4Q18A

Human dck c4s-s74e mutant in complex with udp and the inhibitor 4 [1-[5-(4-{[(2,6-diaminopyrimidin-4-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]-2-methylpropan-2-ol]
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
230
Chain Sequence
b'IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
total genus 86
structure length 230
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q18A00
1G18A 4B3FX 3E2IA 3PUWA 3UPUA 4B73A 1F2UB 1ZUHA 1OXUA 3AKEA 3IHWA 3EG5A 1QVAA 3PEYA 5IDVA 1RYFA 2N1BA 3UANA 1X6VA 3LV8A 3LX5A 4PX9A 1R8QA 2J1LA 1BMFA 4BFVA 3JVUA 2AL7A 3ZQJA 4KODA 1R2QA 2Z43A 2AKAB 4RCYA 3N5CA 1E98A 1FOEB 4X8MA 4M9QA 3CUEF 2GILA 1AQUA 3Q85A 2QMHA 2QT0A 3PUZA 4N0DA 3CIOA 1HV8A 1N5JA 4DLZA 2YOFA 4IXMA 5HZHA 3KTAB 4TN1A 1CJKC 1II9A 3GEHA 3QBVA 2IW3A 1YZGA 1JQLB 5HE9A 3W6OA 1WMSA 3QXXA 4PHFA 2J3EA 3K70C 2OILA 1GL7A 4URWR 4DEYA 1TF5A 1ZD1A 1ZYUA 1M7HA 4OQXA 3T5DA 3GP8A 3HPRA 4TLDA 2B92A 5UKDA 3SE0A 4N0EA 4D6PA 1UPTA 1G7SA 2P5SA 1CKEA 1QVRA 5JHGB 2JLUA 2IUTA 3R7WB 4H1UA 1F5NA 3MD0A 2VSFA 2WJJA 5HCIA 2EWWA 4C4PA 4HAZA 2RKOA 1NN0A 3CM0A 4NYIR 4P31A 3SHWA 2REOA 1PVOA 4AKIA 1US8B 3REFA 5J4KA 1YZTA 1D2NA 1AKEA 4M21A 2ZI6A 3AUXA 3BB4A 4G1UC 4R2IA 3KQUA 1NKTA 2WWHA 4Q4HA 5JMTA 1Q1ZA 1AKYA 3TGPA 4HZUA 1VHTA 3FDIA 3BFKA 4PPNA 4FD2A 1N6NA 1EFRA 1IY0A 4M1TA 5LD2B 2F3RA 1JJ7A 3GJ4A 4WAUA 3AVTA 1Z08A 4LYJA 2FH5B 1N6RA 1OE0A 2VYFA 2Q3FA 2JLQA 3ZZ0A 1QHYA 1KI1A 4PPQA 3RDPA 2EFDB 3MUFA 3EZFA 2CDNA 2BIFA 5IK2D 1CEEA 1QG4A 3BGWA 4C0LA 1OXTA 3FVQA 2WVJA 4M8NE 1U90A 4E03A 1TUEA 2GHIA 3QOFA 1ZM4A 5KSYA 3CPEA 4ESHA 2Q3HA 4L5BA 2JLWA 4TQ9A 2IYTA 2CJWA 4G3XA 3QVVA 3DVLA 3EPLA 1R0ZA 4DCUA 2QTVB 2VL7A 2ZSFA 4BECA 2ZJZA 2WKQA 4B32A 1KMQA 1G8HA 4OQFA 1OH5A 3B78A 2F43A 2XTZA 2D3WA 5HE8A 3U3OA 4OHYA 3P4XA 1QF9A 1E2QA 1W4BA 3BBPA 1ZIOA 4QM6A 2Q9BA 1EGAA 4B35A 1KDTA 1Z07A 1KI2A 4PANA 2VA8A 2V6IA 2DFNA 2VP2A 3D31A 4UJ3A 4CEJB 3LLMA 4II7A 2PT5A 2ZRAA 2O8BA 4DSNA 1G8PA 2QQEA 1E1QA 1VG8A 2HXYA 4EFLA 3PJRA 4XH9B 1NI3A 2G0TA 1XZPA 1E4YA 2Q21A 4EKDA 2FPLA 2QMEA 3FKQA 4N1AA 4Q1CA 2GEUA 1T3SA 4Q00A 2YNMA 1YRAA 1SQ5A 2G77B 2ZRIA 721PA 2EFEB 4JJZA 4KBGA 1TADA 3SC3A 1E2DA 5ELXA 4IVPA 4LJ8A 3KKPA 2IYRA 1BS1A 4HAWA 4JIMA 4JBWA 5EP2A 3NBYC 5AJWA 3UXMA 2O8DA 1SKQA 5CK5A 1KKLA 4JYCA 1II0A 1W5TA 1MABA 3LQQA 4HLCA 2AD1A 1MO5A 4GMXA 1FZQA 2MSEB 4DB2A 1YR6A 2H92A 2OXRA 4GZLA 1HEIA 1Z0IA 2H18A 5JRZA 2VHCA 4D82A 1XEXA 3VR2A 2UKDA 1TEXA 3D6TB 4KCGA 2J45A 1WP9A 1YVDA 4QGAA 1ZD8A 3KX2A 4URZR 1P2TA 1RYHA 4HB3A 5IK2A 4BFZA 4FMBB 4JT2A 2QRNA 1OIVA 2F1JA 3TW8B 3ZIAA 3PENA 3LO5A 3JVVA 4M22A 2GJKA 3P4YA 1FNNA 2ODWA 2V9PA 4TWZA 2ZVPX 1P2UA 1W0JA 3KFVA 3VU9B 3UMRA 3NEYA 3EIHA 3DEFA 2OV2A 1N3BA 2QP4A 2ZQ5A 3I5YA 1KO5A 1S9DA 5BYJA 4OK3A 5C1BA 4KFUA 2ONJA 4N3NA 4B71A 4DT1B 1TX4B 5G40A 1I2DA 1VKJA 4L4UA 3CPHA 4GNKA 1ZJ6A 1HE1C 2VLIA 4QXAA 5EXTA 4YMSA 3TK1A 2J0SA 1VCOA 3G82C 3I4LA 1G20E 2OBMA 2ZJOA 4ZDWA 4CT5A 2JLSA 2C8VA 4RSGA 2IYUA 3FWYA 4JLKA 3B9QA 1G17A 2AXNA 3CF0A 5KO2A 4YC7A 2Q6TA 4TSFA 4HB2A 4LJ5A 4KXFB 4LI0A 2OEPA 1MV5A 2I3BA 2XNDD 2PX3A 1RC8A 1K5GA 1WB9A 2IUSA 5D3MA 4HAXA 3M0EA 4KBFA 4WOPA 3ZH9B 1XD2B 3GFOA 2CBZA 2I1VB 3RS5A 2ZSBA 3CLVA 1KY3A 2CLSA 3ETLA 1QHNA 3P26A 1KK0A 1RVDA 1SVLA 2DY1A 4LRWA 3U6BA 3ZLJA 1RJ9A 3QXCA 4BGDA 2YWFA 2Z0MA 2AWOA 2P2LA 3LFUA 4CEJA 4AY2A 2HLDD 3Q5DA 1BOFA 1N0VC 2IEZA 3K9HA 2XOKA 2ZE8A 1FPMA 4B48A 1E2LA 1GSIA 1FQJA 3GCGA 2D62A 4URYR 4PZLA 1WF3A 2CVFA 3L0PA 3GEEA 4KFSA 3RRYA 3WYGA 4BE7B 4TZ0A 2PBRA 4OK5A 1NIPA 1U8AA 2FEMA 1KYIA 1KZGB 1Q57A 2VF7A 4MYTA 4TTPA 4QRHA 4URVR 2O8CB 1L7VC 1U0HC 3H4MA 3ZS8A 3HP1A 2BV3A 2QBYA 2WHXA 1A4RA 1LNZA 1T5IA 2Z5FA 4DIEA 2R6GA 3EZ9A 4JS0A 1A82A 4A8JA 3R8FA 2D2EA 2BKEA 2QM8A 3VNUA 1P9RA 4GRAA 3HYRA 2IS4A 3FTQA 4A0GA 1Q20A 1ZW6A 2WWFA 1ESNA 4RD2A 3I8XA 5HCNA 4U5XA 2ZSAA 4P4UA 5JSZA 3ZD6A 1G7RA 1VECA 4RKFA 5FL7A 2DFLA 3KB1A 3K1JA 4LC1A 2YV5A 1ODFA 4PZYA 4RFSB 2ERYA 3CONA 1G291 1PLKA 1S8FA 2B7BA 2FFBA 4DZZA 4IXNA 2NZJA 2YC2C 4FI3C 1P75A 3WY9A 3K70B 2NTYC 2AFHE 4W5WA 4M9XA 3L0SA 2ZI3A 1Z2AA 3ZVLA 5LBIA 4BZPA 2E87A 2ZANA 4G0NA 2HYIC 1PJRA 3TBKA 3QSYA 1M2OB 1P4SA 4GPTA 4LBZA 1DAHA 1OKKD 1VYTA 4FWIB 3SZRA 1XMSA 3NIBA 5FBLB 3ND9A 2Z6VA 4RFVA 2H17A 4AIIA 3QUSA 2F1RA 4OI2A 5C4MA 3VHLB 3EX7C 5CDFA 5FR2A 3C4JA 4PPGA 1NJFA 2FEOA 3UG7A 4I1SA 2ASEA 5DN6A 4M9ZA 4TYYA 2GBLC 4S35A 1E3MA 1KNQA 4Q18A 4RKEA 1AS3A 3Q5EA 2ECKA 5JSZB 1KDOA 2QG6A 1ZVQA 2IYQA 2QI9C 5FH9A 1A2KC 3REGA 3IIMA 1W44A 3S1AA 5AUNB 1RRPA 2O0HA 4POAA 3GJ5A 1MOZA 4YDSA 4C0AC 1Z47A 3GLHA 3QEOA 1ZAKA 3FHTA 2PH1A 4A0HA 3MFYA 1V5WA 3GMTA 3PIRA 4Z54A 2BHRA 4QOSA 2GJ9A 2EYQA 1ZCBA 4ARZA 1U99A 1S1MA 4LJ6A 4DRZA 3K53A 2CL7X 1LF0A 2AXPA 2ZS9A 3LX8A 4XSHA 4QJ3A 5CB8A 3L0OA 3VHXA 2ZR9A 2J59A 1JR3D 4GP7A 1E4VA 1N5LA 2PT7A 1LVGA 2YHSA 1SHKA 4O25A 5KHOC 3AP1A 4TLBA 1XTSA 4UNPA 1ANKA 3PCRB 2IXEA 2VSXA 1D9XA 1KO7A 1XTJA 1AJEA 1E2GA 2GK7A 2WKPA 3B5JA 2J7KA 4DDWA 4BPBA 3WNCA 4QHTA 4ABYA 2D2FA 5CJ2A 2JIZD 5SZJA 3SYLA 1UBGA 3BIFA 3CW2A 2J41A 2LKCA 4DWJA 3B7GA 3BC1A 2NIPA 