNDA 2ZYTX 1ETUA 4OQNA 2W2VA 4FWIB 5AJWA 1IN5A 2WMNB 2NQ2C 3BOSA 4NCHA 2OSBA 5GVSA 3OEHD 1NN0A 3OIYA 5TVKA 2AX4A 2J87A 3NH6A 2K5UA 2G3YA 2ZSFA 3UWKA 1R6BX 3X1ZA 1OE0A 4PZLA 1S9DA 3GLHB 2FPLA 3JZAA 4HDCA 2ZAMA 1RRCA 2F3RA 4AC9A 1OT3A 3BORA 4F4IA 2GNOA 1RRGA 4G5OA 2A78A 5FUYA 4B6EA 3P4YA 5K8IA 4QHTA 2IS4A 2ZE7A 4D82A 4XWOA 2A5DA 1KTVA 1DG1G 1ZM2A 2F1HA 1SXJC 3SC3A 4NYMQ 1G18A 3SYLA 1W7AA 1SVIA 2KSQA 4S2EA 3T34A 5HZHA 2JJ2A 4HZUB 2NG1A 1OXUA 3FMIA 4GFDA 4NCIA 1ZD8A 1Z6XA 4ZV4A 2ZROA 3U61B 1G6OA 1ZYUA 2A9KA 3ADCA 3FKSA 3T15A 5JWRA 2WPDD 4HSEA 1XD2A 3QXCA 3C15C 2WOJA 2QEQA 4KVGA 4AKHA 5TY0A 3RRNA 2ZIAA 1XFAA 2R65A 3H4MA 4JT4A 5CB8A 1ZU4A 4CEIA 1HQCA 4HB3A 2ORVA 1KAGA 2EWVA 1IJFA 4N0DA 1G3MA 3H2YA 4KHZA 2ECKA 4BFSA 1OFHA 1E79A 1P61B 2C78A 4NZYA 3NC0C 3EPKA 2DB3A 4JVMA 4M1YA 1VG9B 3K9HA 4DZZA 5LD2B 3I73A 1XMSA 1PV4A 5HZKA 2XOKD 2IYZA 4OHXA 1Q57A 2DFKB 4Q9IA 1CJUC 1GWNA 3MD0A 4LHXA 1UBEA 4D0GA 1RRFA 4A2QA 2F55A 4UNPA 1KDTA 1II0A 4WOPA 5D3QA 3VR6A 2JATA 2IYVA 3EA0A 4KYIB 4LBVA 2IXEA 1P2UA 2IHBA 2ZRKA 3BH7A 3VFDA 4HAYA 1DAEA 4LYHA 4OJQA 4GNKA 2SHKA 3AP1A 4F92B 3SR0A 1RKBA 1T0JB 5J4LA 2IA5A 3K9GA 4Q1DA 4Z8XA 3QJYA 4GZMA 3VKHA 4LGMA 3H86A 5HKKD 4ASUD 2J41A 2WSMA 1TX4B 4UNRA 2QG6A 4QJ3A 2Z5FA 3PEYA 2EFHB 1VIAA 1Z2CA 4V0LA 1E1QA 4ILEA 2PT7A 3BH0A 5EE1A 3TR5A 1VHLA 4C0HA 2PH1A 1E96A 1TEXA 1ZMXA 2WAYA 3CRRA 3RRMA 2WOOA 2HXYA 4DLTA 1AZTA 4EQ6B 2ZRGA 1GNRA 3P20A 1GFIA 5C18A 2HXSA 2QAGB 4AIIA 2OG2A 2ODWA 1US8A 3I62A 5JS7A 5DH9A 5FTKA 2ANBA 3GJ5A 2ZI6A 4H1UA 4IEEA 5FI1B 5L3SA 5GADl 3SNHA 4LCBA 4NL4H 5KO2A 1EX6A 2YOFA 3AF3A 3J81k 4L8GA 2VP5A 4Q47A 1G7TA 3CRMA 4G5GA 4HB2A 5E95A 3UPUA 4ZIRB 3GJ4A 4QHSA 3NG1A 1J8YF 2OXCA 3QBVA 4LJAA 5DYGA 2BJWA 1E9EA 1UPTA 2ZUCA 3BIFA 1H8ED 5J4KA 3UMSA 3L82B 1U8AA 1DAMA 1QHHA 3RS5A 1XJ0A 4LWZA 1AS3A 3E1SA 4OHZA 1R5NA 3VR1A 4DCSA 3AUYA 3AKCA 1FTSA 1P2SA 3IPYA 8OHMA 2GWHA 3A4LA 2OEPA 3VNUA 4R2IA 4URXR 1TMKA 4OQXA 1AN0A 1UKZA 4LSGA 3QQ5A 4O2RA 3OEED 1OXXK 2XZLA 2V8OA 1N5IA 3C5HA 5UKDA 3RDPA 1OHHA 2BM1A 1KMHA 3MWKA 3L8YA 1NIJA 2GDJA 1KI1A 4C0QC 1OIVA 2XNDD 3ZVMA 2GRJA 4A0RA 2FGJA 1UEIA 3B9PA 2XB2A 3NBZC 2FSHA 4DLXA 3MMPA 1DPFA 1IY2A 4B43A 4LC0A 4Q21A 3BRWD 1KKLA 3I1FA 4WZAE 2PEZA 4K46A 2RMKA 2HT1A 4C0KA 1F2UA 4DLVA 1PZNA 1TQ6A 4JLNA 5JHHB 1VHTA 5JWHA 4NONA 3CUEF 4DRZA 4NCNA 1U0JA 1WDTA 3LW7A 4MYCA 2QP9X 421PA 3GEEA 4BZPA 5CK4A 4BGDA 5HE9A 5HCIA 1G41A 2V6JA 5J5CA 3G82C 3OE7D 4CZ2A 1VCNA 1GL6A 3I8SA 3QUSA 2CBZA 4BFUA 1MABA 2IUSA 5J47A 1NY6A 1DAFA 2FSFA 3KQKA 4IDQA 2YVUA 3PEVA 4DT1A 3ND9A 1FX0A 2P6RA 1HTWA 3QBTA 1KMHB 1U90A 4A0HA 3RNLA 4AYWA 3B60A 4I4LA 2W0SA 4G0NA 1YVDA 3MJHA 1NI3A 1YZNA 4PHFA 2GHIA 3QOFA 1ESMA 1SVSA 3WP0A 4BFTA 3AGPA 4RJLA 2QTHA 4ZDJA 3THWB 4Q4AA 1GNQA 4Q9JA 2R44A 5KSYA 4JLOA 4DDUA 3B82A 2WIBA 2GVDC 2ZI3A 1BOFA 4EUNA 1WB9A 4HAUA 1HE8B 5CIQA 5G3YA 4DC9A 4MDEA 2VHUA 3A6PC 1YZKA 2YZ2A 2ZTSA 4Q66C 4F93B 1EFTA 2IEZA 1JR3E 1VPLA 4JMPA 2FE4A 1Q3TA 4XTRA 1U8ZA 4TZ6A 3C41J 1OH6A 1H8HD 5FOVA 1KO8A 3A37A 1CTQA 5AUOB 1P62B 2HLDA 1QHYA 3LXRA 2QA5A 2O8EB 5E7JA 1FQJA 1ZU5A 2RH5A 5FBWB 3KQUA 4JLJA 3VQTA 2FPMA 2G6BA 4L9WA 2V4ZA 1J90A 3IILA 4MYTA 4BFYA 3AH8A 4PAMA 5DI9A 3RS2A 1CLUA 4KV9A 5CM8B 3LBNA 3S1AA 3THWA 3KXKA 1P7CA 1T91A 4EFMA 1KKMA 2JJ8A 4K81B 3UWOA 1GKIA 1ZNWA 1R7RA 3IIMA 4Q4LA 3BWDD 3LDAA 2ZI4A 1OJLA 1JBKA 1R8QA 5FI0B 2PL3A 2LKDA 5GVRA 3U6BA 3LQRA 3AVXA 1A7JA 2H18A 4DSOA 3W6PA 4IVRA 2JJ1A 5D3MB 4XD7D 2IS2A 4X8MA 1ZIPA 4M4SA 1OW3B 4RVCA 1KSGA 2A5YB 1ZAKA 2BEKA 2WM9B 2GXQA 5EP4A 3TVDA 2J0VA 2QRNA 4EFLA 4ZDKA 4HAWA 1YZLA 2O5VA 3GQBA 1FP7A 4MRRA 1N6NA 5KNBA 4TMVA 4M0LA 3RWOA 2V1XA 4JZKA 2GK7A 4HDOB 1TUEA 1KI2A 5EXXA 1KK3A 3KFXA 2W2XA 4Q7LA 1WBDA 1Z0JA 3FB4A 1CIPA 3AVOA 3PUZA 4UJ3A 1AZSC 1ZM4A 2D7CA 1LVGA 2GJAA 4ON9A 3ZYCA 1Z63A 3ZH9B 1SVOA 1YZGA 3LLUA 4A8JB 2F9MA 5BW8A 2ONJA 2O8FA 4Q4HB 3TSWA 4A4DA 2NGRA 3OAAD 2FV8A 2PMKA 