4Q18A

Human dck c4s-s74e mutant in complex with udp and the inhibitor 4 [1-[5-(4-{[(2,6-diaminopyrimidin-4-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]-2-methylpropan-2-ol]
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
230
Chain Sequence
b'IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
molecule keywords Deoxycytidine kinase
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 230
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q18A00
1W4CA 2ZITA 1HA3A 2ZI4A 2CNWD 3G82C 4IEEA 4TLDA 4B32A 3O8CA 1ODFA 1KJZA 2GJAA 4V0NA 2CJWB 1ZNYA 1QF9A 3GLFB 3KXIA 2J45A 1QG2A 3WRXC 1RYFA 3NH6A 4PHFA 4TTQA 1W0JD 3CB4A 4PO1A 5EZ5A 2ZE8A 1HTWA 4TN1A 4G01B 1XTJA 4IDHA 5FPYA 5KNDA 2WV9A 2G88A 3LXXA 4KJZA 3NDBB 1X1RA 5AJZA 2REOA 1BKDR 4CZ2A 1Z63A 2ONKA 4JYBA 3VR6A 5K8IA 1A7JA 3EC2A 4Q7KA 3SYLA 4JLNA 1E9EA 1XMIA 3PENA 3BB1A 1PLJA 4TTRA 2BOVA 3NWJA 3VFDA 4M9XA 2CNWA 1R0WA 3D31A 2NG1A 1LS1A 2YC4C 4M1MA 1V5WA 5DLQC 1HYQA 4LOAA 2GZAA 2IXFA 3E5HA 4CF7A 1P2SA 5AK0A 1G8GA 1KSJA 1W0JA 4WXPA 4EPWA 1Q22A 4TL7A 3HYTA 1HY3A 3K09A 2J41A 2FJUA 3TAUA 2CE2X 1JR3E 2RMKA 2I4IA 2GK7A 3QKRA 5H68A 3ICQB 3P27A 2O8CA 1T5LA 1LTQA 3UMFA 4DT1B 4EQ6A 3A4LA 1U81A 2O5VA 5DHFA 3UK6A 5JEDA 3K0SA 3UWKA 2X8AA 4KITB 4B74A 1M8PA 3IIMA 2UZ3A 4EPVA 3CPHA 5HZHA 5EE9A 2ZREA 3RS3A 1SQ5A 3P1JA 1Q44A 3PCRB 2R2AA 1ZM2A 3AVPA 1OSNA 1S2MA 2QROA 2O52A 2WM9B 3QOFA 4MKFA 4ZDWA 3ZZUA 5EP4A 1C1YA 4QBIA 2CXXA 5AUQA 1PLLA 1W4RA 1YHNA 2C99A 3MWKA 3THOA 2RGCA 4ZIRA 1GILA 3X1ZA 5JI3E 3SQXA 3QPVA 5BXQC 2V54A 4I1OA 2A3RA 5JSZA 2ZRHA 3R7WB 4MYHA 4XVRA 4ZDJA 1XEXA 1II8B 2ZJYA 3BB4A 3SJCA 5JWRA 1NSFA 2Z83A 2ZSEA 1Y3AA 2ZJ5A 3PG5A 3BK7A 1ZM4A 4Z8XA 5KDDA 2IYLD 1GUAA 5EXSA 1NVVR 3SJBA 4DVGA 4I81A 3IQXA 1Z2CA 5JEEA 4I1SA 1NRJB 3WBKA 4XWOA 5FPHA 4RJLA 3VMFA 1E99A 4OJKA 2PLRA 1GITA 1G3RA 1QHHB 2X2EA 4D26A 4B34A 1DE0A 1F60A 5DE3A 5E7IA 4I99A 4AYWA 1N5LA 3JZMA 2Q9AA 5FUWA 2VP0A 2VQSA 2GEVA 4QFMA 2VHCA 1GNPA 4TWZA 3IKJA 3PUZA 3THWB 3PITA 2J87A 3B85A 2PCLA 1AZSC 1D6JA 4DEYA 1BS1A 2QG6A 2RH5A 2VP5A 4LYFA 4UXJA 1SXJC 3SJZA 2F3RA 5KNBA 2QM7A 2YVUA 2FSHA 2AWNA 3LY5A 1E2DA 4LJ9A 3KUCA 1D9XA 4Q4HB 1M74A 5KSOA 1RJ9B 2JJ2A 1IY1A 1XMVA 2QSYA 3CIOA 3EAQA 2OCPA 2IWHA 4BE7B 3EPLA 1J8MF 2J9RA 1L2TA 2G1JA 1OH8A 4R98A 3RRMA 2Q3HA 3AF3A 421PA 1SZPA 3MCAA 1BYIA 1YU9A 5SZHB 2OXRA 4CRWB 1X1SA 2GAAA 1TU3A 2ZUCA 3SC3A 4LHXA 1P7CA 1UEJA 4Q00A 4Z1MD 4R71A 4BQSA 3VR4A 3WP1B 1CRQA 2QMOA 2QMEA 3B78A 4G5SA 2LKDA 1E0JA 1EFCA 1MO5A 1LB1B 1Z0IA 3EARA 1K8RA 4LYHA 5CLQA 2XTNA 1M7BA 2ZR0A 2AK2A 4DSOA 4HATA 4XVUA 3C7KA 1UJ2A 3BS4A 2CCGA 2O8BB 2EYUA 1JAHA 1E9BA 2IYRA 1KSFX 2RB4A 4TLAA 4EPRA 1ETUA 4ZI3A 1P9RA 5EE5B 2EWVA 2P6RA 1DTSA 2HCJB 1AKYA 4Q4AB 1IAQA 4C0QC 1JAIA 5LPNA 2QM8A 1YZQA 4OHWA 5DIFA 4GSYA 2IYYA 1E1QD 1FX0B 1HH4A 1L7VC 4Y0AA 2OT3B 4Z1MA 4DLZA 4FCTA 3GJ5A 2AX4A 4TTPA 4RD3A 2G77B 1ZU5A 4RZXA 5F3WB 1G7RA 3M1IA 2JLSA 3A37A 3B1ZA 1N5KA 4LSGA 2QY9A 4K81B 2C96A 3EWAA 4POAA 3BH7A 4Q02A 3SBDA 2EVWX 1S1MA 4IOJA 2A30A 5TDHA 3SYNA 3T61A 4A36A 4TQ9A 4JKYA 1FMJA 4KU4A 2HYIC 1OFIA 1NJFA 5CB6A 4JLKA 5AJVB 4Q4JA 1KO7A 4ITRC 2YKGA 1CULC 3W5IA 2VF7A 1XX6A 5FFMA 3BH0A 2ODNA 4TL6A 1JALA 3QXJA 3QSYA 2YWEA 3PEVA 3QBVA 4XSHA 5J47A 2O8EA 4PPNA 4CT5A 4UNQA 1G16A 3PV0A 1E2QA 2BMFA 1S9DA 2OEPA 3ZD6A 2JIZD 5KDLA 1KO4A 4JLJA 3CNNA 4DLYA 5JS7A 4ASUD 3U6BA 4BFXA 4GL2A 2V1XA 5K8TA 2JLWA 3DPUA 1P2TA 3QUSA 2P6UA 2MSCB 3CRQA 1QHIA 2REXB 