4Q18A

Human dck c4s-s74e mutant in complex with udp and the inhibitor 4 [1-[5-(4-{[(2,6-diaminopyrimidin-4-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]-2-methylpropan-2-ol]
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
230
Chain Sequence
IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 230
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q18A00
4V0NA 2GJKA 3L0PA 2V7QD 4EFNA 3KKMA 4D25A 2J7KA 3QF7A 5FPKA 3ZDQA 3Q3JB 2J7PD 3CW2A 2QAGB 3W6PA 1KMHA 1IBRA 1GWNA 1G7CA 5FTMA 4KSCA 2PLFA 2PT7A 2CJWA 4OQFA 4PC6A 2IYXA 3A4LA 4F92B 4EKDA 3SFVA 3IBGA 3AVOA 2B92A 2VTKA 1MKYA 2V7QA 5J5CA 1PVOA 1Z2CA 4D4JA 1CS4C 2YKGA 1EXMA 3ADCA 2IWHA 2J7PA 2XXAB 1ZCAA 4Z54A 1UBEA 1TQ4A 2CHVA 2IWRA 1LF5A 3B9QA 1N6NA 1KKMA 2ZRPA 3FHCB 4UKDA 4TT3D 1XXHB 4AI6A 4AWXA 5C46F 4MA4A 1U8AA 3WP1B 2VPPA 1E1QD 1Q3HA 3HYRA 4HZIA 1KAOA 3SJZA 4UXJA 3DPUA 1W2HA 2F1HA 4GOXA 2FFAA 4XTCS 3SC3A 1K5DA 2XTNA 2YOFA 4NYJR 2QP3A 2NQ2C 3R9IA 1W4CA 2QG6A 1NSFA 4BFXA 4QC2A 4CT4B 1A4RA 3AH8A 1SVKA 4JIMA 1G17A 3O8BA 1GVNB 1Z08A 4AG5A 4C4PA 3Q8XB 2OO7A 1E1QA 1U8ZA 1EWQA 4MRPA 2ZI9A 2ZRCA 5IT5A 2FFBA 3PEVA 4W5JA 3KFVA 3RWOA 4HAWA 4PSAA 2Q9BA 1IY1A 4GP6A 4XVUA 4LJ4A 4JLDA 3SE0A 4LBVA 4EFMA 1OFUX 1E0JA 5AJYA 1XZPA 1ESMA 1JNYA 3J81k 4BPBA 3IIMA 2ORIA 3S1AB 1UKVY 5CDFA 2JLRA 3RS3A 2R9VA 4WXRA 8OHMA 2NO6A 4EJSA 3LD9A 3SBEA 2EFCB 1NG1A 3NHAA 2HJVA 1KNXA 4ZV4A 2ZEJA 3AVUA 3VU9B 5F9HA 3ICQB 1IN8A 2JASA 4R98A 5F9FA 3ZVRA 1R8SA 1ZD8A 1BYUA 2J9RA 3BAFA 1G5PA 4BWYA 4UQOA 1M34E 1UBFA 2YWEA 1VPLA 2GAOA 4R2IA 3K09C 1DE0A 3K0CA 3PEUA 3RRNA 2WJJA 3HDTA 4TWZA 3G5UA 3U7HB 5CLQA 1N0VC 1Y63A 4DDVA 2IYLD 5FL7D 2AWNA 5JWHA 3B1ZA 2HJGA 3DKVA 3W5JA 3ZGXA 4B6FA 3P4YA 1VCOA 4EPRA 1US8A 1T0JB 3RVBA 1AGRA 1W0JD 1UDWA 4Q1EA 3N70A 3ZVNA 1O3YA 2WAYA 3ADDA 3NEYA 2J1LA 2GCNA 3AP2A 4OI1A 4JT2A 2O8DA 3BJIC 5FL7A 1Z3IX 1F2UA 4UXHA 4DCUA 1S3GA 4DSUA 2EQBA 1NIJA 1ZU4A 3KB2A 2BC9A 4IOKA 2PT5A 4M1OA 2CMKA 3KZ1E 3HR7A 3OZXA 1W0JA 4A8JC 4DLZA 2PMKA 1Z0DA 2QP4A 2Z4SA 1Z06A 3TIFA 2CCJA 5EP2A 3VHXA 4AYTA 4BFSA 3K70D 1EX6A 2O0KA 3THXA 2AX4A 3LQRA 2RGEA 2J59A 2ZYVX 1UBGA 4QBGB 4FW9A 5GJWC 3X1WA 1SULA 1FZQA 4DKXA 2ZPTX 3HPRA 4HLUC 1NY6A 1JJ7A 3I5YA 3SHWA 5IF9A 1W4BA 4DB2A 2H17A 2WKPA 3QPUA 3BWDD 3FE2A 1EFUA 1OFTA 2BBTA 2XITA 1WBBA 3QKSA 4KCGA 2XEXA 4IDNA 3V4FA 1CF4A 1HY3A 1XPOA 3DEFA 1E4YA 3AUXA 4JVLA 3KKQA 2IYVA 4IDOA 4D6PA 4LJ6A 2O0JA 3TR0A 2ZRBA 2BJWA 1JI0A 2YYZA 3FOZA 3K0SA 5CK5A 1KSHA 2Z0MA 2ZU0C 1DAFA 1NVVR 2GBLA 3M6AA 2REXB 3ZZUA 1G7TA 2DPXA 2GXSA 3DM9B 1DADA 1LW7A 3EZ6A 4MDFA 4V0OA 4TL9A 4PANA 2VL7A 4CEJB 3R9WA 2ONJA 2NO7A 1N2CE 4HI0E 2LCFA 1M7BA 2JLVA 4GOJA 2YC2C 2XB4A 1TPZA 2GESA 2D4HA 4TL7A 3TK1A 4CIDA 4O2LA 3NIBA 4NCHA 5KDOA 4IW3B 3OHMA 3GJ8A 3TUIC 3X1XA 4FMCB 5DIFA 3MJRA 4BFWA 1VYUA 2IC5A 1DAHA 4GDFA 1XEWY 2W83A 2GK7A 1E3MA 4UNPA 2WV9A 2REOA 1E2MA 3KQUA 1KZGB 1ZNXA 5H8WA 3KKOA 1Q1ZA 1DPFA 4HATA 5G40A 5GVRA 1UAAA 4TLAA 2ZM5A 4JL6A 2ZYUX 3PR1A 4KODA 2CLDX 2IW3A 3W90A 4Q4HB 2PH1A 4YMSA 4URZR 1G8PA 4ERNA 2ORWA 2VSFA 3ZS9A 1AGPA 1AA9A 2WPDD 5EP1A 1B0UA 3Q85A 4PO9A 2NZ8A 4HDOB 3RRMA 4LBZA 4OI4A 3GLFB 2BVNA 2FDCA 2ZE5A 3EC2A 4JLMA 5EE3A 1GP2A 1XEXA 3AUYA 5LB4A 5KNDA 2ZS9A 4MKHA 5CB6A 2YOHA 4GMDA 3L2OB 4F38A 2ZJ5A 5C4MA 1TUIA 5KU1A 1N0WA 1VCIA 1TQ6A 2FH5B 5IDVA 1X3SA 4CF7A 2GXAA 1TU3A 3LLMA 1MABA 4N3NA 1GZSA 2WPDA 2RHMA 3CRRA 4Q9KA 5AJVB 1X8LA 1S3SA 3NH9A 1JEDA 2HEIA 4HLQB 4YDHB 1YZNA 2PJZA 3BORA 3Q9LA 3W8RA 5JI2E 1Z47A 4PX9A 2C99A 1I2DA 5JCPA 1KDRA 4L8GA 4YMVA 2D7CA 2E87A 3MWJA 2PJRA 1DG3A 3T1VA 3ETLA 4C2TA 1OPXA 1H8HD 5CLLA 3TKLA 3H4MA 2J0UB 3A1VA 1UKYA 4IEEA 4GNKA 3U5ZB 1GNQA 1T3LA 2PEZA 2MSDB 1OV4A 5F3WB 1RJ9B 2FPMA 1MH1A 1CR0A 3ZVLA 4JJKA 2IT1A 5JJLA 1G7SA 2AKAB 1G4AE 1WDTA 2OFWA 2WIBA 2GRJA 4DCTA 4PPNA 2RCNA 4E5UA 1W5TA 1ZNYA 2PL3A 3DO6A 1G1MA 1GOTA 1H8HA 1ONBA 1DELA 2HYDA 5JLJA 3WHKA 4B76A 2W2XA 1VIYA 2AWOA 2SHKA 3G0HA 2JA1A 1KO7A 1RRCA 1XTKA 2CE2X 2VEDA 4DT1A 1D2EA 2G0NA 3T5GA 3CZPA 3KKNA 1V5WA 3LA6A 4PXAA 5JEDA 5JHGB 1PLKA 4ACBA 3RRZA 3QXCA 4PPGA 4BUJA 4XWOA 2KJQA 4C7OB 4LZZA 1KK2A 1GL7A 2RMKA 3GQBA 1FW6A 2AFHE 3GLIE 4FCTA 1TQ2A 1R6BX 1ETUA 2RGXA 3DZDA 3L8ZA 5EXPA 1CLUA 4AK9A 2PCJA 1N5JA 3U3OA 1A7JA 1MR3F 1ZC4A 2WJVA 4LJ5A 1FUKA 1C9KA 5FR2A 1UJ2A 1VKJA 4HYYA 4DEXA 3X1YA 3AGQA 1LFDB 4JVNA 2Z83A 3TH5A 4EPYA 1N6IA 2JLSA 3TUZC 4M8NE 3CIOA 4URWR 4WA7A 3THOA 4MYUA 3IPXA 2UZIR 2F1RA 3AVWA 1NY5A 3NBYC 1PJRA 2PZEA 3F3YA 1FPMA 2KBEA 4BLRA 2OBLA 2N42A 3VR3A 821PA 1E2FA 3VQTA 2PZFA 2DHRA 1E1RD 2J0VA 2RGDA 3IUYA 4Q18A 4TMTA 4P4SB 1N3BA 1N5LA 1W4RA 4GL2A 1ZD1A 3AKCA 4XSHA 1PV4A 1AJEA 1KDOA 3WNCA 4JLNA 1KKLA 1XB2A 1SVOA 1Z2AA 3VR2A 5AJWA 1CXZA 5FOXA 3VAAA 1KI3A 3U2QA 5KDLA 2RH5A 1ZUNB 4HUQB 1UBCA 4EUNA 4Q1CA 4KHZA 5E3HA 5KYKA 1FOEB 4IJMA 2GETA 1R8QA 2FSHA 3GLHA 4B32A 1XBTA 4R2HA 2BMFA 5L3QB 4LX0A 1S8FA 4PC3A 2RGGA 2JIZD 4XH9B 3TQFA 4AYWA 1S4QA 1N6RA 3KTAB 4UNNA 2QTVB 3L43A 4MITA 4WOPA 3GLGE 2IHYA 2OEPA 4TMKA 3BC1A 3QF4A 4KFSA 4MRSA 1YE8A 3CRVA 4PC7A 2CHGA 3MGCA 5AJXA 3FVQA 3CM0A 4LUCA 