4Q03A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q03A00
4PHTA 4B3FX 2R2AA 2OO7A 5JEEA 3B7GA 4PPQA 4U7DA 3RABA 3QY0A 4XSGA 5FOTA 3TR0A 1D2EA 5FOXA 2KB0A 3GLFE 4G5SA 2ZQ5A 3U4QB 3SQWA 4TLBA 4X8LA 4XWAA 4TYWA 2NMVA 4YMTA 1XMVA 4NCNA 3VTKA 4B75A 4BFWA 3K0CA 3QENA 3C7KA 4E07A 2A3RA 1YZUA 4CEIB 1AK2A 1G19A 1X1SA 2GVZC 2WBLC 3ZS8A 4Z1MD 5L3VA 4JT4A 1JPNA 4AKEA 4BZXA 4HZUB 4MRPA 1PZNA 1JPJA 3GLFB 3B1YA 4JSYA 1P4SA 2OSBA 4F7WA 4ZI2A 4OJKA 1KK3A 5FPSA 3AM1A 1MABA 3X1DA 2VA8A 3P20A 3VX3A 3I8SA 5JSZB 4M1MA 5FTMA 4CRWB 1BYUA 3QIAA 2DWPA 2H8KA 5HTKA 1R5OA 1OLOA 4IFBA 2IHYA 4UQOA 5BW8A 1E2NA 2YC4C 4HAWA 1IY1A 1KI1A 3HPRA 2G6BA 1Z0DA 5AJWA 3IIMA 2EYQA 2ZS9A 4JLMA 1NF3A 2JIZA 2VSOA 2V9PA 1P62B 4EDHA 1FOEB 2IXFA 1A1VA 3GLIE 3RS2A 2ZRHA 3C5HA 4IXMA 5FTNA 1NJFA 2CNWD 4XVRA 2H1LA 4KFSA 4QBFA 3L82B 3KTAA 1QDEA 4NHOA 5ELXA 2GKSA 4DC9A 1AJEA 3Q3JB 1RVDA 1FL9A 5AUQA 1GM5A 2IW3A 4DLZA 1MKYA 2WSSD 3SJAA 1W7AA 5J40A 1DAEA 3HWSA 4KFUA 2ZIAA 2OLJA 4GP6A 421PA 1OXVA 2HJGA 3GMTA 1T8TA 3PITA 4RKFA 3W6OA 2ZRKA 1LV7A 1Z47A 2DFKB 3VNUA 2QRNA 2C95A 5AJYA 5JHGB 2ZJOA 5EE1A 3GLIB 3OE7A 4OI0A 1YHNA 4NH0A 1IM2A 1U99A 3B13B 1QRAA 2HT1A 1XP8A 3ICEA 3O8RA 1KY2A 1JR3D 4Q9JA 1UAAA 1PUJA 1P7CA 1RRFA 3A1VA 3QE0A 4YMUA 3QXXA 5IK2A 4NCHA 3BXZA 3AVYA 1R0YA 5JS8A 3A6PC 3K0CC 2GBLA 4LBZA 4QNMA 4TMKA 5FI1B 3ND9A 2VHQA 3LQRA 3ZIAA 2FFQA 1N5JA 5CJPA 1G8YA 3KTAB 3RRNA 2C77A 3M6AA 1OFHA 4OKSA 4PC6A 5TB5A 4B6EA 2IEYA 2GCNA 1NN5A 1TL7C 3CBQA 4ASUA 5FR1A 2ATVA 2Z0MA 1W4RA 1CJUC 4NL4H 1JAHA 4NYMR 1DVRA 4EFMA 4RCZA 4YMSA 3CRW1 1HURA 1M7GA 1VG8A 2E9SA 2JLSA 3SJCA 3WMGA 3LW7A 5AUPB 5JZVA 3CB4A 2FE4A 4Q18A 3LRPA 2VSXA 4FMCB 1JJ7A 2VF8A 2XAUA 3EZ7A 2PJZA 3K09C 1LY1A 1KAGA 1F2UB 1N5KA 2R6FA 3EZ2A 1XBTA 3ZGXA 2ZRIA 1NN3A 4QBIA 4WW0A 4B6FA 4BLQA 1M34E 3SC3A 1G8HA 1EK0A 4HB4A 4Q4AB 4BLOA 3GEEA 5EXPA 2F3TA 1YJ5A 3BB3A 4IEIA 1II8B 4Z51A 3RS4A 5KSOA 4JSTA 3BH6A 3LD9A 4A8JC 4MA4A 1XX6A 1E9AA 4M1WA 1OYYA 1NIPA 3U3JA 3AVTA 4TYYA 4TL6A 4HSEA 1TADA 4RD2A 1BO6A 4IDHA 4LBVA 4WVFA 1XEXB 4P4TA 1Q1QA 4TL8A 3U2QA 3MSXA 4S2EA 4NTZA 5BYJA 1T0JB 5FUXA 4C0BA 1NKSA 4QJ5A 2CE2X 3OAAA 4LDJA 4CYMA 4U00A 2QBYA 2YJTD 5CIQA 3IBYA 2G3YA 1AQYA 3SFZA 1R8SA 3KQHA 1G8PA 3OEHD 3O8CA 2ERXA 1SHZA 1OJLA 3WHKA 2JDID 1MT0A 2Q3HA 4Z8YA 3U3OA 5HPYB 1G21E 4QRHA 4OYHA 2F6RA 4UKDA 3THXB 1EX7A 2GXAA 2ZSFA 2J46A 4GP7A 2I4IA 4BFTA 4XOIA 5SZKB 2OE2A 4MGKR 2Z6VA 1YZNA 2C03A 2FOLA 4L16A 3CNNA 3WP0A 3ADBA 1GG2A 3ZZ0A 2KWIA 3B82A 1G6HA 2Z43A 1ZAKA 2ZSDA 3R9IA 4D26A 5EXSA 4LBYA 1K5GA 3RS0A 1R7RA 3QKTA 5BQ5A 4URVR 3O8BA 1D2NA 4KSCA 5E7IA 1CF4A 1OKKA 4DVGA 4A0HA 2Z5FA 2DCUA 5KDLA 2EFDB 4PPNA 2FN4A 3R9WA 2PLRA 2G88A 3VKHA 4JBWA 4I1OA 2RGGA 4Q4JA 3SN6A 1JJVA 2XGJA 3DEFA 4QG7A 1HQYE 2FPLA 5FI0B 1XMJA 4PC3A 4DLWA 1E2EA 4D0LB 2DPXA 1HUQA 2QT1A 3X1WA 2AFHE 3N2IA 1E9EA 5TARA 4R71A 4ESVA 4IDPA 2B8WA 2GK7A 4LGMA 5BN4A 3EZ6A 3AVQA 1CJVC 3CX8A 3C5CA 1YRBA 2PJRA 1G18A 1W0KA 4MGIR 5DN6A 3CF6R 4V02A 2GCPA 4A9AA 2CBZA 1G3IA 3FMPB 4CGZA 5G3YA 2O0JA 3B9QA 2V4ZA 1SULA 3WNBA 1W0JD 2NQ2C 2OXCA 3BK7A 1SKQA 2AK3A 4KXFB 3K1JA 1MR3F 4L5BA 1RFLA 3TUIC 5KNDA 2ZI5A 1W44A 3KJIA 3CR8A 4UNQA 1NIJA 3R20A 2J7PA 4QGGA 2CVHA 1NKTA 3LXXA 5JLJA 3IGFA 1XTQA 4MRNA 3CNLA 1S0UA 3VHXA 1NLYA 3AVUA 4G5QA 1HE1C 2C96A 1COWA 1H8ED 2ECKA 1RYHA 2WWIA 2H5EA 4N0EA 4EPXA 1LF0A 4PFSA 4B48A 2D4HA 2XTNA 2FG5A 2QMUA 1KMHB 2ORIA 4JLBA 5CB6A 1ZD8A 1JB1A 2OHFA 4NYIQ 5CYPA 3WXMA 2FA9A 2X2FA 4WOPA 4AI6A 1KJWA 1VG9B 2O0KA 1FUUA 4R9UC 1CKEA 1W4BA 3M4YA 5EE3A 2QAJA 1E6CA 2YVUA 1Z0AA 4GPTA 3UMRA 4LY6A 5L3RA 1PUIA 3W5IA 2BMFA 2IUSA 5J4HA 4D4MA 1IOZA 3FOZA 1ZP6A 1ZUNB 2O8BA 2WJVA 5FBVB 4FMDF 2QROA 4K8OA 2PX0A 1KSHA 4ACBA 1SVSA 5FBRB 3HU3A 2JJ1A 2W58A 3TKLA 4PSKA 1TUIA 2QMOA 2FPKA 2WAYA 4H1UA 2ORVA 1AGPA 5C18A 4LJ7A 3REGA 5KYKA 3OZXA 4BLTA 3CONA 4I1SA 4HDOB 2A78A 5JWRA 4UXHA 4HATA 1N0UA 1U90A 4HAYA 1VKJA 2WAXA 4II7A 4TTRA 2J0VA 2WWFA 5JCZA 1S9DA 4K81B 2ZE5A 1ZNYA 3ZLJA 4WA7A 3RRMA 2HXYA 4DCTA 1W2HA 1IONA 4OK3A 1VTKA 3W6NA 1QHYA 1OIVA 1RPZA 2ZI4A 2JJ2D 3U3KA 2NIPA 5AR1A 5L3SA 3NTUA 1GNRA 2IS2A 4Q21A 2W2XA 4IDQA 3SR0A 2VYFA 1EG7A 2ZSBA 4YDSA 1T3HA 2VP5A 3KZ1E 4JS0A 2ZTSA 2ZAMA 5FFMA 2XOKA 4HAZA 4XVUA 2JIZD 4JLVA 1XTSA 5EP4A 4KLZA 1S3GA 4QBHA 1OF1A 4B3GA 1P75A 1KI8A 4B2LA 1TEXA 1XJCA 4BFVA 3FDIA 4QJ4A 2VHCA 3U7EB 1U98A 4A15A 1GKYA 4OQFA 1G7TA 1KZ7B 2ZUBA 4CEJA 1KI9A 1D5CA 2VBCA 4FWIB 3SU8A 1CULC 2W2TA 1P2SA 4AYWA 2NO6A 2IYLD 1AKYA 4BLPA 1YRAA 1L2TA 1Z0KA 2H18A 4C0JA 2C04A 1XXHA 1HA3A 2J59A 4LYAA 1UEJA 4ABYA 5L3SB 1E2GA 5D3QA 3SZRA 1JECA 3EPKA 2C78A 2X1VA 4DT1A 4F92B 1FP7A 5EZ6B 3H84A 3EA0A 4JL8A 1AGRA 4P4UA 4DIEA 1VG0B 3RVBA 1ANKA 1IN5A 2QENA 2A5GA 1XXHE 5A4JA 2CLDX 5FPTA 5IK2D 2ATXA 2A5FA 1C4OA 4C0QC 2BJVA 1D2MA 4HB0A 2CNWA 3BWDD 2PCJA 1HQCA 1T8UA 5K8LA 2CCKA 3VR4A 2OT3B 4B74A 3ZIAD 3FPAA 3MWKA 4DCNA 4OHXA 721PA 2G1JA 2H17A 5KTYA 1TU3A 3SBEA 2RKOA 1UKVY 3ZVMA 3OF5A 3MJRA 1GNQA 4DCVA 2WSSA 2IWRA 4C3ZA 2IS4A 1BYIA 1P6XA 4P4SB 2P2LA 2QPOA 3IEUA 1JR6A 