4Q0YA

Crystal structure of a thioesterase-like protein (clospo_01618) from clostridium sporogenes atcc 15579 at 1.70 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
b'GRMEISSLSSIDVFKFNSFSKFSNDKIGVIYDEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYFLLYILVGDSEGKSYIIFSGTELSYVLDKNNTNILKEIFLNVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (CLOSPO_01618) from Clostridium sporogenes ATCC 15579 at 1.70 A resolution
rcsb
source organism Clostridium sporogenes
molecule tags Structural genomics, unknown function
total genus 31
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.400 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4q0yA00
4Q0YA
chains in the Genus database with same CATH superfamily
3U9TA 4YR3A 1DV1A 4RB1A 5DG7A 4UCUA 4A2AA 5DG8A 2WE6A 3MJFA 4LSXA 1W93A 5KFJA 4DUYH 5KFQA 4A3FG 4YY3H 4J9MA 4A3CG 2R7MA 3GLKA 4DV7H 3OSPA 2R6FA 3PZPA 5JQWA 4UCRA 1T36A 3ETHA 3KHGA 3OSNA 3L2PA 3I12A 2FPGB 4HQ6A 3K3PA 4IAJA 4R7RA 3GIJA 4OX9H 3OHBA 5DGBA 1S0MA 1JLLB 2NUAB 2GLTA 1RJPA 4O2AF 2W8KA 4F4YA 1BGWA 4RAYA 5KFCA 4UFZA 4HNTA 3Q8PB 3G6XA 3HB9A 4WBNF 4JI2H 1ZHSA 5IYCG 4F4XA 2UUCH 1DV2A 2PN1A 1UC8A 1EUDB 2NU6B 3V6KA 4KHPH 5L1IA 2CZGA 5LOVF 4YQWA 4FS2A 1TWHA 4M7EA 3HOXG 1JKJB 3E5NA 3V4SA 5DQHA 4U7CA 1TA8A 3BA9A 4MA5A 4EEYA 5D1OB 1JXLA 3Q8RB 4RU9A 4DV6H 1S97A 1W96A 2HVQA 2VUGA 3OUUA 5KFNA 1I94H 4ZQIA 5KG2A 1E4EB 5KFUA 4X65H 3GV5B 4F50A 3I4MG 1PK8A 3RBEA 4F4WA 2RF4A 5JUMA 5KFHA 3WO0A 4HNVA 3Q2OA 3M9NB 3U9SA 5HV6A 4DV4H 1S0NA 2R93A 2WTFA 2E2HA 2C2RA 3GILA 4ED8A 4ECYA 2PBZA 5IYZF 3MR3A 4LMYA 2JA7A 4X62H 1S68A 3MWMA 1DIKA 4MV1A 4I55F 3J80W 2UXCH 2CKZB 1O75A 2XC9A 1N56A 2JA7G 5L1KA 1AN7A 5D1PA 1K83A 3BQ2A 4LF6H 2R92A 4DR1H 3H4DA 4JI5H 5C3EG 1RK6A 2UVWA 4DR6H 1A9XA 4Y8VB 4JI6H 2M05A 4LF9H 2DLNA 2C22A 2FP4B 2R92G 2C00A 5LA6F 2OH2A 3PO3G 4J9RA 4JV1A 4FM9A 4A3DG 4MTEA 5KG0A 2JEIA 2FK2A 2ZDQA 4J9NA 2E2IA 4MV7A 4GKJH 5F9LA 5JVDF 2RDJA 5KFWA 5EWEA 2BR0A 5CA0F 4GC6A 1X9NA 1SYXB 4RNNA 1BJTA 2ALZA 4NLGA 4JV0A 3T5KA 3RIZA 2UXBH 4DV2H 1KJ8A 3T5HA 1B04A 5KT4A 3N6XA 4IZOA 1DGSA 3LWBA 5KFIA 2IBKA 2GPSA 4IRDA 1GLVA 2R7LA 3PW5A 2C28A 3GIQA 3VPDA 5FLMG 2W8LA 2JA5A 1V9PA 1XNQH 5LYJF 4A3BG 4DR7H 4LH7A 4LFCH 3RUPA 4QWEA 2W6OA 4EEQA 5L1LA 2FPPB 5J2TF 4L1KA 4QW8A 2V4RA 2FK3A 1JDEA 4I7HA 4YAJB 4DV3H 5DQIA 3HKZE 2IMWP 1CE8A 2CW7A 3VMMA 3V6JA 1FVIA 4J9LA 2QYZA 4JI8H 1J5EH 4ECSA 2W6MA 3GIKA 1VAJA 1K1SA 4XYMB 3VPBA 1IOWA 4J9OA 4BY1G 5BPHA 5KFVA 3KAJA 3JSLA 4C5CA 4FBUA 4PWQA 1Y1VA 5CB4F 1N36H 4ME6A 4BWSC 4RNMA 