2A78A 2C9YA 3CF2A 4PC2A 3NEJA 1CR4A 3SYKA 2OM2A 4NPHA 1E2FA 1CBUA 3K0AB 4DCVA 1G16A 3QG5A 1XD8A 2CL6X 3U4QA 2ZI4A 1P9NA 3W3AA 3AKDA 4R71A 1LS6A 1XMVA 2FA9A 3CF6R 2JJ1A 4BFYA 1ZNWA 4F4JA 4OHVA 3TVDA 5A4JA 4C7OA 4MRPA 3O8DA 1WA5A 1II8B 1AQYA 3BB3A 2RHDA 4TMXA 5L3QB 3GLFB 3M1IA 2JA1A 1CRPA 3WBKA 2RCNA 5DI3A 1E0SA 2FSHA 2Q9CA 1KDPA 3AVUA 2NO9A 3HR8A 2ZYWX 4EIWA 3I8SA 5FR1A 3BE4A 3FHCB 1ZUNB 3PEWA 4XVQA 4WA7A 2G83A 2WSMA 1CIPA 4QBFA 3WP1B 4ZPXA 3LW8A 1COWD 3RAPR 1SKYB 4W5HA 1W36D 1K5DA 5A5GA 1UADA 2F9MA 4A92A 2HDNB 1P6XA 1R8SA 4CVNA 4IFBA 4Z1MD 4OQMA 2CNWD 4UXIA 1KSJA 2P3SA 2RGBA 3LW7A 4TYNA 5AUOB 4B2IA 2CMKA 4JYBA 1GRQA 221PA 4UQOA 4X8HA 5FUWA 2NPFA 1HYQA 1W0JD 3SBEA 1HA3A 5BYKA 1F48A 1LV7A 2N46A 2QSZA 3OEEA 1E99A 1G9XA 2ANBA 4CEIB 3LDAA 3IEVA 3KFXA 3CRRA 4P4SA 4YDHB 4ESVA 4QBGB 1W1WA 3CPJB 4K81B 2XITA 3NC1C 5EXXA 1RIFA 2B6HA 3U44A 4BFSA 3CKLA 4C2UA 1WE2A 1MR3F 2CNWA 4IOLA 4D4KA 2ANCA 5E4FA 3W8RA 1P60A 1EG7A 3OHMA 5EQTA 3MMPA 4DC9A 1L8QA 3M6AA 2HT1A 5D3MB 4D4LA 4XOIA 4MA4A 4TYQA 3PEVA 1TU4A 3X1ZA 4IVQA 4D0GA 3SI7A 2NO6A 1TQ4A 1AM4D 3SFZA 4PHHA 2JLZA 4RY2A 5EE3A 3D3QA 4HAVA 4X8LA 1XEFA 1GOTA 3TUIC 1R5NA 1GRNA 4KHZA 4GOXA 4MKGA 1X1RA 1G64A 1GP2A 4V0ME 4PR0A 1SVSA 3AF2A 1XDBA 2XZOA 4AWXA 1A5TA 3LBIA 1E2MA 4LHYA 3ZYCA 3MWKA 4BFUA 1U9IC 1ZU4A 5KYKA 1WBDA 1X8JA 4WZ6A 2YKGA 2HYDA 2P6RA 2W6JA 3OIYA 2PZFA 3FFBA 2DHRA 4AYWA 2CE2X 2C99A 4IW3B 5EP3A 4B3CA 1E1QD 4L9WA 1XZQA 4WZBE 4A8JB 5TARA 4P4SB 2PJZA 4BEJA 3AF0A 2F43B 1E2IA 3MJRA 4LGMA 1XCMA 2REBA 1I2MA 2ERXA 1OV4A 1SZPA 5JWRA 3SEAA 2J0UA 3H1TA 1IY1A 5EUMA 3A6PC 2IYWA 1V43A 2QMUA 2IYSA 4JJKA 1NMXA 2NMVA 1R6BX 2YVUA 5FOTA 3K0AA 3LXRA 1S2MA 2OO7A 2KBEA 5KPJA 2ZETA 1P72A 3T06B 4MRNA 2HXSA 3SN6A 3T1QA 5F9HA 3CWQA 1NVXQ 5IF9A 4QKQA 1T6NA 4MUAA 4HAYA 3QENA 5GVRA 4TT3D 4DLTA 5J5CA 2JJ2D 4BZXA 4FWTA 1N6KA 3EW9A 4CZ2A 4KLNA 4HLDA 1NG1A 4HZUB 1Z0JA 1AIPA 2JLYA 4M4SA 5EE9A 1NP6A 5E7JA 3OESA 1N5KA 2QAJA 4QJ4A 3TLXA 3GFPA 3UATA 1XU4A 1N6IA 1SKYE 2OAQ1 4LX0A 4YXWD 1X86B 3AVWA 4UJ5A 1O87A 1Z63A 3ZIAD 4IRUB 821PA 4IVRA 2EU8A 2ZVQX 3KXKA 3FMPB 5L3VA 3RWOA 2ORIA 1CJUC 1NN1A 1CTQA 2LKDA 3QI2A 1G3RA 5CIQA 3SDZA 3S1AB 1OXXK 4ZIRB 1IJEA 1KI7A 1KI8A 2FOLA 2GETA 3CZQA 4V0KA 5CM9C 2VRWA 4Z8YA 4V0LA 5DH9A 5JCPA 4C2TA 4DB4A 1EFRD 1CXZA 1GL9B 2QE7D 1Q1EA 1T5LA 3FHOA 3DZ8A 3CWZA 2V54A 2V1XA 2NPIA 4QFMA 4XIGS 2YINC 1YR7A 5GADl 1GVNB 3GLIB 4Z8XA 5H1YA 1MABB 3OFNA 2HCJB 4D0NA 2EFCB 3P27A 2JEOA 2A9KA 1UAAA 1IY2A 3QKRB 1UKEA 2XXAB 1IM2A 3OF5A 2RGCA 1HTWA 5KTYA 2Z83A 2X1VA 3VQTA 3QQ5A 2YZ2A 1ONBA 3O47A 2W2VA 3AV0B 2NG1A 3AKCA 3MG9A 3THWA 4XD7D 2WWXA 3AP2A 2RB4A 1UBCA 3MGCA 4LZZA 3WYAA 4TLEA 4XWKA 4TSFD 1Q21A 4DT1A 5J4YA 3SS8A 2PEYA 3RHFA 3IDQA 3OIUA 1OXVA 1IXSB 3DL0A 3AVQA 1G1MA 2WJHA 4E07A 3BRWD 1IONA 2WKRA 1P9WA 2PMKA 2UZIR 4GMDA 4JSTA 4EJSC 5F9FA 2KI5A 4A2QA 4FMCF 4MYUA 4Q9HA 1G6HA 1ZM3A 2ZAOA 5FBQB 1DOAA 1FFHA 2C03A 1D2MA 2BBOA 3QEJA 121PA 5C2JB 3C7KA 1XP8A 4LV5B 2HCBA 4CIDA 4B74A 1RRFA 1NLYA 3W90A 4O2LA 1KSHA 3WXMA 4Q1AA 2X77A 3VX3A 3O8RA 2WWYA 4RZUA 1AGRA 5ANRB 3ZGXA 2JLVA 3R9XA 2QN6A 3L8YA 4XTCS 5C18A 3BERA 1M7GA 3GLIE 1WRBA 3IGFA 1UDXA 4XVUA 3CRVA 1NLZA 1JXOA 3HJNA 4GL2A 2GJAA 3T34A 1EX6A 1GNPA 2FFAA 3BD9A 4RZXA 4KYUA 4NYMQ 2P0EA 4PHTA 4B47A 3LLUA 2V3CC 3IBGA 4B34A 5EZ6B 3EIQA 3RRNA 1B23P 3DZDA 5FTKA 4AK9A 4JVLA 1FMJA 2R44A 3ASYA 4M1SA 4M9SA 4DLXA 4P32A 3Q3JB 3TQCA 1TUIA 1X3SA 2HV8A 1Z0AA 5DI3B 3THYA 5FPYA 3QIAA 1Z2CA 1DAFA 1KI3A 3V4RA 1P7CA 2Q3MA 2WSSD 3GJXC 1Z29A 2JAQA 1AGPA 3TSZA 5DO9A 3VMFA 4C0BA 4JVSB 4NU0A 2BEJA 3VKGA 2JJ8A 4HLUA 4A0FA 3A8TA 3ICQB 3IPXA 3LVRE 4YMWA 1FUKA 4HUQB 1ZD9A 1N6LA 3SYNA 1WCV1 4QNRA 3L0IB 4KI0A 3VR4A 4PO8A 4X8OA 2C9OA 2ZI5A 4LHZA 1SXJE 3ND8A 2EFHB 5KNBA 3GLGA 1JJVA 2AX4A 1E32A 1KO8A 2IS6A 1DARA 4EFNA 1HQCA 3W5JA 4TTQA 4ZO4A 1OPXA 3BJIC 2IF2A 1UF9A 4I81A 4BLTA 5JLJA 4MDEA 1UKYA 3NBFA 2XB4A 2FU5C 1FP6A 3NTUA 4OYHA 3WRYC 1SXJB 3WP0A 3AF1A 1QHGA 4EJSA 1J90A 5JI3E 2RGXA 3AVOA 2G1JA 1JAIA 2XNDA 4KITB 5IRCD 3K8YA 4LY6A 3PXGA 3RYTC 1E9BA 2F1IA 3RABA 3TR0A 5CB6A 3RRZA 4URXR 2XGJA 5L3SB 2ZUCA 4LBVA 1XF9A 3OE7D 3THXA 1KI4A 4ACBA 4M1WA 3AP3A 2OFWA 3EAQA 3KZ1E 3NDPA 4NZYA 1YZNA 1FMLA 2V7QD 1E96A 1KI6B 2WIBA 2XZLA 3QF4A 1GFIA 5C46F 2R6AA 4TMZA 3Q7PA 2O0JA 4NBSA 5FBVB 4LHWA 5FBWB 4C0HA 3LVQE 1EFUA 1PLLA 1DVRA 1GWNA 2ZYTX 4HZIA 3ZS9A 1FW6A 3ZVRA 2FMXA 1Z6GA 3TNFA 2ZI7A 4W9MC 2A5YB 4IDHA 3TMKA 2ZUBA 1L4YA 4W7SA 3T61A 4L16A 3ZZUA 3N2EA 1YR9A 3DOEA 3CB4A 1SVWA 1XEWX 4GFDA 3GD7A 3EZ2A 5LDDC 2W00A 3QXSA 1MO3A 1XBTA 5J4LA 2WPDD 5CM8B 5F3WB 3CR7A 2FSGA 1XFAA 2CLDX 4PAMA 1DADA 2ODNA 3PQCA 3OZXA 1W0KA 2BDTA 1HUQA 3JZAA 4PTLA 1G3MA 4D4JA 3U6KA 1ETUA 1TQ2A 2OBLA 3CR8A 5SZHB 1R5OA 4O0MA 5FUXA 4DCSA 3RS4A 4BASA 4QHSA 3UIEA 1FNMA 1IHUA 3F3YA 1ZRHA 3HU1A 1W5SA 3ZQ6A 3T5GA 1XRJA 3DMDA 2DBYA 4JL5A 2GBLA 1OIWA 1W4CA 2QPOA 3T1VA 5TV2A 4ASUA 1QHIA 1VG1A 4ZCLA 4B6EA 4NYMR 4O2RA 4B2LA 2FDCA 4MRSA 2G1KA 4JLAA 2ZUDA 4NL4H 1Q1BA 3ZD7A 4A2WA 2AFIE 4GDFA 1BH2A 4U00A 4JT4A 4EFMA 3OE7A 1C1YA 2KE5A 2ZXUA 1UKZA 3HYTA 