2IA5A 4IDOA 4EPTA 1XXHB 3EWSA 1KHTA 4AY2A 1VMAA 2EYUA 5AJVB 4IOJA 5C2JB 1OHHD 1X8KA 2P0EA 4DT1B 4NDZA 1OH5A 1JR3A 2G9NA 4Q9HA 1QHNA 3L43A 3THYA 2MSCB 1J99A 1ZC4A 1FMLA 2HCJB 2W6JA 4DWJA 2WTUA 2IYQA 2YWEA 4KJZA 2CL0X 4C7OA 4TWZA 2BBOA 1FX0A 1M7BA 2CHQA 3A58B 3DO6A 1JR3E 3W6PA 4NMMA 3QEJA 2B7BA 4DIDA 2ORWA 3C14C 1DE0A 1PJRA 1KJYA 2QZ4A 4BQSA 1UDWA 3SJZA 4D4KA 2QSZA 3RSOA 2WM9B 3W8NA 4CIDA 5BXQC 4EFNA 2QUZA 3KJEA 5GJBA 2F1RA 2JAQA 4C0LA 4S35A 3LX5A 3CX6A 5CM9C 2O0HA 3QXJA 3TUJC 2AXNA 3ZQ6A 3KUCA 5FR2A 1R4AA 2J45A 4JBXA 4P0TA 2VHTA 1QBKC 2REXB 3THWA 4UJ5A 2DBYA 2FU5C 2O52A 5C46F 1PLJA 1AZTA 4TYPA 1DG3A 2Z4RA 3ZH9B 4BUJA 2EVWX 4AKHA 2MSDB 2QY9A 2ZSEA 2NO0A 2ZI3A 3OAAD 4Q9KA 4C7OB 4NPHA 2YOGA 4AG6A 4BLSA 2QGZA 3BFKA 4IKEA 4RD3A 4DCSA 4YONB 2V8OA 1ZNXA 3FYHA 4NYMQ 3LV8A 4BGDA 4JKIA 3CPHA 3PFIA 3TSOA 4CT4B 2FSFA 1FTSA 1SQ5A 1KI3A 1E1QD 4Q1CA 3DHWC 5CK4A 2A5JA 5KPDA 4JL6A 3QKRA 5KSZA 1FFHA 1NVXQ 2QT0A 4DBLC 4HDQB 2ZANA 3IDQA 3GJ4A 2J87A 1BKDR 4GOKA 4HYYA 2PH1A 4X8MA 1OIXA 1D9ZA 4JLJA 5IRCD 3FE2A 3L8YA 4XSHA 1RIFA 3ZZTA 4QGAA 3THWB 1ZCAA 3BORA 2CJWA 2V54A 4W5HA 1IN8A 3PVSA 3EARA 2NPFA 1KO1A 3AKYA 2MMCA 4DLSA 4CZ2A 1OKKD 3NBZC 5J47A 3LX8A 3OEHA 4A36A 1MH1A 1OFUX 4R98A 2JDIA 3GJ8A 4G3XA 5AUOB 4ILEA 3OIUA 5KUTA 2R44A 3BB4A 2CDNA 3QKRB 1OPXA 1IHUA 3NEYA 5EUQB 4C30A 1HE8B 2WOOA 4F91B 1S4QA 3PR1A 1ETUA 1TMKA 2HLDD 4GRAA 5H1YA 3AQ4A 1WBBA 2WMNB 1ZYUA 1NG1A 1W0KD 5JJIA 2PZGA 2HV8A 2IS6A 1UBFA 2Z4SA 1PVOA 2CJWB 4R2IA 3QNUA 2ZE8A 1DAGA 1GSIA 3TR5A 2IXEA 1WRBA 1S8FA 4LHWA 1XJQA 4N3NA 2RCNA 2R62A 1N6OA 4Q9LA 1E2FA 1NMZA 4ARZB 3ADCA 3U7FB 1S1CA 4NYIR 1JEDA 1DEKA 2FGKA 4MKHA 2ODNA 2ZRPA 5J4LA 1KO4A 4JIMA 4QL3A 2Q9CA 4PQFA 2OXRA 4OQXA 1CEEA 3G5UA 4PPFA 3EAQA 3MCAA 4A2QA 1P72A 4IHQA 1J8YF 1OH6A 4MDFA 3GEHA 3TVTA 2RMKA 3A4MA 4CEHA 3LVQE 4FD2A 3CPEA 1QHHA 1Z83A 1YZLA 4LOAA 3V4RA 4DLVA 1U94A 1JALA 1KAOA 2RGCA 5HZKA 3DM5A 2WV9A 3OIVA 3LBNA 1E2MA 3QUSA 2DFLA 1OB2A 1K5DA 2A2ZA 1M8PA 1W0JA 1LB1B 1J7KA 2GEVA 4NCJA 3VKGA 1J70A 1E79A 3DKPA 1UKEA 1MO5A 1NY5A 2QE7A 4EPYA 2F9MA 1R0XA 4OK5A 3U4QA 2VF7A 4B71A 2K5UA 3B1VA 2IEZA 3U3MA 1KI2A 2ZJYA 1G6OA 1VG1A 2O5VA 2V6IA 4NE2A 3RS7A 3PEUA 5TY0A 3SQXA 2CE7A 4CDGA 1KJZA 1XD2B 4LV5B 2ZR7A 2RB4A 2BEJA 3ND8A 3QVUA 2JJ1D 5DIFA 2GF9A 4URXR 5JI3E 4Q01A 3B1ZA 2SHKA 4ZCIA 4CEHB 4HZUA 1CR0A 1QHHB 4Z8XA 3LQQA 3A1SA 1XPRA 3NBYC 5KSPA 5KDDA 3K0FB 4O0MA 2FGJA 1E99A 1N3BA 2OFOA 2QRZA 3ONWA 4M2LA 3PXGA 4A92A 2WJIA 3HU1A 1P2TA 3QG5A 2FFAA 5HCNA 2RGAA 3FKSD 2Q3FA 2PZFA 2V7QD 1S96A 1V43A 2GZAA 4JLKA 3RC8A 5JSZA 3M0EA 5SZIA 4PHGA 1W48A 1GIAA 4JKYA 4WXPA 3BERA 4RZUA 5EXXA 4BFZA 2XZPA 2AK2A 2E87A 1FTNA 2F55A 1E9FA 2VSFA 4JVSB 1KKMA 2XJ4A 3KB2A 4G5GA 1NNEA 1Z6GA 4AKGA 1GRQA 1OV4A 2GEUA 4UNPA 4D2IA 1A2KC 3X1YA 4TYQA 1AN0A 2P5TB 3RWOA 3QVVA 3B78A 2XOKD 2OG2A 1Z2CA 1GFIA 1T9HA 3GLHA 4I99A 4MYCA 5JRJA 2FEMA 1OW3B 2JLUA 5L3QA 3HU2A 2C9CA 3SJBA 4D6PA 1Q12A 5DSZA 3CLVA 5IDVA 2JLRA 3KKNA 3DKVA 4DB2A 3F0TA 4E5UA 3GLHE 4M1KA 1NJGA 4QGHA 5JWOA 3CWQA 1E2IA 2FEOA 2GF0A 4OHYA 1IN6A 2IYWA 2JJ2A 4IFEA 2B8TA 1T0HB 3KFXA 3GLIA 4LC1A 3K09A 4W5WA 2QPAA 3EIQA 3W9YA 5K8TA 3ZD6A 3TVDA 1LTQA 4A0RA 5CLLA 4FMCF 1YR6A 1R2QA 4PZYA 1KNXA 1XPUA 4Q03A 3GLHB 3TJZA 1OSNA 2R8RA 1JBKA 1KO5A 5E7MA 1TUEA 2JLYA 1DO2A 5L3QB 5L8VA 4A8JA 3P1JA 4U5XA 1OFTA 3UXMA 5IT5A 3N70A 4KBGA 4XIGS 3BIFA 3CF0A 3FVQA 3UMFA 4R2HA 1P9WA 2NTYC 1WDTA 4RD0A 2JATA 3J81k 2XTMA 3PUVA 3R8CA 4E09A 3KKPA 5DI3A 3ZQJA 2DFTA 3SFVA 3T1OA 1RJ9A 5IF9A 1I4DD 2X2EA 1F6BA 2P6NA 1MRSA 4L4UA 5C4GB 2QNRA 2RHMA 5EP1A 1JXMA 5B30A 5K8IA 2BMEA 4DSNA 1CR1A 2W6JD 1TPZA 4KO8A 1II9A 4MGYR 1F2UA 1NVVQ 2ZSAA 3BFXA 4QHTA 4A8JB 2GILA 2ZVQX 3QPUA 2H16A 4LC0A 4TLEA 5HR5A 1UFQA 3ETLA 4Q4AA 1SZPA 1RC8A 1YE8A 4FN5A 1GL7A 3LLUA 4B35A 5E3HA 5EZ5A 1CJTC 1G291 4ZCMA 1II8A 2R65A 3HYTA 5ANRB 4F38A 1DAFA 3WY9A 5CITA 1FQJA 1VDZA 1ZM4A 2IYXA 2ZU6A 3IILA 3B6EA 4HB2A 3I5YA 5DI3B 2BMJA 1OHHA 4V0ME 4GT1A 1RJ9B 3CRRA 4HAXA 1XEXA 4LI0A 2WMOB 1GNPA 4PX9A 4AG5A 1ZD9A 4GOXA 5KPJA 3HR8A 3UKDA 4QKQA 4LZZA 1OH8A 4D0GA 2CK3A 2OAP1 4OQLA 3B1XA 4BE7B 4LPSA 1G64A 1Z3IX 1AKEA 2ZYWX 1NG9A 3AKDA 3Q5DA 2VP9A 3NHAA 3FHCB 3ZD7A 3CNOA 3HP1A 2C8VA 4DSUA 3DZ8A 1U0HC 3CM0A 3NEJA 3Q72A 1KDTA 1NVWQ 1P9NA 1NN1A 2BCGY 3RSLA 3THXA 2IYTA 1W36C 1KI7A 5AJZA 3GFPA 2QG6A 2J9RA 4L8GA 1SXJB 4GMDA 1TEVA 4H9GA 5AUNB 4KV9A 4QXAA 4DDUA 3MAAC 2DR3A 4KVAA 3I73A 3G0HA 2J0QA 4ZDKA 2JA1A 2H7VA 4M1TA 2A9KA 1JQJC 3WNCA 2D7DA 2RH5A 2BBTA 1KO8A 3IIKA 4DLTA 2OFXA 1ZRHA 4A4DA 3ASZA 3E70C 1HYQA 4D0NA 4LCBA 3CX7A 2VHUA 4MUAA 5FH9A 2XJ9A 4FW9A 4TQUS 1CU1A 5HCIA 2HJVA 3TUZC 3MJHA 1P9RA 3LNCA 4GI7A 3BFVA 1E1QA 1E0SA 3C41J 4DHEA 1QG2A 2D2EA 3NH6A 2NGRA 3KFVA 2WIBA 3TAUA 2R9VA 3BC1A 3W5JA 1DTSA 1E9SA 1R0WA 3ZS9A 1XRJA 5DYIA 3TAHA 1E32A 2WWXA 4JYBA 5KO2A 4D81A 3T06B 1OXXK 1R0ZA 1ZW6A 4ZIRB 1SXJC 2AN9A 4C2UA 2QAGA 2XSZA 5FOVA 2ZPTX 1X8LA 2QM7A 5FBWB 1GP2A 2AWNA 3LVRE 1DADA 2BJWA 2ZUCA 4US2R 5HE8A 4KU4A 3PJRA 2EQBA 2QN6A 2RGEA 4I1VA 1Q0UA 2WJGA 1AQUA 