4CZ2A 2ZVPX 2JIZA 5SZIA 2VF7A 2W6ID 1W48A 3WNDA 1A82A 2V6IA 3PUVA 4D0LB 3IQXA 4KAXA 4JKIA 5F2EA 2N46A 2FV8A 4NDZA 2W2TA 4G3XA 1S2MA 1P9NA 1GG2A 1SXJC 3ND9A 2IEYA 2FGJA 2ZRGA 1KI8A 2NMVA 1T8UA 1R2QA 3OAAD 5HZKA 4OYHA 3FWYA 2OZEA 2W6IA 4BFUA 4TZ6A 1PLLA 2HF8A 1RYFA 2ERYA 1G6OA 2OCBA 1GKUB 2Z4RA 5SZKB 3UMSA 2WWYA 1CP2A 3A58B 4CEHA 3I62A 1F2TB 2C77A 5KSYA 2G77B 5E4FA 1N6LA 2JATA 4XTRA 4Q4JA 3B85A 3KKPA 2IYUA 4TLCA 2O8EB 4M1WA 1BMFD 4RD6A 3RNLA 1E96A 1II9A 1JB1A 1SHKA 1GITA 2XJ4A 2VHUA 4GI7A 1E0SA 3NKVA 4TQUS 2O8FA 2CL7X 3SNHA 1K5GA 1GRQA 1N25A 2EFHB 2X19A 4AG6A 5E7MA 4JBWA 1TF7A 5KSPA 1OLOA 2L0XA 1YR7A 2XNSA 5TMPA 1XPRA 2HXYA 3IHWA 4QM7A 1MT0A 3RAPR 1BMFA 3OEED 2FEOA 1YHNA 2WVJA 3VTKA 2OAP1 2GVDC 4AKEA 1E2DA 2VHCA 4EPWA 1CIPA 1XD2B 4RCZA 4MRRA 1IXSB 2ZQ5A 5J4KA 3SQXA 2OBNA 1M2OB 3V00A 3BIFA 3EPLA 4PR0A 1P9RA 3EASA 1UF9A 2ZYWX 1F60A 2CNWD 3IIKA 2VP0A 4KFRA 5DI9A 4UXIA 1NLZA 3G82C 1Z6XA 1RC8A 2GXQA 4DWJA 1G7RA 4Z51A 2C9YA 4C0LA 1UPTA 1J2JA 4HDQB 4XD7D 2GNOA 4LV8B 4ZKDA 2R8RA 4JT4A 3K8YA 1U90A 3P27A 3AP3A 1WQ1R 2BJVA 1TNDA 3GEHA 2R65A 3W8NA 4BQSA 4EJSC 1W47A 5J4VA 1YRBA 4LJ7A 4I81A 3CWZA 3FDIA 4ARZA 1G19A 5CB8A 4NYMQ 1LS1A 3SJAA 3ZJYA 4XD7A 4GBMA 5FUYA 3VX4A 1GL9B 5H1YA 2KWIA 3VKGA 4LRWA 4A2QA 2R6AA 2A5JA 2BV3A 1XMJA 1Q44A 2FX3A 4HAVA 4I99A 4V0KA 4A0GA 5BWMA 5DNYB 4R7ZA 3OE7D 2ZJBA 3K0CC 5CJ2A 5EP4A 3EARA 3NC0C 3ND8A 4TSFD 3GCGA 3CNLA 3QENA 2DWOA 1HURA 4BASA 4PQYA 1G8FA 1T3SA 3TUJC 3CR7A 3ECCA 4V0ME 1ZM7A 3LO5A 4Q7LA 5TXGA 1EFCA 4Q02A 2BWJA 1O87A 2Z5FA 3QXJA 4ESHA 2OESA 2W0MA 1MRNA 1SQ5A 2IK8A 1IOZA 2NGRA 1XCGB 1X8JA 3B78A 3MMPA 3OE7A 1N5IA 4FN5A 4GMXA 1XTQA 3PG5A 4LJ8A 4TSFA 3B5JA 3D8BA 4A6XA 4P0TA 4FINA 5JWRA 3OEHD 2X8AA 1WA5A 3N2EA 5DISB 3ZIAD 2QEQA 1IY2A 3LX8A 2EFDB 2RGNA 4A4DA 5JS8A 1T0HB 3OESA 3ZH9B 3LW7A 1OJLA 2PX3A 4LJAA 4XJXA 3AP1A 2HLDD 1XFAA 1T6NA 3PVSA 1EWRA 2REBA 3OEHA 3BGWA 4HZUA 5FBWB 1XTJA 2O52A 3JZMA 4KYUA 4Q7MB 3ZIAA 4LI0A 1AZTA 2B8TA 5K8LA 2FPLA 5FPTA 2ZJOA 2DFKB 4JL8A 4FMCF 3THWA 1JQJC 4CYMA 1ZUHA 4HLCA 3W9YA 1T5LA 3GFOA 3UPUA 4ASUD 2ZROA 4A2WA 3BD9A 1UKZA 1GTVA 1IN6A 2VRWA 5DLQC 5C4GB 1ODFA 4MYTA 1ZNZA 4NTZA 3MWYW 1MO4A 3PXGA 2FWRA 5G53C 4B3BA 2FSIA 2GXUA 1KI6A 3T1TA 2WTUA 1Q3TA 3K70B 2FU5C 3UWOA 2GK6A 3QKSB 2H8KA 3I4LA 1S1MA 1WRBA 4Q1DA 4R71A 4G5SA 1NMXA 4GFDA 2HT6A 3LNCA 2WBLC 5BN4A 3JZAA 2NIPA 2VHQA 3WBKA 4HB2A 2ATXA 4JYBA 4P4TA 5FUWA 3P1JA 4WBSA 2X77A 1TEVA 1Z6AA 2NG1A 4ZDKA 2OLJA 4LHXA 2QM7A 4BFYA 1LS6A 2P6UA 1CJTC 1CR1A 3RLFA 3EWAA 1KAGA 1KSFX 1L2TA 2ANBA 2VP6A 1YR9A 1XU4A 1QZXA 1P2VA 3PUWA 4PQRA 2WAXA 5EE0A 3GPLA 5B64A 3U7EB 2QTHA 1BIFA 4Q01A 1LF0A 4QHYA 3C5HA 1MRSA 3O8CA 3EA0A 1ZUIA 2F43A 4NONA 2H1LA 2VBCA 3X2SA 4POAA 3NHBA 2IYZA 4RSGA 2GILA 3X1ZA 4E22A 2GEUA 4LGMA 1ZNWA 1ELOA 1SXJD 3AVQA 3SFZA 3FKSD 4OHXA 2HCJB 3LDAA 1NG9A 5KNCA 2D06A 3GJ4A 4KV9A 4PPQA 1J8YF 5BN5A 2YJTD 4OKSA 2OBMA 1E2JA 5F98A 1BS1A 3VKWA 4N1AA 4A1FA 2CLCX 2IEZA 4G5RA 4ACAA 3LQQA 1SXJA 3VX3A 2B7BA 2FSGA 5DO9A 2QSYA 3FKSA 2P3SA 2XOKA 3DZ8A 2F1JA 2J0SA 1R5BA 2MSEB 4HAUA 4MUAA 3FFBA 4D2IA 4YXWD 1S96A 2QT0A 4LC0A 5HKKD 3C41J 2IUUA 3AQ4A 3KUDA 3THYB 1OE0A 1EGAA 2BIFA 2PCLA 2QSZA 1G21E 1OFHA 2ZRHA 4IDPA 4X8MA 5CIWA 4EIWA 2GA8A 1AKYA 3HPQA 4JLVA 5FH9A 4M53A 2WM9B 1ZM9A 3HJNA 1MABB 2H92A 4QHTA 4A2PA 4YXWA 4IFEA 5HKKA 3EW9A 5D3MB 4OQLA 1XJQA 2ZRMA 4M1KA 4OK6A 1Y3AA 4O0MA 3WP0A 4GZLA 1YKSA 2QAGC 2JJ2D 2BBOA 1UADA 2ZJAA 3CF2A 3EA5A 4XVQA 4EFLA 4LHYA 4DJTA 4TYQA 4G01B 2ZJZA 1YZLA 3GD7A 3VKHA 2QBYA 4IKEA 1DO2A 2AXNA 3EG5A 5GADl 3WY9A 1C4OA 2ZRFA 4MH0R 4QRHA 3W34A 5A0FA 2PBRA 2JJ2A 1J70A 1G291 2A7QA 4Q9LA 4GT1A 3AKEA 3QY0A 4ZIRA 2R2AA 3R7WB 4F93B 5KNBA 3GLIB 5C18A 2NTYC 5JI3E 2J41A 4NYIQ 4BLQA 1KGDA 2FNAA 1HH4A 3NXSA 3QXXA 1P61B 1E9DA 3IO3A 4E07A 3LBHA 4OI0A 3B13B 3UG6A 4DLWA 4DLTA 1NVWQ 2BKUA 2H7VA 2O5VA 1UFQA 1EG7A 2BCJQ 3DDCA 4U5XA 4K46A 2V3CC 3CKLA 5B30A 3UXMA 1U0LA 4ZCIA 3T5DA 2OUKA 4KJZA 2F55A 1K8RA 1FQJA 4ESVA 3U3KA 2CLSA 3LVRE 3NBZC 4B2IA 2ZR0A 3D6TB 4O2RA 2FSFA 4CVNA 1NMZA 1M7HA 2G1KA 4HDCA 4P33A 3WYGA 1G41A 3SU8A 4EPTA 1ZAKA 1M1YE 3B1YA 4IVRA 4JLPA 4A0FA 3T61A 4ZKEA 2IYQA 4RVCA 3AF4A 5CDFE 4UJ3A 2A5DA 2C96A 3DL0A 2YHSA 3VHLB 2BBWA 2OCYC 1X8KA 2QI9C 5KSZA 4QBHA 1KSJA 2QE7D 5KHOC 3AF2A 2I1VB 1FTNA 2J3EA 2V1XA 2VHTA 3QJYA 4OK5A 5FTKA 3O47A 1M6NA 3GLGB 3U4QB 4GZMA 3MSXA 4Q4AB 5FBRB 2TMKA 5DE3A 3L0IB 4M4SA 1Q22A 4DLXA 3JVUA 4PSVA 1ZM2A 4B6EA 3BBPA 3FGNA 2ZI6A 1YQTA 4LYAA 4M1MA 2QE7A 1N0UA 4M9ZA 5DI3B 4B2LA 4FCVA 3EZ2A 2WOJA 1U94A 4D81A 4EQ6B 2QL6A 1GILA 3GJ3A 4AURA 4IOJA 4NCNA 1V43A 4A8JB 1Z6YA 2FZLA 4QM6A 2WWGA 3UKDA 1G3QA 2HXSA 2YNMA 3GFPA 3QF4B 3ASYA 1OIVA 2BM1A 2ZJYA 3NH6A 1MOZA 1Z0JA 1ZC3A 2IXEA 1R4AA 3AV0B 3K0AB 4RFSB 1RPZA 4H9GA 1HE8B 4LYJA 1EESA 1NF3A 3FPAA 3PUYA 3K53A 3K9HA 4QNRA 1HYQA 1KI2A 1N6PA 2WSSA 3A37A 4BEBA 2H5EA 2ZSFA 3ASZA 4WXPA 5GJCA 3RC3A 4N0DA 2NZJA 2VQSA 2HUPA 4WVFA 4RD1A 3QXHA 2X2FA 5ELXA 2EVWX 3Q72A 4FMDB 5BXQC 4EPVA 721PA 2H16A 3MLEA 3ADKA 1ZU5A 1U9IC 1KK0A 2GZDA 5FL3A 2ASEA 3CNNA 3DOEA 2J46A 2VH5R 5HE9A 