4Q0YA

Crystal structure of a thioesterase-like protein (clospo_01618) from clostridium sporogenes atcc 15579 at 1.70 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
GRMEISSLSSIDVFKFNSFSKFSNDKIGVIYDEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYFLLYILVGDSEGKSYIIFSGTELSYVLDKNNTNILKEIFLNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (CLOSPO_01618) from Clostridium sporogenes ATCC 15579 at 1.70 A resolution
rcsb
source organism Clostridium sporogenes
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 31
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.400 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4q0yA00
4Q0YA
chains in the Genus database with same CATH superfamily
2DLNA 2YZGA 4EGQA 3HOXG 3H4DA 4ED6A 2C22A 5KX5F 4DV3H 1S03G 2FPPB 2UUCH 4Y8VB 3RIZA 4TUYF 3MR3A 2J6SA 3GIKA 2W7OA 3RB3A 2BQRA 4J9RA 4UFZA 2WB1A 4LH7A 4A3FG 1TAEA 4TQRA 3T1HH 3V6JA 2ASDA 4UCTA 2VQFH 1KJ9A 4MAMA 1R9TA 3I4NG 4K0KH 2UXBH 4AYBE 2XCPA 2E2IA 5JVDF 3Q1KA 5LXTF 4U7CA 4ECUA 5IYDG 4B3SH 1B04A 3GTKA 4BXXG 2HHHH 1ZQ7A 2FP4B 2V5AA 2C2DA 5L1LA 4FS1A 4MV3A 3BQ0A 1B33N 3HOUG 4IAJA 3PO2G 2B63G 2VQDA 2VUMA 2RGRA 5BMVF 4HNTA 1N33H 3RV3A 4J9NA 1ZHSA 4HR7A 3GIIA 4DR4H 3RGXA 3V4ZA 3HBLA 4ECTA 4RZQA 2W70A 2PMZA 2NU8B 2W8KA 2C00A 2XCAA 4JV1A 4IWYA 4UCUA 1JIHA 5LMNH 4EFBA 3M9MB 3Q8SB 4O4LF 4DV7H 3RF2A 3RTXA 1I7NA 2JA6G 2JA5A 4DL7A 4A2BA 4CC6A 4TQSA 1GO3E 1XMOH 4IRCA 2WB1E 3BA8A 5C3EG 5CAEB 3FDSA 3VPCA 5EWEA 2AU0A 4DV0H 4G3IA 4DR3H 3DF7A 1VS0A 4M9UA 3MJFA 4J9OA 5FD6A 4EYIB 2RGVA 1Y1VA 4DL2A 2AGPA 4AYBA 5IYZF 3PVXA 2M05A 1JDBB 3RB0A 3TIGA 4JI1H 4MV6A 3RFCA 1GYFA 4B3MH 1Y1WG 3R5FA 2JEJA 3BABA 3PW0A 2W6MA 5KFGA 2IP4A 4O3NA 4J9QA 4HNUA 5CA0F 2YZNA 2V59A 2ZJTA 2UVWA 4I7HA 1Z2PX 4J9PA 3GTOA 3N40P 5DG7A 1CQJB 4ZOLF 4F50A 3GIMA 2RDJA 4F4XA 2XIGA 2KSWA 2VR1A 1AUXA 2JEIA 3HXLA 1DIKA 3F8NA 2W9BA 4FU0A 4DL4A 1RYRA 1XNQH 3GIQA 5KFDA 2DPIA 4MV8A 4QW9A 1GGOA 3MR2A 2FK1A 3H0GA 3NGDA 3GV8B 1IOVA 3UFXB 5LA6F 5KT2A 2R92G 3HOVG 1CE8A 4O3RA 5KFCA 2XGPA 4JI0H 5JUMA 1TWGA 3ETHA 4QW8A 2W6PA 1GSAA 4A3LG 4X62H 3N43B 4MV4A 4J9MA 4Q0YA 1X9NA 4C2MA 4LF5H 1DV1A 5KT7A 3K3PA 1OWTA 1EUCB 1K1QA 2C2RA 2R7ZG 5KG2A 1S10A 5T14A 4I55F 4A3GG 2NU6B 5DG8A 2WTFA 3TIIA 5L9XA 4XYLB 2W7PA 3LMLA 2W57A 5KT4A 2PVPA 3BAAA 5KT6A 3BG5A 4LSAA 5D1OB 5KFPA 3GILA 3GV7B 3KAKA 1SCUB 3GIPA 4DLKA 1GSOA 2UXCH 1B6SA 2YCHA 2F4VH 3GTQA 1L2ZA 4X66H 4QWAA 2XC9A 4YR0A 4RB0A 4A2AA 4X64H 2UVVA 5DLGA 3PW2A 2JA8G 4HYKA 4UCRA 2YW2A 2FKLA 2W6NA 2JEGA 4DL5A 1M6VA 2R87A 