5DHFA 1VPLA 3GP8A 2VP4A 3AUXA 3L0OA 3U61B 2P6RA 2IX3A 2KBFA 2BKUA 1E2QA 2YOFA 4G5RA 2CEAA 4PC1A 5F9FA 1FMJA 2D74A 4FIDA 1WCV1 4G01B 3H2YA 1Z2AA 3IQXA 2HLDA 5LD2B 1XTKA 4BFUA 1KMHA 1R8QA 1Y63A 5KSYA 2OBMA 1U8YA 1CP2A 2HF9A 1IY2A 2EFCB 3LAWA 3VQTA 2CLCX 3KL4A 3MRSA 2QAGB 3U6KA 4OQNA 1IXZA 3VNVA 1Z6AA 2XXAB 3AVVA 4MKIA 2D62A 1E79D 2QE7D 4JJKA 4GMXA 3HPQA 3C16C 4MYTA 3RS3A 1NSFA 4DLUA 2FZLA 1OH7A 4M1YA 2OCPA 4LJ5A 5KNBA 1N6NA 5JS7A 2VP0A 5DHAA 1X8JA 4JLPA 2WOJA 2N1BA 3EA5A 5FPYA 3V00A 4ERNA 3V4FA 1XZPA 2GA8A 3IPXA 3GJXC 2W0SA 4TZ0A 4A82A 3B85A 3BOSA 4P3YA 4HAUA 5B58C 3QF7A 1ZCBA 3U3RA 3KQNA 3NDPA 2OCBA 4PR0A 5LD2C 4IJMA 5D3MA 2ZITA 4BLRA 2ZRBA 1FNMA 2C98A 3BE4A 3D6TB 4JLAA 1RRGA 4Q48A 3LBHA 1KY3A 3P4YA 2QAGC 4M9QA 1IXRC 3TSWA 2G0NA 1KK2A 4KCGA 3X2SA 3GQBA 2QP3A 5GVRA 4KYUA 2YKGA 3NG1A 3NHBA 2W6IA 2FDCA 4OHWA 3VX4A 4UNRA 1G7RA 2NZ8A 3N2EA 2OM2A 2NZJA 4POAA 3L0SA 1ZIPA 2L0XA 3R7WB 3Q9LA 1WB9A 3NVAA 4V0OA 4DLXA 4PSVA 1JEEA 2X77A 3AV0B 4RY2A 3QQ5A 1GILA 1ZINA 4EKDA 4Q7LA 1BMFA 4TLDA 4RD6A 3TE6A 1TU4A 2P67A 3SHWA 2IYYA 5F9HA 1Z6XA 2YOHA 3FKSA 2V7QA 4B3BA 5D3MB 2NO7A 1Z28A 2XNDA 4A0GA 3QI2A 1ZD1A 2C5LA 3PEWA 3KX2A 1L4YA 4PZLA 1WBDA 1KSFX 2AWOA 1P60A 2PBRA 2QTHA 2R6DA 2VRWA 1S1MA 1UM8A 3I32A 4XH9B 3HR7A 3MWJA 4US1R 3MD0A 3QOFA 1Z06A 5J4KA 1F60A 2WWHA 4MRRA 4ZDIA 1ZU4A 2CHVA 2UZ3A 4US0R 4C9BA 3IPYA 3BH0A 3EZFA 4EIWA 3AP1A 3IKJA 3CIOA 3P32A 4ZDJA 4O25A 1W47A 3UWKA 2FZ4A 3KUDA 4HLCA 4EJSB 4GL2A 1AIPA 1XEFA 1HEIA 2FF7A 3I1FA 1KZGB 1Q3HA 3AUYA 2KI5A 4MKFA 4P4SA 1YKSA 4YXWA 2Q9BA 3T35A 4Q00A 1LS6A 2IYRA 1NVVR 2WSMA 5H8WA 4MITA 1TQDA 3BJIC 121PA 1RYFA 5JHHB 1OXUA 4BECA 4TZ6A 1G8FA 1U2RA 5DO9A 5FOWA 2GNOA 3K70B 1AS0A 2IS1A 3GJ6A 1UBEA 1O87A 3VFDA 4BFXA 2F43B 3L2OB 3SNHA 1KIMA 3ASYA 1O3YA 3ZZUA 2JEOA 3RRYA 2JLVA 2ZJBA 3H4MA 3A8TA 2FSHA 4I1UA 4W5JA 3ZVLA 1T6NA 1ZM7A 1VCMA 1GKIA 1E0AA 4AD8A 2PCLA 2EFHB 3IO3A 3UANA 2EWVA 4J0QA 3A4NA 1N6IA 3C15C 1I2MA 1YU9A 3VR1A 4V03A 5KU1A 1GTVA 3FFBA 1BIFA 4FMDB 4FXPA 1AS2A 3DZDA 4RFSA 1SXJD 1QVAA 4LJYA 5DLQC 4EJSC 3EPLA 2Y8EA 4I4LA 3IHWA 1NY6A 2F1IA 2VIIA 1D6JA 4ITRC 5FUYA 4LYFA 4HB3A 5EP2A 5FTKA 2FSGA 4M53A 2BM1A 3LW8A 1DBSA 1SKYE 2CK3D 821PA 2WJJA 4MYHA 3EPHA 2OBLA 4MGZR 4RFVA 2YNMA 1T3LA 3K70C 1K8RA 1KDRA 5G40A 2YWGA 1UKZA 3NXSA 4KFTA 4ZV4A 2WICA 4AIIA 2QP9X 2CMKA 2HT6A 2Q9AA 5JWHA 3Q7PA 2ZU0C 1KNQA 3QXSA 4L9WA 4MUBA 4BFSA 2QMEA 1XZQA 5FOUA 3TQCA 4RFSB 3HDTA 3PUWA 4BPBA 3GJ5A 1F5NA 1SKYB 4JZKA 1N0WA 2YYZA 3LH5A 3C4JA 3VAAA 2O8FB 2GAAA 3W34A 4XD7D 3HYRA 1KTVA 1W4CA 2BEKA 1ZU5A 1XEWY 2BM0A 1XDBA 3KB1A 5JEDA 1YQTA 1C1YA 4M1OA 3GEIA 4MQBA 1XEWX 4OHZA 1EFUA 1W46A 2ZYTX 4B2IA 2GXUA 3EXAA 2ZETA 3KQUA 1EWRA 4B32A 2BOVA 4B43A 4PHFA 1E0JA 4MRVA 5JECA 1M2OB 1NSTA 2Q21A 1IJFA 2AR7A 1F48A 2RGDA 1QZXA 3WBJA 4M1SA 4M9XA 2CL7X 5SZHB 3W8RA 1ODFA 1YR9A 3I62A 2VPPA 1YR8A 4B47A 1CTQA 2WJYA 3ADKA 1OE0A 2GJAA 3DVLA 1MV5A 1OFIA 1ZBDA 3AP3A 3GD7A 4PSAA 2VH5R 1GITA 4LUCA 2EFGA 1JQLB 5GJCA 4JL5A 5DE3A 2I1QA 2RGNC 3EC1A 1N0VC 4LJAA 2XSZD 3O8DA 2GWHA 3V9PA 3VMFA 1FW6A 2G83A 1XFAA 1YVDA 3A1UA 3JZAA 1W2GA 4UJ3A 2G77B 1W1WA 2D2FA 2OEPA 4FMBB 4ARZA 4DCUA 4E22A 2GK6A 4GNKA 5J4YA 2IF0A 4FCVA 2A7QA 1X1RA 2W00A 4AYXA 3D7MA 3DM9B 2ZAOA 3WNDA 2OAQ1 4KBFA 4F4CA 1G8GA 3WBKA 4TSFD 1CLUA 2ZEJA 1Z0IA 2AX4A 3N5CA 3MWLA 1E94E 3WMFA 4Q66C 3ECCA 2LCFA 4MYUA 5JCPA 4XTCS 4Z54A 4OBEA 1E9DA 2IBMA 5AJXA 3B5JA 4PC2A 2YWHA 1ZUIA 5CLQA 2BIFA 2KSQA 1H8HA 3I4LA 3NIBA 3FB4A 5G53C 3G82C 2KE5A 4A2PA 1ESNA 4DDWA 4NU0A 5CJ2A 4HLUC 2JLQA 4ACAA 1N6PA 3RYTC 3W90A 3SDZA 1CJMA 1II0A 2IF2A 2ZRMA 3W3AA 2QGNA 3GLGA 1DAHA 2VO1A 4A6XA 4JJZA 2JLXA 5JRZA 521PA 4N0DA 621PA 3U44A 1XD2A 1KK1A 1BS1A 2GZDA 3TK1A 4DLYA 3DOEA 2QTVB 3PG5A 1Y3AA 2LKCA 1MO6A 4G5OA 4TLAA 4LPKA 4AKIA 5SZJA 4NYJR 3GLGE 2V1UA 1VHLA 3WP1B 1C9KA 1UJ2A 2VL7A 1PV4A 1W5SA 3TQFA 1UPTA 5F98A 3DMNA 3K0FA 4JVNA 1DAIA 1XB2A 5C1BA 4QFMA 1IAQA 1N5LA 1Z22A 4P31A 1CIPA 221PA 1TQ4A 1DS6A 2QP4A 3FMIA 3UK6A 1H65A 1YZKA 3EZ9A 5FUVA 2OCAA 2F3RA 4GDFA 5AK0A 4YQFA 3CKLA 3B1WA 4LX0A 3P27A 3L0PA 2ZE6A 2JGNA 1CJKC 3VR6A 2I3BA 2A30A 4MRSA 1KDOA 4ZCLA 3GLGB 4PPGA 1L4UA 2J7KA 4OI4A 3U60B 2QQEA 2W6ID 3LLMA 4TQAA 4IRUB 1CR2A 4G0NA 3U44B 3R9XA 1FP6A 2PX3A 2VEDA 1I4TD 4RKEA 2IHBA 1ZM2A 2ZRAA 2ZRDA 3PUYA 4LJ8A 4RCYA 3DMDA 2EWWA 3FHOA 1XD9A 2YINC 5CDFA 1P2VA 3LDAA 3RWMB 1BMFD 4NCIA 1WQ1R 2MSEB 4HEJA 2PMKA 4UXJA 3FMOB 1Q57A 4DLRA 3CPJB 3ZJYA 4Q4HA 2RGXA 2JJ8A 1GVNB 2WKQA 2XNDD 1NMXA 5TMPA 3A37A 2ZRJA 3I72A 5CDFE 2DB3A 3X1XA 1G17A 2GCOA 4QNRA 5G3ZA 3CH5A 4P33A 3UMSA 2PEZA 2WZQA 3UPUA 1PLKA 3QKSA 4NBSA 1GOTA 2CCJA 3K9LA 3I92A 3IO5A 1ESMA 4TT3A 5E95A 3K70D 3U7GA 5E4FA 1XMIA 3TW4A 2ZR0A 4QHSA 2A5DA 1XU4A 2FH5B 1XTJA 4TN1A 4MH0R 4XVQA 1B23P 3I61A 2EU8A 2GESA 2TMKA 3NBXX 4EPRA 2HXSA 3IIJA 1WP9A 5FBQB 1MO4A 1VIAA 3RS5A 1P3JA 3KJGA 4HUQB 4DZZA 2BWJA 5EE9A 3O47A 4TQ9A 4PAOA 4Q4HB 2J5XA 5B57C 5KOYA 5JJLA 4F4IA 3HJNA 2WVJA 4WBSA 1LFDB 3S1AB 1SVMA 1XCMA 5HKKA 2REBA 1KI4A 4UNSA 1I4LD 4BRWA 1DG1G 4YXWD 3UIEA 