4Q0NA

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) in complex with a hydroxyphenyl-propenone ligand
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4q0nA00
4ZC9A 5CQ3A 2DKWA 4A9OA 4QY4A 5H1UA 3DWYA 5C85A 5A5RA 4PCEA 3U5JA 5LKTA 5DW1A 4MENA 2DVRA 4YK0A 2E7NA 5HFRA 3JVMA 4QC3A 5FG6A 2DVSA 5COIA 4HBXA 4J0RA 4QR4A 5FFVA 5KTXA 5E9LA 5IGKA 3S91A 1WUMA 3MB3A 3UV4A 3LXJA 1WUGA 4QZSA 5FH7A 5LKXA 4O72A 5F1HA 5DKCA 5J0DA 3GG3A 5EGUA 4N4HA 4UIXA 5FE0A 5CQ4A 5CQ7A 1F68A 3O34A 2DATA 4A9NA 4CUPA 4IOQA 4IOOA 5IG6A 5I86A 4UYGA 4YAXA 5BT4A 2RFJA 2RNXA 4LZSA 4XUAA 5EQ1A 3LQIA 4KCXA 5CPEA 5I80A 5II1A 4XY9A 5FE8A 2D9EA 5JI8A 5CGPA 3DAIA 3HMHA 5BT5A 3FKMX 4OGIA 5EWCA 5LUUA 4CLBA 5A5QA 5H85A 4UYFB 4CUTA 5FG4A 2R0VA 4O76A 5E9IA 4YYNA 5E7DA 4HBVA 4ALHA 5FB0A 4N4FA 5ENBA 4LZ2A 4AKNA 5II2A 5F5ZA 4YYIA 4NUDA 5L96A 2YEKA 3O36A 5C4QA 5CUAA 4LRGA 4BW3A 5CUGA 4ZQLA 5ENHA 5A5PA 3O33A 3Q2FA 4YYKA 4TT2A 4NQNA 4QB3A 2YQDA 4QSWA 4MEPA 5ENEA 5DLXA 4YADA 2RI7A 3QZVA 3TLPA 5IIDA 4TYLA 5CZGA 4QSTA 5H1VA 2NXBA 4NQMA 3U5PA 5D3NA 3UVYA 3RCWA 5LKZA 4UYEA 4NR8A 4TTEA 3ONIA 5E73A 3MQMA 4CUQA 5FE6A 5F62A 4C66A 5K29A 5FE9A 4MR4A 5EVAA 5EICA 4QBMA 5CQAA 3U5MA 5HRXA 3U5LA 4A9MA 5D26A 5F61A 5A82A 5I29A 5HELA 5HENA 3P1FA 5CS8A 4N4GA 5CQ5A 5G4SA 5H1TA 4OUFA 5E3DA 5FDZA 4QSUA 3HMFA 4LR6A 4CL9A 4CFKA 4PS5A 3QZTA 5EK9A 5FBXA 4A9EA 4YBTA 3LQJA 4NUCA 3P1DA 5LVQA 4QSSA 2OSSA 4HXSA 4QEVA 4OGJA 4MR5A 5CFWA 5A83A 5LJ2A 4UIUA 3UW9A 4O7AA 5EU1A 2YDWA 4BJXA 5I88A 5CUBA 5CUDA 4UIZA 5ENGA 5EISA 1EQFA 4IR5A 2L85A 5D3JA 3G0LA 5D3PA 5HQ7A 2LSPB 4X2IA 5C7NA 5HLSA 4Q0OA 3UV2A 4QC1A 2MJVB 5I83A 4IORA 4O74A 5DKDA 5D3SA 4YY6A 5ENJA 5C89A 4NXJA 5A81A 3JVJA 5E9MA 3U5KA 4Z1SA 5CY9A 4YATA 5A5SA 4ALGA 4TT4A 5KTUA 1ZS5A 5E0RA 4QSXA 4YBMA 4RVRA 4FLPA 5I1QA 5AMEA 5HM0A 2WP1A 4O78A 4HBYA 4QYLA 2YYNA 3P1CA 5EWVA 2I8NA 4QR3A 2RNWA 4NR5A 4LYSA 5CRMA 5D3TA 5F2PA 5G4RA 3MB4A 5L8UA 5F36A 4N3WA 4YYJA 5DX4A 5L98A 4TZ2A 4UYDA 5F25A 3IU6A 4HXMA 2N9GA 5ENCA 5C87A 3O37A 4HXOA 5D24A 4LYIA 2YW5A 2GRCA 2F6JA 5IBNA 4XY8A 5EI4A 5F1LA 4O71A 3G0JA 3P1EA 4ZW1A 2E7OA 2R0SA 4IR4A 5AMFA 4YYMA 5FE3A 4E96A 5EP7A 5D3RA 4IR6A 5I7YA 4CFLA 5DY7A 5LVRA 5LKUA 4TT6A 4N4IA 3SVFA 4J3IA 1E6IA 4Y03A 1JSPB 2RNYA 3JVLA 4HBWA 5EWHA 4YYDA 5KHMA 2L84A 4MEOA 4BW1A 5ENIA 5CP5A 5LJ0A 5HQ5A 5DYUA 3U5NA 3P5OA 4LZRA 4KV1A 4UYHA 4YYHA 5CU8A 5DYAA 5EPBA 4HXNA 4CURA 5CTLA 2L5EA 5F60A 4MR6A 5FE1A 5CUEA 3I3JA 5ACYA 5FB1A 5F3AA 5I89A 4J0SA 4LYWA 1JM4B 4BHWA 5DLZA 5E9VA 4O7CA 5FFWA 4NYXA 5BT3A 3D7CA 4WHWA 5A5NA 5EWDA 3MXFA 4PCIA 4C67A 5KO4A 4YY4A 4QEWA 3UV5A 3JVKA 4O77A 2D82A 5LJ1A 1N72A 5F63A 3IU5A 4QYDA 4XUBA 5D3HA 4TU6A 5AD3A 4A9KA 5C8GA 4GPJA 4PKLA 2YEMA 5HFQA 4A9LA 4NR9A 4UIVA 4LDFA 5CUCA 4J1PA 2R0YA 5D25A 5HQ6A 4TZ8A 3SVGA 4NR6A 3K2JA 5DKHA 4A9FA 4WHUA 2FSAA 5A5OA 3QZSA 3LJWA 2YELA 2E3KA 5CQ8A 4NR7A 4QR5A 3HMEA 4A9JA 2RO1A 5E74A 4QSPA 4UIWA 5HJCA 4KV4A 5I40A 3MULA 3ZYUA 5HEMA 4QSQA 4F3IA 4Z6HA 5CQ6A 4XYAA 4LC2A 4NRBA 5DFBA 4NRCA 2F6NA 4TU4A 5TB6A 5EM3A 5FH6A 4PY6A 3AADA 4YC9A 4Z93A 4QUTA 5CQTA 4TS8A 3UVDA 4NUEA 5D0CA 4O7FA 5DYXA 5FG5A 4QSRA 5KTWA 5E3GA 5DFCA 2DWWA 4QEUA 3U5OA 5I7XA 5ETDA 4O75A 5IGNA 5AD2A 5JWMA 5L99A 5EPRA 2WP2A 4UIYA 5FE7A 4PTBA 4Z1QA 2KTBB 4NYVA 3UVXA 5HRWA 4CUSA 4YBSA 4BW4A 5DW2A 5HCLA 4MR3A 3Q2EA 5E9YA 5A7CA 5L8TA 5EA1A 5DFDA 5L97A 5FFYA 2H60A 4QUUA 5FE4A 4O7EA 4HXPA 4MEQA 5EV9A 4YH3A 4QNSA 5IGLA 3SVHA 2DVQA 4NR4A 4UITA 2DVVA 2G4AA 2I7KA 4TQNA 4QSVA 4A9HA 5DBMA 4HXRA 2R10A 3AQAA 4CUUA 4YH4A 5KU3A 3NXBA 3LQHA 4UYFA 4WIVA 2OO1A 4Z6IA 3O35A 4HXLA 4IR3A 1X0JA 5E9KA 4DONA 5FE2A 5ETBA 5FE5A 4BW2A 5A85A 4NS5A 5DYCA 2RS9B 4Q0NA 2OUOA 4YABA 4HXKA 4NYWA 3UVWA 5D7XA 5HRVA 5EPSA 4O70A 5ENFA 5IGMA 5EWWA 3S92A 5D3LA 4YYGA 4O7BA 5CRZA 4A9IA 3MUKA 5TCMA 5FH8A 4NRAA