3NIBA 3OIUA 3U4QA 3QVUA 3IBYA 4C7OB 4Q9LA 3AF1A 2A30A 4DCUA 1R2QA 2ZE5A 3B1WA 1OIXA 3QXXA 5HTKA 1AKEA 4LDJA 5EQTA 4IOLA 1KIMA 1DO2A 1GAJA 3FWYA 5JS8A 2FA9A 1DE0A 4S35A 3QSYA 5G53C 4EPTA 1XBTA 4IHQA 1FPMA 1XF9A 2MSDB 1A82A 1ANKA 1MR3F 3AVPA 3ONWA 4I99A 4PR0A 4BLQA 3PUVA 5J4HA 4TT3D 1SXJD 2BKEA 1CP2A 4Q7JB 1TTTA 4MDFA 3NXSA 2EVWX 2O0KA 4CEHB 4IXMA 4YXWA 1YKSA 3VNVA 1JJVA 1QHXA 2IYXA 3GJ8A 4Q4HA 5EE5B 5JFGA 2BC9A 2J9RA 2OE2A 2ZS8A 3W90A 4Q03A 1KZGB 1KI9A 4DVGA 1Q12A 4Z1MD 3AVTA 4U5XA 2C77A 2ZUDA 4JKIA 5B64A 1W2HA 3CLVA 3VU9B 5FTNA 121PA 3F3YA 3WBJA 2HJGA 4TMKA 2D62A 1NG1A 3TQCA 1NG9A 1YR9A 4QG7A 3GLGA 2H92A 4EIWA 4C0JA 721PA 2A5FA 5FL3A 3KX2A 2C2HA 3DMNA 2D3WA 3W3AA 5FBVB 3C4JA 3F8TA 4F4JA 3AVWA 5A4JA 2ANCA 3NEJA 4N3NA 1E32A 2VH5R 4RD3A 1P5ZB 5DGXA 4FMDB 4CYMA 2WKQA 4OI0A 2EFEB 3O8BA 1DS6A 2NIPA 5B30A 2GESA 1IOZA 1NRJB 2FSGA 1JQJC 2QN6A 1LS6A 3W5JA 2VP9A 2ZRBA 2ZJAA 2XITA 3K0CC 5CLLA 2OHFA 3GLFE 3R9XA 2BOVA 1NBME 2FFQA 1V43A 1Z28A 4UXJA 3SQWA 4NYMR 2JLUA 3GLFA 4RZXA 2WWIA 2NO1A 1OFUX 1QRAA 1KO1A 2E87A 2EYQA 1XCMA 3CPHA 1WF3A 3K09C 3TAUA 3FFBA 1GVNB 2P2LA 4FMCF 5GJWC 2GXAA 3GCGA 1KO7A 1OH7A 4US1R 1HURA 1YRBA 2QT0A 1MO5A 1UKVY 4NU0A 4O3MA 3AVYA 2R8RA 3NBFA 4C0BA 1OKKD 2BJVA 1NL3A 2BVNA 2F1RA 2QE7D 1E1RD 3QE0A 1W1WA 1G19A 5AJYA 2W0MA 2JGNA 4LY6A 4MKGA 2BMJA 1XPUA 3PEUA 4E22A 1QZXA 3H84A 2RGDA 5JBQA 3IGFA 2QY9A 1M7HA 4D6PA 2YHSA 4JLVA 1ZC3A 1VECA 2GBLC 3LVQE 4JBXA 3M4YA 4A8JA 4NHOA 1G9XA 2OUKA 3QXHA 5AK0A 5EE9A 3GP8A 5EXTA 1XCGB 4RCZA 4HUQA 4GMXA 4PSAA 4FW9A 1R0XA 1SKYE 3LV8A 2NO9A 1W4BA 4H1VA 1JI0A 2JASA 2I1VB 2FU5C 1G5PA 1JEEA 2G77B 3DMDA 3LXXA 4B2LA 4EPYA 3ZGXA 1TL7C 4QBHA 4DJTA 1Z22A 4RFSB 4TYYA 3SQXA 2BM0A 3DPUA 3KFVA 3Q8XB 4Q7KA 1IXSB 4PANA 4MKIA 3VHXA 4LPKA 4E5UA 3HWSA 2ODBA 1MRSA 3SHFA 3TUZC 4AKGA 1GITA 2ZJYA 3UG6A 4BRWA 2GJ9A 4JIMA 4LJYA 3EXAA 1E9CA 3GLHA 1W4CA 2Z0MA 3SS8A 3VMFA 4KYUA 4V0ME 3P26A 2VP2A 3K9LA 3KXIA 4JJKA 3TNFA 5F9HA 3IDQA 1AGRA 4HLUA 2R9VA 4LUCA 3RWMB 1Z0IA 2BMEA 3GLIB 3HU3A 4QHYA 5FR1A 2VPPA 4G1UC 2VHTA 5LBIA 3ND8A 1J7KA 3GFTA 2OXRA 1PUJA 1E0JA 1U9IC 2ZRIA 3L0PA 2CNWD 2J5XA 4IFEA 4EPXA 3DOFA 3T1TA 2G9NA 4Q9HA 5L3RA 5SZIA 1XP8A 4LJ4A 3WBKA 1Q44A 5CB6A 2V1UA 3X1WA 2W6IA 5DN6A 2H57A 2D74A 2WWFA 3QKRA 2OCAA 3ETLA 3ZQ6A 3LX5A 3QF7A 5G3ZA 2RHDA 1NP6A 4RKEA 3QG5A 2ORIA 1X1SA 4YMVA 3DM5A 2AWOA 2CXXA 3KQNA 2ZRCA 2C5LA 2JLVA 3ADDA 2XB4A 1VIYA 1YZTA 2B8TA 2QM7A 3FE2A 5G41A 3ICQB 2BEJA 4XWAA 3FHTA 1SVKA 1JNYA 1XXHE 1EX7A 1DARA 1IBRA 1N2CE 3LD9A 5H1YA 1VMAA 4L4UA 2GJSA 3D3QA 4C0AC 1YZQA 4GI7A 3I61A 4KXFB 2ZEJA 4B2PA 2PEYA 1UBFA 2QQEA 2UZIR 3V00A 3L0SA 3A1SA 3GJ7A 1T5IA 1KDRA 4M1MA 3CNOA 4QJ5A 4BLTA 2H7VA 5FR2A 3TLXA 4U00A 2EFCB 1YR8A 4A1FA 3HR7A 1QG4A 2LWIA 1SVLA 1RJ9A 2QMUA 2RGCA 1S1MA 5DSZA 3TSZA 2HV8A 1B0UA 4M9XA 3W34A 4DLZA 5JLJA 3DOEA 4TLDA 4DSNA 3EZFA 3HR8A 1CRQA 4GZLA 3ZS9A 4YC7A 4HAZA 3U3KA 3U44B 1D8TA 3AGQA 2YWGA 4M2LA 5CDFA 3V4FA 2QAJA 2Z4RA 1G5TA 2J0UB 2XJ4A 2ZU0C 1H8HA 3B9QA 3C7KA 3K0AA 3CH4B 5DYIA 3PUXA 4IFBA 4X8OA 1N6OA 2R6CA 1IXRC 2OAP1 3K0FA 3MWLA 4U7DA 2C9YA 3LW8A 1I2MA 4QNMA 4ARZA 5FPKA 1KJWA 1AS0A 4A2WA 2I4IA 2AXPA 1W4AA 4AG6A 1CULC 2RGXA 4NKRA 4ZI2A 221PA 3LA6A 1CR0A 1D9XA 3I4LA 1E94E 2H1LA 3CWQA 1HT2E 1F3OA 4G5QA 1X8JA 1OPXA 1S2MA 5TMPA 1XEXB 2J0SA 1VYTA 2GAOA 2PZEA 3BC1A 1D2MA 4WXRA 1E0AA 4KCGA 2QGZA 3AEZA 2CCJA 2C96A 2O8FB 4XD7A 1COWD 2WJJA 2YC4C 3KKPA 4LBZA 4L15A 2CCGA 4Q01A 4LV5B 5P21A 4LYAA 1ZW6A 4GRAA 2CLSA 4Q4JB 1OXVA 3TAHA 5BXQC 4QM7A 2P67A 2RCNA 4Q7MB 4ZKDA 3N2EA 3ZIAA 4A8JC 4KVAA 1DOAA 2BDTA 4ARZB 5E3HA 4HLDA 4Q02A 1OH8A 3REGA 1MOZA 4TLEA 3MG9A 5KSOA 5DHFA 2WWGA 5JJKA 4PO9A 1X8KA 4LX0A 2R6FA 4DUGA 3M1IA 3Q5DA 1S9HA 3TE6A 4YMUA 4TTQA 2VP4A 2ZRJA 3CNLA 3QKUA 4P4UA 4OYHA 4CGZA 4B3GA 4OQLA 1UBCA 3U3JA 2QM8A 1XTJA 1JALA 1SKYB 1R10A 1E9DA 2BKUA 4LBWA 3R8FA 4DDVA 1Z6YA 3FHCB 3D7MA 4BZQA 4UXIA 2ZE6A 3LAWA 