1ONBA 2GCOB 2JLZA 2UZIR 3QKSB 1U0LA 5GVSA 2JCSA 2OBNA 4GFDA 5FL7A 2WWGA 4B3DA 3PUXA 3AVPA 4WXRA 4PO9A 1U9IA 5E7JA 3U7HB 3OFNA 1G4AE 1NI3A 3AF2A 3CRMA 2JASA 4Q1BA 2WPDD 3OIYA 4YC7A 3WHLA 3KQKA 4DJTA 1Z6TA 5H70A 4EAQA 4EQ6A 1SVWA 2ZRLA 5FPKA 1KK0A 4KI0A 1E9BA 2FWRA 4YDHB 4F93B 5GJVC 4WAUA 4DB4A 5LDDC 1ZC3A 3W3ZB 2HCBA 5P21A 4TLCA 4BWYA 3T1VA 4DDVA 1UBCA 1KSJA 1T4GA 1ZNZA 3KJHA 5EE5B 5FOSA 4BZPA 3TGPA 3TW8B 1WMSA 1KO7A 3GFTA 3T12A 3QKUA 3KDSE 4PXAA 3ZVRA 1XNJA 1IJEA 4U02A 2N42A 1SHKA 1AS3A 5A5GA 4RD1A 2ANCA 3JVUA 4RZ2A 4URWR 2GXSA 2GJ8A 4A0FA 1WXQA 3MMPA 5DH9A 3TH5A 2HEIA 1GZSA 4PO1A 3MGCA 4IEEA 4TTQA 3CR7A 1T3SA 2N46A 2Z83A 1Z63A 2G1KA 4E03A 3WYAA 1WE2A 2F1JA 2QA5A 2ZR9A 1MABB 3B8HA 4LWZA 4EQ6B 5TDHA 3IQWA 1W36B 1CXZA 3QPWA 5EXTA 5TV2A 1X6VA 3TSZA 4C0KA 1E0KA 3EIEA 5JMTA 3LFUA 4RZ3A 2XEXA 4MDEA 4RZXA 1A82A 4JT2A 2XB4A 1J2JA 4V0MA 3DL0A 1EFCA 2GDJA 1E1RD 2VLIA 4PZZA 4OJQA 1SXJA 2O8EA 1GRRA 1E3MA 4O2RA 5HZHA 3ZVNA 1Q22A 3OEED 3CO5A 4KAXA 4DDTA 4LJ4A 5JBQA 1S2MA 4B44A 1IN4A 4URUR 3VKWA 2AL7A 3REFA 3GFOA 4DSTA 3BS4A 3ZYCA 1NVUQ 2ZS7A 1N5IA 1SXJE 3GJ7A 1NMYA 1SVLA 2ZM5A 1F2TA 4URYR 3K9GA 2OFWA 2X19A 1P73A 2QORA 2GJKA 4I81A 1U9IC 1D8TA 2AFIE 4B3CA 5FBLB 3EC2A 3VR2A 1XPOA 3I5XA 5EUMA 4RSGA 4CF7A 2GJ9A 1SVOA 2B7CA 3SYLA 3CF2A 3DOFA 4ZDWA 3RAPR 1QHIA 2HYDA 5C4MA 1L7VC 3KXIA 4LV6A 2Q0HA 1YZGA 2O8EB 4PAQA 4DUGD 2FV8A 3AH8A 1CR4A 1HTWA 3KXKA 1QHSA 3F5FA 3T5GA 1Z29A 3Q8XB 3AGQA 5CB8A 1Q3TA 3RDPA 1G3MA 4XD7A 4B3XA 4JLNA 1TF2A 2ZYVX 1TAGA 2LKDA 4ZIRA 4BASA 3KKMA 3SHFA 3IUYA 2HF8A 5EP3A 4CT5A 3FWYA 3GJ3A 4OQMA 1X3SA 3LWNA 3JVVA 4AK9A 1F2TB 3L8ZA 3RC3A 1Z8FA 2IYSA 3SYKA 5B64A 4LSGA 3NC0C 1VCNA 4Q4LA 4C2TA 5KDOA 3AVOA 2ZUDA 3EIHA 1RE0A 2XTZA 3IEVA 2B6HA 1WF3A 2ZJAA 3PCRB 3TBKA 1ZMXA 4GSYA 2ODEA 2ZRGA 4BEBA 4Q7MB 4IOMA 6Q21A 2HYIC 1ZIOA 1CBUA 2V6JA 3UWOA 1OIWA 4X8HA 1IBRA 1KOFA 2ZXUA 3C8UA 4EPVA 4TMWA 1HH4A 3A36A 2IYUA 2PT7A 5EQTA 2ZRNA 1NBMA 3RHFA 1EFTA 4IVRA 4GBMA 4JVLA 1Z0JA 4IDNA 2GETA 4ZKEA 2GBLC 2XXAA 1ZNWA 4Q1FA 3TLXA 5DI9A 4NONA 1RW4A 2NG1A 5B2ZA 4QGFA 1E2LA 2OLKA 3PUZA 4TL9A 1NBME 3B9PA 3OHMA 4LYJA 2DWQA 5IHPA 5JFGA 4YMWA 4B76A 4G1UC 1S3SA 3LXRA 1XF9A 1XTIA 4C0HA 3D31A 2EFEB 3AF3A 4Q7KA 4AYTA 5J4VA 2C99A 4TSFA 1UEIA 1XWIA 1KGDA 4IW3B 2KBEA 3AF4A 1G5RA 1L8QA 3E2IA 3MLEA 1OB5A 2O8DA 5CK5A 2ZI6A 5LB4A 3AP2A 2QBYB 1E9RA 4M22A 2ZYUX 1CRQA 4PC7A 3ADDA 4FCWA 2F1HA 4PHHA 4Q1DA 3AKEA 4L9SA 5DNYB 4PANA 3CW2A 3AEZA 4XTRA 2WWWA 3EW9A 4WIAA 5A0FA 1GL6A 3M1IA 1GRNA 1G9XA 1E4YA 2KJQA 4EFLA 2D06A 2FMXA 4LV8B 4W9MC 2XZOA 1I2DA 2DYKA 4QC2A 4Q1AA 3QSYA 4EUNA 2UKDA 5UKDA 1A2BA 2IYZA 3TIFA 4AC9A 1T91A 3EPJA 2ERYA 2QSYA 2CCGA 4OI2A 4PO8A 2F9LA 5FPHA 3WYGA 2D7CA 4HAVA 3RANA 1W5TA 2PT5A 2OILA 4NP6A 3R7WA 2B92A 2ZI9A 2Q3MA 3E1SA 2O8DB 2OV2A 4JMPA 1FNNA 4O3MA 4QBGB 3AVXA 2GRJA 1Q1EA 1XJ0A 5LPNA 1E2KA 3ICQB 2AXPA 1TNDA 3I3SR 4RVCA 1UDXA 1E2HA 1XTRA 2C9YA 4Q9IA 3VR3A 1DELA 2ODWA 4M8NE 4Q4JB 3Q85A 1EX6A 3UG7A 1KYIA 1P61B 3QXHA 1TTTA 3KQLA 1SVKA 5LB2A 1EFRA 2FFBA 4NYJQ 2PZEA 1X86B 3TRFA 3NBFA 4LBWA 1LNZA 4HDCA 4B2PA 3NDBB 3H0KA 2D3WA 5DISB 4P32A 4B73A 3IHLA 3VU9A 3T1QA 2MMGA 3A1TA 1GDDA 2YZ2A 1GUAA 1US8A 1QG4A 3FFAA 4TT3D 4IVQA 1A7JA 3X1ZA 2GZHA 1H8HD 4DXAA 5K8UA 1R5BA 3CZQA 3K0AA 1XMSA 4IVPA 2AKYA 1JI0A 2AD5A 1P5ZB 5EJEA 5CIWA 1U0JA 4JYCA 1OT3A 4LK2A 3D3QA 1EXMA 2WIAA 2C2HA 1FPMA 1LW7A 2BC9A 2XITA 3VHLB 1NLZA 5KHOC 4X8OA 5BN5A 4FWTA 4EJSA 3EWAA 1DARA 3QF4A 2IUUA 2WKRA 4GZMA 2BCJQ 2VP2A 2WWYA 4PTLA 3LA6A 1Q21A 4PAMA 1G1MA 4D4JA 5HKKD 4CVNA 2IYVA 3CRVA 3TNFA 4PQRA 1YZQA 1MO3A 3F8TA 5GJWC 1W49A 2GHIA 1R6BX 4OI1A 2QTFA 3BAFA 1N6RA 3D8BA 2DY1A 1G16A 4LJ9A 3VU9B 1QHXA 3QPVA 1M6NA 1HV8A 5LBIA 1US8B 4M4SA 4CW7A 5FL7D 4LRWA 2JLWA 2F43A 4H1VA 3R8FA 4QJ3A 3K0AB 4AWXA 3OFND 3PENA 2ZJ8A 3T15A 4OK6A 5DGXA 1VYUA 1G3QA 4NZYA 1N25A 4MKGA 1Z07A 3GPLA 4ZO4A 2ZE7A 1E96A 1UADA 1W36D 4N1AA 1S9HA 4JVMA 1G7SA 3K8YA 3U5ZB 2J0UA 2O8BB 4O2LA 2P3SA 1VCIA 1VCOA 3L0IB 1BH2A 2I1VB 4AURA 3QF4B 3QJYA 5KNCA 4HLDA 4ZPXA 3UATA 4RD4A 2IL1A 2RAPA 4Z1MA 3CH4B 2BDTA 3QXCA 4DEYA 1RKBA 2A5YB 1QVRA 4D4LA 2FFHA 1J90A 3NWJA 2CL6X 1V5WA 3DPUA 1G3RA 3K53A 2FJUA 2GXQA 2IK8A 2QU8A 2ZJ5A 3EX7C 3B2EA 2WPDA 2P5SA 1XCPA 3PV0A 4IOLA 3T61A 3U6BA 4XWOA 4LHYA 2ZVPX 2X8AA 4BRUA 4YMVA 1GL9B 3GJ0A 3FMFA 2CLSA 2J0UB 1GKUB 3SS8A 3T34A 3B60A 3OE7D 3CZPA 2FX3A 4XJXA 1HY3A 2J1LA 1TQ2A 3P26A 4JLOA 1EFHA 3SEAA 1EWQA 4HZIA 2RGNA 5FL3A 3EASA 3NC1C 3VR5A 4TMZA 2O8FA 1LF5A 4ZI3A 5BYKA 2LWIA 4F4JA 1T5LA 2GEDA 5BN3A 3SE0A 1PLLA 4Y0AA 2XX3A 3T5DA 2V1XA 2QI9C 5M04A 5HE9A 1AZSC 4NCKA 4IOKA 3P4XA 1OXTA 3NH9A 1QHGA 2CVFA 1NLFA 3LY5A 4IXNA 4CEJB 1TF7A 4KLNA 3KKQA 4KSBA 1HT1E 3ZDQA 2IC5A 4DSOA 4ASUD 1KI6A 1KMQA 2NPIA 2H92A 2PL3A 1ZVQA 2BKEA 2QM8A 1JNYA 1P2UA 1G5PA 4EPWA 4A6PA 4ZKDA 4Q1EA 2IT1A 1G5TA 4FI3C 3K0SA 1IY0A 4GOJA 5H68A 2ODBA 1M1YE 1JAIA 2ANBA 2YHSA 1E1RA 4UXIA 4WZ6A 3DDCA 1DPFA 2ZRFA 2ZREA 1Q1BA 3NKVA 3OEEA 1F3OA 3JZMA 2ZROA 1G3UA 4TYNA 3CRQA 4DEXA 1Q20A 1VHTA 3CWZA 1NL3A 1TX4B 