2ZAMA 4G1UC 1IXZA 1FP6A 2B6HA 4LJ9A 3CUEF 1VG0B 1KIMA 1GFIA 1ZVQA 3MAAC 2WWHA 4YMWA 2OILA 1R5NA 2OXRA 4C0JA 4TLBA 4ZO4A 4D82A 4URVR 5CJPA 4Q4JB 2IYWA 2GJSA 3BERA 2J0QA 1Z29A 1P9WA 4K81B 4RY2A 4PHFA 2OHFA 4PAOA 2IS2A 1DAIA 3N2IA 4XWKA 4O3MA 3QNUA 3CPHA 4TL6A 4C0KA 2ONKA 1TF2A 4QJ4A 3SJBA 2YWGA 3EZ9A 1U98A 2C9OA 3RDPA 1WE2A 1II8A 1TTTA 5HCIA 1AQYA 4OJKA 4DSNA 5CITA 2IS1A 1Q12A 2GHIA 2GZHA 5CK4A 5J47A 1E94E 3T06B 2D3WA 1U0HC 1Z28A 4P3YA 1GNPA 2CXXA 5FFMA 1AS2A 4D4MA 3CNOA 2IYTA 2OCPA 1T8TA 4D4LA 2JLUA 1ZIOA 2FEMA 3E2IA 2QTFA 4IOMA 1ZM3A 4DZZA 3AVYA 3P26A 5HPYB 1TEXA 4X8LA 3OIUA 1A1VA 1TAGA 4M9QA 2PZGA 2V6JA 3VR6A 4TN1A 3SR0A 1IQPA 3W6NA 1WCV1 4BLTA 1JECA 2GCOA 4DBLC 3B2EA 2QMOA 1QHHA 3UMRA 4OI2A 3M1IA 3NC1C 2G83A 2G9NA 4IXMA 4PHGA 3C7KA 5J4YA 3EPHA 1DAMA 4PQFA 4J0QA 4YLGA 1JALA 1I2MA 4AIIA 3AVXA 2QAGA 3KFXA 1G8YA 3MUFA 5AWFC 3MWLA 3ZVMA 1VECA 3FMIA 3EAQA 1TMKA 1L4YA 2VO1A 3UANA 4DCVA 4B3GA 2WJIA 2OLKA 1P5ZB 1HT1E 2DCUA 1QDEA 5EE5B 1ZD9A 2KSQA 1OSNA 1FL9A 3PFIA 3BOSA 2QA5A 2KB0A 4K8OA 4F4IA 2XXAA 2Q3HA 3MG9A 4LHZA 5FPHA 2ZE7A 4F4CA 2O8BB 2QENA 2EFEB 5DYIA 2ZRNA 2P6RA 1C1YA 3O8RA 3CLVA 2ZRDA 1R0XA 1DAKA 5EXSA 2W0SA 1SVMA 4QBIA 3ZYCA 3EIEA 2QPOA 4Q03A 1OIXA 4ZI2A 2OE2A 2RGNC 1DARA 1DTSA 4TMXA 4IRUB 2BEJA 4ZDJA 2AK3A 3TR5A 4H1UA 5JSZB 2ANCA 1E2KA 1R10A 3LXRA 3QVUA 1AS3A 1NN1A 1UM8A 2CK3D 1U8YA 5HCNA 3TAHA 5UKDA 3K0FB 3N5CA 1GIAA 1NP6A 4LBYA 3FHTA 3PUXA 5IRCD 1JR6A 1OHHD 3I8SA 1I4TD 4D0NA 2ZR9A 3K1JA 1CJKC 3S1AA 4QHSA 4MRNA 1E9CA 3AB3A 4AC9A 4BRWA 2CK3A 2HV8A 4P31A 2O0HA 4UNSA 1AM4D 3TAUA 2DBYA 3LVQE 4A6PA 3CWQA 1NN5A 1OIWA 2RKOA 4W7SA 1P2UA 2JCSA 4NE2A 1NJFA 3ZQJA 1E0AA 4Y0VA 1VHLA 3VU9A 4A0RA 1OW3B 4OK3A 1OHHA 1W46A 3SJCA 2F9LA 4LPKA 1BYIA 121PA 2A9KA 1M7GA 2ZRLA 5KTYA 1T5IA 2DFLA 1U2RA 4M9SA 1KI1A 4M1TA 2N1BA 2OFXA 1G6HA 3BB3A 4TMWA 1JXMA 3TGPA 5FR1A 3EZFA 2ZI5A 1OXVA 5LDDC 4JLAA 2P67A 2IF0A 2R6GA 3A8TA 1XMIA 4PC1A 2HF9A 4CT5A 5LD2B 3PEYA 2ODNA 3REFA 1OH7A 1OXXK 3QQ5A 1F6BA 3P20A 5JHHB 3F8TA 3PUZA 4KU4A 4MRVA 3MJHA 1P2TA 5L3SB 2BHRA 3BH0A 4DLRA 1CRQA 1WF3A 4IXNA 3LBIA 4PC2A 1NN3A 2JJ1D 2ZSEA 4WZBE 4ON9A 4M2LA 1P2SA 1YJ5A 4HEJA 3BH6A 5FOSA 5FUVA 5KOYA 1KJYA 1YR8A 3CRMA 4MDEA 3U6BA 3KQLA 1KOFA 3MWKA 3RANA 2MMGA 3A4NA 4DLSA 3EPKA 1FNMA 4PTLA 4WZ6A 3GJ5A 5GJVC 5AUNB 1J8MF 2FF7A 4QXAA 2JJ1A 3GLHE 3SS8A 3U44A 5EQTA 1YZUA 2WWXA 4BZXA 3CF6R 1AQUA 3D31A 4JLKA 2XNDA 1L7VC 1LNZA 1U9IA 1UKEA 1JR3A 221PA 3CH4B 3HU3A 3K9LA 4DDUA 4A0HA 3I5XA 1ZW6A 2ZE8A 2QORA 3UK6A 1COWD 4YMTA 1IN7A 2QMUA 5DSZA 1KMHB 3CR8A 1XDBA 3IQWA 5B58C 3GEEA 3R8FA 1MV5A 5E7IA 2CJWB 2FFQA 1Q21A 1VYTA 2C5LA 4HB3A 2G6BA 3VFDA 4P32A 4F7WA 1WBDA 2JLYA 2GZAA 3QXSA 1HE1C 2FG5A 4ZCLA 3QEOA 4DLUA 1SVWA 1FMLA 2NO0A 2XTZA 4PAQA 3VR5A 2FJUA 1COWA 1R0ZA 2VP2A 1GNRA 2FE4A 4Q7KA 1FNNA 5L8VA 2QGZA 1XJCA 1K6MA 3H84A 4NZYA 1E2EA 3AF1A 2G3YA 1NKTA 1R5OA 1UEIA 2AD1A 4ILEA 4LV5B 3VMFA 3T35A 2ZETA 1KJZA 4KFUA 4HLDA 3SI7A 4RD2A 3TE6A 3LV8A 1TL7C 2QPTA 1XMSA 3DHWC 4JBYA 1IN5A 1JXOA 5DN6A 1HQCA 5LB2A 4FMBB 4JVMA 3BK7A 4LV6A 3Q5DA 2QROA 5JS7A 4YDSA 2Q21A 2Z6VA 2B8WA 2VYFA 1ZINA 2IF2A 5E7JA 3IBYA 4MUBA 2YOGA 3SQWA 2YV5A 3IIJA 1KNQA 1E9SA 4JS0A 4KLZA 3WMFA 3QIAA 3SYKA 4Q4HA 1W36C 3IHLA 2XX3A 3TSZA 2UVQA 4C2UA 4DDTA 1X86B 2OSBA 3U7FB 3K9NA 2C98A 2UZ3A 4EJSB 3ONWA 4LC1A 1X1SA 3LXXA 4LCBA 3GLFA 2OT3B 4D26A 2DY1A 3EIQA 2ZXUA 2WICA 3SDZA 4AKHA 1RRPA 4M22A 3A6PC 1XTSA 1S0UA 3A1SA 1GRNA 4BFVA 1TF5A 4HAZA 4EAQA 3IGFA 3RS2A 1QRAA 4L9SA 1VCNA 1EFRD 4Q1FA 1D9ZA 1KI4A 1KI7A 3I72A 5EXXA 5EXTA 4B3FX 2Z43A 5HR5A 1IY0A 2HCBA 2ODWA 5AUOB 1OB2A 1D2MA 1CBUA 3PQCA 1QVRA 4JLBA 3W6OA 4M1SA 4CEIA 3IPYA 2WJHA 1P73A 2A78A 4TLDA 1BH2A 3JVVA 4DCSA 2J0UA 1EFRA 1XD8A 4FMDF 1OYYA 2NO9A 1XF9A 4D0GA 4NYJQ 1Z0KA 4MGZR 3V9PA 1US8B 2VSXA 4IOLA 1JBKA 5ANRB 5FPYA 4U02A 5JBQA 1AZSC 4S35A 621PA 1Z0IA 1FQKA 4R9UC 3C16C 5FBVB 4RZUA 3SYNA 1PUIA 2O8DB 2RB4A 1F2UB 1PLJA 1RFLA 2Q3MA 1OKKD 1XCMA 5BYKA 3CO5A 1ZYUA 2BOVA 2QRNA 2I1QA 1D2NA 5FOWA 4B44A 1YVDA 3NG1A 1IJFA 2IX3A 1SKQA 2IS6A 5B57C 2A5GA 2JAQA 1ZIPA 4A82A 2P2LA 2ZS8A 3ADBA 2LWIA 3L82B 1OKKA 1ZMXA 2ZRKA 4RZ2A 3THXB 2CHQA 2HYIC 3QBVA 1H8EA 2F6RA 3TRFA 3FMFA 2OCAA 4MGIR 3FB4A 3RSOA 4DSTA 4C7OA 2QZ4A 3KX2A 4NBSA 3GJ0A 1NBMA 1YZKA 1IONA 4QJ3A 1P3JA 4QNMA 2ZRAA 3AGPA 1G20E 4Q19A 3LLUA 1G3MA 3IDQA 2ORVA 4MQBA 2CDNA 3VNUA 3C15C 4DVGA 1PUJA 3GJXC 2J45A 2CEAA 3KB1A 3QOFA 3SEAA 2HT1A 3ZZ0A 4I1SA 3GJ7A 1CR4A 1YU9A 3EPJA 1KJWA 2GF0A 5JZVA 5JCZA 4NPHA 2H18A 2Q3FA 3QG1A 3QE0A 3I8XA 1NL3A 4B43A 1NNEA 2GJ8A 2BMEA 3IEUA 5G3YA 1NN0A 2GWHA 5K8UA 3ZQ6A 2AKYA 2ZSBA 4QGAA 1CULC 4TYNA 2DWPA 2WMOB 4US0R 3QKUA 3A36A 2R44A 3GEIA 4DSOA 1XPUA 1E6CA 4QGHA 4KFTA 1XRJA 1RVDA 1UEJA 1Z6GA 3I73A 4HUQA 3W3ZB 3D3QA 5FOUA 2XB2A 2XOKD 3WNBA 4RKEA 3WRYC 2OAQ1 2ZAOA 4JL5A 3RC8A 1XZQA 1OF1A 5FOVA 5EZ5A 4E03A 1II8B 3KJGA 1E69A 3QVVA 5EUQB 5A4JA 4CGZA 4PFSA 2O8CA 1ANKA 5JECA 4X8HA 5AJZA 1F3OA 1XTRA 1CJVC 5BYJA 4WAUA 3A1WA 4JLOA 4WW0A 3NEJA 3I3SR 4H1VA 3WXMA 3QPVA 4QGGA 4AYXA 3AVVA 1E98A 2FA9A 4RCYA 3F0TA 4C9BA 