2VPSA 4ED0A 3H20A 4JYAH 2CZGA 2CW8A 3PR5B 1KEEA 2XD4A 3PW4A 1KJIA 4UCVA 2W9BB 2HVSA 5CA1F 4C5BA 1SYXB 5JVLA 3V4SA 4O3SA 4R8UA 5J2TF 4A3JG 2I87A 4EBEA 2W6OA 3V6KA 1HNXH 5DLFA 1E4FT 4F4WA 4FBTA 4LF4H 3N6XA 4LH6A 3CVZA 5L1KA 4DUYH 1S97A 1A0IA 5BPHA 2FLNA 5KFYA 1GSHA 3R23A 5D1PA 3KHHA 4MTEA 1SFOA 5D8DA 1A9XA 5KG7A 1N48A 4EGJA 2MCTA 5KT5A 4ED1A 1V9PA 5KG4A 4IWXA 3MR6A 1JDEA 1PK8A 4J9KA 4FBUA 3QZ8A 1TWHA 3GTMA 3LWBA 2NUAB 1HR0H 2UUAH 5KG1A 5IP7G 4QIWA 3OTOH 2WDTA 5FPRA 5KFJA 1UC9A 1TWCA 4DR7H 1MZBA 1IBLH 4JV2A 2R93A 2CW7A 5EDWA 3MFHA 4DR6H 1JLLB 3R5HA 4HNVA 5I47A 3U9TA 5LP6F 5KFFA 3GTGA 2FB9A 5LMUH 3OHAA 2VUGA 2HVRA 4ECZA 1N36H 3EPIA 2P0AA 5KG3A 2UU9H 4GKJH 1Z2NX 5FLMG 1EZ1A 1WCMG 1VBHA 1W96A 4YHHH 3I12A 2GLTA 3JRWA 3AYHB 1Y14B 5EOYA 3JRXA 4J9SA 2OWOA 4A3CG 2ALZA 3CQZA 3TQTA 5LYJF 3BJYA 1WH2A 1RK6A 1BGWA 5FD5A 5KG5A 4GC6A 4ZHQF 3RAXA 2IBKA 3GTJA 4NXMH 1VKZA 4JI3H 5KKNB 2FMAA 5BPFA 3L4JA 2WAQE 2C2EA 3IN5A 4ECVA 4IRKA 3ORQA 1P8LA 3JZIA 2AGOA 2VA2A 1FJGH 5IT9W 4YR3A 2DPJA 5FLXW 3KTMA 4Q8EA 5KFHA 4EFEA 3N42B 2YU9A 1C3OA 2JEFA 3VPDA 2HVQA 3L4KA 2DZDA 4M7EA 4YBZB 2SCUB 4A3EG 1KC7A 5D1OA 4BBSG 4RB1A 3C0FB 4O2BF 4LMYA 3T5JA 1O75A 4DR1H 4PDBA 2DIKA 2R7ZA 3MWEA 5GONF 2I8CA 4JI6H 4LF8H 2HGSA 1I94H 1VAJA 5HBRB 5KFLA 5J2UF 4C5CA 1I50A 2R7KA 2FE3A 4QJFA 3FKIG 1JXLA 2JA7G 4YR2A 3GLKA 2FPGB 3EYYA 2V4QA 4A3BG 1KJJA 3N41B 4R8UB 4DL6A 3G6YA 1XNRH 4DV2H 4OX9H 1C30A 1M7JA 3HKZA 4L1KA 2Y0SA 5L1JA 4ECSA 4YB8B 1BNCA 4MA0A 1KJQA 5KFIA 2R85A 4RB2C 2IMWP 2QYZA 5FPOA 5KT3A 5KFOA 4LFCH 1S0NA 2R6FA 3RJ0A 1RYSA 3N8DA 1PX2A 4XX0B 3IG0A 4U6PA 4YP3A 2R8HA 4ECRA 2OLSA 1WSCA 3UQ8A 3RB6A 3WNZA 3KHGA 4DL3A 2BQUA 3Q8PB 1SEIA 4MV7A 3T5HA 1AUVA 3JSNA 3L2PA 4QWBA 4XZ3B 1Z2OX 4ZI7F 3GQCA 4F4ZA 1S9FA 2OH2A 5HV6A 4J0MA 4QWEA 4J9LA 5IYCG 3M4IA 5KFAA 5KFKA 3J81W 4YJ3F 1EUDB 3J80W 3Q8RB 4O3QA 5KFWA 2ZDHA 3TINA 1S0MA 3PN1A 4DV1H 3H4BA 4QIWE 2X0SA 3MWDA 5C44G 3SI8A 1M0WA 5IYBG 3JAMW 2ASLA 4EBCA 2O03A 4Q8FA 1RJRA 2YL2A 2VPQA 4BWSC 1N34H 2GPSA 4NXNH 4ME6A 5EWGA 4GC7A 3G8CA 4Q43A 4I50F 1W93A 2B63A 2W9AA 1S0OA 4WBNF 5KFRA 4YAKB 3M9OB 2PN1A 3H40A 2UUBH 2FK3A 1TA8A 4ETSA 3J7AK 5KFZA 4O4IF 4EEYA 3T5KA 4DR2H 2W6ZA 3H3VH 4UCOA 5C5JA 1IOWA 2YZMA 1JKJB 1ULZA 4APMA 3ORRA 1V4YA 1ZHQA 2C35B 2R7NA 4O3PA 3M9NB 4ECYA 5EZYF 4HQ6A 2VQEH 4Q44A 2Y0SE 3SE7A 4AQYH 5L1IA 1HNZH 4XYMB 3BA9A 5KFXA 1J5EH 3PR4A 3GV5B 3Q8QB 4LF7H 4A93G 2JA6A 5LOVF 1WCMA 3G6XA 1TWFA 3GTLA 4JI8H 5KFVA 3HOWG 1XDNA 1HNWH 4IZOA 2RF4A 1DV2A 5A2QW 2VOBA 5KFQA 2AGQA 2E5LH 3MFIA 2FJZA 4MV9A 1B6RA 