chains in the Genus database with same CATH superfamily
4ZC9A 5CQ3A 2DKWA 4A9OA 4QY4A 5H1UA 3DWYA 5C85A 5A5RA 2EJNA 4PCEA 5LKTA 3U5JA 5DW1A 4MENA 2DVRA 4YK0A 2E7NA 5HFRA 3JVMA 4QC3A 5FG6A 2DVSA 5COIA 4HBXA 4J0RA 4QR4A 5FFVA 5KTXA 5E9LA 5IGKA 3S91A 1WUMA 3MB3A 3UV4A 3LXJA 1WUGA 4QZSA 5FH7A 5LKXA 4O72A 5F1HA 5DKCA 5J0DA 3GG3A 5EGUA 4N4HA 4UIXA 5FE0A 5CQ4A 5CQ7A 1F68A 3O34A 2DATA 4A9NA 4CUPA 4IOQA 4IOOA 5IG6A 4AKGA 5I86A 4UYGA 4YAXA 5BT4A 2RFJA 3VKGA 2RNXA 4LZSA 4XUAA 5EQ1A 3LQIA 4KCXA 5CPEA 5I80A 5II1A 4XY9A 5FE8A 2D9EA 5JI8A 5CGPA 3DAIA 3HMHA 5BT5A 3FKMX 4OGIA 5EWCA 5LUUA 4CLBA 5A5QA 5H85A 4UYFB 4CUTA 5FG4A 2R0VA 4O76A 5E9IA 4YYNA 5E7DA 4HBVA 4ALHA 5FB0A 4N4FA 5ENBA 4LZ2A 4AKNA 5II2A 5F5ZA 4YYIA 4NUDA 5L96A 2YEKA 3O36A 5C4QA 5CUAA 4LRGA 4BW3A 5CUGA 4ZQLA 5ENHA 5A5PA 3O33A 3Q2FA 4YYKA 4TT2A 4NQNA 4QB3A 2YQDA 4QSWA 4MEPA 5ENEA 5DLXA 4YADA 2RI7A 3QZVA 3TLPA 5IIDA 4TYLA 5CZGA 4QSTA 5H1VA 2NXBA 4NQMA 3U5PA 5D3NA 3UVYA 3RCWA 5LKZA 4UYEA 4NR8A 4TTEA 3ONIA 5E73A 3MQMA 4CUQA 5FE6A 5F62A 4C66A 5K29A 5FE9A 4MR4A 5EVAA 5EICA 4QBMA 5CQAA 3U5MA 5HRXA 3U5LA 4A9MA 5D26A 5F61A 5A82A 5I29A 5HELA 5HENA 3P1FA 5CS8A 4N4GA 5CQ5A 5G4SA 5H1TA 4OUFA 5E3DA 5FDZA 4QSUA 3HMFA 4LR6A 4CL9A 4CFKA 4PS5A 1PUOA 3QZTA 5EK9A 5FBXA 4A9EA 4YBTA 3LQJA 4NUCA 3P1DA 5LVQA 4QSSA 2OSSA 4HXSA 4QEVA 4OGJA 4MR5A 5CFWA 5A83A 5LJ2A 4UIUA 3UW9A 4O7AA 5EU1A 2YDWA 4BJXA 5I88A 5CUBA 5CUDA 4UIZA 5ENGA 5EISA 1EQFA 4IR5A 2L85A 5D3JA 3G0LA 5D3PA 5HQ7A 2LSPB 4X2IA 5C7NA 5HLSA 4Q0OA 3UV2A 4QC1A 2MJVB 5I83A 4IORA 4O74A 5DKDA 5D3SA 4YY6A 5ENJA 5C89A 4NXJA 5A81A 3JVJA 5E9MA 3U5KA 4Z1SA 5CY9A 4YATA 5A5SA 4ALGA 4TT4A 5KTUA 1ZS5A 5E0RA 4QSXA 4YBMA 4RVRA 4FLPA 1ZKRA 5I1QA 5AMEA 5HM0A 2WP1A 4O78A 3VKHA 4HBYA 4QYLA 2YYNA 3P1CA 5EWVA 2I8NA 4QR3A 2RNWA 4NR5A 4LYSA 5CRMA 5D3TA 5F2PA 5G4RA 3MB4A 5L8UA 5F36A 4N3WA 4YYJA 5DX4A 5L98A 4TZ2A 4UYDA 5F25A 3IU6A 4HXMA 2N9GA 5ENCA 5C87A 3O37A 4HXOA 5D24A 4LYIA 2YW5A 2GRCA 2F6JA 5IBNA 4XY8A 5EI4A 5F1LA 4O71A 3G0JA 3P1EA 4ZW1A 2E7OA 2R0SA 4IR4A 5AMFA 3D1BA 4YYMA 5FE3A 4E96A 5EP7A 5D3RA 4IR6A 5I7YA 4CFLA 5DY7A 5LVRA 5LKUA 4TT6A 4N4IA 3SVFA 4J3IA 1E6IA 4Y03A 1JSPB 2RNYA 3JVLA 4HBWA 5EWHA 4YYDA 5KHMA 2L84A 4MEOA 4BW1A 5ENIA 5CP5A 5LJ0A 5HQ5A 5DYUA 3U5NA 3P5OA 4LZRA 4KV1A 4UYHA 4YYHA 5CU8A 5DYAA 5EPBA 4HXNA 4CURA 5CTLA 2L5EA 5F60A 4MR6A 5FE1A 5CUEA 3I3JA 5ACYA 5FB1A 5F3AA 5I89A 4J0SA 4LYWA 1JM4B 4BHWA 5DLZA 5E9VA 4O7CA 5FFWA 4NYXA 5BT3A 3D7CA 4WHWA 5A5NA 5EWDA 4AKHA 3MXFA 4PCIA 4C67A 5KO4A 4YY4A 4QEWA 3UV5A 3JVKA 4O77A 2D82A 5LJ1A 1N72A 5F63A 3IU5A 4QYDA 4XUBA 5D3HA 4TU6A 5AD3A 4A9KA 5C8GA 4GPJA 4PKLA 2YEMA 5HFQA 4A9LA 4NR9A 4UIVA 4LDFA 5CUCA 4J1PA 2R0YA 5D25A 5HQ6A 4TZ8A 3SVGA 4NR6A 3K2JA 5DKHA 4A9FA 4AI6A 4WHUA 2FSAA 5A5OA 3QZSA 3LJWA 2YELA 2E3KA 5CQ8A 4NR7A 4QR5A 3HMEA 4A9JA 2RO1A 5E74A 4QSPA 4UIWA 5HJCA 4KV4A 5I40A 3MULA 3ZYUA 5HEMA 4QSQA 4F3IA 4Z6HA 5CQ6A 4XYAA 4LC2A 4NRBA 5DFBA 4NRCA 2F6NA 4TU4A 3D1DA 5EM3A 5FH6A 4PY6A 5TB6A 3AADA 4YC9A 4Z93A 4QUTA 5CQTA 4TS8A 3UVDA 4NUEA 5D0CA 4O7FA 5DYXA 5FG5A 4QSRA 5KTWA 5E3GA 5DFCA 2DWWA 4QEUA 3U5OA 5I7XA 5ETDA 4O75A 5IGNA 5AD2A 5JWMA 5L99A 5EPRA 2WP2A 