4Q0YA

Crystal structure of a thioesterase-like protein (clospo_01618) from clostridium sporogenes atcc 15579 at 1.70 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
GRMEISSLSSIDVFKFNSFSKFSNDKIGVIYDEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYFLLYILVGDSEGKSYIIFSGTELSYVLDKNNTNILKEIFLNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (CLOSPO_01618) from Clostridium sporogenes ATCC 15579 at 1.70 A resolution
rcsb
source organism Clostridium sporogenes
molecule tags Structural genomics, unknown function
total genus 31
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.400 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4q0yA00
4Q0YA
chains in the Genus database with same CATH superfamily
2WDTA 4DR4H 3IN5A 4DV2H 2X0SA 1S03G 4A3EG 4YJ2F 3RGZA 5KFKA 5GONF 3K5IA 3PW2A 1N33H 4EBCA 1GLVA 2V9WA 3JSNA 3MR2A 2UVRA 3F8NA 5JVLA 2VOBA 3GTPA 1EZ1A 5HBRB 4DR2H 4RU9A 3V6JA 2ASJA 3K3PA 2ASLA 2JA6A 3H4BA 3I4NG 3U9SA 2FPGB 4FBTA 4YAJB 3TIIA 4I50F 5FLMG 4ECRA 3VPBA 3G6VA 5KG2A 2P0AA 4JV2A 4EFEA 3EPGA 3CQZA 4LF8H 5FLXW 2JA7G 4DR6H 2PN1A 4HNUA 5KFOA 3JRWA 4IWYA 2DPJA 2IBKA 2W71A 1HNZH 3BA9A 2ZM6H 2V4QA 1Z2NX 3RFCA 1RJPA 4DV5H 3JAMW 3BG5A 2R92A 1SCUB 3R5FA 4JI7H 1E4GT 1XDNA 3N41B 3R5XA 4XX0B 5KKNB 1VKZA 1EYZA 1S0OA 1GGOA 1M0TA 5KFFA 1IOVA 3MR5A 5EWFA 4ECYA 4ETSA 1EHIA 4GKKH 3I12A 4X65H 4DL7A 1T3NA 2W6NA 4DLKA 1TWHA 2UU9H 4EBEA 3EYYA 3GIDA 5CA0F 2NUAB 4UCOA 2UXCH 1TWFA 4IAJA 5KFYA 4QWAA 4J0MA 4MV8A 2VR1A 3RIZA 3GILA 5KT7A 1I6UA 2R8HA 3BQ2A 2AGQA 2FPIB 3QZ7A 4JUZA 2CW8A 4J9OA 4O3NA 1WCMA 1BXRA 3HBLA 2CW7A 5J2UF 2YU9A 2W9CB 3KAKA 3RB4A 4GKJH 1ZETA 4Q8FA 5D1PA 2C2DA 5KFGA 4MV6A 3M9MB 3MWMA 3T1HH 5H80A 2SCUB 3HXLA 3HOUG 4RB0A 4RNMA 1M0WA 3GTOA 1W93A 2JEFA 1FJGH 1A0IA 1AUVA 2I8CA 4YHHH 2UVWA 3GTQA 4K0KH 4A3KG 5C44G 4IHJF 3OSPA 4LFCH 1PX2A 4ZQIA 5JH7F 2V4RA 2W9CA 1N32H 3N43B 3FDSA 2OWOA 4IRKA 3JSLA 1KEEA 3LMLA 5KT4A 4ED8A 2ZDQA 4RZQA 1XNRH 1Y1WG 2VA2A 2R86A 4QW8A 4YR3A 2QYZA 3PO3G 1N36H 1ZHQA 1SEIA 2UVVA 3KTMA 4EEQA 3RGXA 3GV5B 1VBHA 5DQHA 1AUXA 4LF6H 1JDEA 4CC6A 1RYRA 4A3DG 4C5CA 2MCTA 4EBDA 1Y1VA 4Y8VB 1KJ8A 5EZYF 2C35B 5A2QW 4J9KA 1B6RA 1ULZA 4TUYF 4X64H 4AQYH 2WYOA 2XC9A 1L2ZA 3M4IA 4A3BG 1ZQ7A 3JRXA 4F4WA 2DWCA 1V51A 2V5AA 4J9MA 4LFBH 4MV9A 4BY7G 3T5LA 2C22A 1VAJA 5LMNH 3J7AK 2VQFH 1B04A 2PMZE 4R8UB 2F4VH 4BXXG 1C30A 2M05A 2FLLA 4DR1H 4NLGA 2HVRA 3GTKA 3BQ1A 4YQWA 3WO1A 2B63A 4F4YA 3R5HA 4HNTA 1K1SA 4UCVA 4BWSC 4J9RA 4I4TF 2UVUA 4I55F 3KXYT 5LXTF 2R8GA 1KBLA 3RB0A 2YL2A 5D1OB 4ZOLF 4UCRA 