3A4NA 3QKRB 2PCJA 4LZZA 1AQYA 1XCGB 1D5CA 2GESA 1D2MA 2OFWA 2ZI3A 3T5GA 4EQ6B 5A4JA 5KPDA 1T9HA 4PQYA 4LHWA 2X2FA 2AXNA 4BLOA 2MMCA 4Y0VA 3KZ1E 3HPQA 4Q01A 1ZD1A 2CLSA 3A1UA 3VQTA 2OM2A 1IN4A 1G64A 1JPJA 4I1UA 1HURA 4MKGA 3KKOA 1YR6A 3ZIAD 4K8OA 2JIZA 4Q9LA 1KNXA 1DS6A 4BFTA 3EZ9A 4DCVA 3R9IA 5SZIA 4D4KA 5JBQA 4C3ZA 4ZIRB 4LJYA 2KBEA 5JHHB 2HT1A 2ZUDA 2D62A 5JSZB 4OHZA 2G3YA 2F7SA 1AGPA 3RVBA 1IXSB 1XEXB 1R0YA 1U8AA 2WPDD 4A2QA 4LV8B 1RE0A 221PA 4HLDA 4P31A 5IHPA 4FD2A 2CL0X 1F48A 4JJKA 1JB1A 2EQBA 1W5TA 2GJSA 3C5HA 5CDFE 3TQCA 3ASZA 4AKGA 4B3DA 3S1AA 4JLVA 3GLFE 1R6BX 1SVKA 2D3WA 1C9KA 1ZIOA 4US2R 3AH8A 5P21A 1AK2A 1E96A 2CHGA 2CVFA 4XTRA 4D0LB 5GVRA 2DPXA 2ODWA 1OXSC 5L3VA 2OO7A 2IYZA 2ZTSA 4HDOB 2G9NA 2ZI6A 2WWGA 2CHQA 2DYKA 3VHXA 1CKEA 1NJGA 1E1RD 5TXGA 2IW3A 4F93B 5FBRB 4PFSA 4AG6A 3LX8A 4C4PA 2WPDA 3SFZA 2F1IA 4C0LA 1WXQA 5FBWB 4FWIB 2FA9A 1GKUB 1P9NA 4RD0A 4RCZA 4LBZA 2IS2A 2RGAA 2KE5A 1G8FA 4WOPA 2OCBA 4B76A 1ZUNB 1OT3A 1Z5ZA 3IIKA 3LBIA 4LHYA 1RC8A 4TMWA 1U2RA 4WZ6A 4JL6A 1UKEA 4M2LA 4NU0A 4A0FA 1Z8FA 3BH6A 4E09A 1GVNB 2QN6A 2WOJA 4X8OA 4DB4A 2A2ZA 1TPZA 2DR3A 2OSBA 2BMJA 2ZRLA 1S1CA 4GZMA 2YINC 3MD0A 4LV6A 3I1FA 1RRCA 1W36C 1LF0A 3M4YA 1AQUA 4MRNA 4W5HA 1E1RA 3ZVMA 4IDOA 1NBME 4LPSA 1GRQA 4GOXA 1NF3A 4NH0A 4C0AC 2DHRA 3IQWA 1G3MA 4NZYA 2OCAA 1Z6GA 1DG1G 1Q20A 1ANKA 4HUQA 3CZQA 2ZE6A 1DAIA 1KOFA 4MRRA 4A8JC 2D2EA 2O8FA 1RFLA 4GNKA 2ORIA 3H1TA 4KXFB 4F38A 1Q1EA 2RGGA 1YZLA 5E95A 1T4GA 2KI5A 1VPLA 3A1VA 4G5QA 2ZRDA 1ZC3A 4KSBA 1NVXQ 5CB8A 4BECA 5GJWC 1NMXA 4KVAA 1U94A 2Y8EA 3R8FA 2NTYC 1ZP6A 1MABA 1RW4A 3OESA 3B9PA 2XJ9A 2ZSFA 2BMEA 4JMPA 5EXXA 1XFAA 3GJ6A 2IYQA 4ACBA 3AV0B 1OLOA 5E4FA 2H57A 1VCMA 4A0RA 2IT1A 5DSZA 1OB5A 5JWHA 3W8RA 3K1JA 5E7JA 4OQMA 1FQKA 1YKSA 4V03A 4WAUA 3CF0A 3GLIA 5EE0A 4ZDKA 4BRUA 1RPZA 5EUQB 1PUJA 2ZS7A 3AB3A 4Q4JB 1BYUA 3UG7A 1KY3A 2QP9X 4M9QA 3C4JA 4IFBA 3NBFA 1O87A 3IPYA 5KU1A 1XPUA 2VP2A 3T12A 3EZ6A 4YLGA 4LY6A 3LA6A 3MGCA 3H84A 2LCFA 1KDTA 3FKSD 2F3TA 4US0R 3GQBA 2O8EB 2GBLC 4LJ6A 1KY2A 1S0UA 2IXGA 5FI1B 2CCJA 1E4VA 3TLXA 3PXGA 1KI7A 4N3NA 3SJAA 2WWXA 3CONA 2IF0A 3O8BA 3OZXA 4ZV4A 5BN5A 2QTVB 3AGPA 1NBMD 3IEUA 4BLSA 4ACAA 2WAXA 2WWIA 2NO6A 1MOZA 2GTPA 4TYPA 4I4LA 1G5TA 3C15C 2ZI9A 4LV5B 3M0EA 4PSKA 3GJ7A 1E6CA 4FMBB 2GF0A 1JBKA 1S3GA 2JLYA 1L4UA 1P3JA 1QHYA 1NLYA 3RS2A 5EE1A 3F3YA 2XTZA 5FI0B 5GVSA 4PAQA 5F9HA 3FDIA 3DL0A 3TKLA 3FKSA 2IK8A 4KO8A 2J7KA 5DNYB 4JVNA 2WSSD 1FZQA 1Q57A 4YXWD 2I3BA 4CW7A 1ESNA 3KX2A 4NBSA 3RAPR 2C8VA 2PEZA 3W90A 4BLTA 4DT1A 2Q9BA 2OBMA 3P4YA 4BZPA 1ZNZA 4ESVA 5EUMA 1I4DD 4M1WA 4TZ6A 3TSWA 4PC2A 1NBMA 4HLCA 5L3RA 3AVTA 1YZNA 2ODBA 1KI8A 4AIIA 2QAGC 1NNEA 4RD2A 2BHRA 3B1YA 1XXHA 2XZPA 3RC3A 1VG1A 4URYR 1HUQA 2J5XA 4CEJA 1TL7C 2ZJOA 3QENA 2HXYA 1G20E 4QNRA 4DLVA 2PH1A 4G0NA 1R0ZA 3S1AB 1K6MA 1VMAA 2B21A 2HLDD 2QQ0A 3GJ0A 3WRYC 1CJKC 2ZRJA 1KJYA 3FMFA 4QBHA 4LGMA 4FMCF 2C04A 4AYXA 3R7WA 1M2OB 2WSSA 4PSAA 1IN7A 4YXWA 3L0SA 5IK2A 2DWOA 2VHTA 3FFAA 4PQRA 2PT7A 2YOGA 4DIEA 1P72A 4NCIA 1CTQA 1SVMA 3ADKA 3CR7A 3HPRA 5J40A 1Z6XA 1QVRA 2FSIA 2RGEA 1N5JA 4Z8YA 4R2IA 4QM6A 1E0KA 5GJVC 4FMDF 1T3LA 2B7CA 3ZZ0A 4GP7A 2EFDB 5EE3A 4TMXA 1JXMA 3ZQ6A 1CR4A 2VH5R 2H8KA 3PEYA 1UDXA 3WY9A 1E94E 4M1KA 1BO6A 1T6NA 2WTUA 2NO9A 3K70D 2HLDA 5BN3A 5LBIA 2Z4RA 1N6NA 1ZIPA 3BWDD 4OHVA 2ZSBA 2UKDA 3SBEA 4KODA 1II0A 1TF7A 3LBNA 4HI0E 2KWIA 4F91B 1IQPA 1NN1A 3TSOA 2AHOA 1GKIA 1W46A 1KDPA 2A5YB 