4UIYA 5FE7A 4PTBA 4Z1QA 2KTBB 4NYVA 3UVXA 5HRWA 4CUSA 4YBSA 4BW4A 5DW2A 5HCLA 4MR3A 3Q2EA 5E9YA 5A7CA 5L8TA 5EA1A 5DFDA 5L97A 5FFYA 2H60A 4QUUA 5FE4A 4O7EA 4HXPA 4MEQA 5EV9A 4YH3A 4QNSA 5IGLA 3SVHA 2DVQA 4NR4A 4UITA 2DVVA 2G4AA 2I7KA 4TQNA 4QSVA 4A9HA 5DBMA 4HXRA 2R10A 3AQAA 4CUUA 4YH4A 5KU3A 3NXBA 3LQHA 4UYFA 4WIVA 2OO1A 4Z6IA 3O35A 4HXLA 4IR3A 1X0JA 5E9KA 4DONA 5FE2A 5ETBA 5FE5A 4BW2A 5A85A 4NS5A 5DYCA 2RS9B 4Q0NA 2OUOA 3ERRA 4YABA 4HXKA 4NYWA 3UVWA 5D7XA 4AKIA 5HRVA 5EPSA 4O70A 5ENFA 5IGMA 5EWWA 3S92A 5D3LA 4YYGA 4O7BA 5CRZA 4A9IA 3MUKA 5TCMA 5FH8A 4NRAA
chains in the Genus database with same CATH topology
4ZC9A 5CQ3A 2DKWA 4A9OA 4QY4A 5H1UA 3DWYA 5C85A 5A5RA 4PCEA 3U5JA 5LKTA 5DW1A 4MENA 2DVRA 4YK0A 2E7NA 5HFRA 3JVMA 4QC3A 5FG6A 2DVSA 5COIA 4HBXA 4J0RA 4QR4A 5FFVA 5KTXA 5E9LA 5IGKA 3S91A 1WUMA 3MB3A 3UV4A 3LXJA 1WUGA 4QZSA 5FH7A 5LKXA 4O72A 5F1HA 5DKCA 5J0DA 3GG3A 5EGUA 4N4HA 4UIXA 5FE0A 5CQ4A 5CQ7A 1F68A 3O34A 2DATA 4A9NA 4CUPA 4IOQA 4IOOA 5IG6A 5I86A 4UYGA 4YAXA 5BT4A 2RFJA 2RNXA 4LZSA 4XUAA 5EQ1A 3LQIA 4KCXA 5CPEA 5I80A 5II1A 4XY9A 5FE8A 2D9EA 5JI8A 5CGPA 3DAIA 3HMHA 5BT5A 3FKMX 4OGIA 5EWCA 5LUUA 4CLBA 5A5QA 5H85A 4UYFB 4CUTA 5FG4A 2R0VA 4O76A 5E9IA 4YYNA 5E7DA 4HBVA 4ALHA 5FB0A 4N4FA 5ENBA 4LZ2A 4AKNA 5II2A 5F5ZA 4YYIA 4NUDA 5L96A 2YEKA 3O36A 5C4QA 5CUAA 4LRGA 4BW3A 5CUGA 4ZQLA 5ENHA 5A5PA 3O33A 3Q2FA 4YYKA 4TT2A 4NQNA 4QB3A 2YQDA 4QSWA 4MEPA 5ENEA 5DLXA 4YADA 2RI7A 3QZVA 3TLPA 5IIDA 4TYLA 5CZGA 4QSTA 5H1VA 2NXBA 4NQMA 3U5PA 5D3NA 3UVYA 3RCWA 5LKZA 4UYEA 4NR8A 4TTEA 3ONIA 5E73A 3MQMA 4CUQA 5FE6A 5F62A 4C66A 5K29A 5FE9A 4MR4A 5EVAA 5EICA 4QBMA 5CQAA 3U5MA 5HRXA 3U5LA 4A9MA 5D26A 5F61A 5A82A 5I29A 5HELA 5HENA 3P1FA 5CS8A 4N4GA 5CQ5A 5G4SA 5H1TA 4OUFA 5E3DA 5FDZA 4QSUA 3HMFA 4LR6A 4CL9A 4CFKA 4PS5A 3QZTA 5EK9A 5FBXA 4A9EA 4YBTA 3LQJA 4NUCA 3P1DA 5LVQA 4QSSA 2OSSA 4HXSA 4QEVA 4OGJA 4MR5A 5CFWA 5A83A 5LJ2A 4UIUA 3UW9A 4O7AA 5EU1A 2YDWA 4BJXA 5I88A 5CUBA 5CUDA 4UIZA 5ENGA 5EISA 1EQFA 4IR5A 2L85A 5D3JA 3G0LA 5D3PA 5HQ7A 2LSPB 4X2IA 5C7NA 5HLSA 4Q0OA 3UV2A 4QC1A 2MJVB 5I83A 4IORA 4O74A 5DKDA 5D3SA 4YY6A 5ENJA 5C89A 4NXJA 5A81A 3JVJA 5E9MA 3U5KA 4Z1SA 5CY9A 4YATA 5A5SA 4ALGA 4TT4A 5KTUA 1ZS5A 5E0RA 4QSXA 4YBMA 4RVRA 4FLPA 5I1QA 5AMEA 5HM0A 2WP1A 4O78A 4HBYA 4QYLA 2YYNA 3P1CA 5EWVA 2I8NA 4QR3A 2RNWA 4NR5A 4LYSA 5CRMA 5D3TA 5F2PA 5G4RA 3MB4A 5L8UA 5F36A 4N3WA 4YYJA 5DX4A 5L98A 4TZ2A 4UYDA 5F25A 3IU6A 4HXMA 2N9GA 5ENCA 5C87A 3O37A 4HXOA 5D24A 4LYIA 2YW5A 2GRCA 2F6JA 5IBNA 4XY8A 5EI4A 5F1LA 4O71A 3G0JA 3P1EA 4ZW1A 2E7OA 2R0SA 4IR4A 5AMFA 4YYMA 5FE3A 4E96A 5EP7A 5D3RA 4IR6A 5I7YA 4CFLA 5DY7A 5LVRA 5LKUA 4TT6A 4N4IA 3SVFA 4J3IA 1E6IA 4Y03A 1JSPB 2RNYA 3JVLA 4HBWA 5EWHA 4YYDA 5KHMA 2L84A 4MEOA 4BW1A 5ENIA 5CP5A 5LJ0A 5HQ5A 5DYUA 3U5NA 3P5OA 4LZRA 4KV1A 4UYHA 4YYHA 5CU8A 5DYAA 5EPBA 4HXNA 4CURA 5CTLA 2L5EA 5F60A 4MR6A 5FE1A 5CUEA 3I3JA 5ACYA 5FB1A 5F3AA 5I89A 4J0SA 4LYWA 1JM4B 4BHWA 5DLZA 5E9VA 4O7CA 5FFWA 4NYXA 5BT3A 3D7CA 4WHWA 5A5NA 5EWDA 3MXFA 4PCIA 4C67A 5KO4A 4YY4A 4QEWA 3UV5A 3JVKA 4O77A 2D82A 5LJ1A 1N72A 5F63A 3IU5A 4QYDA 4XUBA 5D3HA 4TU6A 5AD3A 4A9KA 5C8GA 4GPJA 4PKLA 2YEMA 5HFQA 4A9LA 4NR9A 4UIVA 4LDFA 5CUCA 4J1PA 2R0YA 5D25A 5HQ6A 4TZ8A 3SVGA 4NR6A 3K2JA 5DKHA 4A9FA 4WHUA 2FSAA 5A5OA 3QZSA 3LJWA 2YELA 2E3KA 5CQ8A 4NR7A 4QR5A 3HMEA 4A9JA 2RO1A 5E74A 4QSPA 4UIWA 5HJCA 4KV4A 5I40A 3MULA 3ZYUA 5HEMA 4QSQA 4F3IA 4Z6HA 5CQ6A 4XYAA 4LC2A 4NRBA 5DFBA 4NRCA 2F6NA 