4Q0YA

Crystal structure of a thioesterase-like protein (clospo_01618) from clostridium sporogenes atcc 15579 at 1.70 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
GRMEISSLSSIDVFKFNSFSKFSNDKIGVIYDEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYFLLYILVGDSEGKSYIIFSGTELSYVLDKNNTNILKEIFLNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (CLOSPO_01618) from Clostridium sporogenes ATCC 15579 at 1.70 A resolution
rcsb
source organism Clostridium sporogenes
molecule tags Structural genomics, unknown function
total genus 31
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.400 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4q0yA00
4Q0YA
chains in the Genus database with same CATH superfamily
2XGPA 2UVVA 4C5CA 4LFAH 2O03A 3QFFA 5KFBA 4JI5H 3VPBA 3I4NG 2VOBA 4WD3A 2XCAA 4XZ3B 3BQ0A 1VS0A 2YRXA 5D8DA 1JIHA 4JV2A 4J0MA 2IP4A 5DG8A 1A9XA 3E5NA 1BGWA 2Q2TA 3KHLA 1UNNC 4HYKA 1CQJB 2W6PA 4EG0A 1X9NA 2CKZB 4ECVA 4A2BA 1HNZH 4IRKA 2NU7B 4A3LG 2FJZA 1TWHA 2MCTA 2VPQA 2R86A 4X65H 2WE6A 3V4ZA 1WSCA 5DGAA 5KFQA 3HOYG 3K3PA 3JRWA 2W7PA 1M0TA 2V9WA 3KTMA 3GTJA 4ED1A 4GKKH 2VQDA 5CA1F 3RB3A 1GGOA 4DR2H 4ED3A 3ORRA 4TV8F 2R7ZA 4NXNH 4JI7H 4ECRA 2V5AA 1ZQ7A 5IT9W 4RB1A 5C8YF 3SE7A 2AU0A 4DR4H 2FK3A 2VQEH 2DZDA 4MTEA 5JH7F 2R7ZG 2CZGA 4C5BA 1K1QA 3PVXA 4M7EA 1B6SA 3JSNA 5EWEA 3QZ8A 5D1OA 4RZQA 4CC5A 3KHGA 4XX0B 1E4EB 3IG0A 3H4BA 3HXLA 4QWAA 2DWCA 4QWCA 1E4GT 5KFPA 4YHHH 5KT7A 4MTDA 4ED0A 1GLVA 2YW2A 5JVLA 4RUCA 3PW5A 5KT5A 5KFEA 2W9AA 2DPJA 1GO3E 2XCPA 4EFEA 4LFBH 4A3CG 4MV4A 4RB2C 3G6XA 3GIIA 2W6NA 4I7HA 4U6PA 2C35B 5HBRB 4UCOA 5KT6A 4JI8H 4TQSA 2VQFH 2R82A 2BQ3A 1S0NA 2VA3A 2FLLA 4FBUA 1XNQH 3GTMA 3RFCA 1TWGA 4RNOA 4FS1A 4PDBA 4A93G 2UUBH 1S0OA 1ULZA 2DPIA 4B3SH 2YZMA 2E5LH 1JLLB 5KFMA 2GPWA 3MFIA 2YYAA 3WO0A 3RAXA 4JI3H 3GTQA 1T94A 1E4FT 1DGSA 4DL3A 2W6QA 2M05A 4R8UA 2P0AA 5KFXA 3HOXG 3CQZA 4GKJH 3PO2G 5HV6A 2JA7A 4F4ZA 4IRCA 1CQIB 2CW8A 3GTKA 2I87A 4NXMH 1L2ZA 3JRXA 5KX5F 2RGVA 4MA0A 5LMUH 1S9FA 1B6RA 3RUPA 4LSXA 3GTLA 4DR6H 2I80A 3JSLA 1EUCB 3BAAA 4I4TF 1WCMG 4M9UA 3QZ7A 2JA7G 1S03G 4CC6A 5KFOA 4B3TH 3M9NB 1KBLA 2HHHH 4A3DG 5KFDA 3GIDA 3LWBA 4ED2A 1GYFA 2UVRA 4ECYA 2I8CA 2FPGB 3UQ8A 4OX9H 5KFHA 5KFFA 4LFCH 3H4DA 3HOUG 3I4MG 2JEJA 5A2QW 5JUMA 2W9BB 4IAJA 2R8KA 4MV3A 4DLKA 3FKIG 5BMVF 3RGZA 3TQ1A 4BWSC 4RUAA 3RJ0A 4DR1H 3BQ2A 4ECWA 4JV5H 2FP4B 2XIGA 1HR0H 1T3NA 4J9LA 2JA5G 4RB0A 4Q43A 4BBRG 4B3RH 3EYYA 4RAZA 1SCUB 3GIPA 3JAMW 4YY3H 5EWFA 3GIKA 4DR5H 3PW0A 3MR5A 2W6OA 5KFLA 2ZDHA 3RIZA 