2IWHA 1J8MF 4ESHA 3I8XA 1CRPA 1A5TA 1Z0FA 3A4LA 3E5HA 4V0LA 4HLUA 4C0SA 2C9OA 5AWFC 4BFYA 5TXGA 3BRWD 1GWNA 4UNNA 2V55B 3OESA 4Q5IA 2HUPA 2J0SA 2DWOA 2FNAA 2QMHA 4OL0A 4HUTA 4BEJA 5F3WB 1LS1A 1ZUHA 2ASEA 5FUWA 1G41A 1FQKA 1KI6B 2REOA 1FUKA 4Q47A 1E4VA 1R5NA 2E1RA 1M74A 3K9HA 5BWMA 4RJLA 1XCGB 2WHXA 4WZAE 3AF1A 2FPMA 1Z5ZA 2ZJZA 1N6KA 3T1TA 3BD9A 1ZM3A 4KODA 1AA9A 1AM4D 2DFNA 1DO0A 4DUGA 3THYB 3WRXC 1U8AA 3RRZA 1G7CA 2RGBA 1W4AA 4D25A 1E2PA 2YWFA 3A1WA 3QEOA 1R10A 1TF5A 1N2CE 1FX0B 2YV5A 4M21A 2AHOA 2ZS8A 5F2EA 3SBDA 1FZQA 1LVGA 1NBMD 2WJHA 4KHZA 2ONKA 2P65A 2WKPA 3WRYC 8OHMA 4A2WA 4M9ZA 1E69A 1JXOA 4V0KA 4DKXA 5J5CA 4QOSA 2EW1A 3KXLA 2ZI7A 1MOZA 3LBIA 3AVWA 4PQYA 4QM6A 2QQ0A 4YLGA 1BOFA 3QBVA 1KKLA 2ONJA 4V0NA 1EGAA 1U8ZA 2H57A 1RZ3A 1SGWA 4QHYA 5EE0A 2R6AA 3BBPA 3H86A 1UKYA 2GVDC 3RLFA 3IBGA 4GZLA 2YC2C 2QL6A 3SI7A 4JBYA 2OUKA 2IUTA 4Y0VA 2ZJ2A 4QM7A 5JI2E 3GCGA 2J41A 3Q7QA 1A4RA 1DOAA 3AKCA 2GTPA 2W83A 2R6GA 5DYGA 4LJ6A 4C4PA 3FTQA 4M9SA 1UF9A 4Q02A 1SVIA 2BV3A 4BZQA 3PQCA 1EESA 2XB2A 2UVQA 1N6HA 1M7HA 5CM8B 2OESA 1MRNA 1Z6YA 2P6UA 3BH7A 4OHVA 1NN0A 4KYIB 4C0AC 2Q6TA 4LHZA 3H1TA 5DN6D 1DAKA 1WA5A 4R7ZA 3MFYA 3QG1A 3LO5A 2IXGA 1QF9A 1RRPA 2F7SA 4TMXA 1VECA 4KVGA 4M0LA 2O8CA 1VIYA 3PIRA 3K9NA 4WZBE 4A1FA 2CHGA 1ZM9A 2VP6A 1B0UA 4HI0E 1N6LA 4DRZA 2QPTA 2HDNB 2BBWA 2FSIA 2BVNA 5TVKA 1KSGA 4D80A 1XD8A 2ZRCA 1GAJA 3AF0A 1YR7A 2W2VA 4JLDA 1K6MA 2J7PD 2BMDA 2V3CC 1HT2E 1VYVA 5G41A 1E9CA 4Q7JB 3BB1A 4FINA 3AGPA 1E2DA 1ZJ6A 3K0EA 2NOAA 3WYFA 1COWD 4L15A 3QBTA 1IXSB 1EFRD 2OZEA 1YZTA 4K46A 1CS4C 4TMVA 3THOA 5GADl 3OIWA 3MWYW 3RNLA 3FKQA 1ELOA 4B34A 4TMTA 2XNSA 2PEYA 4HLQB 1OYWA 2GJSA 1KDPA 4LHVA 4TTPA 3KKOA 3FHTA 2B21A 2NO1A 5FTLA 2RHDA 2QEQA 3PEYA 2O8CB 5FTJA 2G0TA 3SYNA 1RRCA 4LHXA 1Q44A 1U81A 1Z08A 2PLFA 3UG6A 1T5IA 2PMDA 1G4UR 2CXXA 1NRJB 4B33A 4XWKA 3MG9A 2OCYC 2W0MA 3Q5EA 4HUQA 1Q1ZA 1UBGA 5CYOA 4ON9A 2BBSA 2NO9A 3PEVA 4Q19A 3SOPA 3CUEF 4W7SA 2R6CA 2VQSA 3WMEA 2DHRA 1OXSC 4FCTA 1H8EA 3S1AA 1E2JA 1G20E 3F3YA 1NP6A 4CEIA 1D9XA 3TMKA 4NKRA 1TQ6A 4URZR 2XZLA 3BGWA 3MUFA 1VYTA 4KITB 2VHJA 3FGNA 4D82A 1IN7A 3EG5A 4LYHA 2VTKA 2BHRA 3AB3A 2GAOA 1E98A 1DAMA 2J3EA 4KFRA 2AD1A 4TL7A 3GLFA 5JJKA 1IQPA 2AKAB
chains in the Genus database with same CATH superfamily
4PY2A 4BO7A 4ER0A 1CUZA 3LVBA 4H0NA 2R2AA 2GUGA 2VDVE 2I9KA 1TD1A 2YMLA 2FSVA 3KEQA 3P9QA 2XRFA 2ZT8A 2PKEA 3QFSA 1G20B 1QSGA 3DPIA 1D2EA 2EKBA 2ZAYA 5FOTA 5FOXA 5DOZA 3WGHA 4CIXA 2HIGA 3GLFE 2C3OA 2ZQ5A 3RJMA 3M6IA 3GWGA 4XWAA 5ELLA 5IH3A 4AXXA 3HKEB 4B4KA 3SQWA 4TYWA 2AEJA 3MJVA 4OHFA 4D5EA 4J3FA 3GJRA 2G08A 3O2SB 2RH4A 1TT5B 3H9JA 5IMBA 3WGMA 4BFWA 1FYEA 1K98A 1XU9A 3PQEA 5DNEA 4DADA 1IHOA 2BHSA 5TQ2A 1EWTA 1AK2A 3KTOA 1AD2A 3BCSA 1F4PA 3V3KA 3MTDA 3ZS8A 1MIOB 4GZ3A 4BZXA 3OOJA 3IKVA 4ZYWA 3QLVA 1EJ6A 5KVSA 3DR3A 3FNIA 3LA8A 1LH0A 3GLFB 3B1YA 2CFCA 2B8NA 2PIAA 1Y7TA 3C5EA 3GEGA 3PNLA 1AT1A 4ZI2A 5CGQB 3VH3A 5ISMA 4PAWA 4IH1A 3ZWXA 3HFGA 3QVLA 5M34A 3AM1A 1SB9A 2IYPA 2QL9A 3TL2A 3W05A 5KTRA 2CUZA 4ZMBA 4BP8A 5FTMA 1P5HA 4CRWB 3GT0A 1XMPA 2VSYA 4KGDA 4N3AA 3PRHA 4OD0A 3A4YA 2BH9A 1VL8A 2V4MA 4YRQA 2WUGA 5K6RA 1R5OA 3PIIA 1KA9H 3ISJA 2R7KA 1XEAA 3FB1A 4U6NA 4E7OA 1NU6A 4DKJA 2Q1XA 3CS3A 1PZMA 2HRDA 4R69A 3F2IA 3MS4A 3Q8KA 1E2NA 1EK2A 5LZ8A 4CMKA 2EZ4A 2POCA 4UUAA 2OV3A 3OPNA 3PX3A 2ZYSA 1Z0DA 3GCXA 2QM3A 1ZN8A 4FJ0A 2VSOA 4YR7A 4QTUB 5K0EA 5K0TA 1ZIYA 2IXFA 4Q24A 5EMJA 2JI4A 3VR5D 1A1VA 2VWHA 3GLIE 4UHDA 1DJLA 1QV7A 2PX2A 1A88A 3NBAA 3LFHA 3EZXA 3QWIA 3DO5A 4XVRA 2ODQA 5FOQA 1KH1A 3H83A 4S1TA 4JENA 1PR2A 3IBCA 4GYWA 4LKRA 3QA3E 5AUQA 1F14A 2P4QA 3TSYA 3KYDB 1GM5A 4DLZA 2WSSD 3SJAA 1TUBA 2R1ZA 2RAFA 3NETA 3OFVA 4KFUA 4MUJA 421PA 1OXVA 3PVCA 3KPVA 3CVUA 3W6OA 2ZRKA 4W4TA 3OUZA 4QXMA 2XE7A 2CNLA 5BRNA 3TINA 4QYSA 4U6QA 3GLIB 2I4NA 1QR6A 4QRIA 1OAOC 1RLJA 2O2EA 1DKNA 4YRGA 3OZVA 4X91A 1KY2A 3KAJA 3A1VA 1P7CA 4BX9A 4YMUA 3QE0A 4CL2A 3QXXA 1F06A 2PWPA 3IODA 3BXZA 4LA4A 4N6NA 5BSWA 5JS8A 3AVYA 1K7FB 4D99A 2OV8A 3DOIA 3V8EA 4TTVA 5FI1B 1PTKA 1C30A 1EXDA 2VHQA 3H8JA 3IPCA 3STVA 4B5LA 1W8IA 1OBVA 1EUCA 1N5JA 3KT3A 1AGXA 1G8YA 3L40A 4RA9B 5CJPA 5A5FA 4XB2A 3TZBA 4OKSA 4RPLA 4PC6A 4RMIA 3UK7A 1W5BA 1F8UA 3KETA 2ZBRA 5BR4A 1VJDA 1C3XA 3OLZA 5EMNA 1IOLA 5LZ7A 3VKFA 4S05A 2Z0MA 5K03A 4K1XA 5FA6A 3K6JA 4Z4IA 2P1ZA 1D03A 3HFJA 5AJUA 2VOEA 4H4EA 4RCZA 4RDXA 1O4VA 1U7PA 4J1SA 5BRAA 5BXYA 1P45A 3ET5A 2FE4A 5FPPA 1M2JA 2EL9A 2W43A 3EZ7A 2C7QA 3GRKA 1TVCA 6GPBA 3BILA 2HB6A 2A1TR 1J25A 3D64A 1Z7GA 4EKEA 1F2UB 2R6FA 2WU3A 3KZKA 2EL7A 1QQTA 4OSOA 5F78A 3ZGXA 4BBAA 4BLQA 5LQJA 1M34E 3VSEA 1VSUA 2ZUEA 1P31A 5TQ0B 1EK0A 4YH1A 5JQGB 3SVTA 1Y8RA 3E84A 5B2FA 4XA8A 2H31A 5EXPA 3GRYA 3V7FA 4BNDA 2B2CA 1SG0A 4ZAVA 3TBFA 1Z2EA 4BJHB 2EKZA 4Z51A 5AVQA 4XQGA 4TUYB 3O3OB 4MMYB 1XX6A 3H42B 2DPYA 4TL6A 4IIFA 3ROPA 3IVRA 3CC8A 1BO6A 4IDHA 1CJCA 4LBVA 4OUDB 3C3YA 1XEXB 2HU8A 3G9TA 4TL8A 4CKZA 1OI3A 1VP3A 3MSXA 4GQIA 1K9SA 1U2GA 1Z5VA 1M34B 9ABPA 1HRKA 5FUXA 3N0WA 