4TU4A 5TB6A 5EM3A 5FH6A 4PY6A 3AADA 4YC9A 4Z93A 4QUTA 5CQTA 4TS8A 3UVDA 4NUEA 5D0CA 4O7FA 5DYXA 5FG5A 4QSRA 5KTWA 5E3GA 5DFCA 2DWWA 4QEUA 3U5OA 5I7XA 5ETDA 4O75A 5IGNA 5AD2A 5JWMA 5L99A 5EPRA 2WP2A 4UIYA 5FE7A 4PTBA 4Z1QA 2KTBB 4NYVA 3UVXA 5HRWA 4CUSA 4YBSA 4BW4A 5DW2A 5HCLA 4MR3A 3Q2EA 5E9YA 5A7CA 5L8TA 5EA1A 5DFDA 5L97A 5FFYA 2H60A 4QUUA 5FE4A 4O7EA 4HXPA 4MEQA 5EV9A 4YH3A 4QNSA 5IGLA 3SVHA 2DVQA 4NR4A 4UITA 2DVVA 2G4AA 2I7KA 4TQNA 4QSVA 4A9HA 5DBMA 4HXRA 2R10A 3AQAA 4CUUA 4YH4A 5KU3A 3NXBA 3LQHA 4UYFA 4WIVA 2OO1A 4Z6IA 3O35A 4HXLA 4IR3A 1X0JA 5E9KA 4DONA 5FE2A 5ETBA 5FE5A 4BW2A 5A85A 4NS5A 5DYCA 2RS9B 4Q0NA 2OUOA 4YABA 4HXKA 4NYWA 3UVWA 5D7XA 5HRVA 5EPSA 4O70A 5ENFA 5IGMA 5EWWA 3S92A 5D3LA 4YYGA 4O7BA 5CRZA 4A9IA 3MUKA 5TCMA 5FH8A 4NRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC9 A;  5CQ3 A;  2DKW A;  4A9O A;  4QY4 A;  5H1U A;  3DWY A;  5C85 A;  5A5R A;  4PCE A;  3U5J A;  5LKT A;  5DW1 A;  4MEN A;  2DVR A;  4YK0 A;  2E7N A;  5HFR A;  3JVM A;  4QC3 A;  5FG6 A;  2DVS A;  5COI A;  4HBX A;  4J0R A;  4QR4 A;  5FFV A;  5KTX A;  5E9L A;  5IGK A;  3S91 A;  1WUM A;  3MB3 A;  3UV4 A;  3LXJ A;  1WUG A;  4QZS A;  5FH7 A;  5LKX A;  4O72 A;  5F1H A;  5DKC A;  5J0D A;  3GG3 A;  5EGU A;  4N4H A;  4UIX A;  5FE0 A;  5CQ4 A;  5CQ7 A;  1F68 A;  3O34 A;  2DAT A;  4A9N A;  4CUP A;  4IOQ A;  4IOO A;  5IG6 A;  5I86 A;  4UYG A;  4YAX A;  5BT4 A;  2RFJ A;  2RNX A;  4LZS A;  4XUA A;  5EQ1 A;  3LQI A;  4KCX A;  5CPE A;  5I80 A;  5II1 A;  4XY9 A;  5FE8 A;  2D9E A;  5JI8 A;  5CGP A;  3DAI A;  3HMH A;  5BT5 A;  3FKM X;  4OGI A;  5EWC A;  5LUU A;  4CLB A;  5A5Q A;  5H85 A;  4UYF B;  4CUT A;  5FG4 A;  2R0V A;  4O76 A;  5E9I A;  4YYN A;  5E7D A;  4HBV A;  4ALH A;  5FB0 A;  4N4F A;  5ENB A;  4LZ2 A;  4AKN A;  5II2 A;  5F5Z A;  4YYI A;  4NUD A;  5L96 A;  2YEK A;  3O36 A;  5C4Q A;  5CUA A;  4LRG A;  4BW3 A;  5CUG A;  4ZQL A;  5ENH A;  5A5P A;  3O33 A;  3Q2F A;  4YYK A;  4TT2 A;  4NQN A;  4QB3 A;  2YQD A;  4QSW A;  4MEP A;  5ENE A;  5DLX A;  4YAD A;  2RI7 A;  3QZV A;  3TLP A;  5IID A;  4TYL A;  5CZG A;  4QST A;  5H1V A;  2NXB A;  4NQM A;  3U5P A;  5D3N A;  3UVY A;  3RCW A;  5LKZ A;  4UYE A;  4NR8 A;  4TTE A;  3ONI A;  5E73 A;  3MQM A;  4CUQ A;  5FE6 A;  5F62 A;  4C66 A;  5K29 A;  5FE9 A;  4MR4 A;  5EVA A;  5EIC A;  4QBM A;  5CQA A;  3U5M A;  5HRX A;  3U5L A;  4A9M A;  5D26 A;  5F61 A;  5A82 A;  5I29 A;  5HEL A;  5HEN A;  3P1F A;  5CS8 A;  4N4G A;  5CQ5 A;  5G4S A;  5H1T A;  4OUF A;  5E3D A;  5FDZ A;  4QSU A;  3HMF A;  4LR6 A;  4CL9 A;  4CFK A;  4PS5 A;  3QZT A;  5EK9 A;  5FBX A;  4A9E A;  4YBT A;  3LQJ A;  4NUC A;  3P1D A;  5LVQ A;  4QSS A;  2OSS A;  4HXS A;  4QEV A;  4OGJ A;  4MR5 A;  5CFW A;  5A83 A;  5LJ2 A;  4UIU A;  3UW9 A;  4O7A A;  5EU1 A;  2YDW A;  4BJX A;  5I88 A;  5CUB A;  5CUD A;  4UIZ A;  5ENG A;  5EIS A;  1EQF A;  4IR5 A;  2L85 A;  5D3J A;  3G0L A;  5D3P A;  5HQ7 A;  2LSP B;  4X2I A;  5C7N A;  5HLS A;  4Q0O A;  3UV2 A;  4QC1 A;  2MJV B;  5I83 A;  4IOR A;  4O74 A;  5DKD A;  5D3S A;  4YY6 A;  5ENJ A;  5C89 A;  4NXJ A;  5A81 A;  3JVJ A;  5E9M A;  3U5K A;  4Z1S A;  5CY9 A;  4YAT A;  5A5S A;  4ALG A;  4TT4 A;  5KTU A;  1ZS5 A;  5E0R A;  4QSX A;  4YBM A;  4RVR A;  4FLP A;  5I1Q A;  5AME A;  5HM0 A;  2WP1 A;  4O78 A;  4HBY A;  4QYL A;  2YYN A;  3P1C A;  5EWV A;  2I8N A;  4QR3 A;  2RNW A;  4NR5 A;  4LYS A;  5CRM A;  5D3T A;  5F2P A;  5G4R A;  3MB4 A;  5L8U A;  5F36 A;  4N3W A;  