5T14A 2JEGA 1BGWA 4MA5A 4YJ3F 4BBRG 5F9LA 3GIKA 4ECTA 2JA5G 1EUCB 2PBZA 1KJJA 4ECXA 4I7HA 5KG3A 4IRDA 1E4FT 2R7ZA 5CAEB 3J80W 3KHGA 3MWEA 4MV4A 3HOYG 5CB4F 3GTGA 2CZGA 3FKIG 5D1OA 4E4TA 3KALA 1RJRA 4MV1A 4BY1G 5L9XA 5LP6F 3ORRA 2VUMG 4ED1A 4CC5A 3L2PA 4J9QA 4UFZA 1SFOA 2HGSA 4C2MA 2GPWA 4F50A 5KFZA 4LSXA 4ED7A 3PW7A 1I3QA 2YZNA 5FD5A 3RV4A 2R93G 4RB3C 3PR4A 3AYHB 3QFFA 2W8LA 4EGJA 3M9NB 5L1LA 3UFXB 3GIMA 3GIJA 2AU0A 3DF7A 1S10A 1JX4A 4DL2A 2IA6A 2OH2A 2FJZA 5K2MA 3PR5B 3RBEA 3WO0A 4FS1A 4FS2A 3NGDA 5KT2A 3PZPA 4Q8EA 4DR7H 2I80A 5DG7A 3Q8PB 2VA3A 3MFIA 2JA7A 5KFHA 4HQ6A 2FE3A 4EYIB 5KG1A 4MAMA 3PW5A 2UXBH 3SE7A 4G3IA 5C4XG 2W6PA 2RF4A 4X62H 4A3LG 2E5LH 3HB9A 3RB3A 2AGOA 2AGPA 2DIKA 2JA6G 1DV1A 4TV8F 3K3VA 1RK6A 2R8KA 4LFAH 2QK4A 4B3SH 2FB9A 4A2BA 3QZ8A 5KX5F 4J9PA 4DUYH 1KJ9A 5KFBA 2R8JA 2NVXA 5KT6A 1CE8A 1SYXB 4LMYA 5JUMA 1A9XA 3H40A 5L1JA 4ED3A 4DR3H 2ASDA 3GTJA 4O3SA 2YS7A 2FK3A 2RGVA 4RB2C 3HKZA 2HVQA 3GLKA 5LL6b 4Q44A 2OLSA 3H0GG 4QIWA 3G8CA 2VQEH 2WB1A 4U7CA 4RB1A 2ZJTA 2W70A 3RJ0A 3N42B 1BJTA 2YZMA 2V59A 4ZHQF 3TQ1A 3KHHA 3G6YA 3E5NA 2W6MA 3BQ0A 4ECVA 3TQTA 5LMUH 4O2BF 1I94H 1GYFA 1Z2OX 2RDIA 3HKZE 4UCTA 4EFBA 1XMQH 2NU6B 5KG6A 5DG8A 4NXNH 2FMAA 3GV7B 1T36A 5KFWA 4ECWA 4QIWE 1XNQH 2IMWP 3VPDA 2C2EA 3N8DA 2WB1E 1Z2PX 3LWBA 3RAQA 4PDBA 3WNZA 1TA8A 2CKZB 4O4HF 2BR0A 5IYCG 5IYZF 4ZI7F 5EDWA 4J9SA 4GC7A 2C2RA 2R8IA 4O4IF 2R84A 4QJFA 1Y1WA 2R85A 3PVXA 1K83A 4O3PA 3N6XA 5KFCA 3H3VH 4R7RA 2PMZA 3SI8A 1DGSA 5JQWA 5FPOA 1OWTA 4OX9H 4O2AF 1RJQA 1UC8A 3OSNA 2XCPA 1N48A 2WE6A 5FJ8G 4X66H 1MZBA 2XGQA 4LH6A 2ZDHA 4FU0A 3RF2A 2WTFA 4O3OA 3U9TA 2HHHH 1I50A 4FM9A 4F4XA 3VMMA 2FK1A 2R7LA 4XZ3B 2HJWA 4O4LF 4RNOA 3EPIA 5BR8H 3Q2OA 2Y0SA 3LP8A 4LH7A 4EGQA 4JV1A 1WH2A 2GLTA 3GQCA 3L4JA 3T5KA 1S9FA 1BNCA 2YRXA 3PW4A 4JI4H 2JEJA 4HYKA 1PK8A 2YW2A 1HR0H 2W8KA 1K1QA 5CA1F 5F9NA 1IBMH 1CS0A 2Q2TA 2VUGA 1CQIB 1UNNC 2DPIA 2RDJA 1JKJB 3MR6A 4O3QA 4DV0H 2Y0SE 4GC6A 2UUBH 3PN1A 3VPCA 5KFNA 2JA5A 2FLNA 5IP7G 3MFHA 1JLLB 3Q8SB 4M9UA 5DGAA 4JV5H 4EEYA 4YP3A 3Q1KA 1KJIA 4LSAA 5KT5A 4Q45A 2BQUA 4JI3H 3FKIA 2PVPA 2FKLA 2V58A 3CVZA 5LA6F 4A2AA 3RB6A 4ED2A 4LF7H 5C3EG 3OUUA 5KFIA 4ECSA 2UUCH 4AYBE 4WBNF 3TIGA 4IRCA 4TQRA 1I7LA 3FMAA 3BAAA 4ME6A 4DR5H 2VUMA 1R9TA 4DL4A 3RUPA 1B6SA 3MWDA 1TWCA 2CQYA 1RK5A 1KJQA 2VPSA 4XYMB 4Q0YA 2Q2UA 5L1KA 1JXLA 1I7NA 4TV9F 4ED0A 2DLNA 2BQ3A 2R93A 2JA8G 2FPPB 4L1KA 5FPRA 4A3MG 2YYAA 5HV6A 5KG5A 5IWAH 1IOWA 1GSHA 2WAQA 4HR7A 1CQJB 2GPSA 4QWBA 2YZGA 3TINA 3RAXA 2FK2A 5JVDF 4A3FG 3GTMA 