4RU9A 3KAJA 2UXDH 4MV1A 5C1PA 1K83A 4O4HF 4FM9A 1Y1VG 4A3IG 1VBGA 5KG0A 4JV0A 1KBLA 1I6UA 5F9LA 2NVXA 4ZQIA 4RNMA 2W9CB 3EPGA 4EBDA 4A3KG 2WE6A 3RBEA 4F4YA 2R8IA 3RBDA 2NU7B 2PBZA 2ZM6H 3T5LA 5K2MA 5DGAA 5DQHA 5C1OA 3Q2OA 2R84A 1DGSA 2YRWA 4BY1G 5F9NA 1CQIB 4QWCA 5C4XG 3HOYG 2BR0A 3LP8A 5DG9A 4TV8F 2NU9B 4BY7G 4RNOA 4JI4H 2DWCA 2XCLA 2ATLA 5KFTA 5KFEA 1IBMH 4B3TH 1JX4A 3R5XA 4O2AF 4ED2A 2R92A 5DQIA 2UVUA 3K5HA 5FJ8G 4DUZH 2FPIB 4WD3A 1EYZA 3RAQA 3KHRA 2ASJA 2AQ4A 4X65H 4IHJF 2VUMG 2YYAA 2J6UA 2J6TA 2HJWA 2FK2A 2WYOA 3WO1A 4BBRG 3WO0A 5DGBA 4FS2A 1T3NA 3N44B 1I7LA 1E4GT 2VA3A 2W6QA 4IRDA 4GKKH 2R93G 3BQ1A 3T1YH 2YS7A 2I80A 4NLGA 2V58A 4RUAA 2NVYA 5CB4F 3OUZA 4EEQA 4ECWA 4O3OA 3GTPA 1E4EB 1UC8A 3KHLA 4LFBH 1GLVA 3PW7A 2R8KA 3QFFA 5DQGA 4TV9F 4LFAH 3HKZE 4RB3C 3OUUA 2Q2UA 3G6VA 2JA5G 1UNNC 4CC5A 4LSXA 3RV4A 1T36A 4JUZA 1N32H 3K5IA 4Q45A 2W9CA 4GLXA 2V9WA 1I3QA 1RJPA 2YRXA 4PWQA 2GPWA 4KHPH 2PMZE 5LL6b 4JI2H 1TWAA 4RUCA 3OSPA 2R82A 5C8YF 5KFBA 4RAYA 4IR1A 1KJ8A 3U9SA 5EWFA 1V51A 1BJTA 1Y1WA 4EYHB 5KFNA 3PO3G 2ZDQA 3VPBA 4MTDA 3RUPA 3I4MG 3V6HA 5KFUA 2Q2TA 1S68A 2R8GA 3JSLA 3GIJA 1IBKH 2CQYA 2J9GA 4RZRA 3TQ1A 4YAJB 5KG6A 3MWMA 2WAQA 2RDIA 5KFSA 1T94A 1BXRA 2CKZB 4DV5H 4LF9H 2YS6A 4YJ2F 4I4TF 4B3RH 1CS0A 5IWAH 1E4EA 3OSNA 3KALA 3KXYT 3MR5A 2FLPA 1EHIA 4YQWA 3PZPA 5BR8H 2ZDGA 3H0GG 2R8JA 5IP9G 2C28A 2W71A 4EG0A 4DV6H 4ECXA 4ECQA 3HOZG 4LF6H 1XMQH 3FKIA 4R7RA 2JA7A 3QZ7A 4DV4H 4JV5H 4IR9A 1RK5A 2FLLA 2UVRA 1RJQA 4UCSA 4YY3H 4A3DG 2E2HA 4QWDA 4JI7H 4RAZA 3PW5A 1WR2A 5KFMA 2R7LA 2V4RA 1FVIA 4DR5H 4ED8A 3FMAA 3RGZA 3RB4A 1FKAH 5JQWA 2QK4A 2R7MA 3GIDA 1AN7A 2R86A 2BQ3A 5JH7F 1ZETA 3HB9A 3K3VA 4MA5A 3VMMA 2IA6A 1M0TA 1N56A 4C5AA 3BQ2A 4A3MG 3OHBA 4JI5H 2XGQA 4E4TA 5H80A 4RNNA 1K1SA 4ED7A 3ETJA 3E5NA 4ED3A 2W8LA
chains in the Genus database with same CATH topology
3BAAA 4LSAA 5D1OB 1O75A 4LF8H 4JI6H 1S03G 3KAKA 1DGSA 2HGSA 4DV3H 2UUCH 3RIZA 1I94H 2YCHA 2F4VH 1L2ZA 4X66H 4RB0A 4A2AA 2FE3A 4UFZA 4X64H 4LH7A 4JI4H 1TAEA 4UCRA 3EYYA 3T1HH 1IBMH 4B3TH 4UCTA 3N41B 2VQFH 1XNRH 4DV2H 4OX9H 4DUZH 2VPSA 3H20A 4JYAH 4K0KH 2UXBH 2CW8A 4X65H 4RB2C 4B3SH 1B04A 4UCVA 2HHHH 2HVSA 5FPOA 1SYXB 2WYOA 4LFCH 4GKKH 3N44B 1E4GT 3RJ0A 4IAJA 3IG0A 3T1YH 1HNXH 1E4FT 3UQ8A 4LF4H 3N6XA 4LH6A 4EEQA 3CVZA 2RGRA 1SEIA 4MV7A 1N33H 4LFBH 3JSNA 3L2PA 4DUYH 1ZHSA 1Z2OX 1A0IA 3RGXA 4DR4H 4RZQA 4J0MA 4LFAH 3M4IA 4RB3C 3J81W 2Q2UA 5D1PA 4CC5A 4LSXA 3J80W 4MTEA 1N32H 4UCUA 5LMNH 2MCTA 4GLXA 3PN1A 4EFBA 4DV1H 1V9PA 4DV7H 3RF2A 3RTXA 