1PVOA 1H65A 2DWOA 4GPTA 2B21A 4LOAA 3ASZA 4RZ3A 4DSUA 4DWJA 4E03A 5LD2C 2NOAA 2CEAA 1CR2A 2CHGA 3BBPA 4HI0E 4LJ6A 4OKSA 3FKSD 1G21E 4QGHA 1M8PA 4ZCLA 2VTKA 2ERYA 3DZ8A 1YHNA 1NMXA 4URUR 5FOSA 3O47A 2F6RA 4TYNA 4DB4A 4V03A 1NMZA 1ZJ6A 2FSIA 3LWNA 1RYFA 2EYUA 2ZREA 2FFAA 3H0KA 3NVAA 3R7WB 3I5XA 1R0WA 1DVRA 4P33A 1HY3A 1QVRA 1FX0B 1YJ5A 4AKEA 4DKXA 1DAIA 4TT3A 1S3SA 3REFA 4KLZA 3HYRA 5JMTA 4FMBB 2ZJZA 3N5CA 3B1XA 1E0SA 1DBSA 1G7SA 2ZJOA 4MGKR 4AK9A 2W6JA 5KHOC 1EESA 1ZNZA 2AN9A 1GIAA 1NBMA 2OBNA 3NKVA 1ZP6A 3D6TB 4URZR 1XD2B 4F38A 2IYUA 3B5JA 4JVSB 4ZI3A 4HYYA 2BHRA 2GCNA 2QPAA 1L4YA 4M9SA 2RGAA 3W8RA 1S8FA 2XGJA 5FPYA 2ZSDA 3VKGA 1TUIA 1XTRA 4JBWA 5IK2D 4D26A 2KBFA 3VHLB 1FFHA 4KBFA 2Q3MA 3GLGE 3EARA 3WMEA 1RIFA 1Q3HA 4KJZA 2WSSA 3KJEA 2AL7A 2ATVA 2WWYA 4M1TA 4QKQA 3PCRB 1IQPA 4ZDWA 3AF4A 4BEJA 1RW4A 2FJUA 2C98A 4IOJA 1LB1B 1I4TD 5DI3A 1TAGA 2FFBA 1T3LA 2RGGA 2D4HA 1SVWA 2P0EA 2B6HA 2VLIA 3IBGA 4G5SA 4DDWA 1LTQA 4B3FX 3WHKA 1KI8A 4DLYA 1E2PA 1M34E 4IDPA 4BUJA 1MH1A 1YR6A 2FEOA 2GZAA 2IYSA 4MA4A 4W5HA 1GOTA 3SBDA 1C1YA 3R8CA 2OCBA 5JJLA 4I1SA 1TEVA 2CHVA 1ESNA 1HUQA 3E70C 4QBIA 1W5SA 2OFWA 1R0YA 2C03A 4Q48A 5BN3A 2NO0A 2ZRHA 3ZD7A 4HLCA 1MT0A 1OXSC 1CU1A 4Q4JA 1W4RA 3BK7A 4XIGS 2HEIA 4N0EA 1TQDA 1U9IA 1KY2A 3I72A 1J99A 4LYJA 3SE0A 2FNAA 4G3XA 4MH0R 1S4QA 2ZRNA 4DSTA 3AV0B 3THOA 2N42A 1ZCBA 2IYWA 2QPOA 2HF8A 5TARA 1RFLA 1FNNA 3PITA 1P73A 4C0LA 3OESA 1E0KA 2W58A 1ONBA 2Q3FA 4JLKA 4LV6A 1A4RA 4EQ6A 4NMMA 4EJSB 3IQWA 4LJ8A 3QNUA 3SI7A 1MO6A 1QHHB 3QF4A 2DYKA 3FGNA 2Z4SA 4HUTA 3K70C 1OB5A 1E2JA 3CF2A 1P6XA 1KK0A 3ZLJA 1E2GA 2ZRAA 1L8QA 1Q1QA 2QI9C 4GBMA 3ZVLA 4DLUA 3QIAA 5AUPB 1XMVA 4V0OA 3OFNA 1Z07A 4DHEA 2ZS7A 2G83A 3KTAA 4TL9A 1BMFD 2J59A 5CK5A 2O8DB 1YU9A 3W3ZB 2DR3A 2O8CA 1CKEA 5DO9A 2XZOA 4BLRA 4JLMA 2H17A 5AJXA 1ZM7A 4B3CA 2NO7A 4P3YA 1JAHA 5FUXA 5AJVB 2GXSA 3CH5A 2WKPA 2KWIA 3ECCA 4RY2A 1CJMA 2XSZA 1JECA 1JPNA 1LV7A 1IXZA 2OBMA 4OI4A 4PC2A 4PFSA 3GMTA 2J7PD 1QVAA 3RYTC 1TQ2A 4M53A 1M74A 1RVDA 2CK3A 4B35A 4WA7A 4B3DA 5JCPA 2AFIE 5JRZA 3WNDA 4LZZA 1CJKC 4AI6A 4W9MC 1Q1EA 1KO4A 5DLQC 4PTLA 1KGDA 4FWTA 4JYBA 1VG0B 4M9ZA 3EX7C 2JDIA 2AXNA 2CJWB 5F9FA 4LPSA 3FMFA 2CNWA 2MSCB 2JCSA 1MO3A 3CF6R 4BPBA 4K8OA 3PXGA 1IAQA 4R71A 5C46F 2P65A 4LJ7A 1XDBA 1WXQA 3QI2A 1KSFX 1E3MA 1HE1C 2J0QA 4A2PA 3T5DA 2C9CA 5KUTA 4CEJB 2GF9A 1W48A 4BEBA 621PA 3AVQA 3WYGA 4P4SA 2O8BB 5F3WB 2QP4A 4FI3C 4OHWA 1T0HB 1E2DA 3ZJYA 2WWHA 2ZU6A 1GRRA 2QL6A 2CLDX 2YWHA 3IIKA 2P6UA 3BD9A 3SOPA 2F1IA 3UK6A 3OEHA 1PLLA 5K8TA 2F43B 2CHQA 1EWRA 2R6AA 4FIDA 4KO8A 3X2SA 4MRVA 1A1VA 1W0KA 2I3BA 4LJ9A 3R20A 1EFCA 1ZNYA 2CJWA 2DCUA 2G1KA 3CW2A 5FFMA 3SZRA 2V7QD 4CF7A 4F91B 1LF5A 4GOKA 2OILA 3OHMA 4RCYA 4BE7B 4B74A 4OL0A 2OLKA 2QMOA 3X1DA 3K70B 3AVUA 3LY5A 4V02A 5HPYB 4PAOA 2DPXA 1X8LA 4I1UA 5DISB 1XCPA 521PA 1NVVQ 1XPOA 1G8PA 1BS1A 1JPJA 3JVVA 2O8EA 4ZCIA 4MGYR 3L2OB 1OSNA 2FZ4A 2GVZC 1W5TA 4Q5IA 4P4SB 3TSOA 4CEIB 3F5FA 2FH5B 2ZRFA 1I4DD 2BIFA 4FMDF 1F48A 3R9WA 1XZQA 2C8VA 2JJ2D 1W36B 1K5GA 3DHWC 3TKLA 2ZR7A 4G01B 5HE8A 1P9NA 4B3BA 2FZLA 3AF0A 2ERXA 4WZBE 4R2HA 1DAKA 4WAUA 1NVVR 4PSVA 3TUIC 1G1MA 4OK5A 2WHXA 1LY1A 1KI6A 3CB4A 2VHCA 3TH5A 1VG1A 3RVBA 3ZS8A 4E09A 3A36A 5KSPA 4EFNA 4GDFA 3K8YA 2AR7A 1PUIA 2VSOA 4PPNA 1E69A 3IQXA 3I92A 2NTYC 2IK8A 4XWKA 2G0TA 4AYXA 2GCPA 3ZZTA 4GT1A 1FUUA 3UATA 2HLDD 3T1OA 2XX3A 4CIDA 1NVXQ 4QGFA 5CLQA 3CWZA 5CM9C 4B6FA 4JLAA 3QXJA 4XSGA 3CKLA 5EP2A 4IRUB 1HA3A 2EFGA 3FHOA 2QGNA 2VF8A 5L3QA 1N6PA 4Q1FA 1EFRD 4RFSA 5AWFC 2PLFA 2MMCA 2YC2C 4TSFD 5ELXA 4OI1A 4P32A 5JI3E 4JVNA 5FTJA 1MRNA 2A5GA 2ZJ8A 4A15A 1DO0A 3G5UA 1G7RA 1F60A 1G3RA 2UZ3A 2FX3A 4DLWA 4ERNA 1UM8A 2ZI9A 1KK2A 1P2VA 5J4VA 4OQFA 2D2FA 4YDSA 4EPRA 3VX4A 1COWA 4OK3A 3U2QA 1XTIA 4ZDIA 3A8TA 2V3CC 1N25A 5JSZA 2ZYVX 3KKOA 3VR2A 4Y0AA 2IXGA 5BN4A 1G17A 3CPEA 4RZ2A 1U2RA 3ADKA 4WBSA 1OYYA 2HT6A 3QPWA 