2VQDA 4A3CG 4RNNA 2R87A 4QW9A 3OTOH 4PWQA 1GSAA 4YBZB 2C00A 1EUDB 1J5EH 4DL3A 2W9BB 2I87A 3IG0A 5L1IA 1P8LA 2XCLA 4DV6H 2DZDA 4LF4H 1WR2A 2YRWA 5KFRA 2YCHA 2ATLA 4DV3H 4IR1A 3GIQA 2WAQE 3OHBA 4APMA 4UCSA 4J9NA 2R7KA 3HOWG 2NU7B 4QWCA 4U6PA 1N34H 5C1OA 5D8DA 5KFQA 2IP4A 5KT3A 2W9BA 3HOVG 2VPQA 3BA8A 3RTXA 2ALZA 5IT9W 1W96A 1UC9A 5KFAA 4QWEA 1S97A 5KFUA 2XGPA 2ZDGA 5C1PA 4B3RH 4A3IG 2R92G 2E2IA 5DQIA 4WD3A 1M6VA 1S0MA 2W6QA 2RGRA 4YY3H 3H0GA 4MV3A 1KC7A 2UUAH 4BBSG 3BABA 5KFLA 3RBDA 5J2TF 1T94A 3V4ZA 4C5AA 5KFJA 4XYLB 1GSOA 1VBGA 2R7MA 4IWXA 2YS6A 4LF5H 2J6UA 1N56A 5KG0A 1TWAA 3BJYA 4RUCA 5IP9G 3I4MG 1E4EB 3HOZG 1Y14B 4JI5H 3T5HA 4ED6A 5KG7A 2FP4B 5C8YF 2W6OA 4TQSA 2NVYA 3V6KA 2XCAA 1WCMG 3KHRA 2W6ZA 4YAKB 5EWEA 1X9NA 4IZOA 1DIKA 3OHAA 2R7NA 1XMOH 3PO2G 3N40P 4HNVA 2NU9B 4YB8B 2J6TA 3MJFA 1E4EA 2C28A 3PW0A 3OUZA 4JI0H 3Q8QB 2HVSA 2FLPA 4DL6A 4M7EA 3G6XA 4A3JG 4O3RA 2BQRA 5EWGA 1V9PA 3V4SA 2W57A 5IYDG 2W7PA 3L4KA 3ETJA 3K5HA 4F4ZA 1O75A 1HNXH 3GIPA 2E2HA 5EOYA 4ECZA 5DGBA 4JI2H 4JV0A 2UXDH 5DLGA 3N44B 1V4YA 4KHPH 5BPFA 1GO3E 5LYJF 5KFMA 4UCUA 5BMVF 5I47A 2XIGA 4ECQA 2AQ4A 2R82A 1HNWH 4GLXA 1M7JA 5DQGA 4YR2A 1RYSA 4LF9H 5DG9A 3MR3A 4A3GG 4EYHB 2R6FA 1Y1VG 4MTEA 5KFVA 2O03A 3T5JA 4NXMH 3T1YH 4ECUA 3H20A 3J81W 4DV7H 4B3TH 4MV7A 3GV8B 1S0NA 4A93G 3UQ8A 5IYBG 4FBUA 4EG0A 5FD6A 4AYBA 5BPHA 5KFDA 1S68A 2JEIA 4MA0A 5KFSA 4RUAA 4DV4H 4JI6H 2W7OA 5DLFA 5KG4A 1FVIA 3Q8RB 2XD4A 4DV1H 4RAZA 3KHLA 4DL5A 4QWDA 2NU8B 4Q43A 5KFXA 2B63G 3H4DA 1IBLH 2KSWA 1JIHA 2J6SA 2W9AA 4B3MH 1TAEA 3ORQA 3HOXG 1C3OA 1AN7A 5KFPA 4JI1H 1DV2A 3C0FB 1JDBB 3ETHA 4RAYA 5LOVF 4RZRA 3V6HA 4MTDA 3GTLA 2J9GA 3RV3A 4YR0A 3JZIA 4J9LA 4R8UA 4C5BA 4IR9A 4JYAH 5KFTA 1TWGA 5KFEA 3KAJA 3R23A 1VS0A 1IBKH 5C5JA 1B33N 1ZHSA 3M9OB 3GIIA 1FKAH 4JI8H 1WSCA 2R7ZG 4DUZH
chains in the Genus database with same CATH topology
4LFBH 2WDTA 4DR4H 4MV9A 3BA8A 3RTXA 1Z2PX 5IT9W 4DV2H 4PDBA 1S03G 1TA8A 5LMNH 2VQFH 1B04A 3J7AK 2F4VH 3RGZA 4B3RH 4DR1H 2HVRA 1N33H 2RGRA 4YY3H 3N6XA 2UUAH 3JSNA 3BABA 3F8NA 4UCVA 4BWSC 4R7RA 2VOBA 3KXYT 1DGSA 4DR2H 4LF5H 5D1OB 5FPOA 4UCRA 4OX9H 1BGWA 2WE6A 4X66H 1MZBA 4LH6A 3RF2A 4JI5H 2HHHH 4EFEA 4FM9A 4LF8H 4I7HA 1E4FT 5FLXW 3J80W 4DR6H 5BR8H 1X9NA 4LH7A 1HNZH 3BA9A 5D1OA 1WH2A 2ZM6H 3KALA 1Z2NX 4DV5H 3L4JA 3JAMW 1XMOH 4JI7H 1E4GT 1XDNA 3N41B 3N40P 4JI4H 4CC5A 3L2PA 4UFZA 1M0TA 2HGSA 1HR0H 4JI0H 4LSXA 1IBMH 4ETSA 4GKKH 2HVSA 5FD5A 4X65H 2VUGA 2Q2TA 2UU9H 4M7EA 3EYYA 4UCOA 4RB3C 4DV0H 2UXCH 1V9PA 4IAJA 2W57A 2UUBH 3PN1A 4J0MA 