1M0WA 4KHPH 4A2BA 4CC6A 5LL6b 3JAMW 1XMOH 4JI2H 1HR0H 2UUAH 3BA8A 2O03A 4BWSC 1N34H 4NXNH 4RAYA 3OTOH 4DV0H 2WDTA 3DF7A 5FPRA 4DR3H 4DR7H 1VS0A 1MZBA 1IBLH 1BJTA 2CW7A 5FD6A 4DR6H 2RGVA 4MTDA 2Q2TA 1GYFA 1S68A 5LMUH 2UUBH 3JSLA 1TA8A 4ETSA 2VUGA 1IBKH 2HVRA 4JI1H 3J7AK 1N36H 4B3MH 3BABA 3MWMA 4DR2H 2UU9H 4GKJH 1Z2NX 4DV5H 4LF9H 4UCOA 2ZJTA 4B3RH 5IWAH 4APMA 1Z2PX 4I7HA 3N40P 3KALA 3KXYT 4YHHH 1ZHQA 2VQEH 2XIGA 2KSWA 5BR8H 4AQYH 1HNZH 5EOYA 4LF7H 3BA9A 1J5EH 3HXLA 4DV6H 2OWOA 3F8NA 4LF6H 1XMQH 4R7RA 4JI8H 1XNQH 4DV4H 4JV5H 1WH2A 5FD5A 1BGWA 1XDNA 4NXMH 1HNWH 4UCSA 4YY3H 4JI3H 5A2QW 2VOBA 2E5LH 4JI7H 3L4JA 4RAZA 4MV9A 4DR5H 4JI0H 1FVIA 3FMAA 3KAJA 3RGZA 2UXDH 1FKAH 4FM9A 1P8LA 5IT9W 1FJGH 1AN7A 4X62H 3N43B 1X9NA 3K3VA 4Q0YA 5FLXW 4LF5H 1I6UA 1M0TA 3N42B 4EFEA 4JI5H 2HVQA 3L4KA 4M7EA 2WE6A 5D1OA 4RB1A 3C0FB 2ZM6H 2UXCH 4LMYA 4PDBA 3LMLA 4DR1H 2W57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0Y A; 
#chains in the Genus database with same CATH topology
 2DLN A;  2YZG A;  4EGQ A;  3HOX G;  3H4D A;  4ED6 A;  2C22 A;  5KX5 F;  4DV3 H;  1S03 G;  2FPP B;  2UUC H;  4Y8V B;  3RIZ A;  4TUY F;  3MR3 A;  2J6S A;  3GIK A;  2W7O A;  3RB3 A;  2BQR A;  4J9R A;  4UFZ A;  2WB1 A;  4LH7 A;  4A3F G;  1TAE A;  4TQR A;  3T1H H;  3V6J A;  2ASD A;  4UCT A;  2VQF H;  1KJ9 A;  4MAM A;  1R9T A;  3I4N G;  4K0K H;  2UXB H;  4AYB E;  2XCP A;  2E2I A;  5JVD F;  3Q1K A;  5LXT F;  4U7C A;  4ECU A;  5IYD G;  4B3S H;  1B04 A;  3GTK A;  4BXX G;  2HHH H;  1ZQ7 A;  2FP4 B;  2V5A A;  2C2D A;  5L1L A;  4FS1 A;  4MV3 A;  3BQ0 A;  1B33 N;  3HOU G;  4IAJ A;  3PO2 G;  2B63 G;  2VQD A;  2VUM A;  2RGR A;  5BMV F;  4HNT A;  1N33 H;  3RV3 A;  4J9N A;  1ZHS A;  4HR7 A;  3GII A;  4DR4 H;  3RGX A;  3V4Z A;  3HBL A;  4ECT A;  4RZQ A;  2W70 A;  2PMZ A;  2NU8 B;  2W8K A;  2C00 A;  2XCA A;  4JV1 A;  4IWY A;  4UCU A;  1JIH A;  5LMN H;  4EFB A;  3M9M B;  3Q8S B;  4O4L F;  4DV7 H;  3RF2 A;  3RTX A;  1I7N A;  2JA6 G;  2JA5 A;  4DL7 A;  4A2B A;  4CC6 A;  4TQS A;  1GO3 E;  1XMO H;  4IRC A;  2WB1 E;  3BA8 A;  5C3E G;  5CAE B;  3FDS A;  3VPC A;  5EWE A;  2AU0 A;  4DV0 H;  4G3I A;  4DR3 H;  3DF7 A;  1VS0 A;  4M9U A;  3MJF A;  4J9O A;  5FD6 A;  4EYI B;  2RGV A;  1Y1V A;  4DL2 A;  2AGP A;  4AYB A;  5IYZ F;  3PVX A;  2M05 A;  1JDB B;  3RB0 A;  3TIG A;  4JI1 H;  4MV6 A;  3RFC A;  1GYF A;  4B3M H;  1Y1W G;  3R5F A;  2JEJ A;  3BAB A;  3PW0 A;  2W6M A;  5KFG A;  2IP4 A;  4O3N A;  4J9Q A;  4HNU A;  5CA0 F;  2YZN A;  2V59 A;  2ZJT A;  2UVW A;  4I7H A;  