1FX0A 1D5CA 3T15A 4BRUA 2AD5A 1G18A 4DLYA 4Q9JA 2R6DA 2PLRA 1XEXB 3BH7A 4FIDA 1OXUA 1DAEA 5DHAA 4RZXA 1NVVQ 1SVIA 2ZU6A 3TW8B 5B2ZA 4F4JA 2VP5A 2VP4A 3SHFA 1FFHA 1D6JA 4LK2A 3R8CA 1SXJE 4BGDA 2RGAA 2VLIA 2W00A 3PIRA 1CKEA 5AUPB 4B3XA 5K8IA 3LW8A 1F2TA 2QQEA 1NIPA 3ICEA 1PZNA 2YVUA 2IYYA 2OV2A 4URYR 5EUMA 1CR2A 1DS6A 1F48A 4NYMR 3SZRA 1FP7A 3LWNA 4YC7A 4C3ZA 3EX7C 2O8EA 5TARA 2ZTSA 2BEKA 2A5FA 4IVPA 1U81A 3BRWD 3EXAA 1Q57A 1JPNA 4ZDIA 2WJGA 2WMNB 4PHHA 5JEEA 5DH9A 2VP9A 2GEDA 4UNQA 1G16A 2C2HA 1AIPA 4P4UA 3UG7A 2B7CA 1SKYE 1W36D 1KTVA 4FXPA 5J40A 1RRGA 3A1TA 3HU1A 3BB4A 3I1FA 3IILA 3CX7A 2ZSAA 3KDSE 4Z1MD 3ZD6A 1OXSC 2AFIE 3MCAA 2ZUDA 1N6KA 4DT1B 1KMQA 1X1RA 3E5HA 1XD2A 3EWSA 3IO5A 5KPDA 4OHWA 2IYSA 2DFNA 1X6VA 2IHBA 1DO0A 5EE1A 2I3BA 4TT3A 1QHXA 2J5XA 4Z1MA 3QSYA 4QG7A 2CBZA 3KXLA 3LFUA 5BW8A 2QPAA 4E09A 2X1VA 4EDHA 1DEKA 3U7GA 3H86A 4ZPXA 3CBQA 4UJ5A 3A1UA 4U7DA 1JAHA 3KUCA 4TL8A 2W6JD 1AK2A 2E9SA 3AKDA 2QAJA 2G1JA 1WXQA 5H68A 3TMKA 2RGBA 2FPKA 4FI3C 2ZITA 1KY2A 1T9HA 1NRJB 1XX6A 5KPJA 5DYGA 4CW7A 3CF0A 1WMSA 5KSOA 3QPWA 4W9MC 3ZLJA 4Q66C 3FYHA 1HT2E 3GJ6A 2W6JA 2F7SA 1VG8A 5DHFA 5JMTA 4A15A 1W7AA 2IA5A 4GOKA 5LBIA 4US2R 1XTIA 1CRPA 5GVSA 1YZTA 5DGXA 3U6KA 2A5YB 1D9XA 1IN4A 4JKYA 2FZ4A 4TTQA 1FTSA 4W5WA 3QG5A 1IXRC 1E9AA 4FCWA 1VG9B 3E70C 4MGYR 1Z0AA 2QGNA 4WZAE 2OFOA 1RZ3A 4MYCA 3BFVA 5EJEA 4Q4LA 3TJZA 3H2YA 3GLHB 1P62B 3M0EA 3BE4A 1CEEA 1AN0A 1Q1QA 4DLVA 3C4JA 4LYFA 4KVAA 4XVRA 2WSSD 1XJ0A 1ZJ6A 2EU8A 2CCKA 2F1IA 3T1QA 1OYWA 2A2ZA 2K5UA 2QM8A 1YZQA 4NCJA 4RFVA 3U3MA 4BZPA 1E2PA 1S9HA 1KHTA 5HZHA 2XZLA 2P5SA 2OM2A 2GJ9A 4EPXA 1N5KA 1KO8A 3BFKA 1J99A 2D74A 1ESNA 4FWIB 4OQNA 2YINC 2FMXA 5FBQB 4KITB 1TX4B 2IL1A 3NBFA 4GP7A 4ABYA 4A36A 3VR4A 2AL7A 3H0KA 3LH5A 3SOPA 3U60B 5GJBA 3AEZA 4XWAA 2GJAA 2WZQA 3U44B 2CL0X 1G8HA 3BS4A 1NKSA 2B21A 4B33A 2ECKA 5TV2A 3NTUA 2G88A 1CU1A 2WWIA 5H70A 2A30A 1Q20A 1L4UA 2ERXA 3Q7PA 3NDBB 3CH5A 4JYCA 3QUSA 1KI9A 4B35A 2ZRIA 5M04A 4NU0A 3EZ7A 5TB5A 4CEHB 2F9MA 4Q9IA 1EX7A 1E32A 1W0KD 3B1VA 1GDDA 4B71A 1D8TA 1NVUQ 3K9GA 4BLPA 2QUZA 4PPFA 1DBSA 3LX5A 1E2LA 3E1SA 3B8HA 3X1DA 5JRZA 1G4UR 4TMZA 1EFTA 2W2VA 3D7MA 1KSGA 1R7RA 5JJIA 5FTLA 1VIAA 3HWSA 1VDZA 3QKTA 1MO6A 3RHFA 4YONB 2ZI7A 2O8FB 3B60A 1R0WA 1W0KA 4G0NA 4I1UA 1CJMA 3RYTC 4B3DA 3ZS8A 4YMUA 1QF9A 4I1VA 2GKSA 2V4ZA 1W5SA 4JSTA 1KDPA 1G9XA 2BCGY 3A4MA 3CPJB 4FD2A 2ODEA 5TVKA 4V02A 1M8PA 4FWTA 3PEWA 1S9DA 2ZYTX 1KY3A 4GRAA 4Q5IA 3CRQA 1HUQA 2JDID 2ZRJA 4URXR 3GFTA 2YWHA 2BMJA 2QRZA 2R62A 3W3AA 2PEYA 1T3HA 2C78A 1N6HA 2UKDA 4HB4A 3UWKA 4IEIA 4B47A 4L9WA 4B73A 2ZIAA 5TDHA 4Q48A 2XAUA 4G5GA 3H1TA 3AKYA 1G3UA 1RIFA 3OFND 4LHVA 1I4DD 4BFZA 3QKRA 1E9BA 3BB1A 2W58A 3P4XA 2JDIA 1TU4A 4BECA 2KI5A 4QGFA 2F3TA 1YZGA 4LHWA 2FN4A 2WIAA 1DG1G 3PV0A 4NYIR 4PO1A 1G5RA 4PZZA 4C0BA 1XNJA 4Q21A 4KBGA 5EP3A 3F5FA 3NBXX 4BZQA 3OFNA 1XMVA 3RS7A 3TSOA 3CX6A 2JJ8A 4ARZB 6Q21A 3DM5A 4HAXA 2QN6A 2JLZA 3THYA 1OH5A 1XEFA 2V55B 1XEWX 3I32A 2VF8A 3PITA 1JAIA 1OB5A 1OH8A 1EFHA 2WSMA 3RS4A 1G64A 1BKDR 5E95A 1II0A 4JMPA 1XWIA 2RHDA 4I1OA 4OHZA 1RKBA 4C30A 1IAQA 4U00A 3TNFA 3QEJA 5D3MA 3LRPA 4B2PA 4NKRA 5JFGA 4KLNA 4CEIB 1G8GA 4NMMA 1AKEA 1XXHA 4G5OA 4S2EA 4DUGD 3IEVA 5CYOA 4JLJA 4B3CA 4TLEA 2NO1A 4DHEA 1CTQA 5KO2A 4MGKR 4TYYA 4F91B 3WRXC 1VYVA 3AVTA 2XTMA 2EW1A 2IXGA 5L3VA 1VCMA 1F5NA 2JEOA 1U99A 4C0SA 2GTPA 3GLIA 2BM0A 3R7WA 4DUGA 1KO4A 4DCNA 1MO5A 4KI0A 3GP8A 1GL6A 3HP1A 3C8UA 1A5TA 2OG2A 1P75A 3LBNA 4HZUB 1XXHE 1QG4A 3R20A 3SBDA 5BN3A 2ZVQX 2C95A 2WKRA 5SZHB 1VG1A 4MKFA 4IDHA 1Z8FA 3VNVA 3LAWA 4LJYA 3TLXA 1OT3A 3THWB 1KZ7B 1GRRA 4QFMA 3SN6A 2BKEA 5FTNA 3L0OA 2EYQA 1RRFA 4BE7B 5BQ5A 1J90A 3WBJA 4RJLA 4C0AC 1TQDA 2AR7A 4G5QA 4MKIA 4Q7JB 1Z22A 3B1WA 4D80A 2P6NA 1G3IA 3DMNA 1KI6B 1E2QA 4AY2A 1GM5A 5CM9C 2CVFA 1A2BA 2AN9A 3UATA 5KDDA 3NVAA 4RKFA 1HTWA 4X8OA 5FUXA 3K09A 3PENA 3WYFA 1XCPA 1NJGA 2XZPA 3L8YA 1H65A 1KO1A 2QT1A 1A2KC 1E79D 1R0YA 3HU2A 4BLSA 3WYAA 1QHGA 1QHSA 2ZSDA 5IHPA 1DVRA 2CVHA 1E9EA 4M1YA 4Z8YA 5EZ6B 1E9FA 4L15A 4B75A 2JLXA 4M21A 2E1RA 4Q1BA 1E4VA 4OBEA 4OL0A 3CX8A 1KK1A 5JRJA 3GLGA 3U4QA 2JLQA 4Q4AA 1YR6A 3WMGA 1QHYA 3EC1A 2QMEA 3OF5A 4Z8XA 1SZPA 4Q00A 2RGCA 1E79A 3AVPA 2GVZC 3L0SA 3ZD7A 1W2GA 4ITRC 4YQFA 2QQ0A 2WHXA 2F43B 3CRW1 1QHIA 1P60A 5G3ZA 3U3JA 5DI3A 5LD2C 4TYPA 3HYTA 4NP6A 4EQ6A 2XNDD 1W49A 1KDTA 1E1RA 1JR3D 2GDJA 2IYRA 1OXTA 3RS0A 3RABA 4A8JA 4DC9A 4DEYA 2O8CB 3AF0A 3OIYA 3B9PA 4QOSA 3CPEA 4URUR 2ZUBA 1S1CA 4DIEA 1SXJB 4QKQA 4OHVA 2CE7A 4DRZA 3IKJA 2A3RA 2GF9A 3K0AA 4RFSA 5FOTA 3PJRA 4HLUA 3U3RA 1FX0B 4PAMA 1GKIA 1RW4A 3NWJA 1G3RA 2IUTA 2XZOA 1NLFA 2AHOA 1JJVA 3T12A 1LV7A 1Z63A 4AKIA 1NLYA 4RD0A 3TVDA 1P4SA 1Z6TA 2V1UA 3FMOB 3O8DA 1OFIA 4LYHA 2R6FA 4KYIB 5G41A 1N6OA 3RRYA 3B1XA 4B34A 4ZI3A 1Q1EA 1EK0A 3GMTA 3FMPB 2Q6TA 3QBTA 2WWWA 1XP8A 1SKYB 4TMVA 3NDPA 4XIGS 4IFBA 1P72A 1JR3E 1E9RA 5DN6D 1E2NA 3CONA 4C0QC 2NPFA 1QVAA 1W44A 1KO5A 4OHYA 3MFYA 4CEJA 3KXKA 5KUTA 2R6CA 3Q5EA 5JJKA 2DYKA 1IJEA 2ZR7A 4CDGA 3OAAA 1E99A 2IS4A 2ZREA 1DAGA 2VIIA 