4DL4A 2UUAH 2RGRA 3HOWG 4LFBH 4BBSG 3KALA 5KFAA 2VPSA 1B6SA 4RNOA 2DPJA 4B3MH 3H3VH 3H40A 4EYHB 2VA2A 5KG4A 4A93G 2UU9H 2V59A 4A2BA 4B3RH 4C5AA 1SCUB 1KBLA 3FDSA 3RAQA 5EOYA 1RK5A 4TV8F 3OUZA 4EBDA 4DL2A 2W71A 4CC5A 2E5LH 1S0OA 2KSWA 3TIIA 4WD3A 5FD5A 5FD6A 5LP6F 4EBEA 5EWFA 3NGDA 5D1OA 3RB0A 4NXMH 5C4XG 1TAEA 4U6PA 3MR2A 5KFTA 3FKIG 3L4JA 2W6ZA 3EPGA 1E4EA 2R84A 4RB3C 3MFHA 3GTGA 1ZQ7A 2RGVA 3N42B 4TQSA 3HBLA 4DL5A 3BG5A 5LMUH 2YZMA 3HKZA 2C2DA 2AGQA 5C1OA 2YRWA 3RGXA 1E4GT 1L2ZA 1AUXA 3T5LA 5KFRA 2JA6G 2FLNA 2WB1E 2X0SA 4QJFA 1B6RA 3RBDA 5BR8H 2XD4A 4J9KA 3R5HA 5KT2A 5IWAH 3KXYT 3PR5B 2AGOA 1HR0H 4JV5H 1N34H 1GGOA 4O2BF 2UXDH 2O03A 4A3EG 1K1QA 4HR7A 3BQ0A 5KFGA 4BBRG 2PMZA 4J9QA 2DPIA 2DIKA 3H0GG 3JAMW 2V4QA 3GTQA 2CW8A 5DLFA 1SEIA 2YL2A 4DL3A 3GTKA 3Q1KA 4EFBA 5KFDA 2C35B 2WYOA 3GTMA 4QWDA 4I50F 4R8UB 4ZI7F 4HNUA 3I4NG 4ECXA 5IP7G 4YAKB 4NXNH 2VQFH 4Q44A 3IN5A 1M0WA 2Y0SE 4JYAH 3TQTA 4ZHQF 1HNZH 3N43B 3Q8QB 4CC6A 4O3QA 1VBGA 2JA8G 2V5AA 1BXRA 4IHJF 5BMVF 3N44B 3WNZA 4DR5H 4ECRA 4IRCA 3M9MB 4MAMA 1XDNA 3R5XA 4APMA 2R7ZG 3RB4A 1V51A 4O3PA 3RJ0A 3G6YA 5KFLA 4DR4H 5K2MA 4A3LG 3VPCA 2W7OA 4B3SH 2WB1A 1R9TA 3J7AK 4DUZH 1JX4A 3M9OB 3T5JA 1GSAA 1B33N 5DLGA 4G3IA 1FJGH 4UCSA 1ULZA 3GIPA 2WAQE 5KT5A 3BABA 4ED0A 3RV3A 3HOVG 5KT3A 3H20A 2R86A 4MTDA 2R8JA 1TWCA 1HNXH 5KG1A 1A0IA 2V58A 1C30A 3KAKA 3G8CA 1I50A 1TWAA 3N41B 1KJQA 1CQJB 1I7LA 5CAEB 2W9BB 2BQUA 1IBLH 5IYBG 4X66H 4IR1A 3M4IA 5FPOA 5EZYF 2W9AA 5LL6b 3J81W 2BQ3A 3GTOA 2B63A 4A3IG 3MFIA 3JRXA 5KT7A 1TWFA 1UC9A 3SE7A 2I80A 1GYFA 2B63G 5IT9W 2ASLA 1PX2A 1Z2PX 2J6TA 2HJWA 3WO1A 4ED1A 2Y0SA 4RZQA 5FJ8G 3HOZG 4J9PA 4Q8FA 3GIMA 1CQIB 4JI0H 3PW4A 5CA1F 4EBCA 5KKNB 4UCVA 4O3RA 1KJIA 2C2EA 2YS6A 4QIWE 5H80A 4IWYA 3BQ1A 4PDBA 2VQDA 3OTOH 2BQRA 2W6QA 5KFSA 2OWOA 4MV8A 2NU8B 2R8IA 3K5IA 4EGJA 2FE3A 2YYAA 2XCAA 5FPRA 5KG5A 3HXLA 4RAZA 2NU7B 4F4ZA 2R8HA 3MWDA 4ECUA 3GIIA 4QW9A 1Y14B 1MZBA 2HVRA 2PVPA 1S9FA 2HVSA 5KFBA 2FLLA 4A3MG 3KHRA 2FKLA 2ZDHA 4MV9A 4C2MA 3TQ1A 4EG0A 2W9CB 2VUMA 4ECTA 2YRXA 2XGPA 3QZ7A 4LF4H 1EZ1A 2VR1A 2OLSA 1KJJA 2FB9A 2VUMG 5KFFA 1SFOA 1GSOA 4EGQA 1M6VA 2YCHA 3GTPA 5LMNH 3FKIA 4HYKA 5EDWA 4Q43A 4LF7H 1XNRH 4YBZB 2JEFA 3GTJA 1EHIA 2UUBH 3LP8A 2NVYA 1RYSA 4A3KG 4XYLB 3Q8SB 5I47A 1IOVA 4QWAA 4O4HF 3JRWA 4MV6A 3MR6A 3L4KA 2P0AA 4R8UA 3CQZA 2JA6A 2FLPA 3LMLA 5J2UF 1WCMG 4DR3H 1I7NA 4JI1H 5EWGA 1WR2A 3KHHA 3IG0A 5D8DA 2XGQA 3PW2A 3R23A 1Z2OX 5C8YF 4DL6A 3MWEA 4A3GG 4O3NA 4E4TA 1BNCA 3GQCA 4JV2A 3K3VA 2Q2TA 5DQGA 2DWCA 2FMAA 5KFPA 3RFCA 