2GPSA 4MV1A 4O4LF 4EGJA 4IZOA 5DG9A 1Z2PX 4IWYA 3BJYA 3V6HA 2ASLA 4J9OA 2QYZA 4AQYH 5KFZA 3U9TA 4QWEA 2VUMA 4RNNA 2GLTA 1S0MA 3DF7A 2C2DA 2V4QA 5L1KA 2SCUB 1BJTA 3H3VH 5EWGA 1ZHQA 3AYHB 5C1OA 1VBHA 4MV8A 4O3PA 2JA8G 1WH2A 2B63G 2VUMG 4Q45A 1SYXB 4TQRA 1I6UA 5BR8H 3ORQA 5DLGA 3LP8A 5LMNH 3HBLA 5KG5A 4DL7A 2C00A 3FDSA 2R87A 3BQ1A 4ECSA 1C30A 5LA6F 2JEIA 3CVZA 4C2MA 4A3BG 5L1LA 5H80A 4JV0A 3VMMA 4J9QA 4DR3H 2NU8B 5DLFA 1XNRH 5KG2A 3Q2OA 1JX4A 1JKJB 4YBZB 2XC9A 1KJIA 1KJQA 2CQYA 5FLXW 5IP9G 3GIQA 2R8JA 1I7LA 1SFOA 4LH7A 4DV0H 4A3JG 1OWTA 2PN1A 5LXTF 4JV1A 1GSOA 3WO1A 2JEFA 3G8CA 2NUAB 4MAMA 5KT2A 1FVIA 2FPPB 2V59A 2BR0A 5J2TF 1XMOH 2UUCH 1N33H 3T1YH 3PO3G 1MZBA 1B04A 1RJQA 5KFSA 4DL4A 2HVQA 1KJ9A 3PZPA 5C44G 2YL2A 4YP3A 3MR2A 4A3EG 4UCVA 2FLPA 5KG0A 5KFIA 2UU9H 1TWCA 5KFGA 2Q2UA 1PX2A 2V58A 4GC6A 2HGSA 1RK5A 2XD4A 1W96A 4F50A 1VBGA 3Q1KA 4NLGA 5BPFA 1KJJA 2UXBH 2Y0SA 2UUAH 4DV1H 3TQTA 5KT3A 3J81W 4EEYA 3IN5A 2VPSA 3GLKA 4FU0A 2R7KA 4EFBA 2Y0SE 3F8NA 1V4YA 2RDIA 3R5FA 4QIWA 2IMWP 3R5XA 4DL6A 3RBDA 4BXXG 4QIWE 4ECZA 1RK6A 3KALA 5KFYA 1EHIA 5KFVA 1GSHA 3H0GG 4YAJB 3RAQA 3TIIA 4EEQA 1IOWA 1SEIA 4I50F 4UFZA 1DV2A 1I50A 4YR0A 3L4JA 4ECQA 2R85A 4EBCA 4DV4H 5FPRA 1R9TA 2W6ZA 5LOVF 2YZNA 4RZRA 4RAYA 4ZOLF 4RU9A 2BQRA 1N32H 2FB9A 2R7MA 2W6MA 4R7RA 3G6YA 4ZQIA 2C22A 3T5LA 2HVRA 5J2UF 4O4IF 1RJRA 3OHBA 1WCMA 3Q8SB 5L1IA 1P8LA 1N48A 1AN7A 2QK4A 2C2RA 5KG7A 1M7JA 1Y1VG 5GONF 3HOVG 2RGRA 3KAKA 2PMZA 1N36H 2KSWA 3HKZE 2J6UA 2XGQA 4EBDA 4LF4H 3V6KA 3OUZA 5IYBG 3T1HH 2PMZE 2AGQA 5KFRA 1EYZA 2W8KA 2OLSA 5KFWA 5C1PA 1E4EA 3FKIA 4J9PA 2ZDGA 4IR1A 5KFKA 5KKNB 2HVSA 1PK8A 3GV5B 3U9SA 2JA5A 2X0SA 4QWDA 3GIJA 4DV7H 4MV7A 3Q8QB 3RTXA 5KFNA 4YR3A 5L1JA 4DV6H 3K5HA 3NGDA 3RBEA 2FK1A 4O3SA 4YJ2F 1XMQH 2R6FA 2IA6A 4LF9H 4JI2H 3JZIA 1RJPA 5IYDG 5C4XG 4A2AA 3HOWG 3MJFA 5EOYA 4JUZA 5DG7A 1KJ8A 3GIMA 4RB3C 3T5HA 4ME6A 2JA6A 2WAQA 3FMAA 4QJFA 2HJWA 5KFAA 4X64H 4KHPH 2B63A 1CS0A 2WAQE 3TIGA 4DUYH 1A0IA 4LMYA 5IYZF 3R23A 4ECUA 4LF8H 3RV4A 3KHRA 3Q8PB 4GC7A 4YJ3F 4Q44A 2R92A 2JA6G 1S10A 3N8DA 2VA2A 1C3OA 1V51A 4J9NA 3M4IA 1EUDB 2VR1A 1UC9A 1DV1A 1K1SA 1N34H 2FE3A 3PR4A 3VPDA 2YS7A 3MWEA 2AGOA 4X66H 4ETSA 3H40A 4X62H 4FS2A 3GQCA 4IWXA 3KXYT 2R92G 2NVYA 2ATLA 2W9BA 2R8IA 4IHJF 1FJGH 1TWAA 5F9NA 4YB8B 1Z2NX 1J5EH 4DUZH 2W71A 5IWAH 4A3IG 4A3FG 4TUYF 1WR2A 3OUUA 5D1OB 2ASJA 1Y1WA 1M6VA 4ED8A 1V9PA 3GTGA 3M9OB 3GILA 2C2EA 3T5JA 4ZHQF 5D1PA 4MA5A 4O3QA 3H20A 5DQIA 4ECXA 4QW9A 5DQHA 3LMLA 5KFUA 3RB4A 3HOZG 4Y8VB 1KC7A 2FMAA 3GV8B 