4YYJ A;  5DX4 A;  5L98 A;  4TZ2 A;  4UYD A;  5F25 A;  3IU6 A;  4HXM A;  2N9G A;  5ENC A;  5C87 A;  3O37 A;  4HXO A;  5D24 A;  4LYI A;  2YW5 A;  2GRC A;  2F6J A;  5IBN A;  4XY8 A;  5EI4 A;  5F1L A;  4O71 A;  3G0J A;  3P1E A;  4ZW1 A;  2E7O A;  2R0S A;  4IR4 A;  5AMF A;  4YYM A;  5FE3 A;  4E96 A;  5EP7 A;  5D3R A;  4IR6 A;  5I7Y A;  4CFL A;  5DY7 A;  5LVR A;  5LKU A;  4TT6 A;  4N4I A;  3SVF A;  4J3I A;  1E6I A;  4Y03 A;  1JSP B;  2RNY A;  3JVL A;  4HBW A;  5EWH A;  4YYD A;  5KHM A;  2L84 A;  4MEO A;  4BW1 A;  5ENI A;  5CP5 A;  5LJ0 A;  5HQ5 A;  5DYU A;  3U5N A;  3P5O A;  4LZR A;  4KV1 A;  4UYH A;  4YYH A;  5CU8 A;  5DYA A;  5EPB A;  4HXN A;  4CUR A;  5CTL A;  2L5E A;  5F60 A;  4MR6 A;  5FE1 A;  5CUE A;  3I3J A;  5ACY A;  5FB1 A;  5F3A A;  5I89 A;  4J0S A;  4LYW A;  1JM4 B;  4BHW A;  5DLZ A;  5E9V A;  4O7C A;  5FFW A;  4NYX A;  5BT3 A;  3D7C A;  4WHW A;  5A5N A;  5EWD A;  3MXF A;  4PCI A;  4C67 A;  5KO4 A;  4YY4 A;  4QEW A;  3UV5 A;  3JVK A;  4O77 A;  2D82 A;  5LJ1 A;  1N72 A;  5F63 A;  3IU5 A;  4QYD A;  4XUB A;  5D3H A;  4TU6 A;  5AD3 A;  4A9K A;  5C8G A;  4GPJ A;  4PKL A;  2YEM A;  5HFQ A;  4A9L A;  4NR9 A;  4UIV A;  4LDF A;  5CUC A;  4J1P A;  2R0Y A;  5D25 A;  5HQ6 A;  4TZ8 A;  3SVG A;  4NR6 A;  3K2J A;  5DKH A;  4A9F A;  4WHU A;  2FSA A;  5A5O A;  3QZS A;  3LJW A;  2YEL A;  2E3K A;  5CQ8 A;  4NR7 A;  4QR5 A;  3HME A;  4A9J A;  2RO1 A;  5E74 A;  4QSP A;  4UIW A;  5HJC A;  4KV4 A;  5I40 A;  3MUL A;  3ZYU A;  5HEM A;  4QSQ A;  4F3I A;  4Z6H A;  5CQ6 A;  4XYA A;  4LC2 A;  4NRB A;  5DFB A;  4NRC A;  2F6N A;  4TU4 A;  5TB6 A;  5EM3 A;  5FH6 A;  4PY6 A;  3AAD A;  4YC9 A;  4Z93 A;  4QUT A;  5CQT A;  4TS8 A;  3UVD A;  4NUE A;  5D0C A;  4O7F A;  5DYX A;  5FG5 A;  4QSR A;  5KTW A;  5E3G A;  5DFC A;  2DWW A;  4QEU A;  3U5O A;  5I7X A;  5ETD A;  4O75 A;  5IGN A;  5AD2 A;  5JWM A;  5L99 A;  5EPR A;  2WP2 A;  4UIY A;  5FE7 A;  4PTB A;  4Z1Q A;  2KTB B;  4NYV A;  3UVX A;  5HRW A;  4CUS A;  4YBS A;  4BW4 A;  5DW2 A;  5HCL A;  4MR3 A;  3Q2E A;  5E9Y A;  5A7C A;  5L8T A;  5EA1 A;  5DFD A;  5L97 A;  5FFY A;  2H60 A;  4QUU A;  5FE4 A;  4O7E A;  4HXP A;  4MEQ A;  5EV9 A;  4YH3 A;  4QNS A;  5IGL A;  3SVH A;  2DVQ A;  4NR4 A;  4UIT A;  2DVV A;  2G4A A;  2I7K A;  4TQN A;  4QSV A;  4A9H A;  5DBM A;  4HXR A;  2R10 A;  3AQA A;  4CUU A;  4YH4 A;  5KU3 A;  3NXB A;  3LQH A;  4UYF A;  4WIV A;  2OO1 A;  4Z6I A;  3O35 A;  4HXL A;  4IR3 A;  1X0J A;  5E9K A;  4DON A;  5FE2 A;  5ETB A;  5FE5 A;  4BW2 A;  5A85 A;  4NS5 A;  5DYC A;  2RS9 B;  4Q0N A;  2OUO A;  4YAB A;  4HXK A;  4NYW A;  3UVW A;  5D7X A;  5HRV A;  5EPS A;  4O70 A;  5ENF A;  5IGM A;  5EWW A;  3S92 A;  5D3L A;  4YYG A;  4O7B A;  5CRZ A;  4A9I A;  3MUK A;  5TCM A;  5FH8 A;  4NRA A; 
#chains in the Genus database with same CATH topology
 4ZC9 A;  5CQ3 A;  2DKW A;  4A9O A;  4QY4 A;  5H1U A;  3DWY A;  5C85 A;  5A5R A;  2EJN A;  4PCE A;  5LKT A;  3U5J A;  5DW1 A;  4MEN A;  2DVR A;  4YK0 A;  2E7N A;  5HFR A;  3JVM A;  4QC3 A;  5FG6 A;  2DVS A;  5COI A;  4HBX A;  4J0R A;  4QR4 A;  5FFV A;  5KTX A;  5E9L A;  5IGK A;  3S91 A;  1WUM A;  3MB3 A;  3UV4 A;  3LXJ A;  1WUG A;  4QZS A;  5FH7 A;  5LKX A;  4O72 A;  5F1H A;  5DKC A;  5J0D A;  3GG3 A;  5EGU A;  4N4H A;  4UIX A;  5FE0 A;  5CQ4 A;  5CQ7 A;  1F68 A;  3O34 A;  2DAT A;  4A9N A;  4CUP A;  4IOQ A;  4IOO A;  5IG6 A;  4AKG A;  5I86 A;  4UYG A;  4YAX A;  5BT4 A;  2RFJ A;  3VKG A;  2RNX A;  4LZS