3H0GA 3GV8B 5KFZA 1ZETA 3PW0A 1M0TA 4I4TF 4MA0A 4QIWA 4RZRA 4LSAA 4DV0H 2J6SA 4EYIB 4X64H 3GV7B 4IWXA 3OHAA 2ASDA 4IR9A 2W7PA 1XMQH 4FU0A 2R87A 1VS0A 5IP9G 1P8LA 2JEGA 2HHHH 4RUAA 1JDBB 2W57A 2XCPA 4AYBE 3KHLA 3GTLA 5C5JA 3RB6A 3TIGA 2Q2UA 3KTMA 4LH6A 5KG3A 3G6VA 4AQYH 5F9NA 1FKAH 3ETJA 3BJYA 3QFFA 4QWCA 2W9BA 1WSCA 5JVLA 3H4BA 3R5FA 4ED2A 4TUYF 1KEEA 3N40P 3RGZA 5L9XA 4DLKA 4DL7A 4LF8H 5KFOA 3SI8A 2R82A 1RJRA 2MCTA 3AYHB 2W70A 2W6NA 1VBHA 4YR0A 4BXXG 2VA3A 2YW2A 2R7ZA 3ORQA 4MV3A 4ED7A 1JIHA 5T14A 4UCOA 1WH2A 3BAAA 5KG7A 2J6UA 3EPIA 4LF5H 2IP4A 2R85A 4TV9F 5KFYA 1AUVA 1I6UA 1N33H 4GLXA 4JUZA 2YZNA 3GIDA 3V6HA 5C1PA 4UCTA 4JI4H 1T94A 4RUCA 4IRKA 3ORRA 3N8DA 5DGAA 2F4VH 2R93G 2ATLA 2AU0A 1UNNC 1I3QA 5HBRB 1IBKH 2CQYA 1EUCB 2JEJA 4J0MA 5BPFA 4J9SA 4DR2H 4LFAH 3PR4A 4O3OA 4FBTA 2ZDGA 2YU9A 1E4FT 2I8CA 4EFEA 1Y1WA 2YZGA 4MV4A 4XZ3B 4QWBA 5DG9A 3MR5A 1M7JA 2VOBA 2R8GA 2FPIB 5KFMA 4JI7H 1Y1WG 2UVRA 2QK4A 4AYBA 1GSHA 4YR2A 4B3TH 5JH7F 4YJ3F 2FJZA 2W9CA 3EYYA 2IA6A 4GKKH 4FS1A 4Q45A 2XCLA 4DV5H 3JSNA 3UQ8A 1XMOH 2NVXA 4RB2C 5C44G 1RYRA 3K5HA 4ED3A 1N48A 2R8KA 3RB3A 1IBMH 1Z2NX 4ED6A 4Q8EA 3BA8A 3JZIA 2NU9B 3PVXA 2RDIA 3RTXA 1KC7A 1S03G 2ASJA 3C0FB 2I87A 4ZOLF 2R7NA 4O4IF 4DV1H 4ECWA 1C3OA 4O3SA 3RV4A 2UVVA 1EYZA 1KJ9A 3DF7A 3TINA 5KX5F 3RAXA 3HOUG 2VQEH 4TQRA 1HNWH 3F8NA 1RJQA 2JA5G 5KFEA 4GC7A 2WAQA 5A2QW 4M9UA 2GPWA 1OWTA 2VPQA 2V9WA 4C5BA 4ECVA 4ETSA 5KG6A 3V4ZA 3CVZA 5GONF 3HOYG 3T1HH 1S10A 4YJ2F 2DZDA 5IYDG 2WDTA 2HGSA 3PO2G 4K0KH 4A3JG 5KFKA 2ZJTA 4O4LF 4Q0YA 5FLXW 2FK1A 5L1JA 2AQ4A 4BY7G 1VKZA 3PW7A 4RB0A 2PMZE 3UFXB 1T3NA 3FMAA 2ZM6H 4ECQA 4YP3A 4JI3H 5LXTF 3QZ8A 1N32H 1Y1VG 1V4YA 2R7KA 5KT6A 1WCMA 4YHHH 4YB8B 1TWGA 3T1YH 2J9GA 2SCUB 2AGPA 1GO3E 1ZHQA 2YS7A 2UVUA 2XIGA 4ECZA 2W6PA 3RF2A 1CS0A 4XX0B 3PN1A 5KFXA
chains in the Genus database with same CATH topology
2CW7A 3H20A 1FKAH 4RB1A 4MTDA 1HNXH 4UCUA 1FVIA 4JI8H 4A2AA 1A0IA 3KAKA 1J5EH 2WE6A 3N41B 3N40P 4LSXA 3RGZA 4DUYH 4LF8H 4YY3H 1IBLH 4X66H 2MCTA 4DV7H 3M4IA 5FPOA 3KAJA 4UCRA 3JSLA 5LL6b 3J81W 1N36H 4UCOA 3L2PA 1WH2A 3BAAA 4BWSC 4IAJA 2UUAH 4R7RA 2RGRA 4LFBH 1GYFA 4LF5H 4OX9H 3KALA 2VPSA 5IT9W 4B3MH 1I6UA 1N33H 4GLXA 1Z2PX 2UU9H 4A2BA 1BGWA 4RAYA 4RZQA 4UCTA 4B3RH 4UFZA 4JI4H 4JI0H 2F4VH 5EOYA 1ZHSA 4JI2H 1IBKH 2UUCH 4CC5A 2E5LH 4UCVA 4J0MA 2KSWA 4DR2H 4LFAH 4PDBA 4KHPH 5FD6A 5FD5A 3OTOH 2OWOA 5D1OA 4M7EA 1E4FT 4NXMH 1TAEA 3L4JA 1TA8A 3BA9A 4EFEA 2FE3A 5D1OB 5FPRA 4DV6H 1I94H 2HVQA 2VUGA 3HXLA 4RB3C 4RAZA 2VOBA 2RGVA 3N42B 4JI7H 