1Z2P X;  4J9P A;  3GTO A;  3N40 P;  5DG7 A;  1CQJ B;  4ZOL F;  4F50 A;  3GIM A;  2RDJ A;  4F4X A;  2XIG A;  2KSW A;  2VR1 A;  1AUX A;  2JEI A;  3HXL A;  1DIK A;  3F8N A;  2W9B A;  4FU0 A;  4DL4 A;  1RYR A;  1XNQ H;  3GIQ A;  5KFD A;  2DPI A;  4MV8 A;  4QW9 A;  1GGO A;  3MR2 A;  2FK1 A;  3H0G A;  3NGD A;  3GV8 B;  1IOV A;  3UFX B;  5LA6 F;  5KT2 A;  2R92 G;  3HOV G;  1CE8 A;  4O3R A;  5KFC A;  2XGP A;  4JI0 H;  5JUM A;  1TWG A;  3ETH A;  4QW8 A;  2W6P A;  1GSA A;  4A3L G;  4X62 H;  3N43 B;  4MV4 A;  4J9M A;  4Q0Y A;  1X9N A;  4C2M A;  4LF5 H;  1DV1 A;  5KT7 A;  3K3P A;  1OWT A;  1EUC B;  1K1Q A;  2C2R A;  2R7Z G;  5KG2 A;  1S10 A;  5T14 A;  4I55 F;  4A3G G;  2NU6 B;  5DG8 A;  2WTF A;  3TII A;  5L9X A;  4XYL B;  2W7P A;  3LML A;  2W57 A;  5KT4 A;  2PVP A;  3BAA A;  5KT6 A;  3BG5 A;  4LSA A;  5D1O B;  5KFP A;  3GIL A;  3GV7 B;  3KAK A;  1SCU B;  3GIP A;  4DLK A;  1GSO A;  2UXC H;  1B6S A;  2YCH A;  2F4V H;  3GTQ A;  1L2Z A;  4X66 H;  4QWA A;  2XC9 A;  4YR0 A;  4RB0 A;  4A2A A;  4X64 H;  2UVV A;  5DLG A;  3PW2 A;  2JA8 G;  4HYK A;  4UCR A;  2YW2 A;  2FKL A;  2W6N A;  2JEG A;  4DL5 A;  1M6V A;  2R87 A;  2VPS A;  4ED0 A;  3H20 A;  4JYA H;  2CZG A;  2CW8 A;  3PR5 B;  1KEE A;  2XD4 A;  3PW4 A;  1KJI A;  4UCV A;  2W9B B;  2HVS A;  5CA1 F;  4C5B A;  1SYX B;  5JVL A;  3V4S A;  4O3S A;  4R8U A;  5J2T F;  4A3J G;  2I87 A;  4EBE A;  2W6O A;  3V6K A;  1HNX H;  5DLF A;  1E4F T;  4F4W A;  4FBT A;  4LF4 H;  3N6X A;  4LH6 A;  3CVZ A;  5L1K A;  4DUY H;  1S97 A;  1A0I A;  5BPH A;  2FLN A;  5KFY A;  1GSH A;  3R23 A;  5D1P A;  3KHH A;  4MTE A;  1SFO A;  5D8D A;  1A9X A;  5KG7 A;  1N48 A;  4EGJ A;  2MCT A;  5KT5 A;  4ED1 A;  1V9P A;  5KG4 A;  4IWX A;  3MR6 A;  1JDE A;  1PK8 A;  4J9K A;  4FBU A;  3QZ8 A;  1TWH A;  3GTM A;  3LWB A;  2NUA B;  1HR0 H;  2UUA H;  5KG1 A;  5IP7 G;  4QIW A;  3OTO H;  2WDT A;  5FPR A;  5KFJ A;  1UC9 A;  1TWC A;  4DR7 H;  1MZB A;  1IBL H;  4JV2 A;  2R93 A;  2CW7 A;  5EDW A;  3MFH A;  4DR6 H;  1JLL B;  3R5H A;  4HNV A;  5I47 A;  3U9T A;  5LP6 F;  5KFF A;  3GTG A;  2FB9 A;  5LMU H;  3OHA A;  2VUG A;  2HVR A;  4ECZ A;  1N36 H;  3EPI A;  2P0A A;  5KG3 A;  2UU9 H;  4GKJ H;  1Z2N X;  5FLM G;  1EZ1 A;  1WCM G;  1VBH A;  1W96 A;  4YHH H;  3I12 A;  2GLT A;  3JRW A;  3AYH B;  1Y14 B;  5EOY A;  3JRX A;  4J9S A;  2OWO A;  4A3C G;  2ALZ A;  3CQZ A;  3TQT A;  5LYJ F;  3BJY A;  1WH2 A;  1RK6 A;  1BGW A;  5FD5 A;  5KG5 A;  4GC6 A;  4ZHQ F;  3RAX A;  2IBK A;  3GTJ A;  4NXM H;  1VKZ A;  4JI3 H;  5KKN