2OUKA 2YWGA 3WMFA 4DWJA 4Q7LA 3C14C 3DMNA 4DRZA 3NEYA 2K5UA 1X6VA 2BMDA 5TY0A 1G6OA 4Q1EA 1HT2E 3LH5A 2IHYA 2ZRPA 5C2JB 2PBRA 4K46A 4NPHA 4B2LA 2CL7X 4OK5A 3KJIA 1I4LD 4HUQB 3QNUA 4B2IA 2DCUA 2O8FB 3CWZA 5HE8A 1XCMA 1BH2A 1DAGA 1E9FA 2C95A 3AP3A 2P5SA 3CLVA 2VL7A 3U7FB 3AKCA 2QU8A 2ORVA 2AKAB 2R6DA 3NC0C 3Q72A 3GJ3A 4MYTA 2F43A 1G9XA 2C5LA 1VHLA 5FTMA 3EPJA 2NZJA 3RS0A 1E9RA 3ZYCA 1MABB 1UFQA 2J0VA 2QNRA 1FOEB 1JEDA 1N5IA 3Q8XB 1ZC4A 3WBJA 3KQUA 4LBVA 4UNPA 2XB2A 1S3SA 4LX0A 4XWAA 4C30A 3K0EA 5FH9A 2IYXA 3E2IA 2A5FA 3QPWA 1X86B 1YE8A 2Z5FA 1MO6A 4UKDA 1OKKD 2YWFA 1V43A 4N0DA 3TE6A 1Z3IX 1P60A 1L8QA 2QA5A 3MUFA 2Z43A 1M34E 1JECA 3QJYA 4PR0A 4Q9JA 5EP1A 3V9PA 4LPKA 2WJJA 4ZKDA 1VCNA 5L8VA 2ZRCA 3GLIB 1QBKC 1DO2A 4HB0A 1OH6A 1KYIA 4WW0A 2IX3A 1P6XA 3CF6R 1T5IA 1UKVY 4BFYA 1G5PA 3IO5A 5BYKA 2AKYA 1ZNWA 1DBSA 1RRPA 1XD9A 4NMMA 1SHKA 3LBHA 3L43A 4X8LA 3SDZA 1YVDA 3VKWA 4ZI2A 3HP1A 1GKYA 3U7EB 3KXLA 3MFYA 2KB0A 4A9AA 4UNNA 5G53C 4EPXA 1ZMXA 1GFIA 3U3MA 4MDFA 4LC1A 3O47A 1D2EA 3THYA 2ZJ8A 3HR8A 2FFHA 4QJ3A 4WZBE 3KQLA 1N6RA 4OJQA 4HZIA 1QHXA 4M1OA 1OKKA 2ZYUX 4ZCMA 2IS1A 1RYHA 4M4SA 2IF2A 4HUTA 3U5ZB 1R2QA 4HSEA 4FCVA 4JVLA 3ADDA 4EUNA 5AJYA 4DB2A 2BEJA 4U5XA 4NCKA 4LYAA 3OIYA 2VPPA 2W2XA 1W2HA 2W2TA 4OK3A 4RFVA 2YYZA 1II9A 1YRBA 3CM0A 4OI2A 4II7A 2OBNA 2XZLA 5GJCA 4IOKA 2V3CC 1W2GA 4B3XA 2ASEA 2V55B 1Z0AA 2HDNB 4CEIA 2V9PA 3ZZTA 1GL9B 2QL6A 1XZPA 4PQFA 2OAQ1 2IUUA 4NYJR 3ZH9B 3EC1A 1U9IC 4JBWA 1Z06A 2ZEJA 121PA 4LHVA 2RKOA 4PO9A 2NO7A 1HQCA 3W6NA 3W6PA 4JT4A 3AVWA 1PVOA 4DLWA 3BC1A 5EQTA 4TL9A 4G3XA 3FKQA 1YZTA 4ILEA 2OFOA 1HT1E 2HJGA 3CR8A 1CXZA 1XXHB 2IYTA 3WYFA 1DG3A 3RWMB 3GJ4A 2JATA 2F9LA 4JLDA 4TYYA 4IOLA 4CEJB 4TYWA 2NZ8A 2ZROA 4GFDA 4HLQB 4FCWA 4KYUA 4TQUS 5FOVA 3ICEA 5FPSA 5SZKB 4KLZA 2VSFA 3GMTA 2WWFA 2QAJA 2OBLA 1KDRA 3NBZC 4TLEA 5DISB 1E69A 1Z6AA 4F92B 1J2JA 2QI9C 2DBYA 4BGDA 3AVUA 3K9GA 1NY6A 4MDEA 2ZYTX 1R4AA 2FZ4A 2RGDA 1JEEA 2FZLA 4YMVA 1VG9B 2QBYA 3OIWA 1IN8A 1J7KA 4QJ4A 2WZQA 1WRBA 1E79D 2YV5A 4YQFA 4NHOA 4MKIA 2VP6A 5DHAA 3EIQA 2JJ2D 1FMLA 2QPTA 2IYWA 5B57C 4MQBA 2O0KA 3PUVA 1KK3A 1Q1QA 3BD9A 4FN5A 1IN5A 4QNMA 1TF5A 1AGRA 4W7SA 5KNCA 3T1VA 2Z6VA 4HLUA 4QBFA 4B44A 1O3YA 3GEEA 1Z0JA 3IUYA 1G291 2JA1A 4AG5A 3BOSA 3L0OA 3CZPA 5DI9A 3TJZA 4XTCS 3HU1A 2E1RA 2XNSA 3I3SR 1IJEA 1I2MA 3OF5A 1E79A 1PV4A 4PPQA 3B2EA 3EZ2A 3KQNA 1YZUA 4EFNA 1E9AA 3NBXX 4GMDA 4OI4A 2BM1A 3I61A 3R20A 4G5OA 1UBGA 4EJSA 2V1UA 4C2UA 1NL3A 4YMSA 5LDDC 4JT2A 3E70C 3PVSA 3PJRA 1Z07A 4DSTA 2OFXA 3FVQA 3QBTA 4CYMA 3T1TA 2D2FA 2VSXA 1OPXA 3PUXA 4G5RA 1OFTA 1Q0UA 4HAVA 5AJWA 3U61B 3K70B 1IM2A 4UXIA 4IEIA 3IGFA 2GCPA 4B2PA 3Q7QA 4ZCLA 1G8YA 2CVHA 1E9DA 4Q1BA 2XEXA 4DSUA 4IJMA 2FPKA 1HEIA 2F43B 4LBYA 4UNRA 3MJHA 5A5GA 4O2LA 5H1YA 5KPJA 4NDZA 3FYHA 3TUJC 2UVQA 4XSGA 1CBUA 4DBLC 2GWHA 1T0HB 3MG9A 1Q21A 3NEJA 3K9LA 1DEKA 3TR0A 1W7AA 1ZM9A 4IDQA 4MRPA 4P3YA 5CK5A 5KDOA 4FXPA 2WWWA 4OI1A 4FIDA 2GZHA 1ZAKA 1F5NA 3FFBA 4TT3D 3IBYA 1KI2A 3SE0A 3PQCA 4TYQA 4UNSA 2ZRFA 3VKGA 3I32A 3L0IB 1W4BA 3ETLA 4IFEA 4US1R 3ZJYA 2GAOA 3UPUA 4DEXA 2X1VA 4HAYA 1FUKA 2FH5B 2A5DA 2ZRBA 2QAGA 2QZ4A 3CRMA 3VNUA 2PZFA 3QKTA 1ELOA 2BKEA 3K0CC 4PC1A 5AUNB 2QRZA 1H65A 3PR1A 1B23P 1W4AA 2GKSA 2QPAA 1PLKA 1QHSA 2QP4A 1CLUA 4DUGA 3AVQA 2REBA 5KOYA 3EZFA 2VEDA 1UAAA 4A0GA 4JJZA 1FQJA 1KSHA 1N6PA 2GNOA 3K53A 3OIUA 1CRPA 4V0ME 4C0KA 1E2EA 1WBDA 4JS0A 3UKDA 4KI0A 4TQAA 3THYB 2YHSA 4TT3A 2OE2A 