2IUUA 2PMDA 2QQ0A 4MGZR 1JR6A 1BH2A 5JEDA 4BFZA 3I5YA 2ZS9A 3A4NA 1Y3AA 2J3EA 2O0JA 3TQFA 3CX8A 3FKQA 1IN7A 1ZC4A 3LQQA 3TUJC 3SFZA 3PENA 5LB2A 5E4FA 4MYUA 3SN6A 1X3SA 3TRFA 3GPLA 1Q21A 1ZVQA 2V9PA 4MQBA 1T5LA 1JAIA 3JVUA 4Z54A 1KK1A 4CEJA 1SHKA 1G7CA 4FD2A 4TQUS 4MUAA 4QBFA 2CVFA 3EZ9A 1E9BA 2VO1A 2HCBA 1VYVA 2Q9AA 2YWEA 2IX3A 3RS3A 1TNDA 2A7QA 4PHGA 3ZVNA 4CEHA 2GKSA 1K6MA 3KDSE 3OAAA 2ZSAA 3Q85A 4BLOA 2MSEB 4JKYA 1XNJA 1UAAA 1Z0AA 4PHTA 4BLPA 1CR4A 4LHVA 3SDZA 3NBYC 4PHHA 2MMGA 1D5CA 1KI4A 2X77A 1I4LD 1KI3A 5BYKA 5GJBA 4PX9A 3B6EA 4V0MA 3RHFA 3G0HA 5TB5A 5KU1A 5DHAA 2QZ4A 5TXGA 1E2MA 3A4MA 5ANRB 2QP3A 5C1BA 2IT1A 3TJZA 2ZITA 4RD4A 3GLGB 2B92A 3P32A 3PIRA 1Z47A 3CM0A 2J7KA 1G4AE 1G64A 2BBWA 5SZJA 2X2EA 1F2UB 1DAGA 2IXFA 4ZCMA 3OEEA 4HLQB 4LV8B 1GRNA 5GJVC 4AG5A 3Q3JB 2DWPA 2GCOB 2WJVA 2ZR0A 3R9IA 5M04A 1Z06A 4TWZA 1M6NA 5E7MA 1BKDR 4TLCA 3GEIA 4ZPXA 1QG2A 1MABB 2IEYA 3KKMA 2ATXA 3RSOA 1EWQA 4B75A 2Q21A 3NBXX 2RGNA 5EZ6B 3T1QA 3U7HB 1M2OB 5JCZA 1BYUA 3OIWA 4TQ9A 5AUNB 1GDDA 3B1YA 1Q1BA 2VSXA 2N1BA 1KHTA 3THXA 3BB4A 3EWSA 4JL8A 3TR0A 3ZVRA 2X2FA 1GKYA 3GLIE 3SJAA 2HF9A 3C14C 3GJ0A 4YONB 1AS2A 3U5ZB 1OIWA 1XU4A 4KBGA 4TL6A 1IM2A 1U81A 2EWWA 3B85A 4A36A 1ZBDA 3VR3A 5CIWA 4GOJA 1SULA 2O0HA 3UANA 1AM4D 1SGWA 3W9YA 3RS7A 4BECA 2IS6A 1E1QD 2GTPA 3A1TA 4W5JA 4JL5A 1Q1ZA 1FQKA 4BFVA 4QGAA 4QGGA 1KSJA 3B1ZA 3VTKA 1M1YE 4C0SA 5JJIA 2H16A 1N3BA 1MO4A 1XTQA 1NLYA 1P9WA 3SU8A 1PLJA 1S0UA 4DBLC 4AY2A 2IYLD 1SXJE 3EPJA 2RGBA 4QJ4A 1KOFA 1YZUA 2ZRLA 4RZUA 2IWHA 4A92A 1JQLB 3EZ6A 4YDHB 1IY0A 1NJGA 2JLQA 4KODA 3T12A 4YMWA 4RKFA 2A3RA 4NPHA 4TTRA 4QC2A 1F2TB 1X6VA 2JA1A 3EZ7A 1J8MF 1LFDB
chains in the Genus database with same CATH superfamily
1HT3A 2BSXA 3D4BA 2PJRA 1V8PA 4GL2A 3DHEA 4A9AA 3GV0A 3T0GA 4GZ5A 4H7EA 2OFPA 1ADCA 2HL6A 2GD2A 3EF3A 3WV4A 4E21A 4HGOA 1NLZA 4KAFA 3RO7A 5L3ZA 2O20A 1EGVB 1T0BA 4L95C 1LGYA 4AX4A 1J2EA 1VDZA 2BEUA 2VXOA 3CX7A 2KHZA 2Y1CA 5DDIP 1N1GA 2DJ5A 3KSRA 3VVCA 1EK6A 3CVOA 2GI4A 2Q6KA 821PA 2B7BA 1UK9A 1XZMA 1CW2B 1SUIA 3ORRA 1UP6A 3N70A 3T0FA 1IOLA 4R7ZA 4R3UC 4RZQA 4HBZA 1AV6A 5KPDA 4DCTA 2PBLA 2VIIA 4WUTA 3LTNC 2YXDA 1W96A 2BD0A 1I3CA 4EKYA 2DBRA 3N6RA 1JTEA 1G2OA 1NONA 4YQEA 1LZLA 1W2GA 4MAAA 4B3TB 4FN5A 2J6IA 2BM9A 1W88B 1CQXA 4KLRA 4YAEA 3AKDA 1QB8A 5AMXA 2RIPA 4QUKA 3NOXA 2V3VA 1FSPA 2OO5C 1H05A 1FUKA 3EN0A 4K03A 3GLRA 5IF3A 2QVYX 1ACLA 4KQ9A 4LDQA 5CDGA 3W5BA 3E3OA 5HJ2A 2CV2A 3RKRA 2JI8A 3ESCA 4NEQA 4Q9KA 2WR8A 4CMBA 4HXEB 1C7FA 3RIXA 1E2FA 3SICE 4B32A 2P7HA 4Y6PA 3PT5A 2ZBUA 3UT0A 3IUYA 4PYOA 5ERXA 1PZXA 5TPZA 3M34A 2Q2VA 3QNMA 3LKVA 1GNLA 2XEDA 3AKEA 3HADA 3O1JC 3VJLA 5JNSA 1GXSB 4BFWA 5K0ZA 4GYKA 3EWNA 3IEXA 4BC1A 1KO5A 2QXUA 3GGCA 4OB6A 3ZTWA 4DM7A 5BR7A 2HR1A 4K6FA 4BDSA 1L5QA 2P4UA 4JLDA 5LZ5A 1FW8A 1NATA 5HCNA 1IBSA 3O3NB 3W06A 3F9RA 3ZCSA 5C8ZA 1R00A 4PPFA 4RK7A 1NFRA 2CUNA 1C8BA 4YMTA 2GNPA 3MAAC 4KFTA 4C4PA 2Y27A 5A6VA 3I5AA 4PAQA 3DEZA 3T3NA 4HYEA 3W6NA 5LYYA 3U37A 4R9UC 5BYJA 1K7EB 2IUFA 3HMKA 1PYDA 2DFLA 3MFYA 3QXSA 5KB3A 1VPWA 1SOWA 4ER7A 1TYZA 4A0FA 1MAHA 1Y8AA 2CVPA 3L0IB 5JHGB 4YRQA 5ICEA 1N0VC 3FGPA 4ND2A 5JDIC 5E3IA 5ITSA 3NRJA 2C95A 2QRLA 3UMJA 1K2VN 3F2IA 1Z5OA 4I5EA 4IVQA 1FXSA 3KEFA 2C94A 1TVKB 3OM1A 2VTDA 3E05A 4HEJA 1O9GA 1V5WA 4IKPA 4P81A 4HWGA 1UDWA 4J1TA 4RM3A 3SQLA 4O25A 3DT8A 2I1QA 3GUHA 4QO7A 1ELOA 1KAOA 5EGSA 4DYDA 3A2MA 2VK8A 4OVKA 1CYDA 3EXG1 4YMSA 4GGMX 2TMKA 1NASA 2LE0A 1QXSA 4IW3B 5KYKA 3BS4A 1YOVA 2YXLA 3JQAA 1SY7A 4OV6B 2EKZA 5FI3A 5FWYB 1ZVMA 2WBLC 3A6EA 3ZZ0A 2VH1A 2NUTB 3IO3A 2SICE 3IQFA 5HJ5A 1KDYA 5AVKA 2A67A 3WYNA 1BZYA 1F14A 3BSFA 3D43A 3PHHA 4F7WA 3WLIA 3EIUA 1QB7A 1J1IA 1G4UR 1YQXA 1G59A 2V7QA 6ADHA 1WD5A 1RLUA 1BX3A 4F5EA 3RFXA 5DNVA 2B9EA 1BHQ1 2J3IA 4ZAVA 1ICIA 4IEIA 3CQ9A 3O6VA 2QX4A 2J1LA 5B1HA 1LNZA 3DXFA 4UOZA 5BNWA 5IKMA 1VFNA 2TS1A 3AF2A 4GVPA 2XDQA 2NO6A 