2HVRA 2HVSA 1MZBA 4B3TH 4X65H 5LMUH 4GKKH 3EYYA 4DV5H 3RGXA 1E4GT 3JSNA 3UQ8A 1XMOH 1L2ZA 4MV9A 4RB2C 4DV4H 1IBMH 1Z2NX 5BR8H 4LF4H 3BA8A 4LMYA 3RTXA 4X62H 1S68A 3KXYT 3MWMA 5IWAH 1HR0H 3J80W 3C0FB 1S03G 4JV5H 2YCHA 1N34H 2UXDH 1O75A 2UXCH 2O03A 5LMNH 1AN7A 5D1PA 4LF7H 4DV1H 4LF6H 1XNRH 4DR1H 4JI5H 3JAMW 3DF7A 4DR6H 2CW8A 4JI6H 1SEIA 2UUBH 4LF9H 2VQEH 1HNWH 3F8NA 4EFBA 3L4KA 4FM9A 4MTEA 2WYOA 5A2QW 3LMLA 4MV7A 4DR3H 4GKJH 4ETSA 4JI1H 4NXNH 3IG0A 2VQFH 1X9NA 1Z2OX 3CVZA 1M0WA 1SYXB 3T1HH 1BJTA 4JYAH 1HNZH 3K3VA 3N43B 2WDTA 2HGSA 3RIZA 2Q2TA 4CC6A 4DV2H 2UXBH 1B04A 4K0KH 4LH6A 3N6XA 2ZJTA 5FLXW 1DGSA 4Q0YA 1M0TA 4DR5H 3N44B 4LSAA 4DV0H 4RB0A 3FMAA 2ZM6H 4X64H 1XDNA 4APMA 1V9PA 1XNQH 4JI3H 3RJ0A 4DR4H 4DR7H 1XMQH 4LH7A 1N32H 4YHHH 4LFCH 4B3SH 3T1YH 3J7AK 1VS0A 1P8LA 4EEQA 4DUZH 2HHHH 1FJGH 2W57A 1ZHQA 4UCSA 2XIGA 4I7HA 4DV3H 3RF2A 3BABA 2Q2UA 4AQYH 3PN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0Y A; 
#chains in the Genus database with same CATH topology
 3U9T A;  4YR3 A;  1DV1 A;  4RB1 A;  5DG7 A;  4UCU A;  4A2A A;  5DG8 A;  2WE6 A;  3MJF A;  4LSX A;  1W93 A;  5KFJ A;  4DUY H;  5KFQ A;  4A3F G;  4YY3 H;  4J9M A;  4A3C G;  2R7M A;  3GLK A;  4DV7 H;  3OSP A;  2R6F A;  3PZP A;  5JQW A;  4UCR A;  1T36 A;  3ETH A;  3KHG A;  3OSN A;  3L2P A;  3I12 A;  2FPG B;  4HQ6 A;  3K3P A;  4IAJ A;  4R7R A;  3GIJ A;  4OX9 H;  3OHB A;  5DGB A;  1S0M A;  1JLL B;  2NUA B;  2GLT A;  1RJP A;  4O2A F;  2W8K A;  4F4Y A;  1BGW A;  4RAY A;  5KFC A;  4UFZ A;  4HNT A;  3Q8P B;  3G6X A;  3HB9 A;  4WBN F;  4JI2 H;  1ZHS A;  5IYC G;  4F4X A;  2UUC H;  1DV2 A;  2PN1 A;  1UC8 A;  1EUD B;  2NU6 B;  3V6K A;  4KHP H;  5L1I A;  2CZG A;  5LOV F;  4YQW A;  4FS2 A;  1TWH A;  4M7E A;  3HOX G;  1JKJ B;  3E5N A;  3V4S A;  5DQH A;  4U7C A;  1TA8 A;  3BA9 A;  4MA5 A;  4EEY A;  5D1O B;  1JXL A;  3Q8R B;  4RU9 A;  4DV6 H;  1S97 A;  1W96 A;  2HVQ A;  2VUG A;  3OUU A;  5KFN A;  1I94 H;  4ZQI A;  5KG2 A;  1E4E B;  5KFU A;  4X65 H;  3GV5 B;  4F50 A;  3I4M G;  1PK8 A;  3RBE A;  4F4W A;  2RF4 A;  5JUM A;  5KFH A;  3WO0 A;  4HNV A;  3Q2O A;  3M9N B;  3U9S A;  5HV6 A;  4DV4 H;  1S0N A;  2R93 A;  2WTF A;  2E2H A;  2C2R A;  3GIL A;  4ED8 A;  4ECY A;  2PBZ A;  5IYZ F;  3MR3 A;  4LMY A;  2JA7 A;  4X62 H;  1S68 A;  3MWM A;  1DIK A;  4MV1 A;  4I55 F;  3J80 W;  2UXC H;  2CKZ B;  1O75 A;  2XC9 A;  1N56 A;  2JA7 G;  5L1K A;  1AN7 A;  5D1P A;  1K83 A;  3BQ2 A;  4LF6 H;  2R92 A;  4DR1 H;  3H4D A;  4JI5 H;  5C3E G;  1RK6 A;  2UVW A;  4DR6 H;  1A9X