4UHKA 5I3ZA 1OC2A 1A72A 1ZK0A 2B30A 2FZVA 3ZK9A 2EATA 1ZL2A 1C8LA 3ROMA 1AQYA 1PTJC 3SFZA 1G8PA 3DEAA 3O8CA 1IK4A 1JDSA 2QYSA 3KVOA 2ACVA 4DUPA 1G2IA 4L4SA 1QZZA 2RB5A 3U3OA 1G21E 1AK9A 2WD7A 1DUVG 3PT5A 5IWAB 2GXAA 1L5SA 2J46A 3BGOS 2I4IA 3RW9A 4XOIA 5SZKB 3Q3GE 4O8CA 4FOOA 4MEJA 1JN0A 4BVAA 2OFFA 5KINB 5IG2A 1JBQA 3WP0A 3NOVA 3PE6A 3ZZ0A 1GPMA 3FMVA 1P4HA 1QU2A 1VE6A 5LYYA 2OWDA 4KE8A 1P17A 4OXRA 4UU8A 4CCAA 2G1AA 2Q49A 1G6HA 2PKRA 4DLNA 1UQUA 1DOZA 3DNMA 2BGGA 5BYBA 3QKTA 3UWDA 3HLKA 1G21B 1O0BA 2JFUA 4KSCA 4F3NA 3S7TA 4FLFA 1U3CA 3IR5A 3ZWCA 1EXVA 2WUDA 3KWMA 5AI0A 3AT1A 3R9WA 3A31A 1J0XO 1J9ZA 1TYEB 3LP8A 4Y30A 2VWGA 4Q4JA 3QBEA 4DMMA 1O5TA 2IEIA 5FI0B 2IYOA 1XMJA 3K2QA 4KR2A 4KH0A 4DLWA 5DNWA 1WX1A 2XUFA 2AC2A 4RTKA 4ZI7B 1JEYA 1SZCA 5HIAA 2X9VA 3K1AB 3CEMA 3EUAA 3ZEAA 1ORIA 5JTUA 5TARA 4ESVA 4IDPA 3K31A 4LGMA 3RBAA 5BN4A 1V9CA 1CJVC 1QC5A 1X9GA 3C5CA 1T4MA 1G18A 3RRJA 5DN6A 3U9TA 6REQB 1AMOA 4FNAA 1JXQA 2ZTUA 2CKDA 2HQSA 3WZMA 3MOGA 4PGAA 2XWPA 3SC2A 4R2MA 3T99A 3B9QA 1Q14A 1HFJA 2PS3A 2V4ZA 5DMXA 4OHOA 2SCUB 3QVMA 2TMGA 4BKQA 4DR2B 4MRMB 3WNBA 3WE7A 4WBNF 1UKCA 4HDSA 5C8XA 1EB8A 2JCGA 4CJXA 3ZCRA 2LR0A 2VNIA 3K1JA 1GSAA 2HDOA 2JRCA 4JQCA 1VIVA 3WO0A 1LK7A 3U7RA 5JADA 3KJIA 3CR8A 4UNQA 3GNSA 1RBQA 2CVHA 1ZUNA 5F35A 1A2OA 4IVNA 5JPIA 3CNLA 2PUTA 1DWQA 1KTIA 1YRQA 3DOUA 4CHGA 3AVUA 4G5QA 1HE1C 3NEPX 2NUAA 2NADA 2C3YA 3HV2A 2EZ8A 3ZHCA 2QMZA 2JAPA 1QIFA 2O2DA 5JNRA 3LWBA 2JC3A 4LZPA 4EPXA 1XPJA 3FHLA 5AW4A 5L4LA 4PFSA 1YFLA 1GGKA 4B48A 3HKDB 4J1QA 1Y1LA 1NHWA 4JLBA 1KMHB 1JB1A 4NYIQ 3WXMA 1OASA 2GO1A 2YYSA 4AJ9A 3SD7A 5J63A 4WOPA 1VG9B 1AKQA 2VCHA 1O7JA 3OOHA 1CKEA 4DF3A 1T1SA 2AE2A 3DEJA 3M49A 5DXJA 3CU5A 3VZPA 2OZLB 4OJTA 2ZJ1A 4GPTA 4PVDA 1DPGA 4TVOA 2WYUA 5ITVA 5JAHA 3L4JA 5I7EA 1T4CB 5BSHA 5C5DA 3CNHA 4GL4A 4MVJE 3EVCA 2R2GA 3PPYA 4FW8A 4P08A 2W6PA 4PG5A 1E8NA 3W5IA 4CI9A 3ZCPA 4DCTA 4ECAA 1F8FA 5C3MA 1N8TA 5ITWA 1ZP6A 3L3BA 5U9CA 1ISGA 4S24A 1ZJJA 2O7SA 3EUEA 5DM0A 4WKBA 2C2YA 3RVLA 3QV1A 1G60A 4K8OA 1XVLA 2PX0A 1RM3A 3ACBA 1GJRA 1DRVA 3SX4A 1WKBA 2W58A 3L8FA 1SY7A 4PSKA 5AI4A 3CX4A 1HYHA 5GZ3A 4O63O 2QMOA 3LHSA 1WDWB 2WAYA 4KGVA 3QX3A 1SEVA 4ZEXA 2FUCA 2XRZA 2C0CA 1MN6A 3WMWA 1J2EA 1T2NA 2ZJ0A 1OI7A 4X94A 7YASA 2Z57A 3PRKE 4UAVA 4RV9A 3GRRA 4P82A 2A78A 3NPMA 5WRFA 1OJ7A 1A50B 4UXHA 5C9ZA 1PK7A 3QK7A 3DB1A 1TM4E 3NBKA 3NRCA 4HATA 4Y9SA 2G06A 4QTTB 2WJWA 4J7UA 5ALUA 3UA4A 5CFPA 1VKJA 2PGXA 2X4DA 5BWNA 3HKCB 3O8QA 4LDPA 3H19A 4R4JA 2P35A 3OA2A 2VAMA 2DPLA 3TQOA 5HTOA 2Q6VA 4WA7A 3RYFB 2HXYA 1XVAA 3DLPX 4N8DA 3KSRA 1IONA 1RLTA 4OK3A 1VTKA 5EEGA 3W6NA 4ARBA 2OSVA 1OIVA 3SC4A 5IANA 2IHZA 5L3SA 1RPZA 1OV6A 3NTUA 3DMFA 2OHIA 2VJMB 5B5SA 5GOTA 5DULA 3ZLUA 4HNSA 2B78A 3SR0A 1PJ4A 2D1SA 1EG7A 2ZT7A 3MBIA 2LUOA 4KDCA 1T1IA 4JS0A 3FCYA 4YDSA 1Y6QA 2ZTSA 4HADA 4IHKA 2V96A 4KQ6A 3DF9A 2GR9A 3AIMA 2JIZD 4ME6A 4U2FA 5H82A 4CIVA 4AQYB 2XBMA 4Q3BA 3NRJA 1OF1A 3KT0A 4HYTA 1B0ZA 2WNHA 1DC4A 4HX5A 5CVDA 5IABA 5H83A 5LOVA 1TEXA 4HTFA 1NYRA 1JA0A 1ORRA 1RWXA 5T8KC 2VHCA 3WLIA 4BFVA 3JVIA 5FFNA 1DC7A 3GG2A 1QGAA 4YT2A 3QWFA 1D5CA 5EHNA 5HKLA 1H4QA 1DJMA 1P2SA 2NW6A 1T0UA 2NO6A 4WESB 3E81A 1YZHA 1YRAA 4ZOBA 5KU7A 3TCKA 3LYLA 4R3WA 1XXHA 3L1IA 2B1RA 4GX0A 4LSWA 1JFLA 1EQ2A 1KJ9A 4M54A 4TSKA 2D13A 3HGMA 5JNWA 2C78A 1RLUA 2X1VA 4IZOA 4DT1A 4F92B 5KB3A 3E27A 4PCVA 4QXQA 1ST3A 1UODA 3EA0A 4IIXA 4JL8A 4P4UA 3FUWA 3RVBA 1ANKA 4Y67A 2QTTA 5EIWA 3WRYA 4RELA 3PE3A 5FPTA 2A5FA 5JFTA 1YZ3A 4RPKA 4C0QC 4DA4A 2C0QA 4Y2UA 3CVOA 4LG1A 4LQDA 1C50A 1NXVA 1WW8A 5EXDA 4EF6A 13PKA 5GONA 4B2YA 3ZIAD 1R4MB 2P0YA 3HBJA 2H17A 2O3TA 3GP5A 3FOEC 3SBEA 2V74B 3I76A 2RKOA 3H1AA 3OF5A 3MJRA 3OJEA 2QVCA 1NFQA 2WSSA 4X1YB 2IS4A 2QLLA 3DONA 4GPBA 4CKBA 5LDHA 3CYFA 1KWKA 2FEAA 2OV6A 2V9CA 3QP9A 3KQPA 1L5LA 2I8LA 3IEUA 2IA5A 4HQOA 4DBLE 2QLMA 4RY0A 2Q3CA 5AJVB 1ADGA 4IOJA 3OIDA 5HMLA 4DLLA 5JATA 2I6UA 2I2XB 4NDZA 5KX5B 1BE6A 1WUIS 3RV3A 3L43A 5EZQA 2MSCB 1ZC4A 3COZA 2R8XA 2WTUA 4M76B 2YWEA 4FGWA 4KJZA 2CL0X 5AW5A 4C7OA 2XA2A 2QN8A 3IJ5A 1Q95A 1Y0BA 4FILA 2EG5A 1RC1A 1FX0A 1W96A 3WG9A 4DNOA 2CHQA 3DO6A 1WLSA 1YACA 1W581 2GCEA 5I4CA 5LQMA 2ORWA 3H2SA 4MLPA 2PRYA 2FN7A 3DOCA 4OP1A 3FI0A 4D4KA 3PFKA 1IZ9A 4YRMA 3RSOA 3BJZA 4G5HA 3WZ2A 1X8XA 3QW4B 4R2KA 3SICE 3A70A 5JBNA 5JAIA 3Q3EA 4Y7CA 3RBZA 4JYMA 2FUEA 5E9JA 1A27A 1FIUA 3G8YA 4YUYA 2ZK7A 3TZKA 3LX5A 4TWRA 1TAHA 2O0HA 2P9TA 1WZCA 4RVHA 1FU8A 2J9ZB 3HCAA 3UAYA 1YA8A 4C01A 2P3OA 2IU4A 1V45E 2BFBB 1NXQA 4GPIB 3D54D 2GPTA 4LMRA 3U09A 4NR0A 3LPAA 1U9YA 1W9MA 1YRWA 2DBYA 3ESAA 4AO6A 1HZZA 1R0CA 2FU5C 2O52A 1WDMA 2XD4A 3IMEA 1AZTA 3R7AA 4YMHA 3D7SA 1WU8A 3L7DA 2EQ5A 4HH4A 2EVWX 4JLUA 4ZTZB 1Q16A 2FPPA 3M70A 2NO0A 2ZI3A 3OAAD 5IAGA 1UWVA 3DE4X 2I91A 1HXHA 3CH7A 3REOA 4AG6A 2XCTB 1VA5A 4MR8B 1Q0HA 3RJ5A 4K9PA 2QGZA 1SQSA 2JGDB 2XDQA 1HG1A 3IV7A 1H9CA 2GBFA 2HCFA 4JKIA 3PXXA 3A3OA 4PW0A 3CPHA 3PFIA 4BGDA 2H63A 4R0VA 2D5CA 1KI3A 4JELA 1E1QD 5KPDA 2G9VA 2RH8A 4ZHQF 2H9YA 5FB3A 3U0VA 3WDKA 