2WKQA 3KXIA 4JSYA 4PSKA 5FI0B 5HE8A 1T4GA 1G5TA 2CCGA 1ZP6A 2QBYB 1LVGA 2JGNA 4KBFA 4TTRA 2ODBA 3U61B 1GAJA 4JBXA 5AR1A 3RS5A 1BOFA 5J4LA 3KJIA 5FTJA 4RD4A 4BFTA 4NCKA 4ZIRB 5IK2D 2XJ9A 1P7CA 3DVLA 1QHNA 4MKGA 3REGA 5A5GA 4XOIA 3FFAA 2G0TA 1IHUA 1SHZA 5TY0A 2P0EA 4IVQA 4CRWB 2OXCA 4V0LA 3Q7QA 3TBKA 1W36B 5IK2A 3KJHA 4GSYA 1LTQA 2MSCB 4GPTA 4KSBA 4JVSB 1GSIA 3DMDA 3HR8A 2NOAA 2ZANA 3I61A 3OEEA 1NI3A 2Q9CA 2KBFA 1VHTA 3EIHA 4RD3A 5FI1B 4XSGA 4PZYA 1L8QA 5L3RA 3TW4A 1HQYE 1AS0A 4II7A 5J4HA 4ZCMA 1Z07A 4KVGA 3KJEA 4V0MA 2EWVA 1NVXQ 4B74A 3QI2A 4TYWA 2CNWA 3WMEA 4UNRA 1M74A 4LPSA 4Q47A 1GKYA 2LKDA 2V8OA 2XGJA 4HB0A 4KXFB 3UIEA 3DOFA 5D3QA 2AK2A 2EFGA 2IXFA 4ZDWA 2FFHA 1Z5ZA 3TSWA 1U0JA 5C2JB 1DOAA 3GLFE 1I4LD 1RJ9A 4L4UA 2QU8A 3FTQA 2MMCA 2DFTA 2DR3A 2FOLA 4BEJA 3K0EA 2XSZD 3OIVA 2ZJ2A 4M9XA 1IM2A 1HV8A 4TQ9A 3ZZTA 3P32A 2P65A 3C14C 1RYHA 2ZUCA 1BO6A 2DB3A 3RWMB 2YZ2A 5SZJA 4QBFA 2O8BA 3OIWA 3RSLA 2C03A 4WIAA 4A92A 1H8ED 2EWWA 5CYPA 3KQNA 4OQXA 1GUAA 2ZI3A 2Q9AA 1HA3A 2C9CA 2P5TB 2PX0A 2XSZA 4TQAA 1TUEA 1NBMD 4NH0A 1ZM4A 4PO8A 1KK3A 2J87A 1SVLA 3FKQA 2F3RA 2IUSA 3UMFA 5C1BA 5AK0A 1CJUC 3B7GA 1JEEA 4JJZA 4IHQA 1KYIA 1ZBDA 3B82A 2GCPA 4TTPA 4MYHA 4I4LA 2LKCA 2WOOA 4IDQA 5JSZA 4Y0AA 2H57A 4TZ0A 4US1R 3WHLA 1Z0FA 2KE5A 1WB9A 4L16A 3AF3A 3W5IA 2D2FA 4BLOA 1UDXA 1E2HA 2FGKA 3K0FA 1E0KA 1Z83A 2D2EA 5EE9A 3KL4A 3SYLA 4NL4H 2GAAA 4B48A 2DWQA 3VR1A 1VTKA 2IBMA 3KQKA 4W5HA 1XD9A 4LWZA 1Q1BA 1VMAA 2WWFA 4D4KA 4O25A 4AD8A 3B6EA 2HLDA 4NCIA 5AUQA 3CB4A 4M0LA 1OH6A 2X2EA 3K70C 4V03A 2QNRA 1NBME 4DDWA 3T1OA 1W1WA 3LY5A 2D7DA 5K8TA 5CM8B 4DXAA 1LB1B 2HDNB 2VA8A 4ASUA 4OQMA 1MO3A 4LY6A 3BXZA 3CZQA 1E2GA 4P4SA 4PHTA 5FBLB 4AKGA 1ZRHA 2RAPA 3DKPA 3MRSA 4LBWA 421PA 2Y8EA 1FMJA 1JQLB 2NPIA 1RE0A 4QJ5A 3I92A 2V54A 4OJQA 2BDTA 1LY1A 2GBLC 5P21A 1TADA 4NHOA 3KQHA 4HAYA 4RZ3A 2CL6X 1NMYA 3V4RA 3C5CA 1YRAA 2YWFA 4LSGA 5FPSA 2ZJ8A 5L3QA 4HSEA 1WP9A 2ZE6A 1ZCBA 2QY9A 4LDJA 5L3SA 3AM1A 2EYUA 2QP9X 5HTKA 3TVTA 2VSOA 4PZLA 2JLWA 2Q0HA 2ZS7A 2YC4C 3KTAA 2C8VA 3MD0A 3R9XA 3BFXA 2BMDA 4JZKA 3T34A 5JWOA 1W4AA 1Q0UA 2QMHA 2ZI4A 4C0HA 4KO8A 2C04A 4QL3A 1J7KA 2PMDA 2V9PA 4L5BA 3PCRB 5LPNA 2ATVA 2WJYA 1HEIA 2I4IA 2AXPA 1JPJA 1QBKC 4DB4A 1NSTA 3QKRB 1SVSA 521PA 1T91A 1B23P 1QG2A 4Q1AA 1FUUA 5CIQA 1SGWA 2VHJA 4A9AA 2GCOB 4N0EA 4Q9HA 1E2IA 2GEVA 4DIDA 3FHOA 2BBSA 4HUTA 1P6XA 3M4YA 4LOAA 1QHHB 3TQCA 2D62A
chains in the Genus database with same CATH superfamily
5MN6A 3WQBA 4ZJZA 2VJMA 3KSZO 3CIFA 1YMUA 5I9MA 2E0IA 4HNSA 1Y33E 3GRVA 4S1NA 3L6DA 5H16A 2RSLA 4ME6A 4Y1EA 3ZDQA 4WH0A 3CCFA 3CW2A 3F5DA 3IDSA 4A8TA 1KMHA 4TV9A 3Q3HA 4F3CA 3AK4A 1G7CA 1JFLA 1B3BA 1QVVA 3GB9A 1N2EA 1WV0A 4BX9A 3M9LA 4XFKA 4EKDA 1KMCA 4B8YA 3OWXA 3VXKA 4BC0A 2CXRA 2IEIA 4P86A 3IVAA 3WDSA 3L6EA 5HFJA 1PVOA 1PWXA 4U6NA 1Z2CA 3DV2A 4UC0A 3FTDA 4BMZA 1EFPB 4K26A 3V1LA 1VFNA 4EF5A 3D5EA 1PYGA 2X8BA 1TQ4A 4FLMA 3D2AA 1EDOA 4GI2A 4UOQA 1RXWA 3B9QA 1N6NA 2ZRPA 3AHGA 1ORIA 4TT3D 3REQA 3ZD9A 4JI0B 3ICWA 4ZAWA 3CLUC 4AWXA 2Z1DA 5G0SA 5C46F 3K1AB 3L5OA 4LF6B 5LLTA 4EBFA 5BQOA 1JZTA 2DLCX 5FAKA 4B80A 4AMGA 2F1HA 3FZNA 1NXTA 3ENQA 4XTCS 2P6OA 1A4IA 2OKCA 2XTNA 5AI6A 5FORA 3A0UA 1M2VA 2C2GA 3JD2A 3CE6A 5HHTA 1GYRA 1FFDA 4JQSA 4H59A 2FMIA 1DT3A 1NUUA 3JAWB 4OKIA 4COOA 5E8JA 4OB7A 1GVNB 1EVQA 5KQLA 5IW8A 1U8ZA 4ZOLA 1J0XO 5IT5A 3OTWA 1LCIA 4DAOA 3PGLA 4FU0A 5JYBA 4CM5A 1XZCA 2G76A 3OM0A 2WIDA 3SC4A 4LBVA 4FK8A 4EFMA 4HEQA 2XCLA 4G97A 1JNYA 3AT1A 4JJ4A 3J81k 4H08A 3AJ8A 3PD7A 5EXDA 3U81A 3TVYA 3WB1A 5DSTA 3V2IA 2GS9A 1UDRA 4G4IA 1YI0A 2IE0A 3LD9A 1N33B 1NG1A 2C3YA 5LXTF 3AVUA 5EYPA 3ICQB 2ZEJA 2FJPA 3VU9B 5F9HA 1DO8A 1GTMA 4RK6A 4X95A 4EB6B 5F9FA 2RJNA 3ZVRA 1K97A 1HETA 4G0OA 3ZDZB 2BE7A 2FPSA 1XKLA 2MSWA 2FUEA 4BWYA 5KX5F 2DPHA 1OI4A 1Y8AA 2AOWA 1CHNA 1FF9A 2GAOA 2UV8A 4HGQA 4RABA 2NXCA 1DE0A 3UA3A 5B7PA 3V8VA 3RRNA 1F9EA 2BZ1A 3FGPA 3G5UA 4KX3A 4TWZA 5ECDA 5KYWA 2V59A 2V65A 2XT9A 1NWCA 4DDVA 3QBEA 3D8HA 2IYLD 2IODA 5A0VA 3K3PA 5FL7D 2IKSA 3EBLA 4PAGA 5JYCA 1GYPA 3B1ZA 4QQKA 1Y9JA 1O95C 2NZXA 4FB4A 2GN0A 4GC9A 5JZ9A 4EMBA 1W0JD 1UDWA 1ULHA 4EOGA 2WAYA 5CNJA 1GZUA 1HOTA 1Z36A 2I34A 3NEYA 3O3OB 4OPMA 2LR0A 4X0EA 2GCNA 3QVXA 4OI1A 1RWBA 3HCCA 4NH4A 1MAWA 1NSYA 5CH3A 5C3UA 3W79A 2JGKA 1UJ4A 3BJIC 1DXOA 1FJ2A 5FL7A 4ZVRA 5BW6B 1S3GA 4D74A 1L4NA 3B9BA 1NIJA 4S1PA 3NEPX 2BC9A 4XPZA 2PT5A 3I28A 1CDZA 1RI3A 3H04A 3OZXA 2YXNA 4KLAA 4OXYA 2QR2A 2JIPA 4B6GA 1JVBA 1KJ8A 1W0JA 4GPBA 2AEMA 3T7TA 1ZH8A 2PMKA 3EWIA 1A97A 1Z0DA 2Y1LA 4MV6A 1Z06A 1QGAA 3KAKA 1JJAA 4NBNA 5C8YF 4OB6A 3F7NA 3VHXA 4BFSA 2O0KA 3UW3A 4BP9A 2FN7A 2Z09A 3ZXYA 4OAQA 3THXA 3BKWA 2UUBB 5JS1A 3VPAA 5LQNA 1GFZA 4OOFA 1UBGA 5CUQA 1BE1A 1JDNA 4PGMA 1FZQA 2SKCA 2WFAA 3KWMA 5D6OA 1A8QA 4MGEA 3QEAZ 1JPVA 2ZPTX 4OHBA 4JUBA 1NY6A 1JJ7A 1MOQA 3M1AA 4MWZA 1G8MA 4WADA 5DOZA 5TS3A 5IF9A 1W4BA 3U4IA 4KWCA 2H17A 3PUIA 3QPUA 4H1HA 4LG1A 2ZYRA 1EJ2A 3UJAA 2WQZA 1N2CA 5C37A 3EEOA 3PKZA 3QJGA 2OO5C 1PG2A 4IJQA 4RYLA 1M1NA 3VV3A 5JDIC 4AJ1A 5TGZA 3U7JA 1UMDB 4C08A 