3BS4A 2EVWX 2R65A 4TLCA 2KB0A 1FTNA 1PLJA 1KI9A 1S0UA 2ORWA 3E5HA 5KSPA 2Z4SA 4CYMA 4XWOA 4US2R 4CEHA 2IBMA 2OXCA 2QUZA 4JLPA 3GLGB 2LCFA 3W34A 5L3RA 1UEIA 2O0KA 1XCPA 3SOPA 4JLDA 2ZRMA 4R2HA 4BLRA 5DN6D 5TB5A 1QZXA 4QGFA 2ZS7A 3RS0A 2GZDA 4PHGA 3V00A 2DR3A 4H1VA 1F60A 2PMDA 2VP4A 2C95A 2C2HA 2EYUA 1CLUA 1RZ3A 3K0FB 4FMDB 3Q7QA 1SVIA 3I32A 2VHJA 5FI0B 3GJ8A 3NDBB 2IS2A 4V02A 1AN0A 1L2TA 2V8OA 2QEQA 3O8BA 5EE1A 4LCBA 3WNDA 2GJ8A 2BBSA 3AVYA 3C8UA 3KXIA 3NBXX 3FOZA 5FOVA 2JLRA 4ACAA 3ZZTA 1JR6A 3C5CA 4Y0VA 2JATA 3A58B 1YJ5A 3NH6A 3AF4A 4OKSA 4R9UC 1GTVA 2PX0A 2XTMA 1QG2A 2WMOB 2BWJA 2FG5A 5HKKD 2J0VA 2DWOA 3AQ4A 4NYJQ 5FFMA 3KTAA 1E0AA 1N25A 1U8YA 3A36A 1YE8A 3I92A 4PAQA 2GEDA 1Z8FA 3GLIA 2F55A 4B75A 1NJGA 1T0HB 3GLGE 1X1SA 4TZ6A 3TUZC 1QHXA 1IAQA 3CBQA 2P6NA 1P73A 3VR1A 2D74A 3BAFA 4BRWA 2HJGA 1VYUA 1XEWY 4D2IA 2BMDA 2QORA 1Z28A 4KV9A 4ERNA 4I4LA 3AVVA 1RRGA 4QHYA 1NIJA 2XJ4A 4JMPA 4RZ2A 4BWYA 2KSQA 4MRVA 4MGYR 3RS7A 1VYVA 4JL6A 5CK4A 5E7MA 5DNYB 2J5XA 4Q4HB 3DHWC 3H86A 4TL9A 5CLLA 3EPJA 5CYOA 3UMFA 1T8UA 2WM9B 4ZI3A 3B1VA 3AVPA 3QKRA 2XXAA 1CJVC 3GQBA 2XX3A 1YU9A 3DO6A 3K9GA 4Q21A 4XVRA 4Q1FA 1KZ7B 2C04A 1F2UA 3RVBA 4DJTA 2KWIA 4Z51A 1VIAA 4LPSA 2J0UB 4TT3A 1P3JA 4PC6A 3EIEA 1ZMXA 3LAWA 3PEUA 4Q03A 4NTZA 2REXB 3QNUA 1XTIA 3MRSA 2CHGA 2YOHA 5A0FA 621PA 3MLEA 4TYPA 3JZMA 1Z83A 1J99A 1KAGA 4US1R 4HDCA 1G5TA 4Q9KA 4DSOA 1CU1A 1DBSA 5GJBA 4BZQA 5JECA 3ZVNA 4Q7JB 2OFOA 4DLRA 1KJWA 1YRBA 4AURA 1G8GA 1VCIA 1R0XA 5KPDA 3EPKA 3EZ6A 1EX7A 3BORA 4FCWA 4G5RA 5AJXA 2GK6A 4Q9JA 4OL0A 2BJVA 4ZCIA 4MITA 2O5VA 1KY2A 4LPKA 1OT3A 2ZRNA 4QC2A 4F91B 1XXHE 2QPAA 4LJAA 3U5ZB 4EPYA 3EZ7A 2WOOA 4LYAA 1E9SA 2IX3A 4M2LA 2GKSA 4QGGA 4PQRA 1NLFA 5FUYA 5K8LA 5K8TA 4YMUA 4HSEA 1GAJA 2KBFA 3C16C 3HPQA 4HLQB 2PLFA 2F1HA 1KMHB 5TXGA 3SHFA 4M1YA 3U7HB 2WTUA 5G3YA 2P65A 1BKDR 5FOSA 5BN3A 3EARA 1HQYE 4NMMA 4JZKA 3LWNA 3SJCA 2VEDA 5DYIA 3TR5A 1NY6A 3ECCA 4GZMA 4DLVA 3K09A 4URUR 4TLAA 2XTNA 3BOSA 5FUVA 2FPMA 1W36B 1NVUQ 3CO5A 4FN5A 5H70A 3U3JA 4XD7A 1ZIPA 4DHEA 4Q7MB 4Q4AA 1ZNYA 1ZNZA 3A1SA 2A7QA 3B9PA 2O52A 3QKUA 4Q5IA 4EPXA 4Z1MA 5P21A 1GL6A 3U7EB 2VIIA 3EWSA 4V0OA 3UK6A 2IK8A 1Y3AA 1HH4A 4QNMA 1OFTA 3MCAA 3HDTA 1Q22A 2ZRGA 4M53A 4TYWA 5J4HA 4AKEA 3N2IA 4AD8A 2MMGA 3NVAA 2HUPA 4KSCA 1GILA 3ADCA 2G88A 3R7WA 1NY5A 2QTHA 3RS2A 3RWMB 4KFRA 1UKVY 2FX3A 5JEDA 2FPKA 4FMCB 3I72A 4JVNA 4DEXA 1R7RA 3TAUA 3FPAA 3VR6A 2J7PA 4GSYA 2W2XA 4NONA 4AYXA 1MO4A 1OYWA 2XSZA 3IKJA 3IIKA 1M7BA 4ZKDA 3R9WA 3E70C 1MO6A 4JLMA 2BOVA 2R8RA 1T4GA 4F7WA 1JXMA 2BBWA 3TSOA 2OCBA 4ITRC 4A6PA 1YKSA 4BLSA 5FTJA 5KSOA 1QDEA 1Z6AA 4A8JC 3GFTA 4JBXA 2O8BB 2BKUA 3KJGA 3MSXA 1U0LA 2GF9A 3X1WA 4EPVA 2A5GA 1JALA 2QPTA 4NE2A 2RGEA 3Q9LA 5BW8A 2OHFA 1RW4A 1O3YA 4QJ5A 4NCJA 3RSOA 3U4QB 2GAOA 1IN6A 1EXMA 1FUUA 4E22A 5KNCA 2FGJA 4QM7A 1E69A 1Z6XA 4C9BA 5J4VA 1XD2A 3IPYA 4DSUA 3K9LA 4L8GA 2GEVA 2RGNA 4LWZA 5DLQC 2CHVA 5JJIA 2FE4A 3EWAA 2ZR7A 3IEUA 4NYJR 2PJRA 2I4IA 2IHYA 3IO5A 1DAIA 4FMDF 5TDHA 1E1RD 4G01B 2EFGA 2Z4RA 3QXJA 2ZYUX 1AK2A 1IXRC 1E9AA 4MUBA 4JBYA 4WVFA 3KJEA 4TMWA 5DIFA 3RS3A 2ZJYA 4TL7A 1QRAA 5BN5A 1OHHA 3ASZA 2H16A 2TMKA 2WWWA 3KQLA 3IQXA 5D3QA 2WPDA 4IKEA 4B3BA 1KTVA 2CK3D 3X1YA 1MRNA 1E9RA 1Q3TA 3BH0A 4DLYA 1OH7A 5E7IA 2V55B 5DYGA 3GLHB 4QBHA 1IN5A 2IS1A 3RC8A 2O8CA 4MQBA 3L82B 1F2TA 4UNRA 2W6ID 4YQFA 3R20A 4A2PA 1LB1B 2QY9A 4TQUS 1M1YE 2IWHA 3K70D 2J7PD 1JQJC 2C9CA 3UWKA 2UVQA 1HY3A 2A5FA 4F4CA 1VPLA 4Q4AB 5JJKA 2EWVA 1XMJA 3CX6A 1TQ6A 1OFUX 4QBIA 3WMGA 1SVKA 3BB1A 3D7MA 3FGNA 4L15A 1SXJA 2G0NA 1CRQA 3PVSA 4ZDIA 1U0JA 2W83A 4Q47A 3ADBA 3IQWA 3PUXA 4BLQA 2ZSDA 3UMSA 2QL6A 2H1LA 4US0R 3R9IA 2VPPA 1NMZA 1E2NA 1J8MF 1CP2A 1HURA 2ZR0A 1YZKA 1ZINA 4PSVA 4Q4JA 4OHWA 4Q9LA 4EQ6A 1EESA 4MRRA 1GUAA 1JI0A 4CEHB 3THYB 1KNXA 3WMEA 3GPLA 4KJZA 4TMKA 4NKRA 2IUUA 3BH6A 1EK0A 4DLWA 5B57C 4HLUC 5M04A 1K6MA 1QHSA 2ZE5A 2D4HA 2BCGY 4NH0A 2C77A 2ZRBA 4JKYA 1S9HA 2C5LA 1II8A 2YC4C 4GOJA 1XNJA 3BFXA 1S3GA 3QE0A 3AUYA 4HUQA 2JJ2A 1Z6TA 2VBCA 5B64A 4C0SA 4A15A 4D26A 2B7CA 2WWGA 1SULA 3BH7A 3TAHA 2GVZC 1D5CA 2NO7A 2VHQA 1GDDA 5AJZA 4B3XA 1U8ZA 2LWIA 4M1KA 1JEDA 1BIFA 5EP4A 4LV8B 2VF8A 4R98A 3NC0C 2E1RA 3SBDA 1E9EA 3C41J 2DYKA 1F3OA 1OKKA 5B2ZA 4EDHA 5CITA 1IN7A 3B82A 3W6PA 4ZDKA 3PFIA 1E6CA 1Z0FA 2GDJA 5EJEA 5K8UA 2O8EA 4IDNA 4A1FA 1VTKA 4YMTA 3N70A 1A2BA 4EPRA 2PCLA 2WAXA 5FOUA 2F9LA 2B8WA 4M0LA 1XPUA 1SVMA 3PUYA 4ZKEA 1VHLA 2IF0A 3LRPA 3QF7A 4BLPA 5BWMA 4L9SA 1E2KA 2BMEA 1NBME 1NVWQ 1I4DD 1G7CA 1OH6A 2WIAA 3AKYA 2CVHA 2F6RA 4NCNA 1GNRA 1VMAA 1OSNA 5KDLA 5JBQA 3SQWA 4XTRA 2VO1A 3WHLA 3UKDA 4PAOA 5DHFA 3F5FA 2OUKA 4Q02A 3NHBA 4CEIA 2AD5A 1MT0A 3WYFA 4DUGA 3O8CA 2OBNA 2QT1A 2FV8A 3GJ3A 4QL3A 4BFWA 3QG1A 1W46A 4PC1A 3K0CA 3KUCA 3MAAC 1NKSA 1XEXB 4UNNA 4IOMA 2ODBA 1XX6A 4Q9IA 2ZJBA 3G0HA 2Q0HA 1H8EA 5GVSA 2ZRPA 4JLOA 4A9AA 1KO1A 1W49A 4LJYA 4J0QA 4I1VA 3TQFA 2FNAA 2CHQA 4HB0A 4OJKA 1JR3E 1Z6YA 1XXHA 2WJYA 3GLFE 4LJ7A 1AA9A 5FTLA 2EQBA 1C9KA 4YONB 1FL9A 2OZEA 1DO2A 1GM5A 2WSSA 1OB5A 4IOJA 4XWAA 2OCYC 3EPHA 