4LF7H 3DF7A 3RIZA 3L4KA 1O75A 1I6UA 1HNXH 5EOYA 4JV5H 4DR7H 2CW8A 4JI2H 2UXDH 4KHPH 3N44B 4LSAA 4JI3H 2FE3A 3CVZA 2CW7A 4A2AA 4UCUA 1HNWH 2UXBH 2XIGA 3KAKA 4GKJH 4GLXA 2UUCH 4LF9H 5D1PA 4X62H 3T1HH 3MWMA 2E5LH 3FMAA 3BAAA 4MTEA 4DR5H 2O03A 4NXMH 3HXLA 3T1YH 2VPSA 3H20A 3K3VA 4RB0A 3J81W 4DV7H 1M0WA 4MV7A 4B3TH 4LFAH 4Q0YA 1FJGH 2Q2UA 1A0IA 4B3SH 3UQ8A 4YHHH 4K0KH 4A2BA 5FD6A 4DUYH 1S68A 4LFCH 1N32H 4JI6H 4DV4H 3N43B 5FPRA 5IWAH 2OWOA 1SYXB 4LMYA 1FVIA 4DR3H 3JSLA 4DV1H 2RGVA 3LMLA 4RAZA 4RB2C 4RZQA 1XNRH 2HVQA 5LL6b 3OTOH 1N36H 1ZHQA 1SEIA 1J5EH 2VQEH 4EEQA 1IBLH 2KSWA 3RGXA 4RB1A 3IG0A 2ZJTA 1P8LA 4DV6H 4B3MH 1TAEA 3RJ0A 4LF4H 3N42B 1BJTA 4CC6A 4LF6H 2MCTA 1AN7A 4JI1H 3C0FB 2YCHA 4RAYA 4DV3H 4MTDA 5A2QW 4APMA 5LMUH 1I94H 4X64H 1GYFA 4AQYH 4UCSA 2WYOA 4JYAH 1Z2OX 4UCTA 4EFBA 3KAJA 3M4IA 1XMQH 4NXNH 1L2ZA 1VS0A 1N34H 1IBKH 4JI8H 1ZHSA 1FKAH 1XNQH 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0Y A; 
#chains in the Genus database with same CATH topology
 2WDT A;  4DR4 H;  3IN5 A;  4DV2 H;  2X0S A;  1S03 G;  4A3E G;  4YJ2 F;  3RGZ A;  5KFK A;  5GON F;  3K5I A;  3PW2 A;  1N33 H;  4EBC A;  1GLV A;  2V9W A;  3JSN A;  3MR2 A;  2UVR A;  3F8N A;  5JVL A;  2VOB A;  3GTP A;  1EZ1 A;  5HBR B;  4DR2 H;  4RU9 A;  3V6J A;  2ASJ A;  3K3P A;  2ASL A;  2JA6 A;  3H4B A;  3I4N G;  3U9S A;  2FPG B;  4FBT A;  4YAJ B;  3TII A;  4I50 F;  5FLM G;  4ECR A;  3VPB A;  3G6V A;  5KG2 A;  2P0A A;  4JV2 A;  4EFE A;  3EPG A;  3CQZ A;  4LF8 H;  5FLX W;  2JA7 G;  4DR6 H;  2PN1 A;  4HNU A;  5KFO A;  3JRW A;  4IWY A;  2DPJ A;  2IBK A;  2W71 A;  1HNZ H;  3BA9 A;  2ZM6 H;  2V4Q A;  1Z2N X;  3RFC A;  1RJP A;  4DV5 H;  3JAM W;  3BG5 A;  2R92 A;  1SCU B;  3R5F A;  4JI7 H;  1E4G T;  1XDN A;  3N41 B;  3R5X A;  4XX0 B;  5KKN B;  1VKZ A;  1EYZ A;  1S0O A;  1GGO A;  1M0T A;  5KFF A;  1IOV A;  3MR5 A;  5EWF A;  4ECY A;  4ETS A;  1EHI A;  4GKK H;  3I12 A;  4X65 H;  4DL7 A;  1T3N A;  2W6N A;  4DLK A;  1TWH A;  2UU9 H;  4EBE A;  3EYY A;  3GID A;  5CA0 F;  2NUA B;  4UCO A;  2UXC H;  1TWF A;  4IAJ A;  5KFY A;  4QWA A;  4J0M A;  4MV8 A;  2VR1 A;  3RIZ A;  3GIL A;  5KT7 A;  1I6U A;  2R8H A;  3BQ2 A;  2AGQ A;  2FPI B;  3QZ7 A;  4JUZ A;  2CW8 A;  4J9O A;  4O3N A;  1WCM A;  1BXR A;  3HBL A;  2CW7 A;  5J2U F;  2YU9 A;  2W9C B;  3KAK A;  3RB4 A;  4GKJ H;  1ZET A;  4Q8F A;  5D1P A;  2C2D A;  5KFG A;  4MV6 A;  3M9M B;  3MWM A;  3T1H H;  5H80 A;  2SCU B;  3HXL A;  3HOU G;  4RB0 A;  4RNM A;  1M0W A;  3GTO A;  1W93 A;  2JEF A;  1FJG H;  1A0I