5KFCA 2BQUA 4LF6H 1TWFA 4JI1H 2PVPA 4UCSA 3L2PA 3EPIA 4F4YA 5EZYF 5DGBA 1Y1WG 1K83A 1Z2OX 5KG4A 5BPHA 1AUXA 1JDBB 5EDWA 3I12A 4HNUA 4DV2H 2DLNA 4XYLB 2R84A 2WYOA 3RB6A 1VKZA 2ALZA 2WDTA 4DR7H 3BA9A 1I94H 2ZJTA 3N40P 4Q8FA 3H0GA 3M9MB 4WBNF 3RGXA 5KFTA 5IYCG 1S97A 1ZETA 4BY7G 2FPIB 3G6VA 1AUVA 5C3EG 2FKLA 2YCHA 3V6JA 5FD5A 4R8UB 1I7NA 2W8LA 2NU6B 2WTFA 4G3IA 4JI0H 1HNXH 2VUGA 1Y14B 2XCLA 4U7CA 4J9SA 4C5AA 3VPCA 3PN1A 2ZM6H 1EZ1A 5DQGA 1JXLA 1S68A 2AQ4A 3N42B 3GV7B 5LP6F 3PW4A 4JI6H 4A3KG 5CA0F 4EGQA 4ECTA 3MWMA 4JYAH 1JDEA 1Y1VA 3MR6A 4ED7A 3T5KA 3MWDA 2C28A 3MR3A 2J6SA 1HNWH 4J9RA 2UXDH 2R7NA 4EYHB 1KEEA 2OH2A 2AGPA 2YRWA 3N43B 3K3VA 5KG1A 1BNCA 2RF4A 2R8GA 5K2MA 1GSAA 5CB4F 4ED6A 1IOVA 1CE8A 5L9XA 4HNTA 2UVWA 3HKZA 4AYBA 4IR9A 4A3MG 5FPOA 1RYSA 4I55F 2R8HA 1TAEA 3RF2A 1IBKH 4O3OA 4AYBE 1B33N 4LSAA 2YZGA 4BY1G 5FD6A 5F9LA 5FJ8G 4EYIB 2E2IA 4YQWA 4QW8A 4DL5A 3R5HA 4O2AF 5IP7G 4LH6A 4UCUA 4O3NA 3UFXB 3MFHA 2V4RA 4LF7H 3ETJA 3OHAA 4APMA 3OTOH 2W9CB 3PR5B 1I3QA 3Q8RB 4MV9A 4GLXA 2YS6A 3GTOA 1M0WA 1DIKA 4HR7A 4J9KA 3N41B 4J9MA 4Q0YA 3BA8A 1N56A 4JI4H 3K5IA 4IRDA 4L1KA 3BABA 3ETHA 2NU9B 4E4TA 2IBKA 4K0KH 4XYMB 2JEGA 3J80W 3KAJA 1ZHSA 2UVUA 4DV5H 2ASDA 4BBSG 4FBTA 3RB0A 3KHHA 4HQ6A 5LYJF 3N6XA 1FKAH 3EPGA 1IBMH 4Q8EA 4ZI7F 4F4XA 3HB9A 5KT4A 2FLNA 2R7LA 4MV6A 3TINA 5JVDF 4F4WA 1RYRA 2J6TA 1TA8A 5JQWA 5KFJA 4PWQA 2UXCH 4UCTA 1UC8A 1W93A 4B3MH 5LL6b 4O3RA 2DIKA 3V4SA 2NVXA 3PW2A 4YAKB 1O75A 1VAJA 4DV3H 3OSPA 2YU9A 2RDJA 4LF5H 2CW7A 2F4VH 4TV9F 2WB1A 3PW7A 2R93A 2ZDQA 4RNMA 3SI8A 2J9GA 4QWBA 5C5JA 2WB1E 4UCRA 4DL2A 5KG6A 2W9CA 1XDNA 5I47A 2W70A 3OSNA 1IBLH 3GTPA 3J7AK 3BG5A 2E2HA 3RV3A 3L4KA 4EBEA 5KG3A 3N44B 2FK2A 4FM9A 4A3GG 4O2BF 2PBZA 5CAEB 4HNVA 2OWOA 2R93G 5T14A 4YR2A 2W7OA 2W57A 3C0FB 5FLMG 4O4HF 1BXRA 1T36A 3WNZA
chains in the Genus database with same CATH topology
3RGZA 2YCHA 4LFAH 1P8LA 2O03A 4BWSC 3RJ0A 1AN7A 4DR1H 5FD5A 4JI5H 4JV5H 2VOBA 2XIGA 1HR0H 2RGRA 4JI0H 3KAKA 2VUGA 4RB0A 1HNXH 1N36H 1VS0A 2KSWA 4B3RH 3EYYA 4RAZA 4J0MA 4LF4H 3JAMW 3T1HH 4DR5H 4YY3H 3PN1A 1BGWA 2ZM6H 2Q2TA 1S68A 3N42B 3RIZA 1Z2PX 1X9NA 4A2BA 1HNZH 4AQYH 2MCTA 4X65H 4JI6H 2WE6A 3MWMA 2HVSA 4JYAH 3DF7A 1M0TA 4DV7H 4MV7A 1HNWH 3RTXA 1BJTA 4GKKH 2UXDH 4DR2H 3N43B 3K3VA 1ZHQA 4DV6H 4NXNH 1WH2A 1XMQH 1I6UA 1SYXB 4LF9H 5BR8H 4JI2H 4JI7H 1IBKH 5FPOA 5LMNH 1TAEA 3RF2A 5IT9W 4RB1A 4DR4H 4LSAA 4A2AA 2VQEH 4MTEA 5EOYA 3CVZA 5FD6A 4RB3C 4LH6A 4UCUA 3FMAA 4M7EA 4LF7H 4KHPH 3JSNA 4X64H 4APMA 4DR3H 1XNRH 5D1OA 3OTOH 4RZQA 4CC5A 