1G5PA 1B0UA 2D7DA 4ZCMA 3QKSB 2RMKA 3EC2A 3L43A 1H8HA 2CL0X 2GF0A 1Z5ZA 5DISB 3RC3A 1JECA 1S1CA 3AF3A 4ZDJA 4HDOB 1BYIA 4A4DA 4UKDA 4LHXA 3W9YA 4ZIRA 4MDFA 3WMFA 5AUPB 4DDVA 1VG9B 1NBMD 5JZVA 5EP1A 2PZGA 5E3HA 5EE5B 4LC0A 3Q72A 5JRJA 5AJYA 3CRW1 4HAUA 4B6FA 3GJ6A 3A4LA 1WXQA 3AVXA 4NCKA 4HYYA 4B2PA 2J46A 4MYHA 4YMVA 5KDDA 3TH5A 3WNBA 2R6FA 4H9GA 2XOKD 2QGZA 5E95A 2DWQA 4ARZB 4V0NA 1GKUB 5BN4A 3DDCA 4BQSA 2QU8A 3WBJA 3VR3A 4AKGA 1LFDB 2RGNC 4JLNA 1DELA 3K0SA 2QAGA 3B13B 3X1DA 1FX0A 3R8CA 2CK3A 2BM0A 2G6BA 2RH5A 1ZCAA 1E79A 3J81k 2VP0A 1UBFA 1XPOA 1Z0DA 5EXPA 1ZC3A 3HR7A 3ZVMA 3ZDQA 1A1VA 2GNOA 3L8ZA 4BEBA 4E09A 3AGPA 1GRRA 1OJLA 2FZLA 2ZE7A 2WZQA 3DMNA 1I4LD 4MH0R 2K5UA 2AR7A 3IUYA 4B76A 3NBZC 4ZI2A 2ORVA 1PV4A 2OESA 4KVAA 1OFHA 2OCPA 2FZ4A 1S4QA 2ZAMA 1ZP6A 1T3HA 3OAAA 3FB4A 2X19A 2ZRKA 3TIFA 5L8VA 3IILA 2VHUA 4A6XA 4CT4B 4K46A 5C4GB 1TTTA 1E0JA 2IYVA 2QA5A 1VCNA 1E2EA 4DLUA 1Q1QA 3I73A 5KNDA 3GLHE 3MJHA 1W0KD 3KDSE 1ZNXA 3KUDA 2IWRA 2EW1A 5JWOA 3X1XA 4RD0A 1HT2E 3LQRA 3B1YA 2FN4A 1KKMA 2HF8A 4MKHA 1JR3A 2Q9AA 1Z3IX 3VTKA 5J47A 5L3QA 1M74A 2ATXA 2I1QA 3GLFA 5LPNA 3QKTA 4RFSA 2ZSEA 3K09C 3C15C 1G7TA 1E9DA 1G3UA 3HU3A 2OG2A 4GBMA 3VKWA 4G5GA 4DCNA 2ATVA 5KUTA 1P62B 2QMOA 4LYFA 2C78A 1TF2A 1JNYA 1VDZA 1XD9A 1LW7A 2VTKA 5FPTA 5SZKB 4Q1DA 2YWEA 2DB3A 4OI1A 3VAAA 2WJVA 1OYYA 2R2AA 3HU2A 2V7QA 4KVGA 4DUGD 2ZU6A 3CX7A 1E9CA 4AG6A 2OSBA 2CEAA 1KIMA 1ESMA 4D0LB 1EFTA 5KU1A 3SQXA 4MYCA 1G3QA 4LK2A 4TMTA 3QKSA 2BVNA 2QE7A 4RD6A 4IHQA 1R4AA 2WAYA 4EAQA 1G3IA 3MWYW 5AJVB 2YWGA 3SNHA 1PUJA 2OFXA 2WOJA 4IDPA 3B60A 2ZI9A 2WV9A 5DSZA 3THOA 1W48A 1TL7C 3AH8A 4FCVA 3H2YA 5DGXA 3T15A 2WBLC 2IHBA 4PQFA 3FKSA 4Q1BA 1YQTA 2BCJQ 3A1UA 1W36C 1IN4A 4I1OA 1KK2A 3BWDD 3SJAA 5AR1A 4EUNA 2WMNB 3K9NA 1DAEA 1KO4A 2FGKA 3I3SR 3PR1A 2XEXA 5JFGA 2A5JA 1F2TB 3W3ZB 3U60B 2H7VA 2ZRLA 4YLGA 1OW3B 5JS7A 1Z0KA 3OEHA 4A36A 3AB3A 3IBYA 1UFQA 1OHHD 3MWLA 4I99A 4LJ4A 4OI0A 1DTSA 1D2EA 1CR2A 1KAOA 2V1UA 4MGKR 1KSFX 2O8EB 3TVTA 1XPRA 2CLCX 1UBEA 2IXGA 2R6CA 5FI1B 4YXWA 1CR0A 2QRZA 1G5RA 2W6JD 4PQYA 2UZ3A 5FTNA 2GRJA 5CYPA 3LXXA 4TL6A 2W58A 5KOYA 2XB2A 2GTPA 1KDRA 4OJQA 4XSGA 2R9VA 2GXSA 3B6EA 2WJIA 4F38A 2RGAA 1BYUA 5TMPA 3U3MA 4HATA 3SJZA 3OEED 3AEZA 4WBSA 4NDZA 3QVUA 5KDOA 1XMIA 3DKPA 2XAUA 1JPJA 5JHHB 3RANA 3WRXC 4LOAA 4HUTA 2ZRDA 5JWHA 2L0XA 1Q12A 4RZ3A 1KMHA 2NQ2C 2ZTSA 1ZM2A 4IJMA 1RJ9B 2DFKB 4TMVA 1QHHB 1TAGA 4OK6A 1Z22A 2JCSA 5FPKA 1R0YA 3I1FA 2AHOA 1MRSA 5GJVC 1R10A 4PFSA 4EPTA 4UNSA 1D8TA 1G21E 2QSYA 1COWA 1YR8A 4DDTA 2BEKA 4RD1A 4DIDA 1Q0UA 4B3DA 1RE0A 1W47A 1UM8A 2QM7A 1SGWA 3B8HA 4F93B 3T1TA 4Q4JB 2YYZA 3TW4A 4EQ6B 4NCIA 3SU8A 3LBHA 1K8RA 1R5BA 3DM5A 2R62A 4F4IA 5DE3A 2QTFA 2FSFA 3PUVA 1YZLA 3NG1A 3PITA 5K8IA 2NOAA 2RGDA 1CF4A 3ZJYA 3DPUA 3VR5A 3B1WA 5JI2E 1XXHB 1X8LA 4NHOA 4DCTA 3RSLA 1M8PA 1EWQA 2CCKA 5FPHA 3TUJC 1DAGA 4KO8A 3C5HA 3T35A 4PSAA 1P5ZB 4QG7A 1KI6A 2YOGA 4C0KA 3TRFA 3LBNA 2J0QA 1W4AA 1ZBDA 5TVKA 1JAHA 2VSOA 4GOKA 1JEEA 4XJXA 2GWHA 5H8WA 3H0KA 1IQPA 1G8FA 5AUQA 3AGQA 5TY0A 1ZUIA 2GCPA 5CIWA 2FJUA 4WIAA 2ZS8A 3A4MA 4BUJA 2E9SA 2QP3A 2PLRA 4U7DA 1IXZA 3F0TA 3GEIA 2GVDC 2AK2A 1KOFA 4PZZA 2HT6A 1GG2A 5LB2A 2ZM5A 5EE0A 1SXJD 3KQNA 3CNLA 1NVVQ 4A82A 4KFTA 3QPUA 2J9RA 4WXRA 3OAAD 1T8TA 1T91A 3WHKA 2A5DA 2DCUA 4TQAA 2VP5A 2QGNA 1FQKA 1M34E 2SHKA 4WXPA 4AG5A 1S3SA 1F6BA 2YJTD 4C0QC 2NO0A 2KJQA 2B8TA 3MWJA 5BXQC 1D9ZA 2IYYA 3CZPA 1DEKA 1AZTA 1CJTC 1G4AE 1US8A 2IA5A 3ICEA 2BJWA 1TEVA 3LH5A 1GZSA 5GJWC 2WWIA 2AK3A 3A37A 1KK3A 4BRUA 1N6OA 1G19A 2VP6A 4DXAA 5F2EA 1TQDA 2BMFA 2GZAA 2IXFA 3CRQA 3EASA 1M6NA 1U81A 3OIWA 4JL8A 3NXSA 3T1OA 2JDID 2MMCA 1P2VA 2X8AA 2ZITA 1YZUA 2W2TA 3W8NA 2QP9X 4ILEA 4PC3A 2G9NA 3FMIA 3B1XA 4BLOA 2VH5R 2A2ZA 1X8KA 1ZU5A 1NSFA 4TL8A 3DOFA 2A3RA 4PPFA 1RRCA 5JCZA 4B33A 4KSBA 4DKXA 4NYIQ 2IEYA 3V9PA 3KJIA 1XTKA 2HLDA 3FMFA 3PV0A 5CJPA 5SZIA 4DVGA 1GIAA 3B1ZA 1IOZA 1KK1A 2PL3A 4OQNA 4E5UA 1P2SA 1UEJA 2IT1A 2ZE6A 4HI0E 5FBRB 3U2QA 2WICA 1OH8A 1G4UR 1N6PA 2ZIAA 3VFDA 3QPVA 2CE7A 4LBYA 1DAMA 1NN3A 2QAGB 4FCTA 4DDUA 1CJMA 3THXB 4EPWA 1G8YA 1LTQA 3KKOA 2ZRHA 1CULC 1G41A 3KQHA 2W0SA 2JIZA 3QF4B 4P0TA 4FXPA 3EXAA 5G53C 1UJ2A 1H65A 1IN8A 1KJYA 1E2PA 2JASA 3H84A 3A1WA 2B21A 3FFAA 4MGIR 4LJ9A 3EA0A 1YHNA 2GCOB 3AM1A 4K8OA 1NL3A 2QZ4A 2AN9A 2ZU0C 4BFTA 2NZ8A 4PO1A 1H8ED 2G3YA 1J2JA 4M1OA 3E1SA 4D80A 4D81A 1JBKA 4AI6A 1HE8B 4CW7A 1VIYA 1J8YF 1Q3HA 2F7SA 1W2GA 2P5TB 1GNQA 4FW9A 5AK0A 1NMYA 1XJ0A 3HWSA 2DFTA 8OHMA 3LA6A 2IC5A 1WBBA 1TNDA 1W2HA 4GT1A 4Q01A 4U02A 1E0KA 1L4UA 2ZJ2A 2H8KA 1IBRA 2N42A 3G5UA 2ZROA 1FTSA 4OQLA 2P67A 4DLSA 2GZHA 4LHVA 1E1RA 1GITA 5J40A 4C7OB 4Q48A 1NSTA 4IFEA 2ZEJA 2ZRFA 5AWFC 1ZM9A 1NBMA 2C98A 1N0UA 3BFVA 3TKLA 2ZJAA 1XCGB 3VX4A 4TTRA 5FOWA 3M4YA 1J7KA 2ZJ8A 1KHTA 2ZJ5A 1OIXA 1WDTA 1D6JA 2ODEA 3FKSD 1N0WA 2RGGA 5LD2C 1OF1A 2CJWB 4JKIA 2O8FA 1E2HA 4ASUD 2GESA 1T9HA 1WQ1R 5EUQB 2V6JA 1N2CE 5G41A 2HJVA 3T12A 1T0JB 1EFCA 2CCGA 4PO9A 2QQ0A 4ON9A 1OFIA 5H68A 4FINA 2JGNA 3PG5A 1NVVR 1U98A 3I61A 521PA 1XB2A 3K0EA 1DG3A 