4R7ZA 4KAXA 2H1LA 3BFKA 1DPFA 3WMGA 1WF3A 3LQRA 4HEJA 2NGRA 5M04A 1AS3A 4IXMA 2XSZD 2RGNA 2WVJA 3C16C 4C2TA 2NPIA 3M6AA 3U2QA 3QF7A 1A82A 1KK2A 4GBMA 1EESA 2FMXA 1XEWY 1YR7A 5FPKA 5FPTA 1KMQA 3OE7D 4QKQA 5JJKA 5FBLB 1KMHB 4JSYA 3MMPA 3X2SA 3SZRA 2W6JD 4NONA 5J4HA 1KO1A 5HCNA 4ABYA 2Q3FA 4BUJA 4PHGA 4CT4B 4BFSA 2AR7A 3EG5A 3KQHA 4CEIB 4JL8A 5JZVA 1KI4A 1OXXK 2PX3A 4F4JA 2O8DA 1S9HA 1CEEA 1TTTA 3QXCA 3EA0A 1E2MA 4GRAA 1LFDB 2R6AA 3WXMA 1TQDA 3OHMA 4B3CA 5TB5A 2ERXA 1W36B 1TEXA 1W48A 5H8WA 4DDTA 2Q3MA 1VDZA 2W58A 2JGNA 5BQ5A 2XSZA 1J90A 2JLXA 3UMRA 2WOOA 3AF1A 2V8OA 3QVVA 1RRGA 2ZJ2A 3AKEA 2XITA 4Q19A 4PAMA 2X77A 5LD2C 2AD1A 4G1UC 3LRPA 5B30A 2BBWA 2E9SA 3OE7A 4DDVA 1SKQA 2W6JA 2FFAA 5G3ZA 2HCBA 3QIAA 4ZCIA 4XH9B 3AVYA 1QHNA 4U00A 2BWJA 2GRJA 1IY0A 5EXPA 3NTUA 1QDEA 4C7OA 2WKRA 5BN4A 1OHHD 3TGPA 4YMWA 3GLIE 1ZBDA 3KDSE 2QBYB 1U90A 3PUWA 3CF2A 4GI7A 3NG1A 2OLKA 3LAWA 5ANRB 1N25A 2JCSA 4YONB 4GZLA 5K8UA 5DH9A 1N6LA 1OFUX 1N6OA 3DMDA 2GVZC 2VA8A 5G40A 3A1WA 5GADl 1G3IA 1UDWA 4URUR 4V0KA 3ZGXA 4RFSA 1P4SA 3I72A 4LC0A 2DY1A 1RRFA 1GTVA 4PZLA 3FMPB 3VHLB 3CPEA 2VHUA 4A0HA 1FPMA 2P5TB 3GCGA 1EK0A 1IXRC 4OHYA 3F8TA 4KYIB 4A4DA 4DCSA 1P2UA 3KUDA 3ZD7A 3LVQE 3ZLJA 3FGNA 3RDPA 1OHHA 3QXHA 3QQ5A 1DELA 4GP6A 1DAKA 1ZJ6A 2D7DA 3EZ7A 1FNMA 1E2NA 2ORWA 4V0MA 2GXAA 4M8NE 4B3BA 4IKEA 1I4TD 3U6KA 4DC9A 5AUPB 2ATVA 4PZYA 1SVIA 2C98A 1ZNXA 2FPMA 3CNOA 4IVQA 4QGGA 1TQ2A 4C9BA 4EJSB 1COWD 4PC7A 4PX9A 4U7DA 2FDCA 2EW1A 3QF4A 5FL7D 3IIJA 2CL6X 2Z4SA 1FTSA 1H8ED 4RY2A 4D4LA 2XXAA 2HUPA 3BXZA 4LCBA 1N6HA 1TUIA 4O0MA 3B1WA 5DYIA 1IN6A 2P67A 4B47A 1A5TA 5TARA 1VTKA 4KBFA 4J0QA 2OAP1 2O0HA 1Z6YA 3BGWA 1ZUIA 3K09C 3KKQA 4IOMA 2DFKB 1XXHE 1HQYE 2Q0HA 6Q21A 3U60B 1U98A 3FTQA 1W5SA 4E22A 3P26A 4M53A 5KTYA 2KSQA 4JZKA 2VHJA 821PA 2BM0A 2XZOA 3CH5A 5JI2E 1TAGA 2Z0MA 3THXA 4X8MA 1COWA 1E2HA 3WHLA 2NMVA 1D2NA 1XRJA 2A7QA 2RGBA 1KHTA 2IHBA 3B1XA 1VKJA 4MGKR 4Q1DA 1XTKA 2C9OA 3QVUA 5FL7A 1YRAA 4MUBA 3W3ZB 3ZVNA 1H8EA 4HB3A 3RNLA 3H4MA 2F55A 2QAGB 2R44A 1X8LA 1Z6TA 2ANCA 2W0MA 1FP6A 2MSEB 4RZ3A 1MV5A 2G1KA 2ZRNA 2NO1A 1S96A 1B0UA 1TNDA 4CVNA 2QRNA 3QKUA 1MO4A 4MUAA 3KKPA 2IXEA 2PMDA 3A36A 5KO2A 4NCHA 3RRNA 4Q9IA 1Z28A 2HYDA 3FPAA 4A82A 4CEHA 3CBQA 2IUSA 5F9FA 1IONA 3D8BA 4QOSA 2BCGY 4PHHA 4RZ2A 3RHFA 1SXJD 5LB4A 4A2WA 4Q9HA 5G41A 2PL3A 3W8NA 3RS5A 3P32A 2PEYA 2BJWA 1G41A 1US8A 1G21E 3CRVA 5HTKA 1LW7A 1Z0KA 2VSOA 4MYCA 3L0PA 3VR5A 3D7MA 4AD8A 1U99A 4LYJA 4DCUA 3B5JA 3H86A 3OAAD 1XB2A 3KJHA 4D0GA 5K8LA 4P4TA 5TV2A 3EWSA 4R9UC 2QORA 3BORA 4GMXA 1X8KA 4P32A 4CIDA 2CEAA 4DKXA 3UMSA 3TK1A 3AVOA 5KSZA 1PZNA 2JAQA 1R7RA 5BYJA 2B6HA 1L4YA 1MT0A 1GAJA 3T34A 5TMPA 1VIYA 4OYHA 4Q9KA 4PC3A 4YMTA 1GM5A 2AFIE 5CITA 3QI2A 4NYJQ 2GXSA 1ONBA 2O8DB 1KI9A 1KKLA 1KAGA 1I2DA 2GF9A 4ZDIA 2BC9A 2NO0A 1JPNA 1SXJA 5BW8A 1Z0DA 2YOHA 2ZI7A 1JJVA 1JQJC 3PEUA 2OILA 1DAEA 521PA 3FMIA 5FOWA 5B58C 1W47A 2FGKA 3NDPA 3RWOA 4KFSA 3U7HB 3OAAA 4Z54A 3TUZC 2YOFA 2AL7A 3O8RA 1A2KC 2WJVA 1G7TA 1Q1ZA 3TQFA 3IEVA 5EP2A 5IK2D 5JLJA 2JDID 1T0JB 3U3JA 4KFTA 2QPOA 1KGDA 2ZIAA 1E2KA 1LS6A 2J0SA 2EFGA 3N5CA 4JLMA 5CK4A 1KO8A 4OHXA 4MGIR 4TLBA 4Q66C 4C7OB 3K0FA 4PAOA 4DLXA 2EFCB 3ASYA 3EPHA 1G7SA 5DN6D 1M7HA 5JS8A 4BPBA 2XGJA 4P4SA 3U7GA 4LRWA 3SNHA 3QG1A 1G1MA 1KJWA 4HAXA 2V6IA 3V00A 3LD9A 1ZRHA 2CCKA 2F6RA 3GP8A 5KUTA 2V6JA 2Q9CA 4HAWA 2ERYA 2QMUA 3Q5DA 4KFRA 1CR0A 2AXPA 4HZUA 1ZCAA 1XD2A 4E5UA 1KI3A 4RFSB 4XVQA 