A;  4Y8V B;  4JI6 H;  2M05 A;  4LF9 H;  2DLN A;  2C22 A;  2FP4 B;  2R92 G;  2C00 A;  5LA6 F;  2OH2 A;  3PO3 G;  4J9R A;  4JV1 A;  4FM9 A;  4A3D G;  4MTE A;  5KG0 A;  2JEI A;  2FK2 A;  2ZDQ A;  4J9N A;  2E2I A;  4MV7 A;  4GKJ H;  5F9L A;  5JVD F;  2RDJ A;  5KFW A;  5EWE A;  2BR0 A;  5CA0 F;  4GC6 A;  1X9N A;  1SYX B;  4RNN A;  1BJT A;  2ALZ A;  4NLG A;  4JV0 A;  3T5K A;  3RIZ A;  2UXB H;  4DV2 H;  1KJ8 A;  3T5H A;  1B04 A;  5KT4 A;  3N6X A;  4IZO A;  1DGS A;  3LWB A;  5KFI A;  2IBK A;  2GPS A;  4IRD A;  1GLV A;  2R7L A;  3PW5 A;  2C28 A;  3GIQ A;  3VPD A;  5FLM G;  2W8L A;  2JA5 A;  1V9P A;  1XNQ H;  5LYJ F;  4A3B G;  4DR7 H;  4LH7 A;  4LFC H;  3RUP A;  4QWE A;  2W6O A;  4EEQ A;  5L1L A;  2FPP B;  5J2T F;  4L1K A;  4QW8 A;  2V4R A;  2FK3 A;  1JDE A;  4I7H A;  4YAJ B;  4DV3 H;  5DQI A;  3HKZ E;  2IMW P;  1CE8 A;  2CW7 A;  3VMM A;  3V6J A;  1FVI A;  4J9L A;  2QYZ A;  4JI8 H;  1J5E H;  4ECS A;  2W6M A;  3GIK A;  1VAJ A;  1K1S A;  4XYM B;  3VPB A;  1IOW A;  4J9O A;  4BY1 G;  5BPH A;  5KFV A;  3KAJ A;  3JSL A;  4C5C A;  4FBU A;  4PWQ A;  1Y1V A;  5CB4 F;  1N36 H;  4ME6 A;  4BWS C;  4RNM A;  4DL4 A;  2UUA H;  2RGR A;  3HOW G;  4LFB H;  4BBS G;  3KAL A;  5KFA A;  2VPS A;  1B6S A;  4RNO A;  2DPJ A;  4B3M H;  3H3V H;  3H40 A;  4EYH B;  2VA2 A;  5KG4 A;  4A93 G;  2UU9 H;  2V59 A;  4A2B A;  4B3R H;  4C5A A;  1SCU B;  1KBL A;  3FDS A;  3RAQ A;  5EOY A;  1RK5 A;  4TV8 F;  3OUZ A;  4EBD A;  4DL2 A;  2W71 A;  4CC5 A;  2E5L H;  1S0O A;  2KSW A;  3TII A;  4WD3 A;  5FD5 A;  5FD6 A;  5LP6 F;  4EBE A;  5EWF A;  3NGD A;  5D1O A;  3RB0 A;  4NXM H;  5C4X G;  1TAE A;  4U6P A;  3MR2 A;  5KFT A;  3FKI G;  3L4J A;  2W6Z A;  3EPG A;  1E4E A;  2R84 A;  4RB3 C;  3MFH A;  3GTG A;  1ZQ7 A;  2RGV A;  3N42 B;  4TQS A;  3HBL A;  4DL5 A;  3BG5 A;  5LMU H;  2YZM A;  3HKZ A;  2C2D A;  2AGQ A;  5C1O A;  2YRW A;  3RGX A;  1E4G T;  1L2Z A;  1AUX A;  3T5L A;  5KFR A;  2JA6 G;  2FLN A;  2WB1 E;  2X0S A;  4QJF A;  1B6R A;  3RBD A;  5BR8 H;  2XD4 A;  4J9K A;  3R5H A;  5KT2 A;  5IWA H;  3KXY T;  3PR5 B;  2AGO A;  1HR0 H;  4JV5 H;  1N34 H;  1GGO A;  4O2B F;  2UXD H;  2O03 A;  4A3E G;  1K1Q A;  4HR7 A;  3BQ0 A;  5KFG A;  4BBR G;  2PMZ A;  4J9Q A;  2DPI A;  2DIK A;  3H0G G;  3JAM W;  2V4Q A;  3GTQ A;  2CW8 A;  5DLF A;  1SEI A;  2YL2 A;  4DL3 A;  3GTK A;  3Q1K A;  4EFB A;  5KFD A;  2C35 B;  2WYO A;  3GTM A;  4QWD A;  4I50 F;  4R8U B;  4ZI7 F;  4HNU A;  3I4N G;  4ECX A;  5IP7 G;  4YAK B;  4NXN H;  2VQF H;  4Q44 A;  3IN5 A;  1M0W A;  