2J87A 3NHAA 2DWPA 3A1TA 4JVMA 1RPZA 4FIDA 4GI7A 2PCJA 4CF7A 1JPNA 4B3GA 3KKQA 4LSGA 1E79D 5DHAA 1MKYA 5FTMA 1NF3A 3K0CC 3U61B 1Y63A 3FYHA 4D4MA 1PZNA 2BMJA 2OE2A 3B2EA 4JLJA 1IJFA 2XJ9A 1OB2A 5L3SA 2ZYVX 421PA 1TPZA 4QGHA 5G3ZA 1BO6A 4Q7LA 2X2FA 1LY1A 1W7AA 2PZEA 4G5QA 1P61B 4G5SA 5B30A 2NGRA 1CR1A 1XTRA 2GA8A 6Q21A 3A1VA 5BQ5A 4IDQA 4OI4A 1SXJC 2Y8EA 2MSCB 2JLXA 1NRJB 2PEZA 3NH9A 4RVCA 2CXXA 3RLFA 5EXSA 1LF5A 2H5EA 4LUCA 4C0JA 2O8FB 1CS4C 1OXSC 1HT1E 2GXQA 1N5IA 3F8TA 3QXHA 3SJBA 1XJQA 3KXLA 4P33A 3QPWA 4G5OA 3FMOB 4DSTA 3Q8XB 4M1MA 4CRWB 4F92B 3TJZA 5HR5A 4RD4A 1EWRA 3BK7A 2W6IA 2GCNA 4AYTA 4Q66C 1KJZA 4MKFA 2AKYA 1DAKA 1RKBA 2D7CA 5IT5A 4LYHA 3VKHA 1TMKA 1N6HA 4KLZA 1DE0A 2MSDB 1JB1A 1E94E 1NG9A 2JJ1D 2NO1A 3ADKA 4PSKA 4C3ZA 1W4RA 2HF9A 4MKIA 5FPSA 3UWOA 3V4FA 3UG6A 4WW0A 2VQSA 2XNSA 1PUIA 4Y0AA 1VG0B 4MGZR 1DPFA 3RNLA 1QHHA 1H8HD 2IYLD 5JS8A 1XWIA 4HDQB 1MH1A 3A4NA 3P1JA 4I1UA 2QBYB 1RFLA 4UXHA 2RHMA 3ONWA 4RD3A 3TSWA 4RJLA 2ZPTX 3SFVA 2RAPA 4S2EA 3RRMA 1DG1G 3LY5A 5JEEA 5KSZA 3IHLA 5HZKA 2P6UA 2FWRA 4OHZA 2F3TA 1U2RA 1T3LA 4CGZA 2XSZD 2GXUA 2A30A 4NCHA 4PXAA 2WJGA 1C4OA 3P20A 3QJYA 1Z06A 3D8BA 4R7ZA 5LB4A 2BM1A 4IEIA 4WZAE 2FFHA 3DM9B 4C30A 1AS0A 3X2SA 2C96A 3QY0A 2QENA 4JSYA 1U94A 1GKYA 4IEEA 4RCZA 3KQKA 5DI9A 2GAAA 3EA5A 4W5JA 3W5IA 1FX0B 3L2OB 3OEHD 1FP7A 4IOKA 4ZV4A 3W6NA 1G6OA 3QBTA 4O3MA 3U3RA 4BFXA 5F98A 2GXAA 2FFQA 4DBLC 4P4TA 1XJCA 4Q4LA 1OLOA 3EC1A 1GKIA 4OBEA 1XTQA 5FL3A 1E2JA 1NN5A 2ONKA 3LNCA 4PC7A 5GJCA 3IIJA 5HTKA 3CNNA 4A0RA 3GJ0A 2DPXA 1VCMA 2O8DB 2H57A 4UXJA 3SR0A 1A7JA 3OIVA 4JLVA 4LDJA 1Q44A 3U7GA 4AC9A 4B43A 4KAXA 3DKVA 1ZC4A 2R6DA 2BBTA 3KJHA 4KYIB 5FOXA 1KGDA 4D25A 2JDIA 4Q1EA 2X2EA 2W0MA 3GJ7A 3CH4B 4NP6A 1KSGA 1YZQA 1SVOA 2YWHA 3CH5A 4IDOA 2ZRCA 1I4TD 5HPYB 3CX8A 3VNVA 4AKHA 3C14C 2IYZA 1QBKC 2OT3B 2XZPA 4HB4A 5B58C 1NNEA 5JJLA 2OLKA 4Q19A 3THWB 2HEIA 2OAP1 1AZSC 4HEJA 1DO0A 2OCAA 3NWJA 2V4ZA 2AWNA 4LV6A 1DS6A 3VU9A 3TE6A 4CDGA 2BC9A 1TF7A 3CRMA 1ELOA 2ZREA 4GP6A 3ADDA 3U3KA 2D06A 1LS1A 3KKMA 4UNQA 3NKVA 3IO3A 2GJSA 3I62A 3B85A 3FE2A 5HKKA 2OLJA 3I5XA 3OFND 4KU4A 4P3YA 3U7FB 5CDFE 5FL7D 1R0WA 3U44B 2FF7A 1BMFD 1UDWA 2GCOA 2VHTA 4B44A 3BXZA 4JLBA 1S96A 4EJSB 3CNOA 4V0MA 2QNRA 5CLQA 1ZM7A 1TU3A 5EZ5A 2IYXA 2IL1A 4OHXA 3KKNA 4V03A 2VP9A 3KL4A 3P32A 2FSIA 2QROA 2QAGC 1EFHA 2ZRJA 4LBWA 2CCJA 4Q7KA 3KB2A 5IHPA 1J70A 1E9FA 1AS2A 3LD9A 1SHZA 1U9IA 3K0FA
chains in the Genus database with same CATH superfamily
4JJIA 1JA9A 1LX7A 4Z4EA 1UPCA 3HBLA 5AKZA 5FYQA 3UAVA 4FS8A 4ZHQA 1ZUHA 2C5SA 2MSLA 3JQAD 3RFFA 3ZK7A 5I45A 4P80A 3GNSA 3Q9SA 3UANA 1X6VA 2GLTA 3FRIA 3LV8A 3VAYA 2J1LA 2OZPA 1E4EB 5A5EA 4D3ZA 3GI1A 4QBTA 4CQMB 4KODA 1R2QA 2CLOB 4QA9A 4XDGA 2YZKA 1BGXT 2K7ZA 1FOEB 1RLOA 2V6MA 1E9VA 4X8MA 5IJ0B 3I5UA 3CUEF 2GILA 5U1PA 1V1MA 2EIXA 2YXBA 1VRVA 3H4TA 3WIOA 1DKRA 3GLKA 4F4HA 2OBBA 3ETGA 1MX5A 3CISA 2NXCA 4NEQA 4XFJA 3SKVA 4IMIB 4NMLA 4N0DA 4YJFA 5ALGA 2CMGA 4EHFA 4NDNE 1V25A 1O97D 1HV8A 3CIOA 3DF9A 2YOFA 4YA6A 3HDGA 2LTAA 4AIRA 1L1FA 1II9A 3GEHA 2VDRB 3QBVA 2IW3A 1Q77A 5K3AA 3IEPA 3F2VA 1KEZA 4EYSA 5IT4A 4Z7QB 4NJMA 1WMSA 1JHAA 1CNFA 1GPYA 2W2QA 4PHFA 5BOVA 3T3EA 4D5GA 2F4VB 2OILA 1ODLA 3A06A 4KPFC 4PPYA 5BNFA 4PNHA 3IDZA 4MCJA 4DEYA 3NIDB 1TF5A 1TT7A 4OQXA 1SBHA 4CWAA 3MFQA 1KWKA 3GP8A 3WOVA 5UKDA 3BWCA 1L7OA 3Q87B 4MPPA 2VYVA 3GNTA 4FYKA 2JI8A 3CLKA 3KEMA 2C3PA 2VQ6A 4N0EA 1ZGBA 1IB0A 3NYRA 3VC2A 1UPTA 4H3VA 3BHIA 3EXFB 4M99A 5JHGB 5FLYA 3WQRA 4GPIB 3ZNQA 4AJJA 2IUTA 5JQGB 1J0AA 3OCYA 4H1UA 4B3HA 2WJJA 2ID4A 5HCIA 1TC2A 1CFJA 4W5QA 1YF3A 2JF0A 4P31A 1BXKA 1EK2A 1V7CA 3KC2A 3QNMA 2JAUA 5EXEA 5H0IA 3SHWA 5IKMA 1IJKA 4AKIA 1M75A 1NOJA 1T9ZA 2BFFA 3NO4A 1YZTA 1D2NA 4NF2A 4E32A 4M21A 2ZI6A 1U3TA 4EZBA 4D79A 3UB2A 3UOAB 1G9TA 1FU8A 2WWHA 3LGSA 5CVDA 5JBIA 3KJQA 1N6NA 1XK7A 1EFRA 4ZVQA 3VR4H 5IMSA 4XQ9A 3GWGA 3ZY5A 3DOOA 1JJ7A 3GJ4A 1FS5A 1V26A 1AUVA 1ISJA 2CFOA 2NSDA 2O2GA 2YY7A 4LYJA 1QFMA 1N6RA 4IG4A 2IZOA 3RTBA 2OSVA 2BUCA 3MUFA 1E66A 1RQ7A 1Y3DE 2WZBA 4PNZA 5AVUA 2CDNA 2YV1A 1XMQB 4LRYA 1V39A 1QG4A 3DXXA 2CF5A 2ZZMA 2O2EA 1GAQA 3M8KA 4HDNB 5HKBA 4E03A 5DOZA 1QVVA 3A0RB 1BH6A 2DUJA 5BRJA 2IYTA 3GH1A 4F9GA 3QVVA 3W8DA 2HPVA 3WDKA 2QTVB 3MWEA 3CVYA 4RENA 2OYRA 1KMQA 4OQQA 2C7QA 1JEQB 1ADBA 1U7ZA 2GA9A 1M10A 1AY0A 3H1PA 1OH5A 2XTZA 2D3WA 4ME6A 3WDLA 1MB4A 4JBNA 5E1OA 3SQOA 3BBPA 1GZDA 4CKEB 2MYPA 4QM6A 1QP7A 4H6PA 2JFWA 2KX7A 2Q9BA 5K3SA 1LX6A 1I2AA 3EZYA 1KDTA 1KI2A 1NUTA 2GRUA 4BO0A 3P0EA 1X1QA 2ZRAA 3CNBA 3IELA 3U09A 2QG4A 1YBMA 1E1QA 3AWDA 5IJWA 4XH9B 3QU5A 1NI3A 2X7XA 3ZCUA 3GXOA 4TPKA 2A1IA 4L8LA 2Q21A 3EQZA 1GPNA 3MS2A 4EVQA 3FCSB 3WGVA 1EZ4A 2O3TA 5J2TA 3CUUA 4ZYXA 4N3CA 3PGLA 4MQUA 2PGIA 3BQMB 2H6EA 4CLRB 1Q5PA 3PNBA 1OBFO 1A71A 2G77B 4AQDA 2C0QA 3ESBA 5M34A 4JJZA 4KBGA 1PQWA 5ELXA 3PNOA 3SHQA 1WD7A 3N7TA 2WF7A 1PK7A 2WTBA 3HDHA 2Q8NA 3TZKA 3CNHA 1L7QA 1L4BA 3R77A 1PG2A 3NBYC 1CW2B 2I7DA 2NU9A 3KEFA 4HH4A 1E3WA 2RAUA 4RZHA 1SY7A 4WD3A 3PFKA 3RTCA 2FWPA 3G88A 3V7FA 2EZ9A 1XZ8A 3VZRA 