2YYYA 2O5CA 3S8YA 2WTMA 1M75A 1XVLA 3ZDRA 3ZYZA 2JJ1D 5CVJA 2Q2QA 1R0ZA 5L6MB 4EI2A 4OQMA 5D7BA 3MHTA 2OYRA 4R2LA 1WA5A 4GPEA 4GG1A 1QFJA 1S2GA 2DQ4A 3MJRA 3SQOA 3ZHRA 4EEXA 3AJDA 4EYKA 5C4MA 1ZJZA 3WHLA 3H5NA 2BF4A 2B83A 2R1UA 4J16C 4MVWA 3H5OA 1RPNA 2G80A 2V96A 1RPAA 2OZEA 3NS7A 3O8OA 1JEYA 1L6IA 1EMDA 1XZDA 2OXFA 3F78A 3OKFA 3HPQA 3NHRA 4L4XA 2H4ZA 4D0NA 2YNMC 3W4IA 5KWEA 1M1ZA 4E15A 1Q7CA 2LR0A 3EPPA 1G66A 2GEDA 3FVTA 3KD3A 1P4JA 1AHHA 4GI5A 3HRKA 3BB3A 2XCQA 3KETA 1D9ZA 3DWFA 3MAGA 1JR3A 4FHEA 3R77A 4HR7A 1DPGA 2VDWB 2F3SA 3NCTA 3HEAA 2CSUA 3Q9SA 4QAQA 1U8FO 4MQMA 3BILA 1Y5RA 3Q2OA 1L8AA 3Q6NA 4U0JA 4RAQA 5BN5A 1DJMA 2WIJA 2PX0A 1A9RA 3SMVA 5IVPA 4B82A 5JRDS 2IZZA 1E3DA 2DUJA 2IPAB 4OL9A 3PDIA 4KU4A 5DXJA 1H3EA 1QRRA 3GHHA 2ZBDA 1KVTA 1B6SA 2R8XA 3O8NA 3ND7A 3SPXA 2QNRA 4LHYA 2O8CB 4GWGA 2OBFA 2PL9A 3VI3B 2G5CA 3OTGA 3EEYA 3UUGA 5L7WA 4Q1BA 4UPDA 4EY6A 4I1VA 4KW7A 4XEUA 1U0LA 3R3SA 4YT2A 4ND1A 2OR3A 3WWZA 4P0QB 4U2FA 2VHXA 1LLQA 1XQVA 1XTTA 1DI0A 2G8LA 3IJRA 4OM7A 4D42A 1RWMA 3QKSB 1KEPA 2O05A 1YL7A 5LNK1 5ADVA 3DLAA 2LBPA 3AKYA 5TIIA 3U7GA 1II9A 3IAM6 1BYIA 3OM8A 5E7IA 4FEEA 1JEDA 1Y5NA 3UT5B 4WVLA 3RC2A 2A5JA 3GG2A 4RV5A 3ENWA 2YKGA 2AZTA 1RTTA 5G0TA 1SXJA 2QLJA 4CM9D 2P78A 4IHJF 2D1SA 5LB4A 2P91A 3V3KA 1SVUA 5L40A 4IMIB 3C5CA 4FW8A 4M7RA 5CFQA 3QVGB 5CXUA 3EAGA 1OHHD 1DCTA 5EIHA 4J7AA 1PL8A 4JYZA 1GNPA 1NT4A 1P3JA 2ARKA 2QUHA 3B8EA 4O1MA 4QFDA 4DXAA 1XX6A 1PJRA 1O1YA 5DGTA 3D31A 2HBYA 2HPZA 1YT5A 3A9TA 2O2YA 3QHQA 3C1OA 1TRHA 1FP6A 2ICAA 2H63A 2AZDA 4MHTA 3HV2A 1J25A 5AVZA 1T4GA 1TADA 1D2RA 1NVKA 2MINA 4REMA 4BO7A 2RHGB 2C00A 3DKPA 3H9CA 1VPDA 3ETEA 1JB9A 2ZAOA 5EJ2A 4B73A 2HRRA 3KG2A 3KZ1E 3ONFA 5D2CA 5JEEA 5KJ1A 4XB1A 1TTQB 2XUPA 3GLIA 9ATCA 1K1EA 5FOXA 1EUCB 3TRIA 5I7FA 3F2VA 2VF2A 2WQ7A 2HUPA 2NMVA 1G16A 3E9CA 1XEAA 3IRUA 3OF5A 3LUCA 2QRHA 3D8BA 4QQFA 4AECA 3B3QA 3RHZA 3C7DB 2NXWA 4L8WB 3HSYA 2W2OA 3TLMA 4NCXA 3WMFA 4TQAA 3PICA 5CMLA 1H4VB 3G8AA 1Y1RA 1Y8QA 3OTIA 5F35A 2OAGA 2XA1A 1P2BA 3CNHA 3TJMA 5IDVA 3Q11A 2AMVA 3FNFA 4KQWA 3E9QA 1MNAA 5AJZA 5DNDA 1KDPA 5B1YA 2EIHA 5KPJA 1QTIA 1NN3A 2HBRA 2R3SA 5IT9A 5JXHA 4HXYA 1EYZA 3HA3A 3PWSA 5I7SA 4C4TA 1OBCA 3DL4A 3NAMA 1HDYA 3RUAA 1FXUA 4M8LA 4WV3A 3WGMA 3FOBA 5EEGA 1JS1X 1MGOA 4EMSA 2Y1EA 4P82A 4PQRA 3CTMA 5EPOA 2DU8A 3U7FB 4LNUB 4OMFG 2XVMA 4LC9A 3IOEA 3EG5A 3JY6A 3F4KA 3E35A 1A5TA 4QQKA 3V33A 3D8HA 5ILQA 2WWWA 2IWRA 1GAQA 2XLCA 2AUNA 2ZTMA 2EW1A 4Q3LA 1NT2A 4RHYA 3CR7A 3HJCA 1LDMA 4HN4B 5DGDA 1NKSA 1SOMA 4TGLA 1LH0A 4CE6A 3G2LA 4BXOB 3DE6X 3LL7A 3QBJA 4WKBA 2GUWA 1AKYA 1KI6B 1P1HA 2HLPA 2Q8NA 4PGMA 4JA0A 2QZJA 1BMTA 3V1TC 4RTSA 4I4NA 3MYRA 3K71B 1K8ZB 1H2FA 4BNXA 1T2CA 3ZGZA 3TX6A 3DXYA 1ATIA 1SZPA 5FHQA 3SXUB 4BO3A 1DRJA 2BZSA 1NV8A 2GEVA 2X86A 1CNEA 1NLUA 3H5AA 3TZKA 3VZQA 2CLCX 5BNZA 4DV7B 3T7AA 1V1RA 2OOKA 3VOSA 3H5VA 4C7VA 3HFJA 1CT9A 5AM4A 4J3FA 4EPWA 3IURA 4I14A 1XVIA 2RG7A 3VOBA 1AMOA 5IVHA 1T15A 3AHIA 3QWHA 4QBKA 3PFIA 1NJSA 2WV9A 4ONEA 1JSXA 5JPIA 4FZRA 3ZGLA 1IZ9A 3M1LA 1X1CA 4MP8A 4BUCA 2HPAA 3FYUB 4MRNA 3FR7A 3UUFA 1UIMA 1ZISA 5AM0A 4DIEA 1TJ4A 4D56A 3CE9A 1GZVA 1FLAA 2BZ0A 3BFXA 4IS3A 3JVIA 1QCYA 5DWDA 3L3BA 4HDKB 1GZUA 4ND5A 4PLTA 5CUQA 3NORA 3WXMA 2Y71A 2CXUA 5JH7A 3DTVB 4S1OA 4TS4A 1SCNE 3ROEA 2BMVA 1IMJA 5JO0A 1ORRA 2OY0A 5LBTA 5IMSA 1XPRA 3KDPA 3K2IA 3MGBA 2B4QA 1UFRA 2GBPA 1E5QA 2X9NA 4YCJA 4AZ0B 3K0EA 2QL5A 4OU5A 3UKOA 4ALKA 5DTQA 1QQ7A 1XEWX 2Z6VA 4CL3A 1X1RA 1VIMA 2OLJA 1P0IA 2GS9A 4J1QA 4C4SA 4RZSA 1ZWKA 3PLAE 3PKIA 3C16C 3NV9A 3VI4B 2R85A 4YWJA 2SECE 1BXGA 3L0YA 2CFTA 2YIMA 3SJUA 1XJCA 3KL2A 5AKEA 3IR5A 4J0QA 4UDOA 5ILGA 4FB5A 3CVJA 3LUJA 1TZBA 3QPBA 5DTJA 2RHCA 1THZA 1FYXA 1SEPA 3G3EA 3OU6A 4P4TA 4RGQA 4EB6A 3AMVA 5BO5A 2CDNA 4FZ5A 3TZCA 5IHPA 1WNFA 6Q21A 1XYGA 1M66A 2WYVA 2I2XB 1R12A 3F71A 5K0SA 1UOOA 3H5WA 2VK4A 1SRRA 4DCCA 5CXXA 3EC2A 2CVHA 1ZONA 