A;  1AUV A;  2I8C A;  4YHH H;  2UVW A;  3GTQ A;  4K0K H;  4A3K G;  5C44 G;  4IHJ F;  3OSP A;  4LFC H;  1PX2 A;  4ZQI A;  5JH7 F;  2V4R A;  2W9C A;  1N32 H;  3N43 B;  3FDS A;  2OWO A;  4IRK A;  3JSL A;  1KEE A;  3LML A;  5KT4 A;  4ED8 A;  2ZDQ A;  4RZQ A;  1XNR H;  1Y1W G;  2VA2 A;  2R86 A;  4QW8 A;  4YR3 A;  2QYZ A;  3PO3 G;  1N36 H;  1ZHQ A;  1SEI A;  2UVV A;  3KTM A;  4EEQ A;  3RGX A;  3GV5 B;  1VBH A;  5DQH A;  1AUX A;  4LF6 H;  1JDE A;  4CC6 A;  1RYR A;  4A3D G;  4C5C A;  2MCT A;  4EBD A;  1Y1V A;  4Y8V B;  1KJ8 A;  5EZY F;  2C35 B;  5A2Q W;  4J9K A;  1B6R A;  1ULZ A;  4TUY F;  4X64 H;  4AQY H;  2WYO A;  2XC9 A;  1L2Z A;  3M4I A;  4A3B G;  1ZQ7 A;  3JRX A;  4F4W A;  2DWC A;  1V51 A;  2V5A A;  4J9M A;  4LFB H;  4MV9 A;  4BY7 G;  3T5L A;  2C22 A;  1VAJ A;  5LMN H;  3J7A K;  2VQF H;  1B04 A;  2PMZ E;  4R8U B;  2F4V H;  4BXX G;  1C30 A;  2M05 A;  2FLL A;  4DR1 H;  4NLG A;  2HVR A;  3GTK A;  3BQ1 A;  4YQW A;  3WO1 A;  2B63 A;  4F4Y A;  3R5H A;  4HNT A;  1K1S A;  4UCV A;  4BWS C;  4J9R A;  4I4T F;  2UVU A;  4I55 F;  3KXY T;  5LXT F;  2R8G A;  1KBL A;  3RB0 A;  2YL2 A;  5D1O B;  4ZOL F;  4UCR A;  5T14 A;  2JEG A;  1BGW A;  4MA5 A;  4YJ3 F;  4BBR G;  5F9L A;  3GIK A;  4ECT A;  2JA5 G;  1EUC B;  2PBZ A;  1KJJ A;  4ECX A;  4I7H A;  5KG3 A;  4IRD A;  1E4F T;  2R7Z A;  5CAE B;  3J80 W;  3KHG A;  3MWE A;  4MV4 A;  3HOY G;  5CB4 F;  3GTG A;  2CZG A;  3FKI G;  5D1O A;  4E4T A;  3KAL A;  1RJR A;  4MV1 A;  4BY1 G;  5L9X A;  5LP6 F;  3ORR A;  2VUM G;  4ED1 A;  4CC5 A;  3L2P A;  4J9Q A;  4UFZ A;  1SFO A;  2HGS A;  4C2M A;  2GPW A;  4F50 A;  5KFZ A;  4LSX A;  4ED7 A;  3PW7 A;  1I3Q A;  2YZN A;  5FD5 A;  3RV4 A;  2R93 G;  4RB3 C;  3PR4 A;  3AYH B;  3QFF A;  2W8L A;  4EGJ A;  3M9N B;  5L1L A;  3UFX B;  3GIM A;  3GIJ A;  2AU0 A;  3DF7 A;  1S10 A;  1JX4 A;  4DL2 A;  2IA6 A;  2OH2 A;  2FJZ A;  5K2M A;  3PR5 B;  3RBE A;  3WO0 A;  4FS1 A;  4FS2 A;  3NGD A;  5KT2 A;  3PZP A;  4Q8E A;  4DR7 H;  2I80 A;  5DG7 A;  3Q8P B;  2VA3 A;  3MFI A;  2JA7 A;  5KFH A;  4HQ6 A;  2FE3 A;  4EYI B;  5KG1 A;  4MAM A;  3PW5 A;  2UXB H;  3SE7 A;  4G3I A;  5C4X G;  2W6P A;  2RF4 A;  4X62 H;  4A3L G;  2E5L H;  3HB9 A;  3RB3 A;  2AGO A;  2AGP A;  2DIK A;  2JA6 G;  1DV1 A;  4TV8 F;  3K3V A;  1RK6 A;  2R8K A;  4LFA H;  2QK4 A;  4B3S H;  2FB9 A;  4A2B A;  3QZ8 A;  5KX5 F;  4J9P A;  4DUY H;  1KJ9 A;  5KFB A;  2R8J A;  2NVX A;  5KT6 A;  1CE8 A;  1SYX B;  4LMY A;  5JUM A;  1A9X A;  3H40 A;  5L1J A;  4ED3 A;  4DR3 H;  2ASD A;  3GTJ A;  