2LV8A 2O8DA 1F1JA 1EFLA 1UBRS 4JYCA 1P2DA 5AKHA 1W5TA 1VBKA 3KSAC 2BFMA 2AD1A 2WD8A 1GVHA 1YQUA 1RIIA 3U4IA 4OHFA 3JV7A 5KU7A 4DB2A 2H92A 2JGIA 3OZSA 4PYIA 4MW6A 1E6WA 5LLDA 3D7RA 3KR0A 4E7PA 4M98A 1E5DA 4G86A 1ONOA 4YY3B 2RKWA 1ES9A 1J8VA 4I9HA 3KX2A 1BCSB 4FHGA 3E61A 4PM4A 1VIVA 5MN6A 4HB3A 4BFZA 3R3ZA 2D3TA 1C7FA 1U3WA 2FEPA 2I3GA 1OIVA 1V16A 2QRNA 3P19A 4FMBB 4B3TB 9MHTA 3IKMB 3CZMA 4HH0A 4C01A 4X41A 3BJZA 1KHHA 3H8WA 2YZGA 3QRWA 4X61A 4B6GA 5K0ZA 1FFSA 3H75A 2GPYA 3N2NA 1XMOB 2BTQB 1JZTA 1VLZA 1C29B 1V11A 2WD7B 1SUFA 3DEFA 1N3BA 3O84A 5BMVA 5BNWA 3I9MA 2WG0A 4NX2A 1UWLA 1V5EA 1UCFA 1WTAA 2GD6A 3EVTA 4MPJA 3UCEA 2XYRA 3TG2A 3G8AA 5IC4A 2VZ0A 1KFEB 3AESA 4RMHA 3FOCA 1QQBA 2IPLA 4L6AA 2ONJA 5FWYB 4AWBA 4B3JA 4QVIA 3A6KA 4QRDA 3D3WA 2VNKA 4Z49A 2BZSA 4HD8A 4YPFA 3WC4A 3GUUA 3UK2A 1AUXA 3TNJA 1VCOA 3FUCA 5A4IS 4Y2HA 4FDMA 1DV1A 1LI7A 2R86A 1PGQA 3G82C 3FMVA 4TRRA 1E7MA 3I4LA 4X92A 5B37A 2QVLA 1MAWA 4AMGA 5FAXA 1GRCA 3Q10A 4EA8A 3AHDA 3IDOA 2C8VA 4RSGA 1QYIA 1VLMA 2O6HA 3FWYA 4OLHA 5EZSA 2W93A 4KPUB 4DW8A 2YXLA 2C1ZA 3GJRA 4RKRA 4YAIA 4YC7A 5TPZA 3DTVB 4TSFA 4HB2A 3RSQA 3X0DA 3MT8A 4WL0A 2XKAA 4N49A 4XLLA 1WU7A 2XNDD 3DBHA 1BS9A 1Z9BA 3A2KA 1SBYA 5M5BA 2WIKA 3NHMA 3I34X 4MOWA 3CS3A 4LWOA 2ECOA 5F7JA 3DUFA 2IJGX 3EQ2A 2ORYA 3GFOA 3K92A 5THXA 1Q0SA 3WGUA 1QP0A 2ZSBA 5CP8A 1TUGA 4RLFA 5IT0A 1JQKA 2OY0A 1QHNA 1HYHA 3ZZNA 1RVDA 4F06A 3ZLJA 1YZVA 3FZGA 3OFKA 3V1NA 1AC5A 4ZI7A 3QXCA 4KK4A 3RYIB 5HFAA 5AOAA 4QTXA 2OHXA 2IPNA 1BG6A 3WWCA 2V0NA 3ROMA 3ZWBA 5CITA 2HLDD 3IP9A 5BW5A 1YJ8A 1UBSB 1KZ4A 2C84A 2XOKA 2VZ8A 1ZD3A 3H1GA 3IKLA 1E2LA 2PYDA 3V4VB 1Q7GA 3I42A 3OM9A 4PVCA 4RF4A 5TF0A 4MRAA 4B4OA 1WF3A 2CFTA 2CVFA 2NWQA 3NPAA 4ZYTA 2OK8A 1Y42X 3P9SA 5ALEA 3GEEA 3RRYA 2R96A 2OBFA 4BE7B 1NIPA 1Q84A 2VF7A 2VZLA 1H4SA 3NX4A 1O5IA 1A96A 1PIWA 4TTPA 3W1WA 2O8CB 4KWEA 1U7WA 3H04A 2IQ5A 2R7AA 1BE8A 3H4MA 1J5XA 4X45A 3SAJA 2WY2D 2XCUA 4UFNA 3ZS8A 4JD5A 3E3LA 1A4RA 4RXTA 1WLSA 3ZDAA 1QUFA 5ED0A 3LS2A 4DIEA 2HX1A 4RGQA 3EZ9A 4WECA 3AY6A 1FTYA 2P9HA 2QM8A 3M1AA 4JYPA 3PI6A 4WZAA 4GRAA 2VTBA 3H5IA 3HYRA 3FTQA 4WNAA 4EKYA 1ZW6A 2ZIXA 3OPYI 4MO9A 4AW9A 1ESNA 2WP8J 4HVCA 3I8XA 1NF8A 3N8IA 3G0CA 1XN4A 1G7RA 1VECA 4JR0A 5ERYA 1BHQ1 1BHSA 5TR9A 5HYVA 1L9KA 1KBZA 4O4LF 1S2GA 3K1JA 2Q9UA 2AR9A 1ODFA 3BZWA 1LJ8A 2I8AA 1K98A 3ECSA 2G82A 5C8YB 2ERYA 4HQ0A 5LZ7A 1N75A 3ESYA 5JVDF 3Q3HA 4UBOA 2FFBA 4DZZA 1LPAB 1AQ6A 1EB9A 2NZJA 2YC2C 4FI3C 1P75A 1B8UA 3WY9A 1P5JA 2Y2VA 4XEUA 1HOTA 1UXJA 3E4CA 2DM6A 3K70B 3FPCA 2AFHE 4RKWA 4EABA 2BI4A 2LD4A 3WIBA 2BH2A 4RHCA 1B00A 3L0SA 3ZH2A 2E87A 1UP4A 3A2LA 3MCZA 1Y7TA 3QM1A 3A6HA 5JFOA 2HYIC 4MLDA 5CG2A 2R8XA 4WJZA 3O0DA 1IZ8A 1OKKD 1AXRA 1IHPA 1VYTA 4FWIB 3HCEA 1Z2DA 3G2PA 1QTNA 4LXYA 3ND9A 4XJTA 2EL7A 4RFVA 5CEEA 2NQ8A 3HDJA 2P4SA 3ND7A 5C0OE 5C4MA 5A3JA 3G8DA 3EX7C 1WMAA 2FEOA 4G4SO 4PPGA 1EAMA 4QYSA 3MGKA 5EGSA 3RJ9A 1AV6A 1CFZA 3LQFA 5LLSA 3Q5EA 1SRRA 4MVJD 3FUVA 3T7SA 4X85A 5HHTA 4LF5B 3ETJA 3H42B 1ZVQA 3KQYA 1YS2X 4P5PA 5GONB 5IMBA 4I1YA 4PX5A 3RFVA 4C21A 3FYDA 3DEJA 1B6TA 3RS9A 5B1DA 3Q8KA 2R5FA 1VJGA 3QVKA 2O0HA 4QYMA 4YDSA 3EC7A 2OMEA 1I2CA 4QUDA 4CM8A 3L0DA 1Z47A 3L4BA 2XV1A 3H5RA 2CLKB 2OD9A 3I2YX 4BL5A 4QIHA 3KTFA 4QOSA 4Y1RA 4MWBA 3K1ZA 2QZSA 2HAEA 2JIQA 3L8GA 3TLZA 1FSPA 1U99A 5E9AA 2VH2A 2YY6A 1MJNA 2ZS9A 4PYMA 2XMDA 2EIHA 4HL6A 5AI9A 4F6RA 5GINE 5ARDA 3VHXA 2PANA 1EM8A 1QVZA 4HAIA 3LRTA 1UZUA 3VUEA 1YGPA 4ESOA 5A03A 5CA0F 4DR5B 4XRRA 1ZESA 4KOAA 1LTHR 5CNIA 4J4HA 4EHBA 3RK1A 1SKAA 4TLBA 3EG9B 3ZGVA 1BFDA 3OG9A 4I3FA 3AI1A 1F7VA 4G4IA 4UCFA 5KZMB 2IXEA 2HDWA 4GVLA 4N5HX 4EKIA 4NU8X 5JPCA 1FU4A 2SKDA 1E2GA 3DFUA 4KKXB 4M88A 3TXXA 5GIOE 2J7KA 3ADOA 1VPVA 4QHTA 9ABPA 1M5TA 1NAHA 3DVRX 1N2JA 1EQ2A 4C0WA 5CD1A 4YUAA 2I7CA 2D2FA 4U5QA 2ZSIA 4D3DA 4IHJF 2GASA 3E7DA 4UHKA 3JASB 3EF1A 1J0XO 2SCUA 3BIFA 3COWA 4ZO9A 3SYLA 3KXPA 2I55A 2ZIVB 4BAUA 5U4QA 1NF2A 2ZUWA 1EIWA 4NZ9A 1USVA 1MIOB 4DWJA 2J6HA 3B7GA 2G4LA 2GCGA 3OA2A 1JAZA 4CM8B 5KTOA 3SYKA 1QG0A 2WYUA 3HLTA 4NPHA 1E2FA 1CBUA 3OLYA 4P3KA 2ZLBA 5HQ3A 3HNOA 1XZJA 3I6IA 3QG5A 1XD8A 4FJ1A 1E6UA 1CC1S 4N65A 3U4QA 2QN9A 4WNYA 2I4RA 3L79A 3EXG2 3LL4A 4R71A 1XMVA 2IFTA 2FA9A 2NU7B 3D9QX 1PJBA 1U8TA 4D3XA 4F4JA 2H2DA 3K5IA 3T5TA 4OHVA 4BGVA 2C4KA 1KH2A 1V9CA 1M2WA 2EBHX 4MRPA 4N48A 3VKUA 2Z8XA 1AQYA 1XAGA 1X9HA 5L3QB 3GLFB 3GARA 5B36A 4Q16A 3M1IA 3COVA 3EGCA 1X14A 1E0SA 2IYAA 4HN9A 3FUXA 1MO2A 4MPDA 1MG0A 3AVUA 2ZYWX 4EIWA 2OECA 5FR1A 4N9QA 4IFIA 3HA7A 3D8TA 5C5EA 2B35A 2X6QA 3BTVA 1XMPA 1O6FA 3EXHA 3HSKA 5WRFA 4AY6A 2BHNA 3RAPR 1AHPA 3PD7A 1QYCA 4NMWA 1W36D 5EIXA 4OQPA 1K5DA 2IXAA 1VFNA 4QU8A 3WAJA 5A5GA 4O6VA 4A92A 4W5NA 4IFBA 3OJWA 4OQMA 5JYDA 1ZNQO 4UXIA 1RWBA 3D5QA 4UU1A 1TM1E 1KSJA 5G0UA 3TZHA 2XKBA 4DUYB 3H2HA 3KR9A 4A6DA 4J49A 2PMBA 1U7HA 221PA 1V95A 2QLTA 4G8DA 4GOOD 2RKBA 1HYQA 3CQ9A 2CYAA 4IWXA 4RM3A 1VE1A 4AICA 3LO8A 2QSZA 3LWDA 3FRJA 3I01M 3Q8MA 3EJWA 3W5DA 1E99A 3L8DA 1G9XA 5H3CA 1E5XA 1FXUA 2ANBA 2HBQA 3QJGA 4L8FA 5EQJB 4CEIB 1H3EA 3CRRA 2W4QA 