4DUYH 3IG0A 1A0IA 3HXLA 4LMYA 5FLXW 1E4GT 4YHHH 4MV9A 4GLXA 4LF8H 4LH7A 4DV0H 1M0WA 4MTDA 3N41B 4Q0YA 3BA8A 4JI4H 3BABA 4EFEA 4LFBH 4K0KH 4RB2C 3M4IA 1N34H 3J80W 4I7HA 3KAJA 2FE3A 1ZHSA 1XMOH 1FVIA 4UCOA 4DV5H 2UUCH 2VQFH 4JI8H 1N33H 3T1YH 1MZBA 1XNQH 4X66H 3N6XA 1B04A 4ETSA 1FKAH 4X62H 2HVQA 1IBMH 2UUAH 2UUBH 4PDBA 3KXYT 4UCVA 4B3SH 2UU9H 2Q2UA 2E5LH 4JI3H 1FJGH 1Z2NX 2HGSA 4DUZH 1J5EH 1TA8A 1E4FT 1DGSA 4GKJH 5IWAH 2UXCH 4UCTA 2UXBH 4DV1H 3J81W 5D1OB 2VPSA 4EFBA 2CW8A 5LL6b 4B3MH 3F8NA 1V9PA 4NXMH 1L2ZA 2RGVA 5LMUH 1O75A 4LSXA 3KALA 5D1PA 4DV3H 4LF5H 3H20A 2F4VH 2CW7A 4DR6H 3JSLA 3LMLA 4LF6H 4EEQA 1SEIA 4UFZA 3BAAA 3L4JA 4UCRA 4JI1H 1S03G 4UCSA 4CC6A 3L2PA 1XDNA 4B3TH 4DV4H 1Z2OX 5FPRA 1IBLH 2HHHH 3J7AK 4RAYA 3L4KA 4DV2H 1N32H 1GYFA 3N44B 4FM9A 2WYOA 4R7RA 2OWOA 2WDTA 4OX9H 3UQ8A 4DR7H 3BA9A 4LFCH 1I94H 2ZJTA 3N40P 2W57A 3C0FB 5A2QW 3RGXA 2HVRA 4IAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0Y A; 
#chains in the Genus database with same CATH topology
 2XGP A;  2UVV A;  4C5C A;  4LFA H;  2O03 A;  3QFF A;  5KFB A;  4JI5 H;  3VPB A;  3I4N G;  2VOB A;  4WD3 A;  2XCA A;  4XZ3 B;  3BQ0 A;  1VS0 A;  2YRX A;  5D8D A;  1JIH A;  4JV2 A;  4J0M A;  2IP4 A;  5DG8 A;  1A9X A;  3E5N A;  1BGW A;  2Q2T A;  3KHL A;  1UNN C;  4HYK A;  1CQJ B;  2W6P A;  4EG0 A;  1X9N A;  2CKZ B;  4ECV A;  4A2B A;  1HNZ H;  4IRK A;  2NU7 B;  4A3L G;  2FJZ A;  1TWH A;  2MCT A;  2VPQ A;  2R86 A;  4X65 H;  2WE6 A;  3V4Z A;  1WSC A;  5DGA A;  5KFQ A;  3HOY G;  3K3P A;  3JRW A;  2W7P A;  1M0T A;  2V9W A;  3KTM A;  3GTJ A;  4ED1 A;  4GKK H;  2VQD A;  5CA1 F;  3RB3 A;  1GGO A;  4DR2 H;  4ED3 A;  3ORR A;  4TV8 F;  2R7Z A;  4NXN H;  4JI7 H;  4ECR A;  2V5A A;  1ZQ7 A;  5IT9 W;  4RB1 A;  5C8Y F;  3SE7 A;  2AU0 A;  4DR4 H;  2FK3 A;  2VQE H;  2DZD A;  4MTE A;  5JH7 F;  2R7Z G;  2CZG A;  4C5B A;  1K1Q A;  3PVX A;  4M7E A;  1B6S A;  3JSN A;  5EWE A;  3QZ8 A;  5D1O A;  4RZQ A;  4CC5 A;  3KHG A;  4XX0 B;  1E4E B;  3IG0 A;  3H4B A;  3HXL A;  4QWA A;  2DWC A;  4QWC A;  1E4G T;  5KFP A;  4YHH H;  5KT7 A;  4MTD A;  4ED0 A;  1GLV A;  2YW2 A;  5JVL A;  4RUC A;  3PW5 A;  5KT5 A;  5KFE A;  2W9A A;  2DPJ A;  1GO3 E;  2XCP A;  4EFE A;  4LFB H;  4A3C G;  4MV4 A;  4RB2 C;  3G6X A;  3GII A;  2W6N A;  4I7H A;  4U6P A;  2C35 B;  5HBR B;  4UCO A;  5KT6 A;  4JI8 H;  4TQS A;  2VQF H;  2R82 A;  2BQ3 A;  1S0N A;  2VA3 A;  2FLL A;  4FBU A;  1XNQ H;  3GTM A;  3RFC A;  1TWG A;  4RNO A;  4FS1 A;  4PDB A;  4A93 G;  2UUB H;  1S0O A;  1ULZ A;  2DPI A;  4B3S