5FUWA 3W9SA 3BIOA 5TX7A 2PUEA 2POCA 2JI6A 2QENA 4AJJA 4LOKA 2CDBA 1GZ3A 5L3SB 3EEOA 1OQAA 2JIBA 1E5XA 1T5BA 5DGCA 2PGNA 4RXUA 2D59A 4DRYA 1C1XA 4PZUA 3PJRA 2YV2A 3PUYA 4TLBA 3JZIA 2HJWA 4KR9A 4WL0A 4F6RB 3L7LA 3RC1A 2IW1A 2Z5LA 4C6TB 2G5TA 4BV3A 4URYR 1F5SA 2O0MA 1WUTA 1LPBB 2HDNB 3JQGA 3R6GA 2JFPA 3OOHA 3HDVA 1L7QA 3SYKA 4BNIA 4DM3A 5FTLA 2PGLA 2W22A 2QZSA 4RJJA 4EMBA 3KQHA 1S3GA 1T29A 5IZCA 1VJ5A 2C1EA 2ZI5A 3C5EA 2L0XA 2RBGA 3D2BA 4H9GA 4LOLA 1G60A 2KLHA 2OO5A 2XD4A 4YUVA 2QVLA 5KNBD 4XDHA 2W2LD 1B93A 3DL2A 5F2EA 1CVIA 3SM9A 4CVNA 5HKAA 5KJFA 1ZJ5A 3I1IA 3MC1A 2ID9A 1MAVA 2O8BA 3PD1A 3UV3A 3RG8A 5L45A 3IUNA 4II3A 1WRBA 5F2OA 4FGWA 1REQA 2I4OA 2IF0A 3IHLA 2VUIB 4UE3S 1KJYA 1MHPA 3SS7X 4GOOD 4A0SA 1I24A 2GQ0A 2CDAA 1GJRA 3PEWA 2YHBA 3NOOA 1FY2A 1OLSB 2JBAA 2FPPB 3GEMA 4FCWA 4TKVA 4D9GA 3N7UA 1TQ4A 2PLRA 5AVVA 1IONA 3LO5A 3DDCA 2R1TB 2ZK7A 5KCMA 4JT2A 4N40A 3GT4A 3MA0A 5FCDA 4DA8A 5GV8A 4GPAA 4R98A 4RTLA 3HSKA 4QYIB 3N3AC 1KDVA 1WE2A 1EVKA 4MDHA 5TMBA 1NI4B 4O4LF 4YY3B 2YDXA 3NWJA 3A14A 3JSAA 4NV1A 2I8CA 3OF2A 3M70A 4CPDA 1RXEA 1P4SA 4WKPA 2W2NA 1BIFA 2F43A 1T9HA 3CLHA 3H8WA 2XIQA 1DFGA 4NJEA 3B2EA 3IT2A 5JDCA 3P27A 2Q9BA 3FVQA 1M3SA 2PIAA 2QDXA 1KYZA 1ZNXA 1EG2A 3GD5A 2JKZA 3OX2A 4WXHA 1F4VA 4HJRA 3VNRA 4ND3A 4TSRA 5JWOA 2QQ5A 1VHQA 1I14A 2CCKA 3IP8A 3ZH2A 3T3HA 4V3CA 3U4AA 5A4FS 5LYJF 1W0CA 4UNQA 1EFRA 2PIDA 5IAGA 4HZUA 2Q9UA 3JPYA 4PO8A 1NIPA 5G0UA 1IZ7A 4XDZA 4BASA 2R96A 2V6FA 3SVTA 1LF0A 3GT7A 5LCXA 3RBXA 4BWYA 5SICE 1QHNA 2LKCA 2W8BA 3F6EX 3M3PA 4JXJA 1LPMA 2DAPA 5H80A 3RC9A 4P35A 1OKKA 4MAMA 8ADHA 2AQKA 2ZGVA 4GRDA 4Y7DA 1TJ3A 1W5EA 4EG7A 2OPBA 4ESVA 3R9XB 2TECE 3ELYA 1CV2A 1LJUA 2CMDA 1ZK1A 2Q3LA 1CF4A 2ODNA 1F17A 2QVBA 5DNEA 2BSQA 4MCJA 4MKXA 3D0KA 2QR3A 3QH4A 1O03A 2XZTA 3IKVA 4CKCA 1E2HA 4U7TB 4EB0A 5ALLA 1EUDA 3QMVA 1NRWA 4XVUA 5EIEA 4JP8A 3KPVA 4PC3A 5EWMA 3TCXB 3EH2A 4DG5A 5JJ5A 3BFVA 4QOHA 3ROPA 3G0CA 1L4KA 1EXVA 4KFUA 1IY8A 3P2EA 4WGGA 1PGQA 1ZJJA 4FP9A 4MR9B 5TRTA 5IXJA 3KPUA 4F11A 2GDZA 3G1TA 1U3UA 1YS4A 1LI4A 3IEVA 1YVUA 3E2IA 4GP7A 5TNXA 2FZGA 2IX9A 1U80A 1GGJA 2CY0A 2XGMA 2IQIA 2XB6A 2VTVA 1IB6A 5LJIA 3PGKA 4DLSA 2V55B 4DV3B 3SYNA 1IEXA 4FGKA 2HYIC 3UXMA 2EV9A 1WMFA 2BFFA 3DEIA 3MRXA 3GJ6A 1E2QA 5JNVA 1I6MA 1E5TA 5SY6A 2A57A 3IPRA 5A4KA 1SM4A 2AI3A 4H0NA 2BJHA 1KR5A 2SNIE 2II6A 2VSFA 4M1OA 1IVSA 1R9MA 1MEEA 4L7VA 1EK1A 1QJCA 4QDZA 1AF7A 3AB7A 3IKJA 1SXQA 1GRQA 4HDRA 3BE6A 3T9CA 1MB3A 2YUIA 4I81A 4RH3A 1UKYA 2ES4A 1ZM3A 2WJWA 4D4KA 4RYDA 1H8EA 2J9YB 4OLFA 3CRZA 3K2EA 1NC3A 3ELWA 1SB9A 1GZ6A 2BEVA 3WYBA 4HHEA 5CDFE 3BL6A 4U6QA 4DAEA 4Q37A 3TGPA 3K9WA 2EJCA 4OXIA 4NVRA 6REQB 3D6JA 1NMSA 1ODKA 1BGWA 3M33A 1WY7A 1ISGA 2P6NA 1FYVA 2ZE8A 5K0BA 1A1SA 1W47A 4B34A 3DF7A 3CINA 3GAFA 4JL6A 4LIPD 4QREA 4RGBA 2WP8J 3DKIA 3EPRA 3FAZA 4D4MA 4EP1A 1DGQA 1WLSA 1M9NA 5TMDA 2XWQA 3PC4A 1CUFA 3NHBA 3ACCA 4M1KA 2KE5A 4DRXB 3EWAA 4D92A 1Y1KE 1NMYA 4WE3A 4EPVA 4EKEA 3F6RA 1CUSA 2J4DA 1B2RA 2OHOA 1DQZA 2WAXA 3VNBA 1TVMA 1W59A 3I2FA 2WP0A 1ZK0A 3CUUA 4XWGA 2JHCA 1IY1A 2MDTA 4ND8A 1WZUA 2G04A 3BMXA 2I2CA 3L7DA 2RHJA 3WSVA 2G0AA 3I28A 4B45A 3KU4A 1E6MA 1N5OX 5F73A 2KBEA 3P97A 5LYJA 1M0EA 1Q20A 2HK7A 4QU0A 3U3RA 1F6BA 2J9XB 2W4IA 3O38A 5PGMA 5K20A 3A2LA 4RK1A 1HE5A 1LDGA 3OZEA 4S0ZA 4LBYA 5FADA 2ZQ5A 1S96A 4LQCA 3VZDA 3LHFA 4HQLA 3TLGB 3ZE2B 1FSGA 1UKEA 2FDCA 1E2LA 4EVIA 3E1KA 2FRDC 1U3CA 1B3BA 3Q7IA 4B3XA 5LXTB 3DDZX 1NJ6A 1QF9A 5CJ2A 5JATA 4GI2A 3RUDA 3C24A 4TX1A 2L19A 3EIQA 4YCDA 5MGBA 4AX8A 1UK7A 1DDOA 2B5VA 3TCKA 5BV7A 3AV3A 4NTZA 4XWTA 3K9FC 3O8RA 1OAAA 2DTXA 1X7WB 1A2KC 3LE8A 4CIBA 2RB4A 2VEOA 2PVCA 4IOKA 3CN9A 1M0WA 4MZDA 4MITA 3VO8A 3HK2A 3PEEA 1ADGA 3HU5A 1Z08A 2P6PA 1FDRA 2PV0A 4LZPA 1NBWB 4ZEXA 2YQ5A 3QKRB 3KL4A 4C06A 3WSWA 1CRWG 2C7RA 3N75A 3GNTA 3IO5A 5JMPA 1DADA 4EL5A 3BERA 2P2NA 1ZH6A 3OBBA 2EEZA 1CUIA 3SXJA 3WYCA 3QG1A 