3UUEA 1PL0A 2BFNA 5K8CA 2O20A 3CPJB 2AX3A 3NC1C 1SCKA 5EWMB 5B6JA 2XDAA 1N3IA 5EXXA 1KVSA 1RIFA 2RHWA 2R8OA 4ZJZA 3ZTYA 5HBRA 1G2IA 1ADYA 1WE2A 2PZMA 1DOHA 2QF7A 4J0IA 5G1NA 2RHGB 3W8RA 5C9ZA 1P60A 1T5SA 1EG7A 1FX1A 1O95D 1VLVA 1L8QA 1PV2A 2CV1A 1PWXA 2WSBA 4TS1A 4QEZA 3WNVA 5HM8A 3EIXA 4RTQA 3D2LA 4DV3B 3LT2A 4BNWA 3UXEA 1TQ4A 1RXUA 1U02A 2JLZA 4IUYA 4LXTA 1EX1A 1GRNA 4B7AA 3WB0A 4GOXA 1B15A 3ZE7A 5L51A 4MKGA 4KR7A 4R54A 4TX1A 4LZNA 3N2LA 3SNKA 5EEHA 1KVRA 1OI2A 2IYNA 3GP3A 4AWXA 5HRCA 3LBIA 4BFUA 3MWKA 5JTUA 3NAGA 1U9IC 2FN8A 1V8OA 2FG7C 4WZ6A 1CJSA 4LYEA 2HYDA 4P83A 4PG6A 1U28C 5CT9A 3FFBA 3PJFA 4YRAA 5B4VA 2C99A 5EP3A 4B3CA 5DU2A 1E1QD 1O95A 3BSWA 5BV0A 4IIXA 1HR0B 1GL3A 3RI3A 2F43B 1E2IA 1I4OA 4LGMA 2RJ3A 4NECA 2EXXA 4KQGA 3EEYA 1GEGA 3TLMA 2WIFA 3KJZA 2J0UA 3D7SA 3RROA 4NG4A 2X7JA 4Y6RA 4HEA6 3OJCA 3A6PC 1JIQA 4J0GA 2C7GA 4F84A 2QMUA 2IYSA 2WUVA 2FW8A 4JJKA 2PXHA 1G4HA 2C2ZA 4U2KA 2YFQA 4RACA 3RFCA 4UE2A 5KPJA 3WMRA 5JSHA 1GUBA 1O9HA 3SN6A 1UBKS 4PCLA 5F9HA 4BWGA 1SG6A 1NVXQ 1TYDE 3M3PA 3MWGA 5AKKA 5IF9A 1UXOA 1U2ZA 3V1LA 5JXWA 1T6NA 2XQVA 5LMZA 3QENA 5FWDA 4BP1A 1TVCA 1I0IA 1QR2A 3D1JA 4DMFA 4KXUA 3JWGA 1XKQA 4BZXA 1NJ6A 3T0GA 1GPBA 3HFGA 4KLNA 4RE6A 3WMXA 4HZUB 1QIIA 2JLYA 4EUSA 2BGRA 1QWSA 4FX5A 1EK5A 1I3LA 2G09A 5DLEA 4UUNA 4DADA 2IHKA 5EE9A 1NP6A 5E7JA 4R1PA 3EMDA 5HILA 1YO6A 1LFAA 1M8JA 2RD2A 3HADA 1B8OA 4OQZA 1XU4A 5B3LA 1NGSA 1SKYE 2OAQ1 3A9RA 2R97A 1X86B 3DTTA 1IUNA 5B7GA 1O87A 1C8BA 4I08A 3ZIAD 2BFEB 4DC1A 5BN3B 2QR3A 3EUAA 4KQKA 5B3AA 2EU8A 2ETVA 1Q1AA 3KXKA 1T3GA 4QJBA 2FPPA 4ENUA 1GZ6A 2QJWA 1GGJA 3KLMX 2C2YA 2LKDA 3QI2A 3SDZA 1G3RA 5JUWA 2C8KA 1CF9A 1KI7A 1ZGGA 3IA7A 3R4VA 1NW9B 4IJVA 1OTHA 3G1TA 5DX8A 4L08A 4A5SA 2XHZA 1EFRD 4UU8A 5JNUA 4GI3A 4FKZA 1PCXA 4RZSA 5JZSA 1Q1EA 1T5LA 1XK6A 2V1XA 1X70A 2OGTA 3CWZA 4QFMA 4RMJA 2I62A 4UM5A 4TMYA 2UZ4A 5GADl 4ZVTA 4Z2AA 4DWWA 5H1YA 3E1GA 4ZD6A 1JBQA 3KZNA 2EFCB 2X9NA 5E2BA 4ILKA 4QSHA 5ADWA 3QKRB 1S3FA 5IUKC 3CUYA 2INGX 4FS3A 2BLLA 1DRWA 5CA0A 3UJ7A 3T1HB 1C3LA 2WWTA 1H2XA 3KQVA 3O5AA 5F78A 3GA7A 3GWZA 4EF4A 3DEAA 4Z4FA 3VQTA 1PT5A 4F6LA 4KR3A 4FOPA 1MXFA 3O47A 2GN8A 5HJEA 3QEKA 2JVIA 2JGMA 1M3SA 2BR4A 5IANA 2QTCA 2WWXA 3THWA 3AP2A 2PQ6A 1J8DA 1UBCA 2PTGA 1YJAA 3W3AD 1P44A 4RIEA 4BDTA 4DT1A 4Y9DA 4GXRA 3OIUA 3TFWA 1L4GA 3CEJA 1IXSB 1YDHA 1P7VA 4I2VA 4XB6B 1TOAA 4Y9UA 3IB6A 4Y2YA 4LQLA 3GUCA 1P9WA 4RKYA 2XW6A 1KRWA 3HJGA 3P9QA 4GMDA 1X7YB 2EJVA 2FCAA 2JBHA 4JSTA 4OEHA 1THMA 1XFDA 4TXMA 4QTYA 2WLTA 3WDSA 4A2QA 5JADA 2TRSB 3VR0A 1QNLA 4IBOA 1NATA 4KTVE 4QATA 5FBQB 1DOAA 4K0RA 4U2CA 121PA 4DY4A 2YMQA 3ZX5A 1F12A 4NV0A 2C7BA 4IJ5A 3G3EA 4O29A 1NF9A 2LR0A 1XTTA 1NLYA 3W90A 3TDKA 5JCOC 2IHJA 1E5QA 4O2LA 2QHXA 3JAWA 3EEOA 4YJGB 3KQWA 1PHRA 4RETA 3VX3A 1YZHA 3GVXA 1HDZA 5BV7A 3LYHA 4GR9A 1AGRA 2CMFA 2CVZA 4TKLA 3PTLA 2W2LD 1I1HA 3BERA 4XTCS 5C18A 2VAVA 4JC5A 1HYEA 4IDEA 4B7ZA 3BIOA 1AXEA 1TI7A 3HJNA 4DCJA 8AT1A 3T34A 3ETEA 3ERCA 1FFWA 2FFAA 3BD9A 1ZJZA 3KKEA 3ZR4B 5JMOA 1SCUB 1PSWA 4HDRA 1MC4A 4B47A 2NO4A 2FWMX 3LLUA 3AJEA 3IBGA 1U3GA 3VO1A 2QM3A 2G72A 5JVDA 3EJ6A 2VA9A 1I3CA 4IY1A 1RAIA 1UJ5A 3OQJA 4M46A 1WZIA 4JVLA 1VSUA 4EEXA 3T5MA 3O8LA 5B12A 1L7RA 2BE7A 5C5DA 1X3SA 1SCIA 2HV8A 4BMPB 1NFRA 2V7WA 2P8JA 3DKKA 3PC4A 3THYA 1AN9A 5EPOA 1H2WA 2VHWA 2ZKLA 1VL1A 1FRFS 3KE9A 3T3MB 3V4RA 2AQIA 1A88A 1B0PA 2WSSD 4JXXA 5CRIA 1AGPA 4NY1A 5JS2A 4JHXA 4KGDA 3KT0A 1GFWA 3F1LA 3V7NA 5K09A 1XSEA 1MT3A 4QXRA 5GWXA 3VKGA 3Q3GE 3IPXA 3TCXB 1LUAA 3SIPA 3WA6A 2XKKA 4HUQB 1ZD9A 3P96A 2HQSA 4JJ7A 4QNRA 3LL7A 3RFXA 1IMJA 1SBZA 4P3PA 2WABA 2DQKA 3HJHA 4AECA 4X91A 1BE6A 4X8OA 3WKCA 3DAYA 1WXEA 1H9CA 5F64A 4NRDA 5K51A 5J59A 4TKUA 5KNBA 4Y1EA 5DBOA 2QB5A 4U39A 1N2HA 1JJVA 1QB8A 4J16C 5ALYA 4ALMA 3U1VA 4J7XA 4F5EA 3OFVA 3BGSA 2FLKA 5ALJA 4NSNA 2IOHA 4JI8B 4JVOA 2YX1A 3GEGA 3PL1A 4L7QA 3MT0A 3R75A 2QE6A 2BGNA 2GYWA 2H06A 3MPUA 4CTMA 1DHRA 3H7AA 4U2BA 3AR6A 4BMXA 5DK6A 3NBFA 1F20A 1EGQA 3EODA 4RESA 4MV5A 5DP2A 3RF7A 4HNVA 1ZVMA 5CDUA 4RVDA 3ZV7A 1N8KA 3QBJA 4EJSA 4BO1A 4FOSA 4II2A 4CCYA 2FW1A 2JIOA 2RGXA 5DFAA 3ZK9A 3AVOA 4UU0A 1SCAA 5JI3E 3O1JC 2RBGA 3LC1O 3K8YA 4LY6A 4EARA 5CB6A 5JXHA 3H6GA 4DMKA 4EW1A 1UWKA 4M1WA 1VJRA 2WZDA 1RU3A 2X0JA 3EAQA 2RGYA 3NEAA 3MXTA 3PC2A 5A5DA 2AJ8A 4HFNA 2R6AA 3ZWPA 3WLPA 4DZTA 2O0JA 1L4FA 2JGDB 2RHLA 2RJNA 2Y67A 4GO1A 1PLLA 1DVRA 1GWNA 2CZGA 4HZIA 1KJ8A 3OEYA 5EESA 3ZVRA 4D46A 2F90A 3TNFA 3VV3A 1RXSA 4E5YA 4J6FA 3GJTA 2FFJA 4YRLA 2VXOA 4W7SA 3ZI4A 3T61A 3EPRA 3ZZUA 3I6MA 1JQBA 1UBOS 1M1NA 1GKKA 2HF7A 3HHPA 4IGKA 1HDYA 2ILVA 5CT4A 1VPDA 5DVZA 2ACVA 2I22A 3BXHA 4TTAA 2JCVA 4B7UA 3CB4A 2DTXA 3HH8A 3Q7EA 1BEUB 4HQFA 3UOGA 1XEWX 4JROA 3UGQA 2B9EA 4KE7A 1KYQA 4XWGA 4Z9XA 4O1IA 5CM8B 5EKTA 1N1EA 1RRKA 5TF4A 5KKCA 2W2KB 3CR7A 2YIDA 5TQ0B 3ZEIA 2RGRA 1EUCB 3GVCA 3LY8A 4FFLA 1A76A 2X4DA 4MIOA 1NW8A 3GL9A 1Y0BA 5CR9A 2EL9A 2CXSA 1P3Y1 1FJ2A 4RAQA 5A6VA 1J1UA 1SC4A 4D74A 3U6KA 1FRNA 1ETUA 1STOA 2CLIB 3IBCA 3MW8A 4HQOA 4Y7DA 1BAPA 1XQ6A 3MUOA 3LWBA 1XI2A 5F2KA 5SZHB 