H;  2YZM A;  2E5L H;  1JLL B;  5KFM A;  2GPW A;  3MFI A;  2YYA A;  3WO0 A;  3RAX A;  4JI3 H;  3GTQ A;  1T94 A;  1E4F T;  1DGS A;  4DL3 A;  2W6Q A;  2M05 A;  4R8U A;  2P0A A;  5KFX A;  3HOX G;  3CQZ A;  4GKJ H;  3PO2 G;  5HV6 A;  2JA7 A;  4F4Z A;  4IRC A;  1CQI B;  2CW8 A;  3GTK A;  2I87 A;  4NXM H;  1L2Z A;  3JRX A;  5KX5 F;  2RGV A;  4MA0 A;  5LMU H;  1S9F A;  1B6R A;  3RUP A;  4LSX A;  3GTL A;  4DR6 H;  2I80 A;  3JSL A;  1EUC B;  3BAA A;  4I4T F;  1WCM G;  4M9U A;  3QZ7 A;  2JA7 G;  1S03 G;  4CC6 A;  5KFO A;  4B3T H;  3M9N B;  1KBL A;  2HHH H;  4A3D G;  5KFD A;  3GID A;  3LWB A;  4ED2 A;  1GYF A;  2UVR A;  4ECY A;  2I8C A;  2FPG B;  3UQ8 A;  4OX9 H;  5KFH A;  5KFF A;  4LFC H;  3H4D A;  3HOU G;  3I4M G;  2JEJ A;  5A2Q W;  5JUM A;  2W9B B;  4IAJ A;  2R8K A;  4MV3 A;  4DLK A;  3FKI G;  5BMV F;  3RGZ A;  3TQ1 A;  4BWS C;  4RUA A;  3RJ0 A;  4DR1 H;  3BQ2 A;  4ECW A;  4JV5 H;  2FP4 B;  2XIG A;  1HR0 H;  1T3N A;  4J9L A;  2JA5 G;  4RB0 A;  4Q43 A;  4BBR G;  4B3R H;  3EYY A;  4RAZ A;  1SCU B;  3GIP A;  3JAM W;  4YY3 H;  5EWF A;  3GIK A;  4DR5 H;  3PW0 A;  3MR5 A;  2W6O A;  5KFL A;  2ZDH A;  3RIZ A;  2GPS A;  4MV1 A;  4O4L F;  4EGJ A;  4IZO A;  5DG9 A;  1Z2P X;  4IWY A;  3BJY A;  3V6H A;  2ASL A;  4J9O A;  2QYZ A;  4AQY H;  5KFZ A;  3U9T A;  4QWE A;  2VUM A;  4RNN A;  2GLT A;  1S0M A;  3DF7 A;  2C2D A;  2V4Q A;  5L1K A;  2SCU B;  1BJT A;  3H3V H;  5EWG A;  1ZHQ A;  3AYH B;  5C1O A;  1VBH A;  4MV8 A;  4O3P A;  2JA8 G;  1WH2 A;  2B63 G;  2VUM G;  4Q45 A;  1SYX B;  4TQR A;  1I6U A;  5BR8 H;  3ORQ A;  5DLG A;  3LP8 A;  5LMN H;  3HBL A;  5KG5 A;  4DL7 A;  2C00 A;  3FDS A;  2R87 A;  3BQ1 A;  4ECS A;  1C30 A;  5LA6 F;  2JEI A;  3CVZ A;  4C2M A;  4A3B G;  5L1L A;  5H80 A;  4JV0 A;  3VMM A;  4J9Q A;  4DR3 H;  2NU8 B;  5DLF A;  1XNR H;  5KG2 A;  3Q2O A;  1JX4 A;  1JKJ B;  4YBZ B;  2XC9 A;  1KJI A;  1KJQ A;  2CQY A;  5FLX W;  5IP9 G;  3GIQ A;  2R8J A;  1I7L A;  1SFO A;  4LH7 A;  4DV0 H;  4A3J G;  1OWT A;  2PN1 A;  5LXT F;  4JV1 A;  1GSO A;  3WO1 A;  2JEF A;  3G8C A;  2NUA B;  4MAM A;  5KT2 A;  1FVI A;  2FPP B;  2V59 A;  2BR0 A;  5J2T F;  1XMO H;  2UUC H;  1N33 H;  3T1Y H;  3PO3 G;  1MZB A;  1B04 A;  1RJQ A;  5KFS A;  4DL4 A;  2HVQ A;  1KJ9 A;  3PZP A;  5C44 G;  2YL2 A;  4YP3 A;  3MR2 A;  4A3E G;  4UCV A;  2FLP A;  5KG0 A;  5KFI A;  2UU9 H;  1TWC A;  5KFG A;  2Q2U A;  1PX2 A;  2V58 A;  4GC6 A;  2HGS A;  1RK5 A;  2XD4 A;  1W96 A;  4F50 A;  1VBG A;  3Q1K A;  4NLG A;  5BPF A;  1KJJ A;  2UXB H;  2Y0S A;  2UUA