2Y0S E;  4JYA H;  3TQT A;  4ZHQ F;  1HNZ H;  3N43 B;  3Q8Q B;  4CC6 A;  4O3Q A;  1VBG A;  2JA8 G;  2V5A A;  1BXR A;  4IHJ F;  5BMV F;  3N44 B;  3WNZ A;  4DR5 H;  4ECR A;  4IRC A;  3M9M B;  4MAM A;  1XDN A;  3R5X A;  4APM A;  2R7Z G;  3RB4 A;  1V51 A;  4O3P A;  3RJ0 A;  3G6Y A;  5KFL A;  4DR4 H;  5K2M A;  4A3L G;  3VPC A;  2W7O A;  4B3S H;  2WB1 A;  1R9T A;  3J7A K;  4DUZ H;  1JX4 A;  3M9O B;  3T5J A;  1GSA A;  1B33 N;  5DLG A;  4G3I A;  1FJG H;  4UCS A;  1ULZ A;  3GIP A;  2WAQ E;  5KT5 A;  3BAB A;  4ED0 A;  3RV3 A;  3HOV G;  5KT3 A;  3H20 A;  2R86 A;  4MTD A;  2R8J A;  1TWC A;  1HNX H;  5KG1 A;  1A0I A;  2V58 A;  1C30 A;  3KAK A;  3G8C A;  1I50 A;  1TWA A;  3N41 B;  1KJQ A;  1CQJ B;  1I7L A;  5CAE B;  2W9B B;  2BQU A;  1IBL H;  5IYB G;  4X66 H;  4IR1 A;  3M4I A;  5FPO A;  5EZY F;  2W9A A;  5LL6 b;  3J81 W;  2BQ3 A;  3GTO A;  2B63 A;  4A3I G;  3MFI A;  3JRX A;  5KT7 A;  1TWF A;  1UC9 A;  3SE7 A;  2I80 A;  1GYF A;  2B63 G;  5IT9 W;  2ASL A;  1PX2 A;  1Z2P X;  2J6T A;  2HJW A;  3WO1 A;  4ED1 A;  2Y0S A;  4RZQ A;  5FJ8 G;  3HOZ G;  4J9P A;  4Q8F A;  3GIM A;  1CQI B;  4JI0 H;  3PW4 A;  5CA1 F;  4EBC A;  5KKN B;  4UCV A;  4O3R A;  1KJI A;  2C2E A;  2YS6 A;  4QIW E;  5H80 A;  4IWY A;  3BQ1 A;  4PDB A;  2VQD A;  3OTO H;  2BQR A;  2W6Q A;  5KFS A;  2OWO A;  4MV8 A;  2NU8 B;  2R8I A;  3K5I A;  4EGJ A;  2FE3 A;  2YYA A;  2XCA A;  5FPR A;  5KG5 A;  3HXL A;  4RAZ A;  2NU7 B;  4F4Z A;  2R8H A;  3MWD A;  4ECU A;  3GII A;  4QW9 A;  1Y14 B;  1MZB A;  2HVR A;  2PVP A;  1S9F A;  2HVS A;  5KFB A;  2FLL A;  4A3M G;  3KHR A;  2FKL A;  2ZDH A;  4MV9 A;  4C2M A;  3TQ1 A;  4EG0 A;  2W9C B;  2VUM A;  4ECT A;  2YRX A;  2XGP A;  3QZ7 A;  4LF4 H;  1EZ1 A;  2VR1 A;  2OLS A;  1KJJ A;  2FB9 A;  2VUM G;  5KFF A;  1SFO A;  1GSO A;  4EGQ A;  1M6V A;  2YCH A;  3GTP A;  5LMN H;  3FKI A;  4HYK A;  5EDW A;  4Q43 A;  4LF7 H;  1XNR H;  4YBZ B;  2JEF A;  3GTJ A;  1EHI A;  2UUB H;  3LP8 A;  2NVY A;  1RYS A;  4A3K G;  4XYL B;  3Q8S B;  5I47 A;  1IOV A;  4QWA A;  4O4H F;  3JRW A;  4MV6 A;  3MR6 A;  3L4K A;  2P0A A;  4R8U A;  3CQZ A;  2JA6 A;  2FLP A;  3LML A;  5J2U F;  1WCM G;  4DR3 H;  1I7N A;  4JI1 H;  5EWG A;  1WR2 A;  3KHH A;  3IG0 A;  5D8D A;  2XGQ A;  3PW2 A;  3R23 A;  1Z2O X;  5C8Y F;  4DL6 A;  3MWE A;  4A3G G;  4O3N A;  4E4T A;  1BNC A;  3GQC A;  4JV2 A;  3K3V A;  2Q2T A;  5DQG A;  2DWC A;  2FMA A;  5KFP A;  3RFC A;  3H0G A;  3GV8 B;  5KFZ A;  1ZET A;  3PW0 A;  1M0T A;  4I4T F;  4MA0 A;  4QIW A;  4RZR A;  4LSA A;  4DV0 H;  