3VVBA 1JA1A 1JG4A 3UH1A 5J58A 3JS5A 3WBBA 1IEWA 1PJ4A 4LE2A 5CLHA 1H4SA 2ZIXB 4O0MA 3TKYA 4KR2A 4ZTUB 3C2QA 1MQAA 1ND6A 1JZSA 1P18A 1YONA 4RPGA 3HUEA 2FMUA 1JZQA 3NHJA 5BV2P 2ASEA 5B7QA 5KYTA 1AQUA 1G21A 2AMFA 5B2ZA 4Z0NA 5EKDA 5LDGA 3OX1A 1XN1A 1R4MB 3DZCA 3I58A 3P9RA 3NEAA 4Q1AA 4KAAA 2VOJA 2NO4A 1K97A 5DULA 4L02A 4RCVA 2GBCA 3ZXUB 2H5EA 5FOTA 1LJ8A 3IDZA 4TZKA 1AHNA 5FPHA 1MP0A 3G2MA 3RGWS 1O58A 3GLKA 1JU9A 1TZ2A 3OHPA 3QENA 1KZ7B 4EVQA 1EG7A 4LXYA 4P7KA 5M3BA 5T3YA 4F4DA 5HK9A 1SVMA 4P0PB 3GEGA 2FLVA 2CZCA 1BVUA 3MCVA 3K5HA 4RK0A 1FDVA 1H2HA 1UBSB 3I6BA 3IVMA 4BC0A 4E14A 3PHIA 4Z0TA 1DKPA 1P60A 3CNEA 3C5WP 1OOEA 1H5QA 3IB6A 3JR3A 1N9KA 3PCTA 1L2TA 3RTDA 5F7XA 3U60B 3QZUA 4JLBA 4BKRA 3KZOA 3WGUA 4V0KA 5BQFA 2HOQA 5FAKA 1GKUB 3D54D 4NYJQ 2ZUWA 4ZCTA 3LGXA 4WN9B 1SIBE 1JIUA 2DY1A 3VR5H 2XUGA 4D8WA 1Y80A 2XWJI 3RRJA 2H2HA 3X0DA 2PX8A 4PNZA 4RF2A 1F7UA 5GOTA 2I6FA 4F3CA 4EB6B 3BMOA 4NR0A 1O6CA 3ROKA 1CBUA 4M0DA 4C2BA 4ENVA 4JSRA 4TV9A 4TZ0A 1UXOA 3B13B 4Z3OA 4MS3A 5HILA 4EBBA 2FW9A 1A4UA 2BLNA 4QYSA 4UHFA 4AM8A 4S1VA 1KZ9A 1E7MA 2JLSA 3OY2A 3FCXA 4ZU3A 3T7IA 3UJ8A 1T9ZA 2CKMA 2VZLA 1OV4A 3BK2A 4RMHA 3QF4B 2VTBB 4B33A 4Z6KA 1ECGA 3IPXA 2JIZD 4U0KA 1Z5NA 3HKEA 4IOMA 2BBTA 3AJAA 4LWOA 2NT3A 3RSHA 2W8ZA 3TM5A 3UJCA 1R6AA 4MVJM 1DIRA 5LN1A 5D3ZA 1FU7A 4B7UA 4DIMA 3ZDDA 2YS7A 4KN9S 1RI5A 2DBYA 1M8JA 2C9MA 2FJPA 2HU8A 2I78A 2WWTA 3G6WA 4KI0A 3H2GA 4X1KB 3WKAA 3KBBA 5IM4A 1FZQA 3LY8A 1EQUA 1LI5A 4NOJA 5GJCA 3OJ0A 2GHRA 1FFEA 2AFIA 4RDIA 4V1CI 5AK5A 3ZEIA 3R5JA 5BWBA 4EECA 1QOPB 1RZRA 2J07A 3BE8A 3NWEA 4EJ0A 2QW1A 4B2IA 3FTEA 4P83A 3L77A 4BQEA 1HR0B 3HRHA 5HIKA 1XMJA 1GPBA 1XB2A 2FR8A 3CBQA 3QA3E 3TMKA 5E3JA 3UQYS 4F4CA 2VAXA 3HCCA 4ZVPA 5KSWB 4RHFA 4ZEVA 3LDGA 3MLBA 2UUOA 3RTAA 1CJVC 2H00A 3G1UA 3L8ZA 1GP2A 2L69A 3NHYA 3DAFA 1ZRSA 3ONEA 3C8HA 3GUUA 1X87A 1GA6A 4IICA 4NZPA 2I7TA 3PR1A 3Q1KA 5CGZA 5ISMA 1RAFA 4MQ4A 4Q9AA 3L18A 4XVRA 4F2PA 1J8DA 1MJHA 1FMFA 2ZYIA 4YMHA 3FYUC 5TT1A 1XJ5A 3M6AA 2XYRA 3SBEA 1G3IA 2Q28A 5KNDA 1GNTA 1DTWA 1ETUA 3QRWA 4IJUA 5DX8A 5AJWA 1W9MA 1UBTS 1L0BA 2F1KA 4G63A 2YICA 4JJ4A 4LZNA 4AQYB 5KYXA 1BEUB 4RUKA 4P7FA 5F52A 2YV1A 1HFJA 5EQJB 1TA4A 3RS9A 2AX4A 5I9IA 3TQIA 4B44A 5IT0A 1R6BX 2QB5A 5HGXA 1OE0A 1TVKA 4MW2A 2FRXA 4PZLA 1S9DA 2AOWA 2CXOA 4MVJD 1M83A 4G86A 4O4JB 2IRWA 1U0EA 3JZAA 4W8GA 1EHIA 3NB0A 5EESA 3UUWA 3DFZA 1D6NA 1XNGA 1OT3A 2WDZA 1MOQA 4MJ7A 1Q0PA 2JH3A 1RRGA 2A78A 4R9VA 5K6AA 4BV9A 2OV8A 3S81A 1JH8A 2Y1LA 4H6PA 1X1BA 4I50F 5B4TA 3P4YA 3S2YA 3QVKA 2G1PA 2V7EA 1N2CA 4D82A 4NBUA 2A5DA 3QVLA 4E4YA 3HLKA 1HKUA 4Y8VA 2K7FA 1DG1G 4EVSA 1GYPA 3PP8A 3PGLA 3SC3A 1LLFA 4NYMQ 1G18A 1J42A 3SYLA 1W7AA 1GY8A 4YWHA 4KX3A 3TOXA 4NNPA 3TSAA 1TQHA 2NG1A 4D9NA 1WXFA 4CKBA 2HB6A 3RM3A 2CLHB 2Z30A 2V7TA 1Z6XA 3DD1A 1O94D 2H65A 3GJRA 4BO5A 2GYYA 2HDHA 3E82A 5HFJA 2ACVA 1ZYUA 3MJDA 5CW2A 1QO9A 1KEUA 1KEEB 2XD9A 1J39A 3H1AA 4HSEA 4GC9A 5HMLA 2C5GA 3AXTA 4G1MB 5KTNA 2FCAA 2PS1A 2M6LA 2B8JA 1YRQA 4YRBA 4YACA 3WBFA 1XHFA 4NV0A 5IPFA 3EXHC 1XFAA 2C59A 3H4MA 4JT4A 3OJFA 4N5NA 1UINA 5EHNA 5LXTA 3H2KA 3DBHB 2HLHA 1KAGA 2QTRA 3HG7A 3P45A 4E30A 4KHZA 4ZO6A 3COSA 4OTZA 2HD4A 1OFHA 1E79A 3RJ9A 1J8QA 1SU7A 5E8JA 5A9RA 4JVMA 2VPTA 3HY4A 4K9LA 4M1YA 1L7OA 5J9FA 1PV4A 1L4HA 1XMSA 5AI4A 4DPLA 3L7OA 2EZ8A 1XCBA 3NFYA 1C9EA 3JYLA 3O93A 4IV8A 2IYZA 4QD3A 1CD5A 2ZW9A 1OU4A 3RIHA 5B6PA 2FJ0A 2E6KA 2FPUA 3OI7A 3LDFA 4XYMA 5IEBA 4JQYA 2R6ZA 1RRFA 2XMGA 4GUDA 2YTZA 4UNPA 4AF6A 5ECWA 3ZX5A 1II0A 2MU1A 3R6WA 4GM1A 5GPBA 1CQIA 4S1PA 2OMKA 2JATA 2WM8A 3VR6A 3SSNA 5K6TA 3ELBA 2IXEA 3GCDA 3VFDA 4MW7A 5JAHA 2ZJ7A 4LYHA 4Z5XA 1YL5A 3ZK7A 2Q5OA 4F92B 4HNSA 4JR0A 3SR0A 1NQAO 1I6KA 4YB8A 5C9ZA 2AC7A 5I7AA 3L01A 5J4LA 1VB5A 2KM1A 3JZFA 4GZMA 3VKHA 1C1DB 2J6HA 3BZBA 4UNRA 3DYVA 4GAEA 5IAKA 3W1WA 2I2AA 2EKLA 1VIAA 1AGYA 1F6WA 1W8IA 2QAIA 1E1QA 3GFVA 3BH0A 1UR5A 1VHLA 