A;  4XUA A;  5EQ1 A;  3LQI A;  4KCX A;  5CPE A;  5I80 A;  5II1 A;  4XY9 A;  5FE8 A;  2D9E A;  5JI8 A;  5CGP A;  3DAI A;  3HMH A;  5BT5 A;  3FKM X;  4OGI A;  5EWC A;  5LUU A;  4CLB A;  5A5Q A;  5H85 A;  4UYF B;  4CUT A;  5FG4 A;  2R0V A;  4O76 A;  5E9I A;  4YYN A;  5E7D A;  4HBV A;  4ALH A;  5FB0 A;  4N4F A;  5ENB A;  4LZ2 A;  4AKN A;  5II2 A;  5F5Z A;  4YYI A;  4NUD A;  5L96 A;  2YEK A;  3O36 A;  5C4Q A;  5CUA A;  4LRG A;  4BW3 A;  5CUG A;  4ZQL A;  5ENH A;  5A5P A;  3O33 A;  3Q2F A;  4YYK A;  4TT2 A;  4NQN A;  4QB3 A;  2YQD A;  4QSW A;  4MEP A;  5ENE A;  5DLX A;  4YAD A;  2RI7 A;  3QZV A;  3TLP A;  5IID A;  4TYL A;  5CZG A;  4QST A;  5H1V A;  2NXB A;  4NQM A;  3U5P A;  5D3N A;  3UVY A;  3RCW A;  5LKZ A;  4UYE A;  4NR8 A;  4TTE A;  3ONI A;  5E73 A;  3MQM A;  4CUQ A;  5FE6 A;  5F62 A;  4C66 A;  5K29 A;  5FE9 A;  4MR4 A;  5EVA A;  5EIC A;  4QBM A;  5CQA A;  3U5M A;  5HRX A;  3U5L A;  4A9M A;  5D26 A;  5F61 A;  5A82 A;  5I29 A;  5HEL A;  5HEN A;  3P1F A;  5CS8 A;  4N4G A;  5CQ5 A;  5G4S A;  5H1T A;  4OUF A;  5E3D A;  5FDZ A;  4QSU A;  3HMF A;  4LR6 A;  4CL9 A;  4CFK A;  4PS5 A;  1PUO A;  3QZT A;  5EK9 A;  5FBX A;  4A9E A;  4YBT A;  3LQJ A;  4NUC A;  3P1D A;  5LVQ A;  4QSS A;  2OSS A;  4HXS A;  4QEV A;  4OGJ A;  4MR5 A;  5CFW A;  5A83 A;  5LJ2 A;  4UIU A;  3UW9 A;  4O7A A;  5EU1 A;  2YDW A;  4BJX A;  5I88 A;  5CUB A;  5CUD A;  4UIZ A;  5ENG A;  5EIS A;  1EQF A;  4IR5 A;  2L85 A;  5D3J A;  3G0L A;  5D3P A;  5HQ7 A;  2LSP B;  4X2I A;  5C7N A;  5HLS A;  4Q0O A;  3UV2 A;  4QC1 A;  2MJV B;  5I83 A;  4IOR A;  4O74 A;  5DKD A;  5D3S A;  4YY6 A;  5ENJ A;  5C89 A;  4NXJ A;  5A81 A;  3JVJ A;  5E9M A;  3U5K A;  4Z1S A;  5CY9 A;  4YAT A;  5A5S A;  4ALG A;  4TT4 A;  5KTU A;  1ZS5 A;  5E0R A;  4QSX A;  4YBM A;  4RVR A;  4FLP A;  1ZKR A;  5I1Q A;  5AME A;  5HM0 A;  2WP1 A;  4O78 A;  3VKH A;  4HBY A;  4QYL A;  2YYN A;  3P1C A;  5EWV A;  2I8N A;  4QR3 A;  2RNW A;  4NR5 A;  4LYS A;  5CRM A;  5D3T A;  5F2P A;  5G4R A;  3MB4 A;  5L8U A;  5F36 A;  4N3W A;  4YYJ A;  5DX4 A;  5L98 A;  4TZ2 A;  4UYD A;  5F25 A;  3IU6 A;  4HXM A;  2N9G A;  5ENC A;  5C87 A;  3O37 A;  4HXO A;  5D24 A;  4LYI A;  2YW5 A;  2GRC A;  2F6J A;  5IBN A;  4XY8 A;  5EI4 A;  5F1L A;  4O71 A;  3G0J A;  3P1E A;  4ZW1 A;  2E7O A;  2R0S A;  4IR4 A;  5AMF A;  3D1B A;  4YYM A;  5FE3 A;  4E96 A;  5EP7 A;  5D3R A;  4IR6 A;  5I7Y A;  4CFL A;  5DY7 A;  5LVR A;  5LKU A;  4TT6 A;  4N4I A;  3SVF A;  4J3I A;  1E6I A;  4Y03 A;  1JSP B;  2RNY A;  3JVL A;  4HBW A;  5EWH A;  4YYD A;  5KHM A;  2L84 A;  4MEO A;  4BW1 A;  5ENI A;  5CP5 A;  5LJ0 A;  5HQ5 A;  5DYU A;  3U5N A;  3P5O A;  4LZR A;  4KV1 A;  4UYH A;  4YYH A;  5CU8 A;  5DYA A;  5EPB A;  4HXN A;  4CUR A;  5CTL A;  2L5E A;  5F60 A;  4MR6 A;  5FE1 A;  5CUE A;  3I3J A;  5ACY A;  5FB1 A;  5F3A A;  5I89 A;  4J0S A;  4LYW A;  1JM4 B;  4BHW A;  5DLZ A;  5E9V A;  4O7C A;  5FFW A;  4NYX A;  5BT3 A;  3D7C A;  4WHW A;  5A5N A;  5EWD A;  4AKH A;  3MXF A;  4PCI A;  4C67 A;  5KO4 A;  4YY4 A;  4QEW A;  3UV5 A;  3JVK A;  4O77 A;  2D82 A;  5LJ1 A;  1N72 A;  5F63 A;  3IU5 A;  4QYD A;  4XUB A;  5D3H A;  4TU6 A;  5AD3 A;  4A9K A;  5C8G A;  4GPJ A;  4PKL A;  2YEM A;  5HFQ A;  4A9L A;  4NR9 A;  4UIV A;  4LDF A;  5CUC A;  4J1P A;  2R0Y A;  5D25 A;  5HQ6 A;  4TZ8 A;  3SVG A;  4NR6 A;  3K2J A;  5DKH A;  4A9F A;  4AI6 A;  4WHU A;  2FSA A;  5A5O A;  3QZS A;  3LJW A;  2YEL A;  2E3K A;  5CQ8 A;  4NR7 A;  4QR5 