2J6S A;  4EYI B;  4X64 H;  3GV7 B;  4IWX A;  3OHA A;  2ASD A;  4IR9 A;  2W7P A;  1XMQ H;  4FU0 A;  2R87 A;  1VS0 A;  5IP9 G;  1P8L A;  2JEG A;  2HHH H;  4RUA A;  1JDB B;  2W57 A;  2XCP A;  4AYB E;  3KHL A;  3GTL A;  5C5J A;  3RB6 A;  3TIG A;  2Q2U A;  3KTM A;  4LH6 A;  5KG3 A;  3G6V A;  4AQY H;  5F9N A;  1FKA H;  3ETJ A;  3BJY A;  3QFF A;  4QWC A;  2W9B A;  1WSC A;  5JVL A;  3H4B A;  3R5F A;  4ED2 A;  4TUY F;  1KEE A;  3N40 P;  3RGZ A;  5L9X A;  4DLK A;  4DL7 A;  4LF8 H;  5KFO A;  3SI8 A;  2R82 A;  1RJR A;  2MCT A;  3AYH B;  2W70 A;  2W6N A;  1VBH A;  4YR0 A;  4BXX G;  2VA3 A;  2YW2 A;  2R7Z A;  3ORQ A;  4MV3 A;  4ED7 A;  1JIH A;  5T14 A;  4UCO A;  1WH2 A;  3BAA A;  5KG7 A;  2J6U A;  3EPI A;  4LF5 H;  2IP4 A;  2R85 A;  4TV9 F;  5KFY A;  1AUV A;  1I6U A;  1N33 H;  4GLX A;  4JUZ A;  2YZN A;  3GID A;  3V6H A;  5C1P A;  4UCT A;  4JI4 H;  1T94 A;  4RUC A;  4IRK A;  3ORR A;  3N8D A;  5DGA A;  2F4V H;  2R93 G;  2ATL A;  2AU0 A;  1UNN C;  1I3Q A;  5HBR B;  1IBK H;  2CQY A;  1EUC B;  2JEJ A;  4J0M A;  5BPF A;  4J9S A;  4DR2 H;  4LFA H;  3PR4 A;  4O3O A;  4FBT A;  2ZDG A;  2YU9 A;  1E4F T;  2I8C A;  4EFE A;  1Y1W A;  2YZG A;  4MV4 A;  4XZ3 B;  4QWB A;  5DG9 A;  3MR5 A;  1M7J A;  2VOB A;  2R8G A;  2FPI B;  5KFM A;  4JI7 H;  1Y1W G;  2UVR A;  2QK4 A;  4AYB A;  1GSH A;  4YR2 A;  4B3T H;  5JH7 F;  4YJ3 F;  2FJZ A;  2W9C A;  3EYY A;  2IA6 A;  4GKK H;  4FS1 A;  4Q45 A;  2XCL A;  4DV5 H;  3JSN A;  3UQ8 A;  1XMO H;  2NVX A;  4RB2 C;  5C44 G;  1RYR A;  3K5H A;  4ED3 A;  1N48 A;  2R8K A;  3RB3 A;  1IBM H;  1Z2N X;  4ED6 A;  4Q8E A;  3BA8 A;  3JZI A;  2NU9 B;  3PVX A;  2RDI A;  3RTX A;  1KC7 A;  1S03 G;  2ASJ A;  3C0F B;  2I87 A;  4ZOL F;  2R7N A;  4O4I F;  4DV1 H;  4ECW A;  1C3O A;  4O3S A;  3RV4 A;  2UVV A;  1EYZ A;  1KJ9 A;  3DF7 A;  3TIN A;  5KX5 F;  3RAX A;  3HOU G;  2VQE H;  4TQR A;  1HNW H;  3F8N A;  1RJQ A;  2JA5 G;  5KFE A;  4GC7 A;  2WAQ A;  5A2Q W;  4M9U A;  2GPW A;  1OWT A;  2VPQ A;  2V9W A;  4C5B A;  4ECV A;  4ETS A;  5KG6 A;  3V4Z A;  3CVZ A;  5GON F;  3HOY G;  3T1H H;  1S10 A;  4YJ2 F;  2DZD A;  5IYD G;  2WDT A;  2HGS A;  3PO2 G;  4K0K H;  4A3J G;  5KFK A;  2ZJT A;  4O4L F;  4Q0Y A;  5FLX W;  2FK1 A;  5L1J A;  2AQ4 A;  4BY7 G;  1VKZ A;  3PW7 A;  4RB0 A;  2PMZ E;  3UFX B;  1T3N A;  3FMA A;  2ZM6 H;  4ECQ A;  4YP3 A;  4JI3 H;  5LXT F;  3QZ8 A;  1N32 H;  1Y1V G;  1V4Y A;  2R7K A;  5KT6 A;  1WCM A;  4YHH H;  4YB8 B;  1TWG A;  3T1Y H;  2J9G A;  2SCU B;  2AGP A;  1GO3 E;  1ZHQ A;  2YS7 A;  2UVU A;  2XIG A;  4ECZ A;  2W6P A;  3RF2 A;  1CS0 A;  4XX0 B;  3PN1 A;  5KFX A; 