2DWQA 3FHCB 2DFNA 3NBYC 2RGXA 2BKUA 2W6ID 3QE0A 1YZKA 2JDIA 1W44A 1Q3HA 3DVLA 4TL8A 1T8TA 3CW2A 4LWZA 4QC2A 1XCPA 4D4JA 4KFUA 5CIWA 1XPRA 5JWOA 5FTJA 3TAHA 3F5FA 3NC1C 1P61B 4W5WA 4NCNA 4TMVA 3AVXA 1PJRA 2RAPA 4KBGA 3TMKA 4NE2A 3TW4A 1EGAA 3ADCA 2FX3A 3B1VA 3CH4B 2CK3D 4MA4A 4WVFA 5DN6A 4BEJA 2IUTA 4JVSB 4UQOA 2D7CA 4UXHA 1KK0A 1CJTC 2HXSA 4GOKA 4DCTA 1ESMA 2ZYWX 4LI0A 1TF2A 5J4LA 2GXUA 1E9SA 1EX7A 1P5ZB 3VR3A 2WMOB 3KTAA 5EZ6B 2GVDC 2N46A 4QGAA 1G6HA 4C0HA 4XJXA 4L5BA 3IHLA 1XTSA 4RD4A 1TX4B 4ON9A 5EP3A 2W6IA 2ZS9A 3QF4B 5HKKD 4AKEA 1BOFA 4QGFA 4NYMQ 4B43A 1G4UR 1YR8A 2XXAB 5C46F 4GPTA 1XMJA 5FBVB 3SQWA 2GK6A 2QENA 4Q21A 3PIRA 2KJQA 2ZRGA 2D74A 4RVCA 2HEIA 4Q5IA 1N6IA 4B48A 1Z83A 1ZCBA 2RHMA 2CK3A 3AEZA 5F2EA 5FTNA 4HAZA 1VG8A 4PHTA 5B2ZA 2FNAA 2J3EA 2J59A 3A58B 5FOTA 5AWFC 2QSZA 3K0AA 1IXZA 2P65A 4URWR 1CU1A 5G3YA 4EKDA 1N0UA 3THXB 4AKHA 3TNFA 3AKYA 1XTRA 4MKHA 2FF7A 3KJGA 4S35A 1KIMA 5HKKA 2QQEA 1OXUA 3WNDA 2MMGA 4Q1FA 3VX3A 2QT1A 2W2VA 4OQFA 2ZRIA 1GOTA 3F0TA 3T15A 4EFLA 3U4QA 1OXTA 3K9NA 1DOAA 2IYUA 3NH9A 4D82A 4CDGA 4JSTA 4C0SA 4NYIR 4RSGA 1R8QA 1E2GA 5KSPA 1X3SA 4DJTA 3X1DA 4CEHB 4AI6A 3KXKA 1R10A 1GZSA 2GCNA 3WNCA 3RRYA 4OQNA 2GETA 5E3HA 3ECCA 2IYVA 3CX8A 1A1VA 3VR2A 4QL3A 3N2EA 4A6PA 3JZAA 2P3SA 3C8UA 4AWXA 1J99A 1US8B 4L15A 2V4ZA 4R2HA 4RZUA 4M9SA 1NSTA 4UJ5A 2A5GA 2NOAA 1G19A 3UXMA 3AKDA 5IT5A 1F3OA 4LJAA 4D25A 4RKEA 3A1TA 4BLQA 3R9XA 1SVWA 1T8UA 3ZQJA 5KHOC 2WHXA 4S2EA 2ODEA 1CP2A 2FOLA 3KB1A 1ZD9A 3MSXA 1SHZA 1YQTA 3EIHA 1W36D 3G5UA 1GL6A 2OV2A 5ELXA 3N2IA 3DEFA 1CR2A 3ZDQA 4OI0A 1G4AE 1K5GA 1OV4A 3AP1A 1SXJB 3DZDA 2ZSDA 3B9QA 3GLHB 2EU8A 4N1AA 1X8JA 2J46A 3DHWC 3K8YA 2BBTA 3B82A 4D4MA 4D80A 1KMHA 1E2LA 4M22A 5JRZA 2G0NA 2WBLC 1U0LA 4L9SA 4L8GA 3HYRA 2IL1A 1J8YF 3X1XA 3TSZA 1G17A 3T5DA 3UWOA 5JHGB 4A6XA 1E3MA 2ZJBA 5C1BA 1ZU4A 5L3QA 1XEWX 1ZM3A 1XP8A 3MJRA 3BBPA 2RHDA 2FFBA 1E0AA 3CUEF 2NPFA 3ZS9A 2ZM5A 5J5CA 1OB2A 1VYTA 3HJNA 5IDVA 1KZ7B 1RVDA 2AK3A 4Q1AA 5HR5A 1GNQA 4X8HA 1Z47A 1U8ZA 1NG1A 1EFRD 1HV8A 2PZEA 4XWKA 5D3MA 3K0FB 2VP9A 2XOKD 2IS6A 3FOZA 5C4MA 3E1SA 4DLSA 3IILA 2ZETA 2ZVQX 2ZJAA 3TVDA 3W3AA 4P4SB 2FV8A 4QM7A 1FFHA 4CGZA 3BFVA 3GLGA 1NMYA 3QG5A 3KFXA 4TLCA 5CM9C 4A8JA 4F4CA 2BVNA 3LQQA 3WYGA 1CS4C 5CJ2A 4HZUB 1IBRA 3H0KA 1XD2B 1SVLA 1SGWA 4PANA 5EXTA 1FL9A 5HE9A 4MRVA 1GRNA 1AS2A 1S8FA 2QP3A 3HU3A 4A15A 2A5JA 4MGZR 1E2JA 2L0XA 3IBGA 5FUYA 3HWSA 3N70A 1JI0A 2LKCA 4DXAA 4AC9A 2FGJA 2QE7D 4B71A 4DCNA 1EFRA 2AN9A 3EA5A 1NN3A 2J1LA 2ZR7A 2F9MA 2XOKA 4B35A 5IF9A 5JCZA 5JMTA 1JR6A 3SFVA 2Q6TA 2H16A 1HE8B 3QEOA 1SKYE 3CRW1 721PA 1XEFA 1KZGB 4Q7MB 4BFUA 1FW6A 2F1JA 1IOZA 4IDNA 2QUZA 3L82B 1NY5A 3KTAB 3QKSA 5FL3A 4DDWA 2EYQA 3L2OB 5D3QA 3MLEA 4BFWA 2N1BA 3D3QA 1KKMA 1RKBA 4LJ4A 4IW3B 2ATXA 2FG5A 3GPLA 1E2FA 2B92A 4FINA 1P9WA 3B60A 1CJMA 3BE4A 3L8ZA 4Q47A 5JCPA 4HYYA 1QG4A 2JJ8A 1UPTA 1Z0FA 3AVVA 1JQLB 4WIAA 1N2CE 2GJ8A 2EWWA 2QE7A 1LVGA 4Q4LA 5FTLA 2GBLA 1EX6A 3G0HA 3TVTA 2DFTA 4I1VA 3I73A 3CWQA 2J0QA 5FOXA 1M6NA 4XD7D 1GNRA 2JLUA 3K9HA 3LV8A 1NLFA 4MYUA 3I8SA 1KSGA 2G83A 1G8PA 1W1WA 3AF2A 5CM8B 4O3MA 4NYMR 3FB4A 5CLLA 2O0JA 5CYPA 4IDPA 1EFTA 1XJQA 1EWRA 3D6TB 3K0AB 2WJGA 4PPGA 1UEIA 1KI6A 1GP2A 1TADA 1JR3D 3I5YA 2BDTA 4OQLA 4ZO4A 1SULA 1XBTA 3BFXA 4QG7A 3H2YA 3A6PC 1LF5A 1N0VC 2V7QD 3FHOA 4DUGD 4E07A 1XPOA 3IHWA 3BAFA 1EXMA 1A2BA 1FNNA 1CF4A 5DI3A 2OESA 2GCOA 1VECA 1XU4A 3HDTA 1E32A 2PZGA 2FN4A 3U4QB 3RSLA 