B;  2FMA A;  5BPF A;  3L4J A;  2WAQ E;  2C2E A;  3IN5 A;  4ECV A;  4IRK A;  3ORQ A;  1P8L A;  3JZI A;  2AGO A;  2VA2 A;  1FJG H;  5IT9 W;  4YR3 A;  2DPJ A;  5FLX W;  3KTM A;  4Q8E A;  5KFH A;  4EFE A;  3N42 B;  2YU9 A;  1C3O A;  2JEF A;  3VPD A;  2HVQ A;  3L4K A;  2DZD A;  4M7E A;  4YBZ B;  2SCU B;  4A3E G;  1KC7 A;  5D1O A;  4BBS G;  4RB1 A;  3C0F B;  4O2B F;  4LMY A;  3T5J A;  1O75 A;  4DR1 H;  4PDB A;  2DIK A;  2R7Z A;  3MWE A;  5GON F;  2I8C A;  4JI6 H;  4LF8 H;  2HGS A;  1I94 H;  1VAJ A;  5HBR B;  5KFL A;  5J2U F;  4C5C A;  1I50 A;  2R7K A;  2FE3 A;  4QJF A;  3FKI G;  1JXL A;  2JA7 G;  4YR2 A;  3GLK A;  2FPG B;  3EYY A;  2V4Q A;  4A3B G;  1KJJ A;  3N41 B;  4R8U B;  4DL6 A;  3G6Y A;  1XNR H;  4DV2 H;  4OX9 H;  1C30 A;  1M7J A;  3HKZ A;  4L1K A;  2Y0S A;  5L1J A;  4ECS A;  4YB8 B;  1BNC A;  4MA0 A;  1KJQ A;  5KFI A;  2R85 A;  4RB2 C;  2IMW P;  2QYZ A;  5FPO A;  5KT3 A;  5KFO A;  4LFC H;  1S0N A;  2R6F A;  3RJ0 A;  1RYS A;  3N8D A;  1PX2 A;  4XX0 B;  3IG0 A;  4U6P A;  4YP3 A;  2R8H A;  4ECR A;  2OLS A;  1WSC A;  3UQ8 A;  3RB6 A;  3WNZ A;  3KHG A;  4DL3 A;  2BQU A;  3Q8P B;  1SEI A;  4MV7 A;  3T5H A;  1AUV A;  3JSN A;  3L2P A;  4QWB A;  4XZ3 B;  1Z2O X;  4ZI7 F;  3GQC A;  4F4Z A;  1S9F A;  2OH2 A;  5HV6 A;  4J0M A;  4QWE A;  4J9L A;  5IYC G;  3M4I A;  5KFA A;  5KFK A;  3J81 W;  4YJ3 F;  1EUD B;  3J80 W;  3Q8R B;  4O3Q A;  5KFW A;  2ZDH A;  3TIN A;  1S0M A;  3PN1 A;  4DV1 H;  3H4B A;  4QIW E;  2X0S A;  3MWD A;  5C44 G;  3SI8 A;  1M0W A;  5IYB G;  3JAM W;  2ASL A;  4EBC A;  2O03 A;  4Q8F A;  1RJR A;  2YL2 A;  2VPQ A;  4BWS C;  1N34 H;  2GPS A;  4NXN H;  4ME6 A;  5EWG A;  4GC7 A;  3G8C A;  4Q43 A;  4I50 F;  1W93 A;  2B63 A;  2W9A A;  1S0O A;  4WBN F;  5KFR A;  4YAK B;  3M9O B;  2PN1 A;  3H40 A;  2UUB H;  2FK3 A;  1TA8 A;  4ETS A;  3J7A K;  5KFZ A;  4O4I F;  4EEY A;  3T5K A;  4DR2 H;  2W6Z A;  3H3V H;  4UCO A;  5C5J A;  1IOW A;  2YZM A;  1JKJ B;  1ULZ A;  4APM A;  3ORR A;  1V4Y A;  1ZHQ A;  2C35 B;  2R7N A;  4O3P A;  3M9N B;  4ECY A;  5EZY F;  4HQ6 A;  2VQE H;  4Q44 A;  2Y0S E;  3SE7 A;  4AQY H;  5L1I A;  1HNZ H;  4XYM B;  3BA9 A;  5KFX A;  1J5E H;  3PR4 A;  3GV5 B;  3Q8Q B;  4LF7 H;  4A93 G;  2JA6 A;  5LOV F;  1WCM A;  3G6X A;  1TWF A;  3GTL A;  4JI8 H;  5KFV A;  3HOW G;  1XDN A;  1HNW H;  4IZO A;  2RF4 A;  1DV2 A;  5A2Q W;  2VOB A;  5KFQ A;  2AGQ A;  2E5L H;  3MFI A;  2FJZ A;  4MV9 A;  1B6R A;  4RU9 A;  3KAJ A;  2UXD H;  4MV1 A;  5C1P A;  1K83 A;  4O4H F;  4FM9 A;  1Y1V G;  4A3I G;  1VBG