4O3S A;  2YS7 A;  2FK3 A;  2RGV A;  4RB2 C;  3HKZ A;  2HVQ A;  3GLK A;  5LL6 b;  4Q44 A;  2OLS A;  3H0G G;  4QIW A;  3G8C A;  2VQE H;  2WB1 A;  4U7C A;  4RB1 A;  2ZJT A;  2W70 A;  3RJ0 A;  3N42 B;  1BJT A;  2YZM A;  2V59 A;  4ZHQ F;  3TQ1 A;  3KHH A;  3G6Y A;  3E5N A;  2W6M A;  3BQ0 A;  4ECV A;  3TQT A;  5LMU H;  4O2B F;  1I94 H;  1GYF A;  1Z2O X;  2RDI A;  3HKZ E;  4UCT A;  4EFB A;  1XMQ H;  2NU6 B;  5KG6 A;  5DG8 A;  4NXN H;  2FMA A;  3GV7 B;  1T36 A;  5KFW A;  4ECW A;  4QIW E;  1XNQ H;  2IMW P;  3VPD A;  2C2E A;  3N8D A;  2WB1 E;  1Z2P X;  3LWB A;  3RAQ A;  4PDB A;  3WNZ A;  1TA8 A;  2CKZ B;  4O4H F;  2BR0 A;  5IYC G;  5IYZ F;  4ZI7 F;  5EDW A;  4J9S A;  4GC7 A;  2C2R A;  2R8I A;  4O4I F;  2R84 A;  4QJF A;  1Y1W A;  2R85 A;  3PVX A;  1K83 A;  4O3P A;  3N6X A;  5KFC A;  3H3V H;  4R7R A;  2PMZ A;  3SI8 A;  1DGS A;  5JQW A;  5FPO A;  1OWT A;  4OX9 H;  4O2A F;  1RJQ A;  1UC8 A;  3OSN A;  2XCP A;  1N48 A;  2WE6 A;  5FJ8 G;  4X66 H;  1MZB A;  2XGQ A;  4LH6 A;  2ZDH A;  4FU0 A;  3RF2 A;  2WTF A;  4O3O A;  3U9T A;  2HHH H;  1I50 A;  4FM9 A;  4F4X A;  3VMM A;  2FK1 A;  2R7L A;  4XZ3 B;  2HJW A;  4O4L F;  4RNO A;  3EPI A;  5BR8 H;  3Q2O A;  2Y0S A;  3LP8 A;  4LH7 A;  4EGQ A;  4JV1 A;  1WH2 A;  2GLT A;  3GQC A;  3L4J A;  3T5K A;  1S9F A;  1BNC A;  2YRX A;  3PW4 A;  4JI4 H;  2JEJ A;  4HYK A;  1PK8 A;  2YW2 A;  1HR0 H;  2W8K A;  1K1Q A;  5CA1 F;  5F9N A;  1IBM H;  1CS0 A;  2Q2T A;  2VUG A;  1CQI B;  1UNN C;  2DPI A;  2RDJ A;  1JKJ B;  3MR6 A;  4O3Q A;  4DV0 H;  2Y0S E;  4GC6 A;  2UUB H;  3PN1 A;  3VPC A;  5KFN A;  2JA5 A;  2FLN A;  5IP7 G;  3MFH A;  1JLL B;  3Q8S B;  4M9U A;  5DGA A;  4JV5 H;  4EEY A;  4YP3 A;  3Q1K A;  1KJI A;  4LSA A;  5KT5 A;  4Q45 A;  2BQU A;  4JI3 H;  3FKI A;  2PVP A;  2FKL A;  2V58 A;  3CVZ A;  5LA6 F;  4A2A A;  3RB6 A;  4ED2 A;  4LF7 H;  5C3E G;  3OUU A;  5KFI A;  4ECS A;  2UUC H;  4AYB E;  4WBN F;  3TIG A;  4IRC A;  4TQR A;  1I7L A;  3FMA A;  3BAA A;  4ME6 A;  4DR5 H;  2VUM A;  1R9T A;  4DL4 A;  3RUP A;  1B6S A;  3MWD A;  1TWC A;  2CQY A;  1RK5 A;  1KJQ A;  2VPS A;  4XYM B;  4Q0Y A;  2Q2U A;  5L1K A;  1JXL A;  1I7N A;  4TV9 F;  4ED0 A;  2DLN A;  2BQ3 A;  2R93 A;  2JA8 G;  2FPP B;  4L1K A;  5FPR A;  4A3M G;  2YYA A;  5HV6 A;  5KG5 A;  5IWA H;  1IOW A;  1GSH A;  2WAQ A;  4HR7 A;  1CQJ B;  2GPS A;  4QWB A;  2YZG A;  3TIN A;  3RAX A;  2FK2 A;  5JVD F;  4A3F G;  3GTM A;  2VQD A;  4A3C G;  4RNN A;  2R87 A;  4QW9 A;  3OTO H;  4PWQ A;  1GSA A;  4YBZ B;  2C00 A;  1EUD B;  1J5E