3TR5A 1DARA 2FPLA 4LDJA 5SZJA 4XD7A 2AD5A 2ZPTX 2OXCA 1E4YA 1LY1A 2GJKA 4LJ8A 5LD2B 2BJVA 1G3QA 3NKVA 4EFMA 1KAOA 4YC7A 2B8WA 4HAUA 3KL4A 3B7GA 3AUYA 4QGHA 8OHMA 2WMNB 5CIQA 2WIBA 3MWLA 3NIBA 4EPTA 2IWRA 2J0UB 5JJLA 3B13B 4P4UA 5C18A 1JR3A 2GA8A 2GEDA 3KQKA 3MWJA 1TMKA 1N0WA 5FUVA 2ZR9A 2R65A 2VBCA 2V7QA 2CE7A 5FR1A 4DLUA 2I1VB 1VIAA 4U02A 1G18A 4M21A 1XTIA 3DM5A 3W9YA 1YR9A 1WA5A 3DZ8A 4B3GA 2C03A 3QXXA 1T3SA 1OF1A 4QHTA 3X1YA 3ZVRA 3QEJA 2ZU6A 4BWYA 4GT1A 2FSFA 3U3RA 5EJEA 3U44A 2FSGA 5FOSA 1VHTA 3BJIC 4AY2A 1XZQA 1WB9A 1Q12A 1K5DA 1UKZA 4WA7A 2F1HA 5GJBA 4NTZA 1MO3A 4N0EA 1NP6A 1AS0A 3CRRA 4D2IA 2IS4A 1IHUA 2PJZA 4KV9A 1Q3TA 2C9CA 1F2TA 4QJ5A 2FU5C 4PZZA 4M1YA 4MRSA 4JBYA 3ND8A 3DOEA 2DB3A 4Q03A 3Q85A 2WKQA 4KLNA 1XMSA 2UZIR 2NQ2C 3LW7A 2IYSA 3T1OA 3SS8A 5FOUA 3CX7A 4ARZA 2A78A 1UADA 3SEAA 1WQ1R 3EW9A 3FWYA 3TIFA 3WP0A 5L3QB 2YJTD 2VO1A 2ZSAA 3L8YA 1KDOA 5UKDA 2BBSA 3PEWA 2WJYA 3LDAA 1E1QA 1FP7A 2CLCX 3R8CA 1GWNA 2VYFA 3LO5A 4URZR 1BIFA 3QPUA 4DHEA 5D3MB 4JLPA 1AM4D 4V0OA 1W0KD 1XTQA 2BBOA 1J70A 1IY2A 2ZVPX 1Q1BA 3PUYA 4IVRA 4H1VA 2G6BA 4E03A 3K70C 1E0SA 1TUEA 2YZ2A 3VKHA 3FE2A 4TMZA 1OXVA 1UBFA 2JEOA 2PT5A 3RANA 3DM9B 4Z51A 3GLGB 4A8JB 2O8CB 4G5GA 3TRFA 1WDTA 1NG9A 2JLVA 2WAYA 4DZZA 1QHGA 4P0TA 3AQ4A 3RS7A 3GFTA 2C2HA 3TBKA 2ONJA 1F2UA 4TMTA 3NXSA 1M7GA 5FBQB 4IHQA 3VU9A 4HDQB 2IBMA 3BB3A 2C9YA 1ZW6A 2RCNA 4JVMA 4TYNA 2BV3A 4B75A 4LK2A 2HJVA 4AKIA 2TMKA 3LVRE 4D0NA 1G7CA 2YNMA 3AF4A 3TUIC 4BZQA 1GDDA 2JLQA 2HV8A 1W0KA 4ASUA 3KB2A 3DO6A 2ZXUA 3EIEA 2FEMA 4ZKEA 1NMZA 1UF9A 4F4IA 2WJIA 3REFA 3REGA 5JRJA 1G8HA 3I92A 3VTKA 1DADA 3T06B 1OH5A 2ZYVX 1UBEA 2P2LA 2ZRAA 3RRZA 4DLTA 3LWNA 3QKSB 3UG6A 1SVOA 1UKYA 3DOFA 1XWIA 2CMKA 5KSYA 5J4KA 1S4QA 2R6GA 1TEVA 3KKMA 2WWHA 3NVAA 2HF8A 2A9KA 4JBXA 3SI7A 4D6PA 5F98A 1WP9A 3TH5A 3ZIAA 3GLHE 5J4VA 1SXJE 4OBEA 1WE2A 1R5BA 2VLIA 4BASA 4W9MC 2GHIA 5DYGA 5CJPA 3AP2A 2IEZA 2OZEA 5KYKA 4OL0A 1XDBA 5L3SA 1F6BA 1OJLA 2JLRA 4NL4H 4KVGA 3WYAA 4P33A 3CPJB 4Q1CA 3LNCA 4AYTA 4GOJA 5TVKA 4BLRA 2ZU0C 3MAAC 2WWYA 1GRRA 3SOPA 1Z2AA 2VIIA 1C4OA 4A1FA 2Q21A 3C41J 2BCJQ 4RKFA 4XIGS 2GXQA 2VHQA 1KI6B 3LLMA 1GL7A 1N3BA 1FTNA 4DSNA 1GG2A 3WMEA 1KTVA 2XAUA 2FEOA 3CX6A 4HDCA 2CBZA 1BMFD 3LLUA 2MSDB 1UBCA 4OKSA 5J4YA 3A8TA 5DI3B 1A4RA 2GCOB 5FR2A 2IC5A 3X1WA 1NVWQ 1OIVA 4YDSA 2VP4A 4JLBA 3OEHD 3WHKA 4EAQA 5H70A 2W83A 1T3HA 3CNLA 3KKNA 4YDHB 1ZD8A 1JXOA 3EXAA 1T91A 1ZINA 3CKLA 3GJ8A 5DO9A 4ESHA 1MH1A 1OYWA 4NYIQ 3JVVA 1U9IA 2R6FA 2LWIA 2FFQA 4IVPA 3V4FA 4JYCA 4EDHA 3VAAA 2QT0A 1QRAA 3Q3JB 2ZRMA 2W0SA 2SHKA 3AUXA 1XJ0A 3NHBA 1GSIA 2CLDX 4TZ0A 4TSFD 2CDNA 4ERNA 1E2PA 4M9ZA 1LV7A 1XD8A 5B64A 4NCJA 1AKEA 1HE1C 1D8TA 4C0BA 2G0TA 1BMFA 4KCGA 2H18A 2GILA 3EX7C 3VNVA 1PUIA 1Z22A 1XF9A 3GFOA 5C4GB 3EASA 3OEHA 1OYYA 4FW9A 2BEKA 1E2IA 4BFVA 5JECA 2ZQ5A 2ECKA 1R8SA 1U0HC 3LFUA 2CHVA 1RZ3A 2DWPA 4MITA 4MGYR 3RC8A 1VYUA 3U44B 2D4HA 2P6NA 2QGZA 3ND9A 1QZXA 3T35A 2XTMA 2PX0A 3V4RA 1DAFA 1TQ6A 2QTFA 4HLUC 5HPYB 1OFHA 3SHFA 1SKYB 1NN5A 2B7BA 2W00A 3KFVA 1H8HD 1NKSA 4QBGB 4TSFA 4YMUA 4B73A 4ZPXA 1F2TB 3DDCA 2E87A 3W34A 3ZS8A 3IDQA 3ZVLA 1DVRA 3Q9LA 5CDFA 1TU4A 4BFZA 2H7VA 2CJWA 2F1RA 2ZJZA 1EFHA 4ARZB 4RCYA 3GLFA 2FE4A 1VG0B 2ZUBA 2WICA 3GEIA 3RABA 3ONWA 5FUXA 1M1YE 4KSCA 3OEED 2VRWA 4A92A 3FHTA 4M1TA 1NKTA 4L4UA 1LNZA 2ZANA 2ANBA 2BIFA 3GFPA 3GLHA 1EG7A 4DLRA 5IRCD 3AM1A 1GIAA 2GZDA 4EJSC 1G3UA 2WJHA 3RYTC 4URXR 4V02A 4NP6A 4BEBA 