4Z0NA 1LSOA 1MA3A 3ZKWA 1FFHA 1ID1A 1PFUA 4RIHA 4F56A 4X1OA 3R0JA 5FQNA 3HB0A 4HDMB 2VDMB 4EUHA 5I7RA 4GOKA 3ITKA 2LIPA 3O90A 4WMLA 3TRJA 2PH1A 4LJKA 2Z1MA 4JLJA 4XUGB 2JKZA 3A04A 5HIIA 2AOTB 3L8YA 1YIAA 4XSHA 5GOZA 3U40A 5L95A 3NPAA 2WABA 3ZZTA 1V1MB 1ZCAA 2B8EA 3BORA 3IX7A 4E0BA 3OWHA 1N1MA 1ZQ1A 4ENSA 1DG9A 2J3HA 1G5HA 3LJKA 1BEZA 2L19A 2P2YA 2PDAA 1KO1A 4G4SO 4Z9FA 3AKYA 3R9KA 1YDGA 5J47A 1PFYA 2BKXA 1YE3A 3LX8A 3NVMB 4YJGB 1EUDA 3VO9A 3IEPA 1MH1A 1FTYA 1OFUX 3NAGA 3WYCA 3TDKA 3OECA 4HNAB 2RONA 4XB6B 3P2OA 1D2RA 2KLHA 2IEAA 1Y9EA 5JJBA 5ILOA 3OIUA 3V46A 3F47A 3UHJA 1L1FA 3WV4A 3A9CA 3QKRB 3ID6C 3K3PA 1IHUA 4DOMA 1N1DA 2G7MC 5IULC 1ONSA 4WNAA 4M87A 2GM4A 2H65A 1V4NA 4X5OA 1W4ZA 3EFBA 2N9UA 3I0MA 2NLOA 4DCOA 4GRAA 4ZVMA 3KVNA 1IOVA 4ITUA 2QXYA 1RADA 2Z4SA 4PU0A 1HZJA 3R41A 4R2IA 3DKKA 1DJNA 3KBOA 1QUFA 3FYTA 1OBFO 1GGEA 2IXEA 3UWPA 3HYSA 4N3NA 4G4GA 2H6EA 4Z9XA 5TE9A 1LDEA 4YX9A 2M9MA 1N6OA 3QQPA 4Q9LA 3U7FB 3KYCB 1N2ZA 1OY1A 2Z5VA 2JFZA 3RGWS 5I5GA 1JEDA 4NMWA 1AKRA 4MKHA 2QX4A 3D0QA 1MTOA 3BIXA 3LT0A 5J4LA 3IT1A 3IH5A 2GNAA 2OXRA 4OQXA 1MQSA 1TLTA 4PPFA 4PO3X 4XWGA 3HHEA 2LD4A 3MCAA 4W5RA 5JO0A 2GLTA 1EWKA 1PR6A 2COKA 1L5NA 4IHQA 3UMVA 1Y8QA 2JIQA 4MDFA 3TVTA 4LMAA 5E1BA 1OWMA 3DEYX 4FD2A 5SYAA 3UUEA 4CEHA 4MGEA 4MVWA 1POXA 3CPEA 3C7AA 2JFGA 4QSHA 4J6FA 5U1PA 5HUQA 1SUAA 3B9RA 1L9XA 2WVHA 1U94A 5CJJA 3NYQA 5ENVA 1H5UA 4DLVA 4I50B 3UJCA 2BFEB 1E2MA 2GYVA 2ZWPA 3LBNA 4MVJD 2PY6A 5IP5A 5THXA 3IQIX 2ZYIA 4C4RA 3NT5A 4FMPA 5K01A 1VRCA 5KIAA 3NBQA 4HQFA 1FJHA 4RKWA 4KVFA 1MO5A 1G20A 4M37A 5TEWA 3O8OB 1Y37A 3DZBA 2DF8A 2F48A 1TYZA 4TT8A 1CY2A 1W5FA 4G9EA 4RY9A 5FA5A 3N8KA 4DM7A 2H29A 3BJRA 2K5UA 3HKEA 3K6KA 2QX8A 1HDIA 3TSAA 2ZJYA 2X5JO 3HXKA 3U3MA 4HNTA 1VG1A 2V6IA 2O5VA 3A2LA 1TT5A 5J9FA 1XQXA 1JHOA 4MVJH 3HHPA 2VUUA 3SQXA 3L01A 3MT0A 1QQBA 4CQMB 3C97A 4B09A 2Q0SA 4QODA 2V0NA 3N2GA 3QVUA 3N0RA 2XV1A 1R9NA 5JI3E 5JW6A 4KQFA 4ZCIA 1ESEA 2RAUA 4YRRA 3L7MA 4KIUA 3EVDA 1T13A 3LQQA 3A1SA 4GGPA 3RVQA 3NBYC 2WA2A 3G23A 1CC1S 1MQAA 4O0MA 3BXOA 2OFOA 2QRZA 4PG6A 3ONEA 4M2LA 5F33A 2PBZA 2VZEA 1RMQA 2HSJA 2WJIA 4DSAA 5HCNA 4I9FA 2W4MA 1USVA 1YQEA 4QVGA 1GQOA 2Q3FA 4NEHB 4R41A 4GYJA 3P94A 4JI3B 1V43A 4EJ0A 1XRPA 3H5TA 4KWCA 3PFGA 4PYOA 3RC8A 1FS4A 3EHEA 4L74A 1KP2A 1W48A 4PHGA 4MA5A 4RHFA 1A8PA 3DTVA 3BERA 3EE6A 4YP7A 1BCRB 3TG2A 2AK2A 2E87A 3WSVA 4K6GA 3C3JA 4E5PA 5DPMA 3QUBA 3HEMA 2E4WA 3KB2A 4TS9A 1R27A 4O4LB 3ERCA 4PYJA 4MVCA 3L4EA 3TXAA 3BHMA 4PYNA 2GEUA 4UNPA 1UOPA 3T0GA 5DT2A 1QE3A 2GN8A 1EQUA 5FPQA 1YKFA 1OFUA 2R47A 3VUEA 3OY2A 3RUCA 3R3UA 3IB3A 2YX1A 2AS0A 1NVMB 4N5IX 2OG2A 2YUTA 1T6BY 3AHHA 1F2VA 3GLHA 5SYMA 1L8OA 2BFNA 2OKGA 2FEMA 2Y1OA 1XLTC 4ZO7A 5FYQA 3O31A 5B2EA 2XUOA 4YI5A 3K9BA 3SJBA 1Q12A 4NZMA 1PK8A 2DXIA 2JLRA 1YQWA 2A92A 2YS6A 2PJDA 4X7PA 5IUJC 4JKOA 1YULA 1ZX1A 1NJGA 2XE6A 4FR2A 4PLYA 2CJYA 3EIOA 1IU9A 3OCUA 1KPIA 1VKZA 3QOXA 5F5LA 1E2IA 2GF0A 3D6UA 1CV2A 4IFEA 3OURA 1QH0A 2BTEA 4KPEC 3GLIA 1T6YA 2XOEA 1O89A 3PQDA 4LC1A 4NZNA 5ERGB 4BQOA 3K09A 5A6VA 3OZWA 3W9YA 3EIQA 2BR5A 1UFRA 1ML3A 4YQYA 4A0RA 5IJ0A 1NQWA 1YZYA 4JI6B 3RC9A 5L7TA 4QFDA 1CEQA 1YBHA 3FSRA 3GAMA 1YR6A 1R2QA 4EG6A 1BE8A 1SHUX 2HA4A 2JZOA 2EDAA 4BVEA 1KNXA 4NOJA 3M34A 4JYPA 3FVRA 4Q03A 4WHMA 1TC2A 1XPUA 1DZ3A 3FNRA 2WDPA 3BMOA 4EKIA 5CCBA 2CXUA 1KO5A 2JBAB 3M4NA 4FFLA 5E7MA 5AW7A 4CXMA 2V7UA 4RA9A 3G3EA 1TM2A 5L3QB 3I6BA 3VKVA 4ZVLA 3UXMA 3ZQJA 1YCGA 5IT5A 3MBOA 4PZUA 4KBGA 3GZTB 1NRXA 3LQFA 4D1YA 3DFKA 4P53A 2XCRB 2H00A 3AMVA 4HDNB 4O1HA 5DCLA 1WDTA 1RZUA 1KR5A 4JP2A 3J81k 2CXPA 3HB7A 3I37X 4DBZA 3JYPA 3BMCA 2JJYA 1P2DA 1ZFNA 3RJTA 3WR5A 2RI6A 3RSHA 1RJ9A 1Y81A 2ENUA 4YRFA 4YUZA 2B34A 2P6NA 3LL7A 3TQRA 1I1QB 4XDYA 2QNRA 1M72A 4MV3A 3DJYA 2O8BA 1ABBA 1JXMA 1FFXB 3L0BA 1L1RA 1CR1A 5CCDA 4DSNA 3F9CA 2BSXA 1TPZA 3PWTA 4FGKA 4JU8A 1A9XB 2PZLA 3KYIB 5REQA 4GXQA 9LDBA 3HEAA 3RIHA 3S55A 2RHLA 1II9A 1SQGA 1F2UA 3A4VA 3GXOA 3OZSA 5JPCA 4U4AA 4GOMD 3O5AA 3PD0A 4MWZA 4V2UA 4W1RA 3GR6A 2ZVQX 4A8JB 5AW6A 1ZONA 2H16A 5FNVB 3IIIA 5HR5A 2OCGA 4O6VA 4G5YA 1MB9A 3ELYA 3NTOA 5DSXA 3PKZA 4FN5A 4YCDA 2Y9MB 4P4NA 3LLUA 4J49A 1CJTC 3AR9A 3KUKA 4PONA 1J09A 1J1ZA 5CVJA 2R65A 4ZT2A 2C4UA 4F38A 2J3MA 1Y98A 1MHPA 3O95A 4TUYA 1JWAB 5AKHA 2Q4RA 1I32A 1UANA 2IYXA 3MAJA 1IB0A 3AUJB 3R0IA 1NKVA 1OILA 2AJLI 3G49A 2X5NA 3Q7TA 4GT1A 3VH2A 5TPWB 4HAXA 1XEXA 4FWBA 3ZLBA 1VMKA 4GOXA 5CFMA 5KPJA 4JI7B 2NYAA 1LZKA 1XQ6A 2ZQYA 4LZZA 1OH8A 4D0GA 2EEPA 4UARA 1JEOA 2IU0A 2ZYWX 5ALGA 3DV2A 2HQRA 2D0OB 4RHTA 2W9XA 1JIVA 1USWA 3O7WA 4NBKA 3SIWA 5C51B 1F4LA 1FDUA 3FHCB 2PKQP 3P71T 1J4AA 4D92A 1OX4B 1GVHA 3BDVA 3CNOA 1E3SA 1P6UA 2A14A 2C8VA 1KFJB 4RDHA 4DSUA 3DZ8A 1FU4A 3JQ7A 1BA2A 1K6EA 1L3BA 1MEOA 1KDTA 3JATB 4ENUA 4PSCA 3FOWA 3TEFA 1X15A 3Q88A 2D6FA 1Z8DA 4E1VA 1W36C 5AJZA 4ENVA 4L8GA 1NNEA 4GMDA 1TEVA 1Q2XA 1YL5A 1YQDA 1AH2A 1VBKA 4DDUA 1TJPB 1XKXA 3PKIA 3USCS 1QFYA 1MJGA 4RDCA 4KVAA 4Y2YA 4YV1A 3G0HA 4PPYA 3S0JA 4EG8A 2QDKA 4M1TA 2A9KA 2ERCA 