H;  4DV1 H;  3TQT A;  5KT3 A;  3J81 W;  4EEY A;  3IN5 A;  2VPS A;  3GLK A;  4FU0 A;  2R7K A;  4EFB A;  2Y0S E;  3F8N A;  1V4Y A;  2RDI A;  3R5F A;  4QIW A;  2IMW P;  3R5X A;  4DL6 A;  3RBD A;  4BXX G;  4QIW E;  4ECZ A;  1RK6 A;  3KAL A;  5KFY A;  1EHI A;  5KFV A;  1GSH A;  3H0G G;  4YAJ B;  3RAQ A;  3TII A;  4EEQ A;  1IOW A;  1SEI A;  4I50 F;  4UFZ A;  1DV2 A;  1I50 A;  4YR0 A;  3L4J A;  4ECQ A;  2R85 A;  4EBC A;  4DV4 H;  5FPR A;  1R9T A;  2W6Z A;  5LOV F;  2YZN A;  4RZR A;  4RAY A;  4ZOL F;  4RU9 A;  2BQR A;  1N32 H;  2FB9 A;  2R7M A;  2W6M A;  4R7R A;  3G6Y A;  4ZQI A;  2C22 A;  3T5L A;  2HVR A;  5J2U F;  4O4I F;  1RJR A;  3OHB A;  1WCM A;  3Q8S B;  5L1I A;  1P8L A;  1N48 A;  1AN7 A;  2QK4 A;  2C2R A;  5KG7 A;  1M7J A;  1Y1V G;  5GON F;  3HOV G;  2RGR A;  3KAK A;  2PMZ A;  1N36 H;  2KSW A;  3HKZ E;  2J6U A;  2XGQ A;  4EBD A;  4LF4 H;  3V6K A;  3OUZ A;  5IYB G;  3T1H H;  2PMZ E;  2AGQ A;  5KFR A;  1EYZ A;  2W8K A;  2OLS A;  5KFW A;  5C1P A;  1E4E A;  3FKI A;  4J9P A;  2ZDG A;  4IR1 A;  5KFK A;  5KKN B;  2HVS A;  1PK8 A;  3GV5 B;  3U9S A;  2JA5 A;  2X0S A;  4QWD A;  3GIJ A;  4DV7 H;  4MV7 A;  3Q8Q B;  3RTX A;  5KFN A;  4YR3 A;  5L1J A;  4DV6 H;  3K5H A;  3NGD A;  3RBE A;  2FK1 A;  4O3S A;  4YJ2 F;  1XMQ H;  2R6F A;  2IA6 A;  4LF9 H;  4JI2 H;  3JZI A;  1RJP A;  5IYD G;  5C4X G;  4A2A A;  3HOW G;  3MJF A;  5EOY A;  4JUZ A;  5DG7 A;  1KJ8 A;  3GIM A;  4RB3 C;  3T5H A;  4ME6 A;  2JA6 A;  2WAQ A;  3FMA A;  4QJF A;  2HJW A;  5KFA A;  4X64 H;  4KHP H;  2B63 A;  1CS0 A;  2WAQ E;  3TIG A;  4DUY H;  1A0I A;  4LMY A;  5IYZ F;  3R23 A;  4ECU A;  4LF8 H;  3RV4 A;  3KHR A;  3Q8P B;  4GC7 A;  4YJ3 F;  4Q44 A;  2R92 A;  2JA6 G;  1S10 A;  3N8D A;  2VA2 A;  1C3O A;  1V51 A;  4J9N A;  3M4I A;  1EUD B;  2VR1 A;  1UC9 A;  1DV1 A;  1K1S A;  1N34 H;  2FE3 A;  3PR4 A;  3VPD A;  2YS7 A;  3MWE A;  2AGO A;  4X66 H;  4ETS A;  3H40 A;  4X62 H;  4FS2 A;  3GQC A;  4IWX A;  3KXY T;  2R92 G;  2NVY A;  2ATL A;  2W9B A;  2R8I A;  4IHJ F;  1FJG H;  1TWA A;  5F9N A;  4YB8 B;  1Z2N X;  1J5E H;  4DUZ H;  2W71 A;  5IWA H;  4A3I G;  4A3F G;  4TUY F;  1WR2 A;  3OUU A;  5D1O B;  2ASJ A;  1Y1W A;  1M6V A;  4ED8 A;  1V9P A;  3GTG A;  3M9O B;  3GIL A;  2C2E A;  3T5J A;  4ZHQ F;  5D1P A;  4MA5 A;  4O3Q A;  3H20 A;  5DQI A;  4ECX A;  4QW9 A;  5DQH A;  3LML A;  5KFU A;  3RB4 A;  3HOZ G;  4Y8V B;  1KC7 A;  2FMA A;  3GV8 B;  5KFC A;  2BQU A;  4LF6 H;  1TWF A;  4JI1 H;  2PVP A;  4UCS A;  3L2P A;  3EPI A;  4F4Y A;  5EZY F;  5DGB A;  