2YC2C 2D06A 1OIXA 3AGQA 4NKRA 1H8HA 2R9VA 4B3FX 2EFHB 1KI1A 4WXRA 4BZXA 4B33A 1CIPA 5DGXA 3IPXA 4A2PA 1IJFA 2R62A 1R5OA 1RIFA 2XX3A 1P73A 2DFLA 3BIFA 3KJEA 1NVUQ 3DKPA 1F2UB 1U0JA 1ZUHA 2HT6A 3GD7A 1UM8A 4LJ5A 2PJRA 1R5NA 4IXNA 2WIAA 3VU9B 1W49A 3UANA 1SVSA 1YJ5A 1DAHA 3NHAA 3OEEA 5BWMA 5CYOA 3OFND 2JLZA 1NLZA 1MR3F 2XNDD 1U8YA 3I8XA 1P75A 4M1SA 2KBFA 3C5CA 1CJUC 1OIWA 1AN0A 4QHYA 2GEUA 1NI3A 3A4MA 2I1QA 4V0LA 2EFEB 1E9CA 5E7MA 4JLAA 2QGNA 4C0JA 4H9GA 3U3OA 3UIEA 3RS4A 3OIVA 1AZTA 1DAMA 3EPKA 2H5EA 3P4XA 2AFHE 4JIMA 3TW8B 1NVVQ 1KNQA 2X19A 2ZE7A 4PTLA 3SU8A 5JJIA 4B6EA 3VX4A 3AF0A 3K0CA 4EPYA 3LW8A 3WNBA 3SR0A 3OFNA 2NIPA 4O2RA 1ZYUA 2XNDA 2ZE5A 4JL5A 1QVAA 2ZS8A 2WSMA 2P0EA 4MH0R 1CR1A 1II8A 1Z29A 2N42A 2QMHA 4Q48A 2GDJA 4OK6A 2PLFA 3I62A 4BRWA 2XB4A 3HU2A 2B8TA 3T1QA 5L3SB 3P20A 2RGNC 2HF9A 2XJ4A 4RD1A 1JNYA 4L9WA 1R0XA 1NIPA 3GJXC 1QHHA 3R9WA 1XJCA 1NIJA 1AA9A 1D9ZA 4UJ3A 1G5RA 1WMSA 3MWYW 3BERA 2YWHA 4EIWA 1KO5A 2VF8A 4DDUA 3I5XA 3SYKA 3W6OA 4LBWA 3JVUA 4KHZA 2ZAOA 5LB2A 3GEHA 2ZAMA 1OW3B 4H1UA 3VR1A 3LXRA 3THWA 4HB4A 4D81A 2QEQA 1Y63A 2J7PD 4XOIA 4LHZA 2IEYA 4JKIA 1AJEA 2QTHA 4HB2A 1OE0A 1N6KA 3UATA 2R6CA 2ZRKA 1MRNA 3B6EA 5HCIA 3GLGE 4B6FA 2PMKA 3PFIA 4Q7JB 1Z08A 5AR1A 5A0FA 1DO0A 2ZI5A 4Q4HA 1YZGA 1EFUA 3QY0A 1RJ9A 3IO3A 4L16A 4M0LA 4PPFA 3SN6A 3W5JA 1VCIA 3DKVA 4F7WA 1KK1A 1ZM7A 2FWRA 3Q5EA 3RLFA 1WBBA 3ADBA 2WKPA 2OLJA 3CO5A 3RSOA 4DIDA 4JLOA 3MRSA 4WBSA 2JJ1D 4BLPA 4AURA 1ZVQA 1OH7A 1NN0A 3LX5A 1E98A 1MKYA 1XNJA 1FUUA 3U3KA 3SHWA 1EWQA 5HZKA 4IRUB 2J7PA 1AIPA 4PC6A 3I4LA 4QHSA 3J81k 3QXSA 4FWTA 2OG2A 5FTKA 4W5JA 2H17A 4O25A 4LJ7A 4FMCB 2C77A 4PXAA 1MRSA 1JJ7A 4OQXA 1CJVC 2J0UA 1WCV1 2H92A 3BRWD 4PSVA 5AUOB 3HR7A 1P62B 1VCOA 1VYVA 4URVR 2R8RA 5JFGA 2GJ9A 4Q18A 2JASA 4PO8A 621PA 2O8BA 4QRHA 3FMOB 2OCYC 4QXAA 4FI3C 4LUCA 4GDFA 4WZAE 3O8DA 3Q7PA 2C78A 3A1SA 2VTKA 5AJXA 2IA5A 2JJ1A 4TMKA 2OHFA 4AK9A 1TQ4A 1P2VA 4FMDB 4Q4AA 4RD6A 3B8HA 2AWOA 1FX0A
chains in the Genus database with same CATH superfamily
3ZD6A 3C5VA 4IEEA 2GCIA 1ZNYA 4A10A 3V1TC 3NS7A 2NU9A 4OXYA 4FEGA 1QG2A 3T7AA 2IPOA 5I9MA 4HVTA 4HNGA 5TPZD 4QYIA 4C3UA 4PO1A 3KDPA 5EZ5A 2ZE8A 5AW8A 1GKKA 2JB9A 2Y68A 4G01B 4TN1A 1JDZA 2G88A 3LXXA 4KJZA 2PH3A 2WSBA 3MERA 2BFBA 2FSVC 4O4IF 4ALLA 1BKDR 2QL5A 4D9MA 1Z63A 4R1SA 2ONKA 3TQIA 1TAQA 3VR6A 5K8IA 1VMIA 2FEPA 3REOA 1SBIA 2FP4B 5HF9A 3EC2A 5F7OA 2PUFA 4Q7KA 2Z6UA 5BRNA 4EQZA 4GZ3A 4MWCA 2FWIA 4JLNA 4R1UA 5C31A 3F5MA 4YDRA 3TD2A 3VVBA 3T3MB 2SKDA 1PNOA 1PLJA 2C54A 1KERA 3MMSA 4KE8A 4XVCA 4CKCA 4IJKA 2CMGA 2P9HA 2P0AA 1P18A 2BL4A 2NG1A 1V8BA 3NDIA 2YY5A 5DLQC 3FCXA 3UT6A 3CH7A 3E5HA 4R3NA 2I34A 1TB4A 3A9CA 5AK0A 5MGNA 1G8GA 1W0JA 3C43A 4WXPA 5ARCA 4TL7A 3M4JA 1U0OC 3IMGA 4D9CA 3K09A 4BZWA 2FJUA 4J2HA 2AQIA 3NKFA 2H4YA 9LDBA 2CE2X 3K6JA 2GK7A 3EXFB 5H68A 4H17A 2O8CA 3BM5A 5MN5A 3O4IA 3MT8A 5K45A 4RCVA 3RAFC 1X1AA 3W8EA 2MU1A 2QD2A 1D1TA 4BN5A 1T2EA 3LFTA 1JIQA 5JEDA 5HHTA 2X8AA 3MMZA 2V6GA 3KP1A 5ICFA 3FFWA 2PKCA 3D54D 1NQTA 2AG1A 3QMPA 1ESCA 4RM2A 4YRRA 3O93A 5EE9A 4IAOA 5HZHA 2GO1A 4GH5A 3P1JA 5FLKA 2O1XA 1PR9A 2C84A 1U7XA 1P4GA 2BFPA 4UTOA 4ZCQA 3UK1A 5LQKA 2O52A 1A5BB 3QOFA 3ZZUA 4F11A 3WO0A 4KQWA 3QU4A 5EP4A 1C1YA 5HDQA 5B4TA 4RK5A 1D2RA 3LPNA 4UDOA 2GN8A 1PT5A 4Y9SA 3THOA 1YJ8A 4DAEA 4LGVA 3V1LA 5JAUA 4IV0A 1XWWA 3EWIA 2QN1A 3TD6A 3X1ZA 3DMRA 4JHLA 4EG8A 1EB8A 5BXQC 5JI3E 1QCCA 2A3RA 4D3XA 2ZRHA 2N3ZA 3A9RA 1N2JA 