H;  4DL3 A;  2W9B B;  2I87 A;  3IG0 A;  5L1I A;  1P8L A;  2XCL A;  4DV6 H;  2DZD A;  4LF4 H;  1WR2 A;  2YRW A;  5KFR A;  2YCH A;  2ATL A;  4DV3 H;  4IR1 A;  3GIQ A;  2WAQ E;  3OHB A;  4APM A;  4UCS A;  4J9N A;  2R7K A;  3HOW G;  2NU7 B;  4QWC A;  4U6P A;  1N34 H;  5C1O A;  5D8D A;  5KFQ A;  2IP4 A;  5KT3 A;  2W9B A;  3HOV G;  2VPQ A;  3BA8 A;  3RTX A;  2ALZ A;  5IT9 W;  1W96 A;  1UC9 A;  5KFA A;  4QWE A;  1S97 A;  5KFU A;  2XGP A;  2ZDG A;  5C1P A;  4B3R H;  4A3I G;  2R92 G;  2E2I A;  5DQI A;  4WD3 A;  1M6V A;  1S0M A;  2W6Q A;  2RGR A;  4YY3 H;  3H0G A;  4MV3 A;  1KC7 A;  2UUA H;  4BBS G;  3BAB A;  5KFL A;  3RBD A;  5J2T F;  1T94 A;  3V4Z A;  4C5A A;  5KFJ A;  4XYL B;  1GSO A;  1VBG A;  2R7M A;  4IWX A;  2YS6 A;  4LF5 H;  2J6U A;  1N56 A;  5KG0 A;  1TWA A;  3BJY A;  4RUC A;  5IP9 G;  3I4M G;  1E4E B;  3HOZ G;  1Y14 B;  4JI5 H;  3T5H A;  4ED6 A;  5KG7 A;  2FP4 B;  5C8Y F;  2W6O A;  4TQS A;  2NVY A;  3V6K A;  2XCA A;  1WCM G;  3KHR A;  2W6Z A;  4YAK B;  5EWE A;  1X9N A;  4IZO A;  1DIK A;  3OHA A;  2R7N A;  1XMO H;  3PO2 G;  3N40 P;  4HNV A;  2NU9 B;  4YB8 B;  2J6T A;  3MJF A;  1E4E A;  2C28 A;  3PW0 A;  3OUZ A;  4JI0 H;  3Q8Q B;  2HVS A;  2FLP A;  4DL6 A;  4M7E A;  3G6X A;  4A3J G;  4O3R A;  2BQR A;  5EWG A;  1V9P A;  3V4S A;  2W57 A;  5IYD G;  2W7P A;  3L4K A;  3ETJ A;  3K5H A;  4F4Z A;  1O75 A;  1HNX H;  3GIP A;  2E2H A;  5EOY A;  4ECZ A;  5DGB A;  4JI2 H;  4JV0 A;  2UXD H;  5DLG A;  3N44 B;  1V4Y A;  4KHP H;  5BPF A;  1GO3 E;  5LYJ F;  5KFM A;  4UCU A;  5BMV F;  5I47 A;  2XIG A;  4ECQ A;  2AQ4 A;  2R82 A;  1HNW H;  4GLX A;  1M7J A;  5DQG A;  4YR2 A;  1RYS A;  4LF9 H;  5DG9 A;  3MR3 A;  4A3G G;  4EYH B;  2R6F A;  1Y1V G;  4MTE A;  5KFV A;  2O03 A;  3T5J A;  4NXM H;  3T1Y H;  4ECU A;  3H20 A;  3J81 W;  4DV7 H;  4B3T H;  4MV7 A;  3GV8 B;  1S0N A;  4A93 G;  3UQ8 A;  5IYB G;  4FBU A;  4EG0 A;  5FD6 A;  4AYB A;  5BPH A;  5KFD A;  1S68 A;  2JEI A;  4MA0 A;  5KFS A;  4RUA A;  4DV4 H;  4JI6 H;  2W7O A;  5DLF A;  5KG4 A;  1FVI A;  3Q8R B;  2XD4 A;  4DV1 H;  4RAZ A;  3KHL A;  4DL5 A;  4QWD A;  2NU8 B;  4Q43 A;  5KFX A;  2B63 G;  3H4D A;  1IBL H;  2KSW A;  1JIH A;  2J6S A;  2W9A A;  4B3M H;  1TAE A;  3ORQ A;  3HOX G;  1C3O A;  1AN7 A;  5KFP A;  4JI1 H;  1DV2 A;  3C0F B;  1JDB B;  3ETH A;  4RAY A;  5LOV F;  4RZR A;  3V6H A;  4MTD A;  3GTL A;  2J9G A;  3RV3 A;  4YR0 A;  3JZI A;  4J9L A;  4R8U A;  4C5B A;  4IR9 A;  4JYA H;  5KFT A;  1TWG A;  5KFE A;  3KAJ A;  3R23 A;  1VS0 A;  1IBK H;  5C5J A;  1B33 N;  1ZHS A;  3M9O B;  3GII A;  1FKA H;  4JI8 H;  1WSC A;  2R7Z G;  4DUZ H; 