2ZYDA 1B76A 2FKNA 4PLFA 4BBPA 2GHRA 2HLNA 4X61A 4TKLA 1KO8A 1ZD4A 4FU0A 4JB8A 4QEZA 2AE1A 4RVGA 4RMGA 2ZBUA 3VDNB 4D0NA 4CQLB 3CX7A 1J20A 4YI3A 2XJ9A 2VHEA 3IKMB 4Z4CA 2FY8A 3GN2A 3U7IA 4F5YA 4JOSA 3OM8A 2OENG 2QVBA 5KTKA 2HJVA 5TT0A 1RM0A 1YGYA 1KBQA 2W8BB 1U1GA 3O2NA 4I14A 4GI7A 1L7MA 4KUHA 1AKMA 2FP4B 3AFGA 4QSMA 4YRIA 1E1QA 4EB6B 1QG2A 1I5RA 1KQNA 1ABFA 2D2EA 4ZI7A 1DBVO 3DD1A 1JQKA 1I2AA 2VG8A 3VR0A 3W5JA 2EW2A 3GUZA 2P9BA 1E9SA 4RF4A 2OB1A 5EKDA 4NBRA 2CXNA 1JAYA 1QXSA 3NKFA 5K3DA 2B5VA 1C14A 5L51A 4CLRB 5EJFA 4D43A 2H4HA 3RPEA 4D81A 1CFJA 1ZW6A 1R0ZA 1ZK2A 3T06B 4E4RA 4KXQA 2VJDA 3EPRA 2AN9A 4C2UA 2V65A 2ZT5A 2B4YA 1UBMS 2WUVA 2XSZA 4RO0A 3MMSA 2ZPTX 3AHDA 2EGHA 3E7FA 3OMXA 3ONFA 2BGWA 1EAMA 4NSNA 4I1PA 1S89A 3SS9X 3HR4A 2OB2A 3DMRA 5E0KB 4FYPA 1BGVA 4IXWA 4BMPB 2QN6A 5IM4A 5C8YF 1QO0A 4HFJA 5DHFA 1OX5A 2G07A 1SWWA 2YWDA 3ZX4A 5K1ZA 3RG8A 2YN2A 4FT4A 5DGCA 3W3AD 3I28A 5BR7A 2E21A 1HTTA 2BKUA 5H5JA 4H1WA 1E2QA 1SQFA 2YOFA 3ZE0B 2JG3A 4FIDA 4CQMD 2XR1A 4G01B 5I4KA 1DQZA 3SXUB 1F7VA 1Z2AA 1T36A 2LGJA 3HKDA 1QAMA 4MUNA 1TJ4A 1KMHA 3P2MA 1MOSA 1R8QA 1LDYA 1XZKA 2BZSA 4AW9A 2OBMA 4IHJA 1L7BA 1J7JA 1TCCA 4HXEB 2EFCB 1JF8A 3LAWA 2QWXA 3K4QA 1UBHS 3F6BX 3OBBA 1UAGA 1AE1A 1QO7A 2QAGB 3W3AH 1VMEA 1EJ0A 4KQEA 3U6KA 4ARIA 1KKUA 1XZMA 1DBIA 4LCJA 3QW2A 1IXZA 1E3IA 1Z6AA 1FUEA 3MGBA 2OZLA 4H3VA 4BVJA 5AT1A 2GEBA 1MT3A 4WERA 4WCFA 2QE7D 4FN4A 1WNFA 2A6PA 2ARKA 4J4BA 4BC1A 2GHQA 2QD4A 4ZYLA 2DRIA 2AZTA 3HPQA 1EHIA 3N7TA 3RS3A 3VZBA 4YRZA 2WWTA 2FZLA 3FUVA 3JR3A 4DLUA 4LJ5A 1GTG1 2B4KA 1ZSVA 5CDUA 5HW0A 4JP1A 5JS7A 5KBYA 2VP0A 2YJNA 4HN2A 3EGVA 5ITZB 3W9BA 3HM9A 2QTMA 5AVRA 1KRHA 2DLCX 5DHAA 2O5EA 3PC4A 1X8JA 4JLPA 5C37A 4GOOD 4C21A 2M98A 1PZXA 5I01A 4XPZA 1IJBA 1PSZA 3V00A 1KQ3A 4ERNA 4QFBA 2A33A 1UR5A 1XZPA 2GA8A 3F97A 3PHCA 4BBZA 4F3TA 4TZ0A 3CV3A 4A82A 1J0BA 1UJ6A 1VKRA 3BOSA 3RUEA 3VR6H 1NVDA 1L4EA 4MVJA 2WUEA 4HAUA 1UK8A 4JX8A 3QF7A 4MQ5A 1ZXLA 4MUXA 1ZCBA 5CNJA 3T5MA 4CN8A 4DANA 4QXOA 2X22A 2INGX 5DHRA 3LDFA 2OCBA 5KCMA 3MSCA 5B7PA 3CO0S 1GPWB 3SK0A 2I66A 2ZRBA 1JSZA 4JLAA 1F9EA 1RRGA 4B3TB 3LBHA 4OGFA 1LLDA 1U0NA 2BI4A 3RYFA 3TSWA 3X2SA 2QRQA 2YRWA 4F8YA 1Z7EA 4HKTA 4MWCA 3NG1A 3NHBA 1EUYA 1ENOA 3IDOA 2W6IA 1NDQA 3PUHA 1K4KA 1U1DA 1G7RA 2BGIA 4QUKA 3N2EA 1DC8A 1Q50A 2NZJA 4O33A 2O3RA 1SC1A 2XUIA 2Z4TA 1RI5A 3L6BA 1TD9A 5CXSA 1WULS 4ZOLA 3KOZA 1WB9A 2E5LB 4NMLA 3HVKA 4TXHA 3L5OA 1Y3IA 4PSVA 3WIVA 4MQMA 3AV0B 4JXZA 3QQ5A 1OVMA 2QQFA 4N82A 2X9NA 4TLDA 4EKDA 4EY3A 1UC5B 2CNDA 3TE6A 1K89A 2IHUA 3BQMB 3SHWA 2NSDA 1YB1A 3H7IA 1PBNA 3VYTB 1R9JA 3B6KA 1NQTA 2NO7A 4BB0A 1Z28A 2FEPA 2OKCA 4A0GA 1ZD1A 3BJEA 1V71A 3D3NA 4CM3A 1QFJA 1SG9A 2AWOA 4LOHA 5MN4A 1CEYA 2ZTVA 2CNOA 2GI4A 3ZHZA 5SYNA 1S1MA 3KEMA 1XI2A 1LPPA 3PEFA 1GTSA 2KYRA 2DPGA 4US1R 3MD0A 1XF1A 5KJFA 3G79A 1WUKS 3OC6A 1V3VA 4MRRA 2OG1A 1QCZA 2ZIVB 3E48A 3KDAA 2HQBA 3KVVA 1PHRA 2UYQA 5CW2A 5BSMA 2VBFA 4YAJA 1SK8A 8MHTA 3FD8A 3WKAA 1BVHA 3ELBA 4FSXA 1QIIA 1RTKA 5CT9A 3FOFC 3BH0A 3BUSA 1WPXA 4EIWA 4IIEA 1DEOA 1AKUA 3GL9A 2XVYA 4IP0A 4M8KA 4MPTA 4B1FA 3CIOA 3P32A 5AK4A 4KPFC 2AGVA 4YJKA 4NE9A 1ZZEA 4PZ0A 1U0BB 4N01A 4B46A 3GB9A 3GGJA 1EA5A 2J32A 3PK0A 2WE7A 3ICWA 4HLCA 3TGLA 1B3BA 2AHRA 5FAKA 3C7CB 4XPIB 1HEIA 1QCDA 4X1YA 3I1FA 2XQJA 2FW7A 4MKFA 2TS1A 2ZGVA 3AUSA 3L8HA 5ESDA 3WJ7A 5L6MB 5LUBA 2Q9BA 2JGIA 3OPYA 5LSAA 5JCXA 2XTAA 4Q00A 5CDYA 1NVVR 4WOBA 3C4VA 3BD8A 4JR0A 4MITA 1B93A 1Z88A 2I2BA 3N87A 3BJIC 1KYTA 3MLAA 3HVUA 1G8FA 1I3NA 4YJFB 3GJ6A 1MTZA 3FDFA 2ZKLA 2F43B 3NWPA 5EINA 5K0LA 3ASYA 3T4EA 1O3YA 1QGUA 3H9UA 3JQFC 2ZJBA 4CF6A 1XCLA 3H4MA 2FSHA 1PHPA 2QTNA 1HE3A 2O57A 5F77A 3PP8A 4Y7DA 1C3OB 3RSCA 3G8AA 3JYQA 5TVGA 2EFHB 3AL3A 4AD8A 2XOXA 4C1NA 4OAOA 1E5QA 5LWQA 2EWVA 3I6YA 4X1KA 1N6IA 1L1QA 1IZZA 1N2HA 4FK8A 1QKJA 3I9MA 4V03A 1YI0A 2K6GA 2UZ1A 2QUAA 2AW5A 1HRDA 4D3SA 5TNXA 1CUGA 1WTCA 1Y5MA 2O8NA 3R4VA 3ZNQA 1H4SA 3P9ZA 4GP9A 4DV2B 4RFSA 1PVVA 4P2BA 2GZSA 1T10A 2Y67A 3F5DA 4HVAA 2DUMA 2JCXA 1GU7A 1QVAA 1EFPB 1O94A 1SWVA 3U39A 2Y8EA 1ODLA 1Q7CA 1FFYA 1XZGA 3ZCSA 3R5XA 1B6RA 2VIIA 3MMNA 4ITRC 5FUYA 2XD9A 3AB7A 2BFBA 2H52A 3L7YA 4HB3A 5F5XA 1SVUA 3QFHA 3V4OA 5LP1A 1UJ4A 2Q3EA 4QX6A 5HSGA 1XSEA 2IH2A 4PWYA 4UMVA 3LW8A 1DBSA 4XJVA 821PA 1M6HA 2WJJA 3RAJA 3MK31 2ZUTA 1B43A 1H05A 2G04A 4GMKA 4MYHA 1FNSA 3T6KA 4MGZR 1ULBA 4CM9D 3K70C 1KDRA 3LRXA 4R01A 2XA1A 3AG6A 1UKZA 2DH5A 3NXSA 1UJBA 4KFTA 2JGDA 4ZV4A 3BYZA 3C6QA 1JIXA 4TWIA 4R9NA 5BSEA 5DEOA 3FNFA 1JQBA 2XH8A 1DFHA 4LWPA 4XRGA 4DE5A 4DYVA 3Q7PA 2HX1A 3NHYA 4FHDA 1YJQA 3CVXA 4FR0A 3WK4A 4BFSA 4JVOA 4BLVA 2C58A 4HWSA 5JD6A 3WIDA 1U0TA 4BPBA 3GJ5A 3VTFA 1EVKA 2QTAA 3DOJA 1N0WA 1TRKA 5CHEA 4DFDA 5GM2A 2O8FB 1MX3A 4NULA 2AFVA 4NFHA 2AOTA 5TLSA 1YS2X 2ZJ7A 5CPFA 1MVOA 2SKDA 3B12A 5I8ZA 1JKJB 2BEKA 3V9AA 4HNGA 2HPHA 4K6KA 2A1IA 2HA0A 3MVEA 4MVYA 4ZOAA 1XUOA 4TWBA 1W46A 2C5HA 4UAUA 1O9GA 3DKIA 2ZETA 1TDJA 2BOVA 4A27A 2CY0A 5BW5A 4YJGA 3N39C 2C5AA 5IVPA 2NXNA 1GAQA 1I4OA 3N2ZB 5KYYA