A;  5KG0 A;  4JV0 A;  1KBL A;  1I6U A;  5F9L A;  2NVX A;  4ZQI A;  4RNM A;  2W9C B;  3EPG A;  4EBD A;  4A3K G;  2WE6 A;  3RBE A;  4F4Y A;  2R8I A;  3RBD A;  2NU7 B;  2PBZ A;  2ZM6 H;  3T5L A;  5K2M A;  5DGA A;  5DQH A;  5C1O A;  3Q2O A;  2R84 A;  1DGS A;  2YRW A;  4BY1 G;  5F9N A;  1CQI B;  4QWC A;  5C4X G;  3HOY G;  2BR0 A;  3LP8 A;  5DG9 A;  4TV8 F;  2NU9 B;  4BY7 G;  4RNO A;  4JI4 H;  2DWC A;  2XCL A;  2ATL A;  5KFT A;  5KFE A;  1IBM H;  4B3T H;  1JX4 A;  3R5X A;  4O2A F;  4ED2 A;  2R92 A;  5DQI A;  2UVU A;  3K5H A;  5FJ8 G;  4DUZ H;  2FPI B;  4WD3 A;  1EYZ A;  3RAQ A;  3KHR A;  2ASJ A;  2AQ4 A;  4X65 H;  4IHJ F;  2VUM G;  2YYA A;  2J6U A;  2J6T A;  2HJW A;  2FK2 A;  2WYO A;  3WO1 A;  4BBR G;  3WO0 A;  5DGB A;  4FS2 A;  1T3N A;  3N44 B;  1I7L A;  1E4G T;  2VA3 A;  2W6Q A;  4IRD A;  4GKK H;  2R93 G;  3BQ1 A;  3T1Y H;  2YS7 A;  2I80 A;  4NLG A;  2V58 A;  4RUA A;  2NVY A;  5CB4 F;  3OUZ A;  4EEQ A;  4ECW A;  4O3O A;  3GTP A;  1E4E B;  1UC8 A;  3KHL A;  4LFB H;  1GLV A;  3PW7 A;  2R8K A;  3QFF A;  5DQG A;  4TV9 F;  4LFA H;  3HKZ E;  4RB3 C;  3OUU A;  2Q2U A;  3G6V A;  2JA5 G;  1UNN C;  4CC5 A;  4LSX A;  3RV4 A;  1T36 A;  4JUZ A;  1N32 H;  3K5I A;  4Q45 A;  2W9C A;  4GLX A;  2V9W A;  1I3Q A;  1RJP A;  2YRX A;  4PWQ A;  2GPW A;  4KHP H;  2PMZ E;  5LL6 b;  4JI2 H;  1TWA A;  4RUC A;  3OSP A;  2R82 A;  5C8Y F;  5KFB A;  4RAY A;  4IR1 A;  1KJ8 A;  3U9S A;  5EWF A;  1V51 A;  1BJT A;  1Y1W A;  4EYH B;  5KFN A;  3PO3 G;  2ZDQ A;  3VPB A;  4MTD A;  3RUP A;  3I4M G;  3V6H A;  5KFU A;  2Q2T A;  1S68 A;  2R8G A;  3JSL A;  3GIJ A;  1IBK H;  2CQY A;  2J9G A;  4RZR A;  3TQ1 A;  4YAJ B;  5KG6 A;  3MWM A;  2WAQ A;  2RDI A;  5KFS A;  1T94 A;  1BXR A;  2CKZ B;  4DV5 H;  4LF9 H;  2YS6 A;  4YJ2 F;  4I4T F;  4B3R H;  1CS0 A;  5IWA H;  1E4E A;  3OSN A;  3KAL A;  3KXY T;  3MR5 A;  2FLP A;  1EHI A;  4YQW A;  3PZP A;  5BR8 H;  2ZDG A;  3H0G G;  2R8J A;  5IP9 G;  2C28 A;  2W71 A;  4EG0 A;  4DV6 H;  4ECX A;  4ECQ A;  3HOZ G;  4LF6 H;  1XMQ H;  3FKI A;  4R7R A;  2JA7 A;  3QZ7 A;  4DV4 H;  4JV5 H;  4IR9 A;  1RK5 A;  2FLL A;  2UVR A;  1RJQ A;  4UCS A;  4YY3 H;  4A3D G;  2E2H A;  4QWD A;  4JI7 H;  4RAZ A;  3PW5 A;  1WR2 A;  5KFM A;  2R7L A;  2V4R A;  1FVI A;  4DR5 H;  4ED8 A;  3FMA A;  3RGZ A;  3RB4 A;  1FKA H;  5JQW A;  2QK4 A;  2R7M A;  3GID A;  1AN7 A;  2R86 A;  2BQ3 A;  5JH7 F;  1ZET A;  3HB9 A;  3K3V A;  4MA5 A;  3VMM A;  2IA6 A;  1M0T A;  1N56 A;  4C5A A;  3BQ2 A;  4A3M G;  3OHB A;  4JI5 H;  2XGQ A;  4E4T A;  5H80 A;  4RNN A;  1K1S A;  4ED7 A;  3ETJ A;  3E5N A;  4ED3 A;  2W8L A; 