1QP8A 1ENYA 4IDOA 2JI6A 3AFHA 1DRJA 2VUHB 1H2XA 2B4AA 2A0UA 3AHCA 3OJFA 4HPJB 3N8HA 2FR8C 2YJ3A 5CLHA 4PNPA 4ZYUA 1WY5A 1I51A 3GEPA 1IUKA 1ZICA 2BTOA 2DPXA 4G84A 4QQRA 4XGQA 1EAMA 2AOUA 3SR4A 4AX8A 4MDFA 4NOMA 4W5JA 3TLAA 1W2WB 4HWKA 3LOPA 2O1WA 4PANA 1FYEA 1PBNA 2WIKA 3FSRA 3H0EA 3SD7A 5LQMA 1N2CE 4GPAA 4HI0E 3STTA 3ZKAA 5KYNA 2N47A 6ADHA 1IQUA 1CNFA 3L92A 1LBIA 3D9QX 2CLMB 5F73A 1PR9A 2XB4A 2YC2C 1LLQA 2GESA 3O2JA 4WN9A 3FX2A 1NF8A 3UAZA 4CIDA 4NCHA 2VQ6A 2AKEA 4DILA 3KQVA 2AB0A 1W5AA 3GJ8A 3OHMA 3X1XA 2O2CA 1BS2A 1JMYA 4U9HS 3SF8B 1NBAA 2EX0A 2I7CA 3ZCSA 1VYUA 2XGGA 5JMWA 2VWGA 5EPEA 3RVPA 3G9XA 3H83A 2WV9A 2REOA 1OWPA 4D5EA 1KZGB 1VLHA 1J25A 1ORRA 5C9ZA 7GPBA 3EUWA 3TQRA 1KRHA 1T26A 4BNIA 2QYOA 4TLAA 1UAAA 4ARCA 3HI6A 5AK6A 3PR1A 4MI6A 4CG0A 2J4FA 2YZ7A 2ETXA 3HGTA 1AH2A 1RYBA 4V24A 4N8SA 3GFVA 1G8PA 2VSFA 3AO0B 1KJ9A 2LCIA 1AA9A 2PLNA 2WPDD 4LXHA 4LWOA 3Q85A 1ZI9A 4PO9A 4PZDA 4WNAA 3TG2A 4PX2A 4J16A 3GLFB 1E7SA 4JU9A 2ZE5A 4JLMA 3L1KA 5EE3A 1GP2A 1XEXA 3ANLA 2XA1A 4MS1B 3S7ZA 5BNIA 1F8GA 1M1ZA 2EJBA 2O6HA 2YOHA 3A6LA 4GGMX 4GI3A 4OGWA 2WJWA 1NMEA 4RK7A 2JZNA 1TUIA 3OFKA 4NEGA 4UASA 3P9NA 1HPLA 5HKLA 1X3SA 4F12A 2XMRA 2WPDA 4A27A 4D43A 1A2OA 2XQKA 1YRQA 2OA0A 4XR4A 4RTLA 1PR6A 4RIEA 2HEIA 1SKMA 3AHIA 2PJZA 5JI2E 3U1VA 2PVSA 5EINA 4L4ZA 1I2DA 5EIFA 2OVBA 3P0EA 4E12A 1TRHA 2D7CA 5AHOA 3MWJA 1ZKDA 5KNBH 3ETLA 5D8DA 1OPXA 1H8HD 2CFTA 3LC2O 4YH1A 4JI4B 3VTAA 3GA7A 2N1MA 2R1TA 3LP6A 1UKYA 4JBHA 4PLTA 4YJHA 2XWJI 2PEZA 3KFLA 1OV4A 1RJ9B 1MH1A 3PS9A 4JLUA 5ICSA 4ETNA 4DR1B 2WNHA 1QYXA 2GUGA 3ZE6A 4HRVA 1GGNA 2WABA 1AUVA 1QGZA 2JZOA 5JJLA 1G7SA 2PRIA 3ED5A 1KH3A 1GADO 4MLZA 3N2ZB 1ZNYA 4WA8A 2XUPA 2H9IA 4EG0A 1ONBA 1H8HA 1F14A 1CZRA 1YJAA 1D03A 2I2WA 3PPVA 3GLKA 2EJCA 4ZT4A 3RUAA 4IIHA 5ITSA 3I1JA 4DPKA 4AP5A 2G28A 4KQEA 2CXNA 1MEOA 1QH1A 1VI6A 2I99A 2W2XA 2IUFA 1BQEA 4CNBA 2JJQA 4EWLA 3G0HA 1U6IA 3FTFA 3JYOA 1UPBA 1T4CB 1K92A 3AOEC 4OQZA 1SR8A 2OPHA 4DABA 2ZRQA 2Q28A 3EXHA 2LNDA 3SIPA 2IOHA 1NBEA 3P7MA 3NHMA 3I04A 4V38A 4CPDA 3I12A 3C1AA 1YD7A 3DVSX 3E58A 5AKJA 4P2GA 4Y2SA 1NXOA 3RE1A 5JCJD 4MEBA 3P5SA 3OIGA 4B6RA 1KK2A 1OI7A 1PNOA 2RMKA 3GQBA 4MZXA 3TZKA 2AFHE 3AXSA 3SMQA 4MS4A 2XMQA 3G2MA 4FCTA 1ETUA 3L8ZA 1U9CA 2X22A 2PD6A 2QMQA 3ZTTA 1E3SA 1N5JA 1DWUA 1ZC4A 2WJVA 3H42B 3AIMA 4P4NA 2OZVA 1FUKA 2AI1A 4PLZA 4BNKA 1MORA 4XGIA 1JW9B 5FR2A 3DCNA 1VKJA 1DFHA 3JVIA 3LCCA 5JCJA 3JQQA 4DEXA 1EIWA 3AGQA 4ER3A 3DBRB 4JGBA 5AM4A 1SBTA 1YIAA 2NTVA 1CB7A 2HJ9A 3ONEA 4I66A 4AICA 5KTRA 2X7JA 3N39C 1LDYA 4JEIA 3RFXA 3EIUA 4MYUA 3D6FA 4UE6A 5BSTA 1DL5A 2W8BB 4ID9A 3OT1A 2RHCA 1FFAA 1FTWA 4XM1A 1PCXA 4D9GA 1IOLA 2H63A 3M3HA 2WD7B 3TSCA 4BLRA 1M8KA 2MTBA 821PA 3VQTA 4CFZA 2PZFA 4EJMA 3IUYA 3A9RA 3FUWA 4Q18A 2YRWA 1N3BA 4NNJA 1RBYA 3AKCA 1HNWB 4YRPA 1AJEA 2M1XA 1KDOA 2Z56A 4B7ZA 2XWBF 2BFOA 3NEAA 1Z2AA 2NUPB 2WEKA 1KI3A 2RH5A 2Y92A 3DVAA 3JU3A 1K6JA 3LL4A 2J32A 4HUQB 3QHPA 1UBCA 2NZ2A 4LQ4A 3QYJA 4KHZA 1N2ZA 1CY1A 3G0BA 1R8QA 3TS1A 1ECLA 2JA2A 1JN0A 4LX0A 5JISA 1RFGE 2CJYA 4YJ3B 1YU6A 4XH9B 5IANA 2Q1WA 1S4QA 2ARKA 4C2AA 5FIUA 4H0NA 4B3GA 1JSCA 3LKVA 4XLTA 4NOKA 3IQHX 4BNYA 4B4UA 4NVRA 3QF4A 5IM4F 5KX5B 4YYEA 3AHHA 1PT5A 2R8BA 4QQFA 1E7WA 3H5IA 5ESWA 4HBZA 4CQNA 4D9HA 4AY3A 3OZUA 3MGCA 4C2BA 2I6XA 2RC6A 3FVQA 1VE3A 2XIQA 2ZVPX 4CZ2A 3ONFA 2VSNA 1YUMA 5KWEA 1Z73A 1E6LA 4M0MA 1FTQA 3COVA 3PUVA 1CCWA 1L4LA 1V5IA 3EOAI 4MIKA 3V8MA 3QTBA 4ZI7F 2W2TA 3TQTA 4L07A 2G9QA 4PGHA 2HQOA 5K20A 1H0SA 4WN3A 1KI8A 4H3HB 5AM5A 2NZYA 3I53A 3KWJA 2HHHB 2NMVA 1T8UA 3OAAD 5F5XA 4YA6A 3FWYA 5AM1A 2OZEA 2REQA 4AXXA 2FKNA 4BFUA 4JCCA 5CFLA 1Z4OA 5PNTA 3HL4A 3UJPA 4M54A 4MLCA 3FOEC 4ZV9A 1P9OA 2J5RA 1GKUB 1CP2A 2YS6A 4TS1A 5HG0A 3ZHQA 1F2TB 4E5VA 4K9LA 5FUQA 5JATA 4HGPA 4J90A 3N2LA 4FE7A 2C8KA 2JATA 4XTRA 5FWAA 1QDUA 4UE3S 3B85A 2J6BA 3MMXA 2B7LA 3EE6A 2ATIA 4RD6A 1VPVA 1PL8A 2OAGA 1JB1A 2XJ4A 1GITA 1Y6ZA 4GF5A 3L6BA 1E0SA 3CJQA 4GI7A 3DMFA 5KWJA 2CL5A 2EKQA 4LIPD 4QFCA 4GI5A 1LSJA 3RVRA 2OGUA 3RSHA 2XNSA 1XPRA 5TMPA 2DAPA 2HXYA 4XX0A 2FXVA 3WK7A 4NPAA 4FZ3A 2IY9A 3RAPR 3UJBA 3WR5A 2FP4A 2IYAA 4GICA 1DEAA 4ESEA 3OEED 4Y98A 3CLSC 2WVJA 3VTKA 5LWHA 3CUVA 1WQ3A 3GN2A 3IULA 4RL4A 1E2DA 4H4DA 2OXTA 2ZBGA 5KOJA 5T4EA 2DEUA 3FAZA 3O82A 1UJMA 3M70A 1IXSB 3ZWMA 3G9TA 3FYTA 2C4TA 1JV2B 3HKBA 3OT4A 1M2OB 4EYGA 4LE0A 1QGDA 4MWBA 4PR0A 1FB5A 3KDPA 4IL5A 4ARBA 5LC1A 2E6UX 2HRRA 3ZK9A 5KS2A 2EL7A 2VP0A 1V8OA 4L5AA 1NLZA 4REOA 4UXIA 4YFYA 2C8JA 4PY2A 1T2AA 2C9YA 4C0LA 2CMFA 2PH3A 5HM6A 2GNOA 3PF9A 1Y5RA 3N9IA 3RGGA 3USZA 3PZRA 5K0CA 3GFSA 1K7FB 4JT4A 3K6RA 1U90A 1V16A 3O5AA 4Q82A 4H7DA 3K5WA 4LJKA 4RE5A 3ZY2A 1W6RA 2E7ZA 4HJRA 4HTFB 5C5DA 5I7RA 1OJ7A 4XQGA 2R65A 3W8NA 4EJSC 4EA6A 3DV9A 4I8XA 2HU2A 1MC1A 2J4DA 2OFPA 3QU5A 1I2ZA 2IXBA 1ADCA 4O6VA 2DG2A 3ZJYA 3E3LA 2IHZA 4RMIA 4AP9A 2YYAA 4XPIB 5FUYA 4OMUA 2IHJA 3S70A 2GPYA 2P9ZA 3R75A 3ICCA 4I8DA 3ZPXA 4A2QA 1M0TA 2R6AA 1FNBA 4AFNA 2A5JA 2RKBA 1U9JA 2FX3A 4XRRA 1Z35A 4V0KA 4A0GA 1YHZA 3A9TA 4R7ZA 3OE7D 3K0CC 4FKZA 4ZJUA 