#chains in the Genus database with same CATH homology
 4LFB H;  2WDT A;  4DR4 H;  4MV9 A;  3BA8 A;  3RTX A;  1Z2P X;  5IT9 W;  4DV2 H;  4PDB A;  1S03 G;  1TA8 A;  5LMN H;  2VQF H;  1B04 A;  3J7A K;  2F4V H;  3RGZ A;  4B3R H;  4DR1 H;  2HVR A;  1N33 H;  2RGR A;  4YY3 H;  3N6X A;  2UUA H;  3JSN A;  3BAB A;  3F8N A;  4UCV A;  4BWS C;  4R7R A;  2VOB A;  3KXY T;  1DGS A;  4DR2 H;  4LF5 H;  5D1O B;  5FPO A;  4UCR A;  4OX9 H;  1BGW A;  2WE6 A;  4X66 H;  1MZB A;  4LH6 A;  3RF2 A;  4JI5 H;  2HHH H;  4EFE A;  4FM9 A;  4LF8 H;  4I7H A;  1E4F T;  5FLX W;  3J80 W;  4DR6 H;  5BR8 H;  1X9N A;  4LH7 A;  1HNZ H;  3BA9 A;  5D1O A;  1WH2 A;  2ZM6 H;  3KAL A;  1Z2N X;  4DV5 H;  3L4J A;  3JAM W;  1XMO H;  4JI7 H;  1E4G T;  1XDN A;  3N41 B;  3N40 P;  4JI4 H;  4CC5 A;  3L2P A;  4UFZ A;  1M0T A;  2HGS A;  1HR0 H;  4JI0 H;  4LSX A;  1IBM H;  4ETS A;  4GKK H;  2HVS A;  5FD5 A;  4X65 H;  2VUG A;  2Q2T A;  2UU9 H;  4M7E A;  3EYY A;  4UCO A;  4RB3 C;  4DV0 H;  2UXC H;  1V9P A;  4IAJ A;  2W57 A;  2UUB H;  3PN1 A;  4J0M A;  4LF7 H;  3DF7 A;  3RIZ A;  3L4K A;  1O75 A;  1I6U A;  1HNX H;  5EOY A;  4JV5 H;  4DR7 H;  2CW8 A;  4JI2 H;  2UXD H;  4KHP H;  3N44 B;  4LSA A;  4JI3 H;  2FE3 A;  3CVZ A;  2CW7 A;  4A2A A;  4UCU A;  1HNW H;  2UXB H;  2XIG A;  3KAK A;  4GKJ H;  4GLX A;  2UUC H;  4LF9 H;  5D1P A;  4X62 H;  3T1H H;  3MWM A;  2E5L H;  3FMA A;  3BAA A;  4MTE A;  4DR5 H;  2O03 A;  4NXM H;  3HXL A;  3T1Y H;  2VPS A;  3H20 A;  3K3V A;  4RB0 A;  3J81 W;  4DV7 H;  1M0W A;  4MV7 A;  4B3T H;  4LFA H;  4Q0Y A;  1FJG H;  2Q2U A;  1A0I A;  4B3S H;  3UQ8 A;  4YHH H;  4K0K H;  4A2B A;  5FD6 A;  4DUY H;  1S68 A;  4LFC H;  1N32 H;  4JI6 H;  4DV4 H;  3N43 B;  5FPR A;  5IWA H;  2OWO A;  1SYX B;  4LMY A;  1FVI A;  4DR3 H;  3JSL A;  4DV1 H;  2RGV A;  3LML A;  4RAZ A;  4RB2 C;  4RZQ A;  1XNR H;  2HVQ A;  5LL6 b;  3OTO H;  1N36 H;  1ZHQ A;  1SEI A;  1J5E H;  2VQE H;  4EEQ A;  1IBL H;  2KSW A;  3RGX A;  4RB1 A;  3IG0 A;  2ZJT A;  1P8L A;  4DV6 H;  4B3M H;  1TAE A;  3RJ0 A;  4LF4 H;  3N42 B;  1BJT A;  4CC6 A;  4LF6 H;  2MCT A;  1AN7 A;  4JI1 H;  3C0F B;  2YCH A;  4RAY A;  4DV3 H;  4MTD A;  5A2Q W;  4APM A;  5LMU H;  1I94 H;  4X64 H;  1GYF A;  4AQY H;  4UCS A;  2WYO A;  4JYA H;  1Z2O X;  4UCT A;  4EFB A;  3KAJ A;  3M4I A;  1XMQ H;  4NXN H;  1L2Z A;  1VS0 A;  1N34 H;  1IBK H;  4JI8 H;  1ZHS A;  1FKA H;  1XNQ H;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...