1Y1W G;  1K83 A;  1Z2O X;  5KG4 A;  5BPH A;  1AUX A;  1JDB B;  5EDW A;  3I12 A;  4HNU A;  4DV2 H;  2DLN A;  4XYL B;  2R84 A;  2WYO A;  3RB6 A;  1VKZ A;  2ALZ A;  2WDT A;  4DR7 H;  3BA9 A;  1I94 H;  2ZJT A;  3N40 P;  4Q8F A;  3H0G A;  3M9M B;  4WBN F;  3RGX A;  5KFT A;  5IYC G;  1S97 A;  1ZET A;  4BY7 G;  2FPI B;  3G6V A;  1AUV A;  5C3E G;  2FKL A;  2YCH A;  3V6J A;  5FD5 A;  4R8U B;  1I7N A;  2W8L A;  2NU6 B;  2WTF A;  4G3I A;  4JI0 H;  1HNX H;  2VUG A;  1Y14 B;  2XCL A;  4U7C A;  4J9S A;  4C5A A;  3VPC A;  3PN1 A;  2ZM6 H;  1EZ1 A;  5DQG A;  1JXL A;  1S68 A;  2AQ4 A;  3N42 B;  3GV7 B;  5LP6 F;  3PW4 A;  4JI6 H;  4A3K G;  5CA0 F;  4EGQ A;  4ECT A;  3MWM A;  4JYA H;  1JDE A;  1Y1V A;  3MR6 A;  4ED7 A;  3T5K A;  3MWD A;  2C28 A;  3MR3 A;  2J6S A;  1HNW H;  4J9R A;  2UXD H;  2R7N A;  4EYH B;  1KEE A;  2OH2 A;  2AGP A;  2YRW A;  3N43 B;  3K3V A;  5KG1 A;  1BNC A;  2RF4 A;  2R8G A;  5K2M A;  1GSA A;  5CB4 F;  4ED6 A;  1IOV A;  1CE8 A;  5L9X A;  4HNT A;  2UVW A;  3HKZ A;  4AYB A;  4IR9 A;  4A3M G;  5FPO A;  1RYS A;  4I55 F;  2R8H A;  1TAE A;  3RF2 A;  1IBK H;  4O3O A;  4AYB E;  1B33 N;  4LSA A;  2YZG A;  4BY1 G;  5FD6 A;  5F9L A;  5FJ8 G;  4EYI B;  2E2I A;  4YQW A;  4QW8 A;  4DL5 A;  3R5H A;  4O2A F;  5IP7 G;  4LH6 A;  4UCU A;  4O3N A;  3UFX B;  3MFH A;  2V4R A;  4LF7 H;  3ETJ A;  3OHA A;  4APM A;  3OTO H;  2W9C B;  3PR5 B;  1I3Q A;  3Q8R B;  4MV9 A;  4GLX A;  2YS6 A;  3GTO A;  1M0W A;  1DIK A;  4HR7 A;  4J9K A;  3N41 B;  4J9M A;  4Q0Y A;  3BA8 A;  1N56 A;  4JI4 H;  3K5I A;  4IRD A;  4L1K A;  3BAB A;  3ETH A;  2NU9 B;  4E4T A;  2IBK A;  4K0K H;  4XYM B;  2JEG A;  3J80 W;  3KAJ A;  1ZHS A;  2UVU A;  4DV5 H;  2ASD A;  4BBS G;  4FBT A;  3RB0 A;  3KHH A;  4HQ6 A;  5LYJ F;  3N6X A;  1FKA H;  3EPG A;  1IBM H;  4Q8E A;  4ZI7 F;  4F4X A;  3HB9 A;  5KT4 A;  2FLN A;  2R7L A;  4MV6 A;  3TIN A;  5JVD F;  4F4W A;  1RYR A;  2J6T A;  1TA8 A;  5JQW A;  5KFJ A;  4PWQ A;  2UXC H;  4UCT A;  1UC8 A;  1W93 A;  4B3M H;  5LL6 b;  4O3R A;  2DIK A;  3V4S A;  2NVX A;  3PW2 A;  4YAK B;  1O75 A;  1VAJ A;  4DV3 H;  3OSP A;  2YU9 A;  2RDJ A;  4LF5 H;  2CW7 A;  2F4V H;  4TV9 F;  2WB1 A;  3PW7 A;  2R93 A;  2ZDQ A;  4RNM A;  3SI8 A;  2J9G A;  4QWB A;  5C5J A;  2WB1 E;  4UCR A;  4DL2 A;  5KG6 A;  2W9C A;  1XDN A;  5I47 A;  2W70 A;  3OSN A;  1IBL H;  3GTP A;  3J7A K;  3BG5 A;  2E2H A;  3RV3 A;  3L4K A;  4EBE A;  5KG3 A;  3N44 B;  2FK2 A;  4FM9 A;  4A3G G;  4O2B F;  2PBZ A;  5CAE B;  4HNV A;  2OWO A;  2R93 G;  5T14 A;  4YR2 A;  2W7O A;  2W57 A;  3C0F B;  5FLM G;  4O4H F;  1BXR A;  1T36 A;  3WNZ A; 