#chains in the Genus database with same CATH homology
 2CW7 A;  3H20 A;  1FKA H;  4RB1 A;  4MTD A;  1HNX H;  4UCU A;  1FVI A;  4JI8 H;  4A2A A;  1A0I A;  3KAK A;  1J5E H;  2WE6 A;  3N41 B;  3N40 P;  4LSX A;  3RGZ A;  4DUY H;  4LF8 H;  4YY3 H;  1IBL H;  4X66 H;  2MCT A;  4DV7 H;  3M4I A;  5FPO A;  3KAJ A;  4UCR A;  3JSL A;  5LL6 b;  3J81 W;  1N36 H;  4UCO A;  3L2P A;  1WH2 A;  3BAA A;  4BWS C;  4IAJ A;  2UUA H;  4R7R A;  2RGR A;  4LFB H;  1GYF A;  4LF5 H;  4OX9 H;  3KAL A;  2VPS A;  5IT9 W;  4B3M H;  1I6U A;  1N33 H;  4GLX A;  1Z2P X;  2UU9 H;  4A2B A;  1BGW A;  4RAY A;  4RZQ A;  4UCT A;  4B3R H;  4UFZ A;  4JI4 H;  4JI0 H;  2F4V H;  5EOY A;  1ZHS A;  4JI2 H;  1IBK H;  2UUC H;  4CC5 A;  2E5L H;  4UCV A;  4J0M A;  2KSW A;  4DR2 H;  4LFA H;  4PDB A;  4KHP H;  5FD6 A;  5FD5 A;  3OTO H;  2OWO A;  5D1O A;  4M7E A;  1E4F T;  4NXM H;  1TAE A;  3L4J A;  1TA8 A;  3BA9 A;  4EFE A;  2FE3 A;  5D1O B;  5FPR A;  4DV6 H;  1I94 H;  2HVQ A;  2VUG A;  3HXL A;  4RB3 C;  4RAZ A;  2VOB A;  2RGV A;  3N42 B;  4JI7 H;  2HVR A;  2HVS A;  1MZB A;  4B3T H;  4X65 H;  5LMU H;  4GKK H;  3EYY A;  4DV5 H;  3RGX A;  1E4G T;  3JSN A;  3UQ8 A;  1XMO H;  1L2Z A;  4MV9 A;  4RB2 C;  4DV4 H;  1IBM H;  1Z2N X;  5BR8 H;  4LF4 H;  3BA8 A;  4LMY A;  3RTX A;  4X62 H;  1S68 A;  3KXY T;  3MWM A;  5IWA H;  1HR0 H;  3J80 W;  3C0F B;  1S03 G;  4JV5 H;  2YCH A;  1N34 H;  2UXD H;  1O75 A;  2UXC H;  2O03 A;  5LMN H;  1AN7 A;  5D1P A;  4LF7 H;  4DV1 H;  4LF6 H;  1XNR H;  4DR1 H;  4JI5 H;  3JAM W;  3DF7 A;  4DR6 H;  2CW8 A;  4JI6 H;  1SEI A;  2UUB H;  4LF9 H;  2VQE H;  1HNW H;  3F8N A;  4EFB A;  3L4K A;  4FM9 A;  4MTE A;  2WYO A;  5A2Q W;  3LML A;  4MV7 A;  4DR3 H;  4GKJ H;  4ETS A;  4JI1 H;  4NXN H;  3IG0 A;  2VQF H;  1X9N A;  1Z2O X;  3CVZ A;  1M0W A;  1SYX B;  3T1H H;  1BJT A;  4JYA H;  1HNZ H;  3K3V A;  3N43 B;  2WDT A;  2HGS A;  3RIZ A;  2Q2T A;  4CC6 A;  4DV2 H;  2UXB H;  1B04 A;  4K0K H;  4LH6 A;  3N6X A;  2ZJT A;  5FLX W;  1DGS A;  4Q0Y A;  1M0T A;  4DR5 H;  3N44 B;  4LSA A;  4DV0 H;  4RB0 A;  3FMA A;  2ZM6 H;  4X64 H;  1XDN A;  4APM A;  1V9P A;  1XNQ H;  4JI3 H;  3RJ0 A;  4DR4 H;  4DR7 H;  1XMQ H;  4LH7 A;  1N32 H;  4YHH H;  4LFC H;  4B3S H;  3T1Y H;  3J7A K;  1VS0 A;  1P8L A;  4EEQ A;  4DUZ H;  2HHH H;  1FJG H;  2W57 A;  1ZHQ A;  4UCS A;  2XIG A;  4I7H A;  4DV3 H;  3RF2 A;  3BAB A;  2Q2U A;  4AQY H;  3PN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...