A;  3HME A;  4A9J A;  2RO1 A;  5E74 A;  4QSP A;  4UIW A;  5HJC A;  4KV4 A;  5I40 A;  3MUL A;  3ZYU A;  5HEM A;  4QSQ A;  4F3I A;  4Z6H A;  5CQ6 A;  4XYA A;  4LC2 A;  4NRB A;  5DFB A;  4NRC A;  2F6N A;  4TU4 A;  3D1D A;  5EM3 A;  5FH6 A;  4PY6 A;  5TB6 A;  3AAD A;  4YC9 A;  4Z93 A;  4QUT A;  5CQT A;  4TS8 A;  3UVD A;  4NUE A;  5D0C A;  4O7F A;  5DYX A;  5FG5 A;  4QSR A;  5KTW A;  5E3G A;  5DFC A;  2DWW A;  4QEU A;  3U5O A;  5I7X A;  5ETD A;  4O75 A;  5IGN A;  5AD2 A;  5JWM A;  5L99 A;  5EPR A;  2WP2 A;  4UIY A;  5FE7 A;  4PTB A;  4Z1Q A;  2KTB B;  4NYV A;  3UVX A;  5HRW A;  4CUS A;  4YBS A;  4BW4 A;  5DW2 A;  5HCL A;  4MR3 A;  3Q2E A;  5E9Y A;  5A7C A;  5L8T A;  5EA1 A;  5DFD A;  5L97 A;  5FFY A;  2H60 A;  4QUU A;  5FE4 A;  4O7E A;  4HXP A;  4MEQ A;  5EV9 A;  4YH3 A;  4QNS A;  5IGL A;  3SVH A;  2DVQ A;  4NR4 A;  4UIT A;  2DVV A;  2G4A A;  2I7K A;  4TQN A;  4QSV A;  4A9H A;  5DBM A;  4HXR A;  2R10 A;  3AQA A;  4CUU A;  4YH4 A;  5KU3 A;  3NXB A;  3LQH A;  4UYF A;  4WIV A;  2OO1 A;  4Z6I A;  3O35 A;  4HXL A;  4IR3 A;  1X0J A;  5E9K A;  4DON A;  5FE2 A;  5ETB A;  5FE5 A;  4BW2 A;  5A85 A;  4NS5 A;  5DYC A;  2RS9 B;  4Q0N A;  2OUO A;  3ERR A;  4YAB A;  4HXK A;  4NYW A;  3UVW A;  5D7X A;  4AKI A;  5HRV A;  5EPS A;  4O70 A;  5ENF A;  5IGM A;  5EWW A;  3S92 A;  5D3L A;  4YYG A;  4O7B A;  5CRZ A;  4A9I A;  3MUK A;  5TCM A;  5FH8 A;  4NRA A; 
#chains in the Genus database with same CATH homology
 4ZC9 A;  5CQ3 A;  2DKW A;  4A9O A;  4QY4 A;  5H1U A;  3DWY A;  5C85 A;  5A5R A;  4PCE A;  3U5J A;  5LKT A;  5DW1 A;  4MEN A;  2DVR A;  4YK0 A;  2E7N A;  5HFR A;  3JVM A;  4QC3 A;  5FG6 A;  2DVS A;  5COI A;  4HBX A;  4J0R A;  4QR4 A;  5FFV A;  5KTX A;  5E9L A;  5IGK A;  3S91 A;  1WUM A;  3MB3 A;  3UV4 A;  3LXJ A;  1WUG A;  4QZS A;  5FH7 A;  5LKX A;  4O72 A;  5F1H A;  5DKC A;  5J0D A;  3GG3 A;  5EGU A;  4N4H A;  4UIX A;  5FE0 A;  5CQ4 A;  5CQ7 A;  1F68 A;  3O34 A;  2DAT A;  4A9N A;  4CUP A;  4IOQ A;  4IOO A;  5IG6 A;  5I86 A;  4UYG A;  4YAX A;  5BT4 A;  2RFJ A;  2RNX A;  4LZS A;  4XUA A;  5EQ1 A;  3LQI A;  4KCX A;  5CPE A;  5I80 A;  5II1 A;  4XY9 A;  5FE8 A;  2D9E A;  5JI8 A;  5CGP A;  3DAI A;  3HMH A;  5BT5 A;  3FKM X;  4OGI A;  5EWC A;  5LUU A;  4CLB A;  5A5Q A;  5H85 A;  4UYF B;  4CUT A;  5FG4 A;  2R0V A;  4O76 A;  5E9I A;  4YYN A;  5E7D A;  4HBV A;  4ALH A;  5FB0 A;  4N4F A;  5ENB A;  4LZ2 A;  4AKN A;  5II2 A;  5F5Z A;  4YYI A;  4NUD A;  5L96 A;  2YEK A;  3O36 A;  5C4Q A;  5CUA A;  4LRG A;  4BW3 A;  5CUG A;  4ZQL A;  5ENH A;  5A5P A;  3O33 A;  3Q2F A;  4YYK A;  4TT2 A;  4NQN A;  4QB3 A;  2YQD A;  4QSW A;  4MEP A;  5ENE A;  5DLX A;  4YAD A;  2RI7 A;  3QZV A;  3TLP A;  5IID A;  4TYL A;  5CZG A;  4QST A;  5H1V A;  2NXB A;  4NQM A;  3U5P A;  5D3N A;  3UVY A;  3RCW A;  5LKZ A;  4UYE A;  4NR8 A;  4TTE A;  3ONI A;  5E73 A;  3MQM A;  4CUQ A;  5FE6 A;  5F62 A;  4C66 A;  5K29 A;  5FE9 A;  4MR4 A;  5EVA A;  5EIC A;  4QBM A;  5CQA A;  3U5M A;  5HRX A;  3U5L A;  4A9M A;  5D26 A;  5F61 A;  5A82 A;  5I29 A;  5HEL A;  5HEN A;  3P1F A;  5CS8 A;  4N4G A;  5CQ5 A;  5G4S A;  5H1T A;  4OUF A;  5E3D A;  5FDZ A;  4QSU A;  3HMF A;  4LR6 A;  4CL9 A;  4CFK A;  4PS5 A;  3QZT A;  5EK9 A;  5FBX A;  4A9E A;  4YBT A;  3LQJ A;  4NUC A;  3P1D A;  5LVQ A;  4QSS A;  2OSS A;  4HXS A;  4QEV A;  4OGJ A;  4MR5 A;  5CFW A;  5A83 A;  5LJ2 A;  4UIU A;  3UW9 A;  4O7A A;  5EU1 A;  2YDW A;  4BJX A;  5I88 A;  5CUB A;  