#chains in the Genus database with same CATH homology
 3RGZ A;  2YCH A;  4LFA H;  1P8L A;  2O03 A;  4BWS C;  3RJ0 A;  1AN7 A;  4DR1 H;  5FD5 A;  4JI5 H;  4JV5 H;  2VOB A;  2XIG A;  1HR0 H;  2RGR A;  4JI0 H;  3KAK A;  2VUG A;  4RB0 A;  1HNX H;  1N36 H;  1VS0 A;  2KSW A;  4B3R H;  3EYY A;  4RAZ A;  4J0M A;  4LF4 H;  3JAM W;  3T1H H;  4DR5 H;  4YY3 H;  3PN1 A;  1BGW A;  2ZM6 H;  2Q2T A;  1S68 A;  3N42 B;  3RIZ A;  1Z2P X;  1X9N A;  4A2B A;  1HNZ H;  4AQY H;  2MCT A;  4X65 H;  4JI6 H;  2WE6 A;  3MWM A;  2HVS A;  4JYA H;  3DF7 A;  1M0T A;  4DV7 H;  4MV7 A;  1HNW H;  3RTX A;  1BJT A;  4GKK H;  2UXD H;  4DR2 H;  3N43 B;  3K3V A;  1ZHQ A;  4DV6 H;  4NXN H;  1WH2 A;  1XMQ H;  1I6U A;  1SYX B;  4LF9 H;  5BR8 H;  4JI2 H;  4JI7 H;  1IBK H;  5FPO A;  5LMN H;  1TAE A;  3RF2 A;  5IT9 W;  4RB1 A;  4DR4 H;  4LSA A;  4A2A A;  2VQE H;  4MTE A;  5EOY A;  3CVZ A;  5FD6 A;  4RB3 C;  4LH6 A;  4UCU A;  3FMA A;  4M7E A;  4LF7 H;  4KHP H;  3JSN A;  4X64 H;  4APM A;  4DR3 H;  1XNR H;  5D1O A;  3OTO H;  4RZQ A;  4CC5 A;  4DUY H;  3IG0 A;  1A0I A;  3HXL A;  4LMY A;  5FLX W;  1E4G T;  4YHH H;  4MV9 A;  4GLX A;  4LF8 H;  4LH7 A;  4DV0 H;  1M0W A;  4MTD A;  3N41 B;  4Q0Y A;  3BA8 A;  4JI4 H;  3BAB A;  4EFE A;  4LFB H;  4K0K H;  4RB2 C;  3M4I A;  1N34 H;  3J80 W;  4I7H A;  3KAJ A;  2FE3 A;  1ZHS A;  1XMO H;  1FVI A;  4UCO A;  4DV5 H;  2UUC H;  2VQF H;  4JI8 H;  1N33 H;  3T1Y H;  1MZB A;  1XNQ H;  4X66 H;  3N6X A;  1B04 A;  4ETS A;  1FKA H;  4X62 H;  2HVQ A;  1IBM H;  2UUA H;  2UUB H;  4PDB A;  3KXY T;  4UCV A;  4B3S H;  2UU9 H;  2Q2U A;  2E5L H;  4JI3 H;  1FJG H;  1Z2N X;  2HGS A;  4DUZ H;  1J5E H;  1TA8 A;  1E4F T;  1DGS A;  4GKJ H;  5IWA H;  2UXC H;  4UCT A;  2UXB H;  4DV1 H;  3J81 W;  5D1O B;  2VPS A;  4EFB A;  2CW8 A;  5LL6 b;  4B3M H;  3F8N A;  1V9P A;  4NXM H;  1L2Z A;  2RGV A;  5LMU H;  1O75 A;  4LSX A;  3KAL A;  5D1P A;  4DV3 H;  4LF5 H;  3H20 A;  2F4V H;  2CW7 A;  4DR6 H;  3JSL A;  3LML A;  4LF6 H;  4EEQ A;  1SEI A;  4UFZ A;  3BAA A;  3L4J A;  4UCR A;  4JI1 H;  1S03 G;  4UCS A;  4CC6 A;  3L2P A;  1XDN A;  4B3T H;  4DV4 H;  1Z2O X;  5FPR A;  1IBL H;  2HHH H;  3J7A K;  4RAY A;  3L4K A;  4DV2 H;  1N32 H;  1GYF A;  3N44 B;  4FM9 A;  2WYO A;  4R7R A;  2OWO A;  2WDT A;  4OX9 H;  3UQ8 A;  4DR7 H;  3BA9 A;  4LFC H;  1I94 H;  2ZJT A;  3N40 P;  2W57 A;  3C0F B;  5A2Q W;  3RGX A;  2HVR A;  4IAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...