1AQ6A 3R75A 4AP9A 3C87A 3FZNA 5EJFA 1KAHA 4GICA 4MW6A 4A7PA 9LDBA 3RRMA 3AO0B 4RABA 2X2PA 3EZXA 1GNRA 1GFIA 3OF3A 1Q7BA 1U8CB 4ID9A 2QAGB 5A1JA 5KTMA 1AA6A 4YX9A 1D0IA 1NULA 1X7XB 2I4NA 1Y6FA 2VVTA 4CM1A 3SIPA 5FTKA 1VC2A 1YRWA 3A2KA 3FTNA 3SNHA 3ZDBA 4M1EA 1R16A 1PFKA 4NL4H 4YAGA 1IFXA 2ZUVA 1EX6A 1E7RA 2YOFA 3L02A 4RL6A 2C3MA 3PX2A 4NBNA 3V8EA 1F4PA 3S70A 1G7TA 1RWKA 2YJGA 3JQBA 5KYVA 3R8XA 3UPUA 3GJ4A 3L7AA 4O2AF 3VR4D 4GKJB 2OXCA 4YRSA 3A10A 1FDIA 2ZUCA 3IQDB 3M3HA 4KRXA 1J06A 1PNQA 1QUFA 2G7MC 4PRKA 3L82B 1U8AA 2A0WA 4YJ3F 1QHHA 2HEGA 4CT0A 5IBCA 1M5TA 1KKUA 3BXHA 4LWZA 5M29A 1GPKA 2PK3A 1JHXA 1NVDA 3G1WA 1I3MA 1NPDA 4GM4A 5DFAA 8OHMA 3T9EA 3AUUA 3OOSA 3KUKA 4K2AA 2OEPA 3PUHA 5I9NA 3H6GA 1ESDA 3EJWA 4E32A 1BDHA 5LWHA 1LBEA 2DECA 3HVKA 1AN0A 1R5JA 4BJ3A 1D1TA 3QQ5A 3K0HA 2E1PA 3RYFB 1MEOA 2OTCA 2XA9A 4QDOA 4FGSA 4DOMA 4EW6A 1R50A 2WYWA 2XZLA 2WDPA 5UKDA 3WLFA 3RDPA 2QTGA 4BO1A 3MWKA 3TEMA 4DQLA 4X44A 2P3LA 3ZVMA 3S2GA 4DV6B 1UEIA 2OM6A 2I4RA 1IWBB 2YYSA 2Z2JA 3FW1A 3DYIA 5B3JC 5K7SA 2XB2A 4YUAA 3MBKA 2FSHA 5CFLA 1DPFA 3EH1A 1W6UA 3BEOA 4MCIA 1IVYA 2CB9A 1Z4KA 1L8LA 3LF1A 3MM4A 5REQA 1AOXA 4AO7A 4B43A 1CY4A 3PZRA 3I1FA 2GEBA 2PEZA 4JLSA 4K46A 5GQSA 2X5KO 3EDRA 1A8SA 3HWWA 4ZREA 3TMYA 4DLVA 4KPGA 5K51A 4BTLA 1C7JA 3U4HA 1X14A 4BNUA 1ONOA 1AXGA 2CLKB 4BCCA 5JWHA 4NONA 2A33A 1USIA 4NCNA 3IAHA 1U0JA 1WDTA 421PA 4BGDA 2QP9X 3GEEA 3GO4A 2VAWA 2GHQA 1UMDB 3ENVA 2PWBA 1DNPA 3G82C 3GYGA 3OE7D 5DN9A 3A28A 5J5CA 4DGQA 4KHPB 1G21B 1GL6A 2WKWA 2HQOA 3QUSA 4YFYA 5G1NA 2IUSA 4D3FA 2H5JA 4AJ9A 2FSFA 5J47A 4M99A 4EFDA 3G9QA 1YJ8A 3EGIA 2P9CA 4IF4A 3RVKA 2IKQA 1FX0A 3OQVA 4H31A 1HTWA 1CFZA 1KMHB 3EDMA 3R3WA 4IJWA 3WNZA 1RBYA 4GOND 4XA8A 3B60A 4I4LA 3RNLA 4BN0A 2O2ZA 3SK0A 3G0DA 4HRVA 2MSLA 3BSYA 4QUGA 5JNUA 3T1YB 2XBMA 3G79A 1I0IA 1GUDA 4PHFA 5FLKA 2XRMA 1QP8A 1T9GS 1Q84A 4HNQA 4BFTA 3A4TA 3AGPA 1IHXA 2QTHA 3THWB 4Q9JA 4DQVA 1T6YA 2R44A 2Q5EA 4GLLA 1U9YA 4YAIA 5AO9A 3OETA 3B82A 3WWDA 1PJ2A 1VYHA 1MCZA 4ZRDA 1Y1LA 3NRBA 2FK7A 1O94C 5CT4A 3A6PC 3SIRA 2WU4A 4DC9A 4PN7A 1UMDA 1YZKA 2NZWA 4YGYA 2ZTSA 3WWPA 4Q66C 1V2GA 3K4QA 3N2KA 1EFTA 2IEZA 2X4LA 1VPLA 5COAA 1C7QA 5EHGA 4I9FA 3EBOA 4N7MA 3C41J 1LA2A 2ODTX 1OH6A 1T6BY 3A37A 1QGOA 1P62B 4XM0A 1QGYA 4YRDA 3NO4A 4DR2B 5GP1A 2QA5A 1PG0A 1RMYA 1N8TA 1ZU5A 4UTOA 5E7JA 4CU2A 1V8DA 4YR7A 2O8EB 2G82A 3Q1LA 2FPMA 1I2BA 1JIVA 2YIDA 3QE9Y 4ZO8A 1BROA 3SBOA 2V4ZA 1YJXA 3AL0C 4AY5A 4DJJA 2GN6A 8GPBA 2VDWA 5CM8B 1QFMA 2VZ0A 4IJ5A 2X1LA 4M8IA 3KQSA 4GP9A 5L7YA 4F71A 4QVIA 1T91A 1GPDG 1KKMA 4MB0A 3OZFA 4K81B 5FNVF 4X1KA 1EP3B 4W5NA 1H2AS 2VXCA 4IUYA 4HL6A 3HN2A 4MHSA 1LSUA 4PSUA 3IIMA 4KZPA 4Q4LA 5FLYA 1HDGO 5FULA 1ZXXA 3BWDD 3U1BA 4AQDA 5FI0B 1R4NA 3GXOA 3WDLA 2LKDA 4QFCA 4YROA 3BRSA 4A16A 3U6BA 4DSOA 1BMDA 4RHUA 5DYYA 5LP6C 5A3RA 1KJ8A 5CBPB 1ZIPA 2CW5A 1ZVVA 5BQOA 1UPAA 2Q5CA 1KSGA 1Q6YA 2A5YB 1ZAKA 1F1JA 1PGPA 1BXGB 3KPJA 4KGZA 1Q74A 4G0YA 3UA3A 3K8OE 1JDUA 2CNKA 3LTEA 5EP4A 4OLBA 1UP7A 4OB7A 2PKQP 1N4DA 1YZLA 3O26A 1NW6A 1JWLA 3TIXB 1YR1A 3AIKA 4ZXPA 1WUKS 3ZGOA 5KNBA 1J2RA 4W8OA 1QLWA 4XPIB 3RWOA 3MJ4A 1R0CA 2P7IA 3NUZA 5B1EA 1KI2A 1H0SA 3HA7A 4NJMA 4LFAB 1B42A 1NFFA 1CZLA 2W2XA 4Q7LA 5FO0A 2CUZA 2E7ZA 2HGSA 1JEQA 1QO0A 2NU7A 4ND4A 3FB4A 1FBNA 2O1WA 1MO2A 3PUZA 4O4IA 1OTXA 5BOSB 3P9SA 5AQEA 1AZSC 1ZM4A 2BMAA 1XCJA 1NXPA 3SHTA 2D7CA 1LVGA 2GJAA 4ON9A 2D1FA 2PMWB 3TRHA 1YZGA 1I5EA 5F5LA 3LLUA 2F9MA 2ZJFA 3DDUA 1QGUB 1ODCA 4C01A 1BVYF 4Q4HB 3TSWA 2A1UA 2NGRA 2NLOA 2PJDA 4X1OA 5E9JA 1TUGA 5J2TF 3WVNA 5F7OA 4G0UA 5KTRA 3JWEA 1P1CA 1X2EA 2D5IA 1J2YA 1YI8A 1X7ZB 2PMKA 2QX7A 2ZATA 4JX8A 1ADJA 1E1CA 4MV8A 1SU6A 3GLTA 4DCUA 1ORDA 3PL5A 1UDBA 2QTZA 4PFKA 3W5UA 3M81A 2IY9A 3QXXA 1AKEA 4YRRA 4YQZA 5EQTA 4XGNA 3BXFA 3VYVA 4WEOA 2PL1A 2Q1XA 2XRFA 2VQDA 4LVCA 4YBZA 1OGYA 4XDYA 1GAJA 2W11A 2FA9A 2X58A 1NJ1A 2J4CA 4Z3KA 5DTMA 3T1HB