1BW9A 3AB8A 3NDJA 4MUXA 1OZHA 3DXXA 3ND8A 1Q5PA 3GCGA 4NX2A 2P9GA 4MEAA 2HTFA 2Y0DA 4BASA 2RG7A 1G8FA 1T1IA 1T3SA 3CXUA 4OCZA 4V0ME 1OBHA 2BGRA 1AC5A 3LO5A 2HIAA 5TXGA 1H4SA 1QV7A 3BXFA 1EVLA 3TQIA 1O87A 1A77A 2Z5FA 4EW3A 3GYBA 2COEA 4YRFA 1MRNA 4OBXA 3LYAA 3JQAD 4R1LA 4S05A 3F6CA 3KWLA 3OE7A 4FN5A 5B1HA 3IPCA 5A4MS 1NT4A 1XTQA 2QJWA 3QM1A 1E1CA 1AHPA 5DBHX 3B5JA 5JYEA 1QU2A 4L7VA 4P0TA 3MXTA 5JJ5A 1OWMA 2EATA 4UTRA 1HDRA 5JWRA 1EFAA 5C51B 1L7NA 1WA5A 5FLEX 4EM6A 1Z16A 2QG4A 5DISB 2EFDB 3MK31 4I5EA 2W2KB 3HLYA 1M76A 3JPWA 2JKVA 1IHDA 1YS1X 1L5HB 3JQAA 1SU4A 2IVFA 3ZH9B 2X15A 3LW7A 5AVRA 1NASA 2BFEA 2ZAIA 2BI7A 1HLPA 1O0BA 3N8GA 1UWVA 2HLDD 3S5JA 5IFLA 3ANSA 3NP7A 3OZFA 2REBA 1P45A 2VXBA 4KYUA 4PCVA 4BMYA 5I9NA 1C5KA 3BA6A 2P0AA 3WO0A 4W6ZA 3WIUA 3ZNNA 5FPTA 2YNMC 1TMYA 4HXEB 2ZJOA 5EKDA 3WYEA 1TD9A 2XXBA 4FMCF 3KPVA 3THWA 4FDAA 4K86A 3O4RA 3GFOA 4KV7A 5CDGA 4QUBA 2QMYA 3UPUA 3LKDA 3BD9A 1UKZA 1X1DA 2XUGA 1IN6A 3MTIA 3KQOA 5I5GA 5DTMA 2BELA 2DCMA 2ZIXB 4DNXA 4C5BA 2NU9A 4DRXA 5IN5A 2PRYA 3AESA 1MO4A 1T9BA 2EDCA 2INGX 2JBAA 2JLBA 3EEIA 3GEDA 3PXGA 4QXPA 1YV9A 1TK3A 3FPFA 1Q3TA 3OKFA 1H2WA 4I8IA 4FGSA 3K70B 4Q39A 3B3QA 4OHMA 3SHQA 4U5QA 1WU7A 3DDOA 4MAMA 4G5SA 3R0JA 1NMXA 2HSJA 1SG9A 2XYVA 3LNCA 3PP8A 4EJ0A 4X97A 2VR1A 1SFRA 2KPOA 4JYBA 3AHDA 2NACA 4K05A 4F9FA 1AGXA 5FUWA 3ETDA 3DW3X 5JAZA 2IRWA 1ZHOA 4QOHA 3HCAA 2A5LA 5IUJC 3P9ZA 4IF4A 4YUWA 2NG1A 2Q2VA 3K20A 3PFWO 4TS4A 1QS0B 5G1PA 2CD9A 1HDOA 4G0XA 4C21A 4K8RB 1N3IA 1PGOA 1S7GA 4FZJA 1KAGA 1L2TA 1A95A 2ANBA 2NADA 1G0OA 4J0JA 4NY1A 4PSCA 1C4WA 1RYYA 1YR9A 3VRHA 1VJRA 2O2IA 4HGYA 1MQ9A 1P2VA 2JPDA 1RKQA 4PQRA 4ZO9A 3GPLA 4G1EB 1Y82A 4Z1OA 4Z0NA 1LF0A 3VVMA 1MRSA 2QW8A 3O8CA 3OJCA 2MR5A 4O5AA 4ZT2A 3DCIA 4S2UA 1MGPA 3EA0A 2Y99A 2F43A 2DTXA 4N03A 4Y1GA 2VRBA 4EO9A 5J58A 3O1JC 1ZNWA 2H29A 4OP3A 1ELOA 5TGDA 2OCKA 2ZKLA 2UXCB 5ITZA 3AVQA 5K2OA 2HCJB 3COSA 4X66B 1XTUA 5DM0A 1LBQA 1NG9A 1C1XB 1XV5A 1ZVJA 2D06A 3QHQA 5LN1A 5BN5A 2YJTD 3M4NA 4OKSA 5BSHA 4ZTUB 2F59A 4RZSA 4WEQA 1E2JA 5EFOA 1BXRB 1HTTA 1BS1A 5F98A 5AVOA 3VKWA 4N1AA 1V8FA 2Z3VA 4YRGA 3C5EA 2Z9BA 4UW9A 1XA4A 2VJLA 3KYCA 5E2BA 4ACAA 4TTTS 1SXHA 3EXG1 2QSYA 1PVDA 4FYIA 1R0RE 3DZ8A 2UZ0A 3EMKA 3BMNB 4BPRA 2MSEB 3HMQA 4U7WA 4MUAA 4QU9A 5LQUA 4OH1A 4OH7A 3FFBA 4ZO6A 4D2IA 3GC6A 2V7UA 1GZ6A 4RH1A 2YR0A 4HYEA 2IPAB 3PNKA 3KUDA 4WFQA 3L4KA 1OE0A 3G0OA 3MTDA 5CIWA 5FA8A 2IS1A 4UAJA 1EK5A 3R41A 1WHTA 1WXFA 1KY5A 2ZK7A 4LTDA 4XVCA 5FH9A 1BWSA 3PHGA 4FDUA 4XB2A 1KEZA 1MABB 4DMMA 2H92A 2F00A 2Y0CA 3SSAA 4WNIA 2O5EA 1H2BA 3OSZA 1S6YA 4EUKA 4P3NA 2NX2A 2H00A 5D3MB 7MDHA 1Y80A 3PJFA 4D3FA 4JDUA 2UYQA 3PYXA 1C50A 3PU6A 1EHCA 4K2AA 3SPXA 2QAGC 2K4MA 2ZLBA 1ZMRA 3ENVA 2X5XA 2CNBA 1N1DA 1UADA 2BBOA 1GCAA 2IIQA 3Q41A 4CM8A 3WDLA 4YDRA 1L3BA 2P9FA 3I4FA 5KNBD 2H1HA 4XVQA 4GYJA 3AY0A 4P98A 4EFLA 1JYFA 5TC4A 3RUDA 4DJTA 1EJ0A 2RHWA 2ZWAA 2HWKA 3HBFA 4G01B 4YJFA 5EIAA 1MENA 1YZLA 2QBYA 3FZQA 1ITZA 3C1TA 1ARZA 3C3KA 4QRHA 1ZRMA 4LF4B 1E18A 2EZ8A 1ULTA 2D2IA 2WP8J 3OLCX 2YJNA 3OX3A 3PHHA 4MP3A 4XFJA 1NU8A 1NPDA 4U8HA 5AOVA 5A0FA 1A9OA 1G291 3R6TA 2HK6A 2R4TA 1VHWA 2ZATA 4GT1A 4ML3A 3MT8A 3QY0A 5KNBA 1CYEA 1LQUA 3FFTA 5C8XA 1FMCA 4W8GA 4KLRA 4PQEA 5JI3E 2B4YA 3CVOA 2H0AA 2J41A 1W9MA 3H4TA 3HA3A 3DAFA 3OQJA 4YI3A 3WGQA 2XADA 4EARA 1QX4A 2YQ5A 2YUIA 2P7IA 5BN3B 2Q3CA 5IAEA 3FBGA 1POXA 2QX6A 1W4ZA 1U7XA 2XQGA 3HDQA 4UTNA 3SLGA 1Y0BA 3NX4A 3B13B 3L4BA 2HRBA 4FSDA 1HE2A 4WKPA 2ZJFA 3UG6A 4DLWA 5GZ3A 2JG3A 1F5SA 1TECE 4HG2A 4DWVA 3ND5A 1YUBA 2OY0A 1JFTA 1G8KA 1ECPA 4U5XA 2C9BA 4K46A 3EFOB 1OZGA 1W88A 4OY3A 1I10A 1KDZA 1XHEA 1U0LA 3UBTA 5CPBA 2O8VA 1MNQA 1QOQB 3T5DA 4CM4A 4FFBB 3LBFA 1RVV1 1U8EA 5IDYA 4RY0A 4ESVA 5EKSA 3RB8A 1CUJA 3EVZA 2DM6A 4NC9A 3D6TB 4IIYA 4O2RA 2Q2OA 3EY9A 1NDHA 1R0BA 1WUKS 3JSXA 1NMZA 2PSSA 4JOSA 1DUIA 1M7HA 2G67A 4IIXA 2BGWA 4P33A 2FEKA 2Q3LA 3QHAA 4B3IA 4DPLA 5LIRA 4W1PA 1ZK1A 1SCAA 1LRKA 1XVVA 1VLMA 1YJQA 2IZ1A 1RYMA 1X9HA 2MYNA 4IIJA 4II3A 4H7JA 1HOXA 1AZLA 3S1LA 4UJ3A 2A5DA 1F8UA 3VHLB 1H6AA 2YHSA 1MV8A 2QVBA 4D3ZA 4UVDA 1X8KA 1YB4A 5D84A 3QLVC 4FFWA 2QE7D 3F3SA 3WV4A 4G26A 2GZMA 3ABRB 5DP1A 1FTNA 4LSWA 5B3JA 2VHTA 5SY4A 1DCKA 3MJEA 1JF8A 4OK5A 3VVBA 5EJ9A 5K3OA 1N8SA 5FBRB 2AMLA 3HLKA 2TMKA 1FXWF 2QJFA 3E82A 3HJTA 4QQ8A 4FP9A 4CM3A 4PSVA 5CFRA 5COQA 1Z4PX 1SIWA 2Y67A 1ICIA 3B2NA 4RTOA 2VAMA 4M1MA 1NULA 2QE7A 2ZJ1A 4OQQA 1IC6A 4GYWA 3LNTA 3MRVA 4LMPA 2O3UA 1J1IA 1S2DA 3FZYA 4IR7A 3AFMA 4HZGA 4D81A 3BICA 1N32B 4G0ZA 2Z04A 3JPYA 1B16A 3DTTA 2AE2A 1RHMA 4KR7A 5I4BA 2WWGA 3LZDA 2LV8A 2HXSA 4WX2B 1K8YB 2VHWA 4CM9D 3FNRA 5FULA 1Y1PA 1YS7A 1FLNA 4REQB 1DKUA 1JLSA 4EVSA 3SEZA 4MEJA 4XUCA 3ASYA 1DJLA 1H6BA 2CBGA 3S29A 3TTSA 4C7BA 2B4TO 4GHWA 4XGNA 4RMNA 2ZJYA 1KVUA 3NH6A 4GPEA 1Z0JA 1ZC3A 2FN8A 3FWHA 1RPZA 1SIOA 1C9JA 3ECAA 1CUFA 4H9GA 4WOCA 5EHXA 1T2VA 3CLHA 4OD0A 4QNRA 2DT8A 2WSSA 1N6PA 3FR7A 4KQ9A 4BEBA 1NTOA 2PUHA 2A1IA 5K0LA 2NZJA 3FTCA 1NBIA 1OGIA 2OHHA 2YMMA 4RD1A 1GGKA 1JBQA 2FPGA 2X2FA 4FS3A 3Q72A 1UOPA 4Z0PA 