5BSFA 4EO9A 1YB2A 5B2FA 5JSFA 4ZU1X 4RWZA 3DV9A 3PUIA 5FUBA 3D3JA 2JCXA 3M70A 4KQ9A 2R1VB 4X24A 2R25B 4FQ5A 1F1BA 1FNMA 1UXKA 5LU8A 2VDMB 3JZFA 4K7JA 1ZRHA 2IOFK 4N8EA 4NG5A 5HXAA 1BQ3A 4NFSA 2FPUA 3BIXA 1YMQA 4QDJA 5IAAA 1XC7A 1D0SA 3E8SA 4AUKA 3G85A 3H3XA 1IPFA 3IOMA 4B6EA 1L3IA 4NYMR 4O2RA 1SEVA 3VPDA 4L0DA 2G1KA 4ZZIA 3BRSA 5EG5A 5KTMA 1IDN1 2H7CA 4NL4H 1IBSA 1WQ4A 3FYTA 4GDFA 2CLMB 3NDIA 2YYAA 3HCAA 3L4EA 2H0RA 3O91A 3JD2A 3OE7A 1M6VA 3HCRA 1LLCA 5ICFA 5H9WA 1EUCA 2QIPA 2CJFA 2EVWX 3F98A 4PINA 1DIHA 1E62A 3IT3A 1V8FA 4X90A 1YWGO 1R4NB 3NTQA 4G63A 2QUZA 4JLPA 4QXMA 2LCFA 1GUDA 4BQEA 3W34A 3RAFC 5IS2A 1UEIA 2BL4A 4CIXA 1ZJ5A 3ESXA 1V7ZA 1YT5A 3QU2A 2E4ZA 2WUFA 1QV9A 4QGFA 2IYOA 2O7VA 3V00A 2OZLB 3H83A 1E3IA 2F3QA 3QYPA 4WASA 5EJFA 1ZKMA 3PC8C 1WVIA 3T9FA 2I6QA 3VTAA 2VDQB 4D9FA 3K0FB 4MWZA 1SHTX 1SVIA 3C3AA 2JFYA 3S2SA 1FP2A 2BMWA 4WI1A 2HQBA 4JR2A 3T9CA 5IH7A 5TQ2B 3TQOA 5JYCA 3FOAA 3QLTA 1ML3A 1AN0A 1JLMA 1L2TA 2J07A 3GELA 4GPD1 4CDNA 5JAIA 4M83A 3V4PB 3KXIA 4MWSA 3K9FC 2V5UA 4ACAA 5K20A 1XTPA 3C43A 5KVSA 3O8QB 4R40A 3C5CA 4Y0VA 2JATA 3NJ4A 2P6MA 2Q6VA 4XIFA 2WJ3A 4O5AA 4CJXA 1EBFA 5TEVA 3NH6A 1UMCB 4CPDA 1NTOA 2GEFA 2PX0A 4CNQA 3OTIA 2WMOB 3M4ZA 2BWJA 2PO7A 2FG5A 3G9ZA 4EO4A 1PJ4A 2J0VA 1F8XA 2AJTA 1OZGA 3SR4A 3AQ4A 1N3YA 4JFAA 4LN1A 4NYJQ 1U8YA 1NDHA 4NXMB 4ZU3A 4PAQA 1GG9A 2VUSA 4ROTA 2B36A 3GLIA 1MDFA 3NZEA 4B75A 5JV5A 2IPOA 1X1TA 3I4FA 1GN9A 3F7TA 2ZJ4A 4TZ6A 1AKTA 1QHXA 2WFAA 1XRMA 3H2JA 3TE7A 2P6NA 4RBNA 1P73A 2BP7A 1GA6A 1ZRNA 2D74A 4O59O 1YC5A 2HJGA 1XEWY 3OZWA 4MR7B 4N40A 4MW2A 3G7UA 4XCXA 4YROA 5CIYA 3WE7A 2FDRA 1RYYA 3KKZA 4KV9A 1GXSB 4OG2A 4ERNA 1BGVA 5ADUS 1I7LA 1NIJA 2XJ4A 4G81A 4BCBA 5ES4B 4MRVA 5I6DA 4D1YA 2QLNA 5DNYB 2E5FA 1KU6A 4PVDA 1VLHA 5E7MA 4X7RA 4IH4A 2B2XA 1SVNA 4BYGA 4F72A 3EPJA 4PONA 4UHFA 5A1JA 1Q19A 4F2WA 1M8FA 3AVPA 1XDDA 3GQBA 4ZFNA 2BTEA 1YU9A 2QYOA 4C4OA 4F3RA 1Q7EA 1V8DA 4GLOA 4Q21A 4R1MA 5IJAA 3SM3A 1N57A 4Q1FA 1KZ7B 5AKEA 1DMRA 3LQ2A 2FHPA 3ANSA 5LUBA 3RVBA 2PUHA 2KWIA 1K06A 1I24A 4Z51A 4H0NA 4YRFA 5IZCA 1P3JA 1CUHA 1DXHA 4NTZA 2GWRA 1VJTA 3QNUA 1GCGA 1NXXA 1VE7A 2WRZA 3ABIA 4PSDA 3CIFA 4TXLA 5A0FA 621PA 4L4SA 2GBPA 1D7OA 2FWBA 3DYIA 3JZMA 4US1R 4ZQCB 4DSOA 1T5OA 4L3VA 4H4EA 4C87A 1DBSA 5GJBA 2C2GA 5JECA 3ZVNA 1ZRSA 2H51A 3ZGZA 3HP7A 4WZBA 4DLRA 1JHXA 4KGZA 5L9AA 1R0XA 3EPKA 3MK31 4UPEA 1XTUA 3EYWA 3DD5A 2R1TB 4YCAA 1CK4A 1T6YA 5ER6A 5I7EA 2O5VA 2ZBVA 4LPKA 4QFBA 1OT3A 3RTGA 5I48A 1A4XA 2EDAA 1SOAA 3QXGA 4TTSA 3SYMA 3CVUA 3HJTA 4J7UA 3U5ZB 3BULA 1ZN2A 3RIMA 4LYAA 1IFXA 4ZAGA 1FUEA 2X13A 3PQ2A 2GKSA 4PQRA 2O2ZA 1Q0ZA 2ROQA 5A9TA 2QUHA 5I9TA 2I9KA 1R6XA 1J7JA 1GAJA 4HSEA 2QV0A 4L5CA 4BRSA 4WNCA 1GPDG 3GUYA 3H5OA 4NBWA 3RK4A 3GAAA 1AMOA 3C3XA 3VDNB 1BXRB 2YXEA 3C97A 4JZKA 4NMMA 2VEDA 5HRAA 4E5MA 3UVEA 1Y9EA 3N3AC 3LU1A 3I52A 3V1YA 1ATIA 3MTIA 4GZMA 4DLVA 2HU5A 4I8XA 4OAPA 5KCMA 4URUR 5J2UB 5G4KB 4FWBA 4XOUA 2NUBA 2E85A 3QW4B 4FVTA 2FPMA 2ABWA 1Y5LA 4N7MA 3WISA 1NVUQ 4BNLA 1CVRA 1RDFA 2W5UA 3QPBA 3UGJA 4DHEA 4PCVA 4F3CA 4MS4A 5BR7A 1DRJA 1MF7A 1E6LA 2BGLA 3HUFA 4JQZA 1ZNZA 4L9AA 1A9YA 2A7QA 2O52A 3B9PA 4XE5A 4Z1MA 1G6KA 2F3UA 2WJAA 4H77A 1UC5B 2R5WA 5P21A 3LK7A 3NOVA 3U7EB 1D7AA 2AE1A 1MC1A 2JGJA 4MV3A 1M6EX 3UK6A 4S04A 4W6ZA 3LCMA 4NJEB 5HUQA 4ENWA 3I9NA 5BSTA 1Z35A 1DI0A 3AILA 4I2NA 1OFTA 3HDTA 3KEGA 2J3IA 3FR7A 3DBVO 4GXTA 4L2IB 3MUEA 4XYGA 4AKEA 1Y5IA 3A4YA 3H18A 3RUCA 3LUFA 3HGTA 3O7WA 3OECA 3R7WA 4EEZA 5CPBA 1WMEA 4I1PA 1ZONA 3NT4A 1UMDB 3RWMB 1UKVY 5JSYA 3I0NA 3L0ZA 3VSDA 2IBSA 3U31A 1GZHB 5CTJA 1GTJ1 2FPKA 4UEQA 2DP4E 1F51E 3DP9A 3NCTA 4PX2A 4RU1A 2CLFB 4AULA 4DCGA 1MGOA 3RIYA 1W93A 3VR6A 4CQLB 4OGLA 3ZY3A 1D4FA 4NONA 1I9GA 3I04A 3LHFA 4DNOA 4D44A 1RM5A 3N9IA 2QVXX 3QY9A 2K87A 1M7BA 4Q3EA 2YHIB 3STHA 4J43A 3RM3A 5GPBA 4X6UA 3IKTA 3EBPA 4Y6LA 4L74A 1JXMA 5G1PA 5LQMA 2A8YA 2BBWA 2O2JA 3DQZA 1LRLA 4NNPA 4LFCB 4OXQA 1ZCJA 4PR3A 5FTJA 4BLSA 1QDEA 3IOBA 3VAAA 4EGFA 2BKUA 2XWBF 2GF9A 4MNTA 4UM9D 1USUA 4RMNA 4CUKA 1NURA 1ZK4A 3D2BA 3D5TA 4MQ6A 4XUGB 4ZCQA 4G4GA 1ZA2A 4PYNA 3KL2A 2RGEA 3ZJ5A 2W6ZA 4WCFA 2O7RA 3GEDA 2JJYA 4G1CA 1O3YA 2Q4BA 4NCJA 2Z3VA 3MRVA 1FUUA 1PU2A 1Q92A 2ZULA 4U2EA 3ZG6A 1QIEA 2HH9A 2FGJA 4QM7A 4QU9A 1HWYA 1Z6XA 1G8JA 1CT9A 1M34A 5DPMA 3UK7A 4C9BA 3IPYA 2C5HA 5HGXA 5G4LA 5J4VA 3NAMA 3K9LA 3D6MA 4L8GA 2JFGA 5DLQC 1WF6A 4WERA 1K2WA 1OTYA 3IOEA 5C1IA 1UJBA 3BE5A 5JJIA 4KQWA 2RK6A 3GLQA 4JU8A 3UJPA 1PEYA 3IEUA 3PR2B 2PJRA 4GRIA 4NARA 3NHSA 3HB0A 1BW9A 3E9QA 1DAIA 1ZGJA 1EX9A 1HZJA 1KVQA 2EFGA 7AT1A 5BT9A 3KZOA 3R7FA 1KS9A 1SCUA 2ZYUX 3IRUA 3PF8A 4JBYA 4WVFA 1DL5A 1LU9A 1QYDA 3KJEA 5EMLA 5B7PA 1PEKE 1ITZA 2QRQA 5BN5A 2H16A 3Q1KA 4EI9A 1WPRA 2WWWA 1VPEA 5T41A 4EO7A 3SXUB 1J2YA 2NTEA 1GJRA 4I9GA 4IKEA 4R2JA 5DNEA 1R00A 3X1YA 1MRNA 1E9RA 1Q3TA 2I2AA 3M3DA 3CCFA 4J7AA 4BKPA 4C5BA 1B1CA 4DA0A 2WHPB 5DYGA 3GLHB 3R3WA 1RJFA 1AG9A 4H7IA 4X5OA 4RWEA 5EPEA 3HBFA 4QQKA 3ZWQA 1IN5A 3CVOA 3RC8A 2VOEA 1JS1X 1NA5A 1OGYA 3L82B 4MQ4A 5M2QA 1UMBA 2P40A 1CQWA 4GHWA 2SNIE 3OPMA