#chains in the Genus database with same CATH homology
 3BAA A;  4LSA A;  5D1O B;  1O75 A;  4LF8 H;  4JI6 H;  1S03 G;  3KAK A;  1DGS A;  2HGS A;  4DV3 H;  2UUC H;  3RIZ A;  1I94 H;  2YCH A;  2F4V H;  1L2Z A;  4X66 H;  4RB0 A;  4A2A A;  2FE3 A;  4UFZ A;  4X64 H;  4LH7 A;  4JI4 H;  1TAE A;  4UCR A;  3EYY A;  3T1H H;  1IBM H;  4B3T H;  4UCT A;  3N41 B;  2VQF H;  1XNR H;  4DV2 H;  4OX9 H;  4DUZ H;  2VPS A;  3H20 A;  4JYA H;  4K0K H;  2UXB H;  2CW8 A;  4X65 H;  4RB2 C;  4B3S H;  1B04 A;  4UCV A;  2HHH H;  2HVS A;  5FPO A;  1SYX B;  2WYO A;  4LFC H;  4GKK H;  3N44 B;  1E4G T;  3RJ0 A;  4IAJ A;  3IG0 A;  3T1Y H;  1HNX H;  1E4F T;  3UQ8 A;  4LF4 H;  3N6X A;  4LH6 A;  4EEQ A;  3CVZ A;  2RGR A;  1SEI A;  4MV7 A;  1N33 H;  4LFB H;  3JSN A;  3L2P A;  4DUY H;  1ZHS A;  1Z2O X;  1A0I A;  3RGX A;  4DR4 H;  4RZQ A;  4J0M A;  4LFA H;  3M4I A;  4RB3 C;  3J81 W;  2Q2U A;  5D1P A;  4CC5 A;  4LSX A;  3J80 W;  4MTE A;  1N32 H;  4UCU A;  5LMN H;  2MCT A;  4GLX A;  3PN1 A;  4EFB A;  4DV1 H;  1V9P A;  4DV7 H;  3RF2 A;  3RTX A;  1M0W A;  4KHP H;  4A2B A;  4CC6 A;  5LL6 b;  3JAM W;  1XMO H;  4JI2 H;  1HR0 H;  2UUA H;  3BA8 A;  2O03 A;  4BWS C;  1N34 H;  4NXN H;  4RAY A;  3OTO H;  4DV0 H;  2WDT A;  3DF7 A;  5FPR A;  4DR3 H;  4DR7 H;  1VS0 A;  1MZB A;  1IBL H;  1BJT A;  2CW7 A;  5FD6 A;  4DR6 H;  2RGV A;  4MTD A;  2Q2T A;  1GYF A;  1S68 A;  5LMU H;  2UUB H;  3JSL A;  1TA8 A;  4ETS A;  2VUG A;  1IBK H;  2HVR A;  4JI1 H;  3J7A K;  1N36 H;  4B3M H;  3BAB A;  3MWM A;  4DR2 H;  2UU9 H;  4GKJ H;  1Z2N X;  4DV5 H;  4LF9 H;  4UCO A;  2ZJT A;  4B3R H;  5IWA H;  4APM A;  1Z2P X;  4I7H A;  3N40 P;  3KAL A;  3KXY T;  4YHH H;  1ZHQ A;  2VQE H;  2XIG A;  2KSW A;  5BR8 H;  4AQY H;  1HNZ H;  5EOY A;  4LF7 H;  3BA9 A;  1J5E H;  3HXL A;  4DV6 H;  2OWO A;  3F8N A;  4LF6 H;  1XMQ H;  4R7R A;  4JI8 H;  1XNQ H;  4DV4 H;  4JV5 H;  1WH2 A;  5FD5 A;  1BGW A;  1XDN A;  4NXM H;  1HNW H;  4UCS A;  4YY3 H;  4JI3 H;  5A2Q W;  2VOB A;  2E5L H;  4JI7 H;  3L4J A;  4RAZ A;  4MV9 A;  4DR5 H;  4JI0 H;  1FVI A;  3FMA A;  3KAJ A;  3RGZ A;  2UXD H;  1FKA H;  4FM9 A;  1P8L A;  5IT9 W;  1FJG H;  1AN7 A;  4X62 H;  3N43 B;  1X9N A;  3K3V A;  4Q0Y A;  5FLX W;  4LF5 H;  1I6U A;  1M0T A;  3N42 B;  4EFE A;  4JI5 H;  2HVQ A;  3L4K A;  4M7E A;  2WE6 A;  5D1O A;  4RB1 A;  3C0F B;  2ZM6 H;  2UXC H;  4LMY A;  4PDB A;  3LML A;  4DR1 H;  2W57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...