5HS4A 721PA 2CDCA 1EK1A 2L82A 1ZU5A 4U0JA 3TI7A 1X92A 3B53X 3I42A 3V9AA 4O4IA 1ECGA 1LPNA 3CNNA 3G0IA 3E3OA 3DL7A 4IDDA 4MK4A 3ST7A 3W2IA 1JTVA 2ZAMA 3HDHA 4G1UC 5HE9A 2Q6LA 4DGQA 4L22A 4LXTA 2Z2JA 3ILSA 4YBRA 1J2TA 2F8LA 1VG0B 2VJYA 3CUEF 3FI9A 4ZALA 3AI1A 2V74B 2WWHA 2FRDA 3B51X 4Y2QA 1GRCA 3WIBA 4ZO4A 1KDVA 1Y7PA 4URVR 4NE7A 2GK3A 1RXVA 2GRAA 4K3VA 1MAHA 2J0QA 1P9WA 4K81B 4CT0A 5ETJA 4PHFA 3LXMA 2OHFA 2BZ0A 1X7YB 4K5QA 5CVEA 5BWNA 1QHFA 2AMJA 3E0XA 3GRCA 4BVJA 3S44A 3QNUA 5H9VA 1XAJA 4TL6A 5ELMA 1RZRD 3TB6A 2ZFUA 1MQ8B 1RPNA 1R6XA 2ISQA 4QJ4A 4QYIB 5F64A 3SJBA 4IF6A 4RS3A 3WISA 3WIVA 3TWOA 3NR2A 4LDZA 3EZ9A 3JQPA 4NHEA 2PS1A 4NS1A 3E03A 3RDPA 3T3NA 4MQEB 3W6ZA 1RLTA 1V48A 4IGAA 5BT8A 5HCIA 3Q11A 3M6WA 4MUFA 4IJVA 1UOEA 1TCAA 1JJBA 1Q12A 1VL0A 2L2QA 3R3JA 3ZDYB 2HR1A 1E94E 4HAIA 2D3WA 4XOUA 4H7KA 1C7FA 1U0HC 1Z28A 1I32A 1A69A 4MVXA 1GNPA 3W5JA 1X94A 1AS2A 5FFMA 1WW2A 4C3VA 4D4MA 3GMDA 5HRCA 1RZRA 1JEYA 2ZSHA 2OCPA 3QW4B 4MR7A 1TZMA 4D8VA 2JLUA 5D5PA 1M6VA 3RJMA 2OP0A 3F4LA 2FEMA 1JA0A 3G0GA 4IOMA 5JBIA 1ZM3A 1U2GC 1KWGA 2AJTA 3H6GA 3CUUA 5ECGC 2VYVD 4BNXA 3GA5A 4DZZA 1CUGA 5LDHA 5GIPE 1HZZC 4L5IA 1Q7EA 2ZYGA 1L7OA 2PA0A 3FTNA 4PG6A 1ATIA 3QXGA 3GA0A 5LL6P 2ZBQA 5B1SA 4PTZA 1RWXA 3VPDA 1T9AA 1HRKA 4CLRA 1K3FA 2R96A 5EPOA 3ZOKA 3SR0A 2YX1A 1ODIA 2Z8ZA 5KHLB 5EZYA 1EXWA 4ZOEA 3PGVA 4XIIA 2J9XB 3X0DA 1GN9A 1Y1RA 4HQ6A 4YRCA 3UMRA 4F71A 4LW8A 1PFGA 5AOAA 4XWWA 1Q77A 4RQTA 2V0GA 2JRLA 3T3GA 3VOTA 2VLBA 3C7KA 3CKMA 4LA4A 4PRYA 4D56A 1DAMA 5J4YA 1T2EA 2YJGA 3ELWA 5EJ5A 4YLGA 4AIIA 3WSWA 3D6NB 3KFXA 1G8YA 4G1FA 1EDBA 3FZGA 3M5DA 3MWLA 3ETCA 5GONF 4J3NA 3FMIA 1XVLA 2FVXA 4J3FA 1IHPA 3OUZA 1QIIA 4X45A 4W8HA 1TMKA 4OL9A 5HM8A 4DCVA 3CLRD 1ZRSA 2OLKA 2XVZA 4PG5A 1P5ZB 4R1TA 5DPMA 4QDOA 1HT1E 3BL5A 3JQBC 1UJCA 3N0TA 4MVJG 2I9KA 1OSNA 1FRNA 3AJDA 1EFPA 3B48A 4K8OA 2KB0A 1KQPA 1RXYA 2Q3HA 3BGVA 3KCQA 3KJFA 1LLCA 1LLFA 4IQ8A 4O3FA 2XODA 2OGTA 1PJ8A 4F4CA 1GDTA 4MHTA 3ZWPA 1Z5GA 2M32A 2ZRNA 2P6RA 3F73A 5EXSA 5IUNC 4LY0A 4XGRA 1VI2A 3K1AA 1TVMA 3ZYCA 3WL8A 1GTL1 2UYGA 2QPOA 4MCHA 1OIXA 1UXJA 3AJEA 2OE2A 4B7CA 3DFKA 4LSMA 5DGIA 1DTSA 2CXTA 4L76A 3LL7A 1KJJA 4I1RA 2WF9A 1RKVA 3TR5A 2C2KA 1EFVB 5IMSA 4INJA 2WE8A 4RZHA 1UM8A 5BOSA 5KVSA 1UP4A 3TAHA 3GCWA 3PXUA 1QFXA 4JSRA 4Y6SA 1L4HA 4L4RA 3SZMA 4FT4A 3LLSA 3FNQA 1NP6A 5EMKA 4NBLA 3V6MA 5BR7A 2UUAB 2JBWA 2MSLA 2PS0A 3ZTWA 4Y9RA 5G1NA 1NPYA 1E9CA 3AB3A 4NS4A 4YV7A 3JD4A 2D54A 2O0HA 3HB7A 4UNSA 4NULA 3ROXA 1L9KA 3LVQE 3CWQA 3UTCA 4A6PA 2RKOA 1R9NA 1HKHA 2AUMA 2ORYA 5I9SA 4D0RA 3KV1A 1NUPA 1USIA 3VU9A 4EI8A 1U65A 4KQFA 4M3NA 4OK3A 1F0PA 2PV0A 3NV9A 2F9LA 4HH4A 3UNXA 5AK3A 121PA 1QCYA 3M34A 3RYHB 4PRZA 1M7GA 3QPDA 1J5EB 1M2JA 5KTYA 3AEQB 4MA0A 4M7OA 1NP7A 4P80A 2E55A 3HB9A 4M9SA 5BN4B 1E5VA 2P11A 5KTPA 2FHPA 1G6HA 3BB3A 4TMWA 4YT4A 3A9WA 5H59A 1OXVA 5AW3A 5LDDC 3DF9A 3M5PA 1Q74A 4MGHA 2R6GA 3OU7A 2P9CA 2TECE 5LD2B 2H4FA 3REFA 5IDQA 3DLHA 3GHHA 4YT2A 1ACJA 3D2LA 1SPBS 3PUZA 4GOMD 4MRVA 2AI2A 4MW2A 2AT1A 1RU3A 1X7DA 3BJEA 2DBVO 4G4JA 1T6XA 4Y2XA 4PC2A 2EOAA 1BQ4A 2HA0A 3QQPA 4BFLA 2YWCA 3BWBA 2ZSEA 1SOWA 4M2LA 1PNTA 2NSDA 1P2SA 1YJ5A 3E3MA 5DNDA 4EDFA 5FOSA 3BDVA 3LXUX 2I22A 3D0RA 2OYCA 5FLKA 3TZQA 1YR8A 3CRMA 4EKGA 4MDEA 3KEFA 1JQ3A 3KM0A 1QFMA 3RANA 2MMGA 3EVAA 2XHZA 3GJ5A 5GJVC 3ZK8A 5DM70 1JG6A 5TIIA 2LP4Y 2V0NA 3FB1A 3JYHA 3GLHE 2C7VA 1ZOLA 1QQ6A 4OSOA 5AHWA 1QFZA 1E4OA 2WNSA 2WWXA 2PSDA 3UW1A 2DPYA 3U49A 4YJGB 1XA0A 1QUFA 4JLKA 4ZVPA 4O1MA 3DE0X 2HWWA 2XNDA 5HUHA 3F9CA 4DIOA 4YV1A 2ZB4A 1T2NA 1BH6A 3IAS1 3I0MA 4HPXB 4BNMA 3OOSA 1IBMB 4F8JA 3LUFA 1WTAA 3QYAA 3IR5A 1QQAA 1PGJA 1P4RA 1ZW6A 3K31A 2ZE8A 3OLQA 3L9XA 1IN7A 4F5ZA 1ZUD1 1UMDA 4P7KA 1NDUA 4JP2A 4OVKA 3TPFA 5IJAA 5JOQA 3R8FA 5C3MA 1P39A 1SA0A 4FGKA 4HB3A 2G6BA 2XVMA 4NJEB 5J59A 3L8FA 3QVTA 4FFMA 1WBDA 2GZAA 1KF0A 4CV1A 1M83A 1HE1C 3O7WA 3QTLA 3HY3A 3EGVA 2M2IA 3PX7A 1FMLA 4K40A 2GCEA 2QZJA 4NICA 4RHEA 1IHOA 2B99A 3I30X 1L7MA 1P3Y1 3O38A 2QGZA 4NZYA 4IIUA 1E2EA 1JT2A 2XDYA 3AF1A 1DWPA 1RXUA 4R9NA 2MOKA 3C45A 2JAWA 1PWEA 1KZ1A 3OTIA 4F2GA 4BV9A 2FPPB 4KFUA 1SD5A 1XMSA 2PQ2A 2H1SA 3GH1A 1JXOA 1PQYA 5DN6A 1HQCA 5E9WA 3RV4A 3B1KA 5DWQA 4QICA 3SF8A 4KDFA 5G2OA 4E2WA 3COPA 2Q21A 5DCYA 3HSKA 3V8PA 1VOTA 4N0QA 2DF8A 5HKBA 3OZEA 3HB0A 4D9KA 5JRDS 4HBGA 2GZ2A 3UWPA 4MYSA 3ANTA 1QONA 3SQWA 3IIJA 5CR9A 3ZXIA 4ND6A 3QIAA 3WMFA 4HDSB 1M1YB 2L18A 4LTMA 3UA4A 1W36C 3TSZA 4AS1A 2PIAA 2DGDA 3AG6A 5DHUA 3SWWA 4C2UA 2PUTA 2GKOA 1LPSA 4CF4A 3K9NA 1N4DA 1YZYA 3U7FB 4LNUA 1A9SA 1BXZA 4EJSB 5GTDA 2P9BA 3BN3A 3TECE 4LZWA 4ZFNA 3LXXA 3R09A 3CH6A 1Y3HA 3GLFA 4LGYA 1H0HA 1BDJA 1CUCA 2XMPA 3I5AA 4M1ZA 1IZ9A 1RRPA 4M22A 4QOGA 1S0UA 5A4FS 1YZ3A 4EAQA 2CHUA 2KMLA 1PR3A 4Q1FA 3V1KA 2R7AA 3A4YA 2QK4A 3ORSA 4GZ6A 5EXXA 4TX1A 4OXIA 2Z43A 1IY0A 1FQWA 1Y5MA 2AZTA 5I7VA 1OB2A 1B8UA 1HDZA 4ND5A 3E5RA 4E21A 5BORA 1ZMBA 2QYTA 4JLBA 3AZQA 1RWMA 4G65A 3WMXA 3DHYA 4DBLE 5E1OA 1UBMS 5DF1A 1OX6A 3TZEA 3UOGA 5KYGA 5AK5A 1P73A 4KXQA 1R16A 1BH2A 3PGKA 4MWDA 5ILGA 2WVAA