5CUD A;  4UIZ A;  5ENG A;  5EIS A;  1EQF A;  4IR5 A;  2L85 A;  5D3J A;  3G0L A;  5D3P A;  5HQ7 A;  2LSP B;  4X2I A;  5C7N A;  5HLS A;  4Q0O A;  3UV2 A;  4QC1 A;  2MJV B;  5I83 A;  4IOR A;  4O74 A;  5DKD A;  5D3S A;  4YY6 A;  5ENJ A;  5C89 A;  4NXJ A;  5A81 A;  3JVJ A;  5E9M A;  3U5K A;  4Z1S A;  5CY9 A;  4YAT A;  5A5S A;  4ALG A;  4TT4 A;  5KTU A;  1ZS5 A;  5E0R A;  4QSX A;  4YBM A;  4RVR A;  4FLP A;  5I1Q A;  5AME A;  5HM0 A;  2WP1 A;  4O78 A;  4HBY A;  4QYL A;  2YYN A;  3P1C A;  5EWV A;  2I8N A;  4QR3 A;  2RNW A;  4NR5 A;  4LYS A;  5CRM A;  5D3T A;  5F2P A;  5G4R A;  3MB4 A;  5L8U A;  5F36 A;  4N3W A;  4YYJ A;  5DX4 A;  5L98 A;  4TZ2 A;  4UYD A;  5F25 A;  3IU6 A;  4HXM A;  2N9G A;  5ENC A;  5C87 A;  3O37 A;  4HXO A;  5D24 A;  4LYI A;  2YW5 A;  2GRC A;  2F6J A;  5IBN A;  4XY8 A;  5EI4 A;  5F1L A;  4O71 A;  3G0J A;  3P1E A;  4ZW1 A;  2E7O A;  2R0S A;  4IR4 A;  5AMF A;  4YYM A;  5FE3 A;  4E96 A;  5EP7 A;  5D3R A;  4IR6 A;  5I7Y A;  4CFL A;  5DY7 A;  5LVR A;  5LKU A;  4TT6 A;  4N4I A;  3SVF A;  4J3I A;  1E6I A;  4Y03 A;  1JSP B;  2RNY A;  3JVL A;  4HBW A;  5EWH A;  4YYD A;  5KHM A;  2L84 A;  4MEO A;  4BW1 A;  5ENI A;  5CP5 A;  5LJ0 A;  5HQ5 A;  5DYU A;  3U5N A;  3P5O A;  4LZR A;  4KV1 A;  4UYH A;  4YYH A;  5CU8 A;  5DYA A;  5EPB A;  4HXN A;  4CUR A;  5CTL A;  2L5E A;  5F60 A;  4MR6 A;  5FE1 A;  5CUE A;  3I3J A;  5ACY A;  5FB1 A;  5F3A A;  5I89 A;  4J0S A;  4LYW A;  1JM4 B;  4BHW A;  5DLZ A;  5E9V A;  4O7C A;  5FFW A;  4NYX A;  5BT3 A;  3D7C A;  4WHW A;  5A5N A;  5EWD A;  3MXF A;  4PCI A;  4C67 A;  5KO4 A;  4YY4 A;  4QEW A;  3UV5 A;  3JVK A;  4O77 A;  2D82 A;  5LJ1 A;  1N72 A;  5F63 A;  3IU5 A;  4QYD A;  4XUB A;  5D3H A;  4TU6 A;  5AD3 A;  4A9K A;  5C8G A;  4GPJ A;  4PKL A;  2YEM A;  5HFQ A;  4A9L A;  4NR9 A;  4UIV A;  4LDF A;  5CUC A;  4J1P A;  2R0Y A;  5D25 A;  5HQ6 A;  4TZ8 A;  3SVG A;  4NR6 A;  3K2J A;  5DKH A;  4A9F A;  4WHU A;  2FSA A;  5A5O A;  3QZS A;  3LJW A;  2YEL A;  2E3K A;  5CQ8 A;  4NR7 A;  4QR5 A;  3HME A;  4A9J A;  2RO1 A;  5E74 A;  4QSP A;  4UIW A;  5HJC A;  4KV4 A;  5I40 A;  3MUL A;  3ZYU A;  5HEM A;  4QSQ A;  4F3I A;  4Z6H A;  5CQ6 A;  4XYA A;  4LC2 A;  4NRB A;  5DFB A;  4NRC A;  2F6N A;  4TU4 A;  5TB6 A;  5EM3 A;  5FH6 A;  4PY6 A;  3AAD A;  4YC9 A;  4Z93 A;  4QUT A;  5CQT A;  4TS8 A;  3UVD A;  4NUE A;  5D0C A;  4O7F A;  5DYX A;  5FG5 A;  4QSR A;  5KTW A;  5E3G A;  5DFC A;  2DWW A;  4QEU A;  3U5O A;  5I7X A;  5ETD A;  4O75 A;  5IGN A;  5AD2 A;  5JWM A;  5L99 A;  5EPR A;  2WP2 A;  4UIY A;  5FE7 A;  4PTB A;  4Z1Q A;  2KTB B;  4NYV A;  3UVX A;  5HRW A;  4CUS A;  4YBS A;  4BW4 A;  5DW2 A;  5HCL A;  4MR3 A;  3Q2E A;  5E9Y A;  5A7C A;  5L8T A;  5EA1 A;  5DFD A;  5L97 A;  5FFY A;  2H60 A;  4QUU A;  5FE4 A;  4O7E A;  4HXP A;  4MEQ A;  5EV9 A;  4YH3 A;  4QNS A;  5IGL A;  3SVH A;  2DVQ A;  4NR4 A;  4UIT A;  2DVV A;  2G4A A;  2I7K A;  4TQN A;  4QSV A;  4A9H A;  5DBM A;  4HXR A;  2R10 A;  3AQA A;  4CUU A;  4YH4 A;  5KU3 A;  3NXB A;  3LQH A;  4UYF A;  4WIV A;  2OO1 A;  4Z6I A;  3O35 A;  4HXL A;  4IR3 A;  1X0J A;  5E9K A;  4DON A;  5FE2 A;  5ETB A;  5FE5 A;  4BW2 A;  5A85 A;  4NS5 A;  5DYC A;  2RS9 B;  4Q0N A;  2OUO A;  4YAB A;  4HXK A;  4NYW A;  3UVW A;  5D7X A;  5HRV A;  5EPS A;  4O70 A;  5ENF A;  5IGM A;  5EWW A;  3S92 A;  5D3L A;  4YYG A;  4O7B A;  5CRZ A;  4A9I A;  3MUK A;  5TCM A;  5FH8 A;  4NRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...