1NW9B 4MYHA 4XVRA 4J0KA 1J2YA 1PJTA 3OLVA 3CINA 1II8B 2JGAA 2O4UX 3AY7A 3IXQA 5A2GA 1RIIA 2NYRA 1QBGA 1DXYA 3PE4A 1J5XA 2O7VA 1Y3AA 2ZSEA 2ZJ5A 2X2OA 3PG5A 1NPDA 1BCSB 5AI4A 1GUAA 2X2PA 1ZH8A 2JFVA 1VPTA 1QHEA 4YI3A 5JEEA 5EPEA 3VPBA 3K6RA 2CDRA 4MQLA 1C9EA 1QHHB 1G3RA 2X2EA 5K8VA 3TG8A 1SBTA 2PWYA 5DE3A 5E7IA 3K72B 4B34A 5AW9A 3I45A 2WKWA 2Q99A 4Z49A 1P7YA 4DG5A 4DR1B 5M5BA 1M34A 1JHZA 4G63A 1RI4A 1B00A 1E2UA 3L07A 1Q17A 1IVSA 2RBEA 1WKVA 1K7SN 2R1VA 2VHCA 2W6CX 3D2BA 3F3KA 3G79A 1GNPA 2EF0A 4N5NA 4KR7A 1JFTA 3OLYA 3PUZA 4FDAA 2JFZA 3DA8A 4AJ9A 3QZUA 5EHXA 4LGYA 3L9XA 2M6KA 1JEQB 1OY1A 1YWGO 2OCXA 4O29A 5K3CA 2GHTA 5TT0A 1KAEA 3VR4D 4DEYA 3EXG1 2PDAA 5KNBA 1SXJC 5LYYA 4ES6A 7REQB 2B6NA 2QM7A 2WF5A 2CXRA 3EFBA 3ZW9A 1C7QA 4FHCA 1LQTA 4ER3A 2FOXA 5B2FA 2IY7A 2NZYA 3QELB 4AZ3A 1MU0A 3QLUC 2NUAB 4XR4A 1KMIY 1M74A 3H5OA 2LGJA 2FN7A 3CW9A 1IY1A 4MTCA 2HPVA 2JBHA 2IWHA 5A4KA 1F12A 2GYYA 2RI1A 4RZSA 3OE1A 1Z0ZA 3BZUA 3GPBA 4BQNA 2B7LA 4EW3A 5IJWA 2XTJA 4TQGA 4BTVA 4DR5B 3OZVA 1FCJA 1YI1A 3PCTA 5A4MS 3RS9A 3BICA 4KAJA 1EGQA 3FRJA 1YBMA 4K88A 3W1EA 3ID6C 1UEJA 1SG9A 4E11A 4GX5A 1NP3A 4AP9A 4R71A 4Z1MD 4MIOA 5HRCA 2JIOA 5JD5A 3UM9A 3O8QA 1O6FA 2IVFA 4C7MA 4KACA 2QMOA 2FK8A 3LHKA 2LKDA 5IJXA 4DNPA 3VZCA 4P7JA 3WGNA 5CLQA 2O2SA 1HM5A 5AVVA 2GZ1A 3LLCA 3HXMA 4CQMA 3E9DA 1HBJA 4O2AF 2AK2A 4QQNA 1X1TA 1TTPB 2FP3A 1BSVA 3DOJA 4FFBB 4OLHA 5IEJA 2BZ0A 3VVMA 3C7KA 1FYFA 4V1CA 5GINE 3EVZA 3BS4A 2EGUA 4TX1A 3EIUA 2QD1A 2DKNA 2CMDA 3KJXA 3J7AC 1JAHA 2FPIB 3SF8A 1YVRA 2O8BB 2IYRA 5HEKA 2RB4A 1ULTA 2XWPA 1U0SY 1U2QA 4TKLA 4D57A 4HWPA 3UJBA 5HQJA 4ZI3A 3QEBZ 1P9RA 2M6RA 3E2PA 1GAWA 3O2NA 1TCVA 1DTSA 3CZRA 4O4LA 4I3GA 4C6RA 3E58A 1JZSA 2XLCA 4Q4AB 1N2IA 3N7AA 5LPNA 3DMGA 5IXYA 2DPLA 1RMQA 1WIWA 2PXXA 4DLZA 2HNBA 1W6RA 3DGFC 4TKMA 3NMUF 3R6TA 1NR7A 4Q82A 2H1CA 2G77B 1ZU5A 4GGOA 4R83A 4BO2A 5F3WB 1WMEA 2RC5A 1G7RA 4QUGA 4ZAYA 3UGKA 2JLSA 1E3DA 5AO9A 3ET5A 4TV8A 3VZRA 3WGVA 1QUEA 1DRKA 2I7TA 3N8IA 4LSGA 2Q7XA 3DXYA 1RKVA 4QYIB 5DTRA 2EKLA 4U63A 4ALNA 1T4MA 3PFWO 3BH7A 3GI1A 3GX1A 2BUCA 4HJRA 3S28A 2A30A 1OFUA 5TDHA 1HR0B 2BFBB 3SYNA 4BNNA 3Q2OA 1YQEA 2A0WA 1CR6A 1QYWA 2F17A 2V3WA 1R4MA 4JKYA 4Z7NB 1UBRS 1MRZA 2HYIC 2QX6A 4JBLA 3OJLA 5IKOA 2RIPA 4JLKA 4Q9AA 4Q4JA 4DZTA 1MJNA 2DBVO 1U28A 4MDHA 4P7BA 2DWCA 2YKGA 3D6MA 5ALHA 3G5LA 2X3YA 4TXMA 1YQQA 2PX5A 3E7FA 1XX6A 3T7KA 4KPFC 2NAFA 4TL6A 1JALA 3QXJA 3QSYA 2XRZA 2O8EA 4CKCB 4MUKA 1QV7A 1G16A 1GPYA 2XUFA 5KREA 5F2OA 1B7GO 4UCQA 1QE5A 3LDGA 1E20A 3LYUA 1W1UA 2QD4A 1AXEA 1XQ6A 3BL8A 3CNNA 3P19A 5D6OA 4ZZ2A 4C4OA 4QVKA 4Z4FA 2H4XA 4BFXA 4IFTA 3CR3C 1ZMOA 1QO0A 3RM3A 5KYNA 1WETA 5JVDF 2IIBA 3DPUA 4OLFA 5ESWA 3O8OB 3G85A 3ZHRA 4Q3OA 2X9GA 3CXRA 5BPHA 4BXOA 1AQYA 1XCGB 1D5CA 1D2MA 5HGJA 2QVLA 5JQGF 3CZ5A 5CFRA 5KPDA 2VPQA 2VXCA 4UVIA 4FKBA 1LH0A 4IY1A 2X2FA 2GD6A 3OQOA 3JSXA 2RB5A 3WLTA 1F6WA 2MMCA 3BFPA 3LX6A 1VHQA 1SUSA 1VBKA 4Q01A 5BN1A 4RTJA 3L49A 4CFZA 3ANMA 3A1UA 3VQTA 2W6PA 5TLSA 2C5GA 1XAIA 3KTDA 1YR6A 3F7OA 3F7TA 5DT2A 3PXXA 1NTOA 2FFRA 3KHKA 3L1IA 5BSWA 2FDXA 3R3UA 1KNXA 1DMSA 4LHSA 4ZZ0A 3R9IA 3QUTA 3EF1A 3C3XA 4GKAA 1A5AB 2D62A 3OF2A 4IDFA 3FYUA 2AQ8A 1OBFO 3ZWVA 4NU5A 4ENPA 4LE2A 1CV2A 1T1EA 1U8AA 2WPDD 3OJEA 1LJ8A 1RE0A 221PA 4PYMA 4R01A 2VDKB 3E7WA 5LZ5A 3AZQA 2W2QA 4DZRA 5CEJA 3WYEA 1Y7LA 2CL0X 4ER5A 1L3IA 1JB1A 2R7LA 5IG2A 2PV7A 3NM6B 3L4JA 2UZAA 1JG1A 3ASZA 3V80A 3R76A 3ZUPA 3S1AA 3SZUA 3U4AA 3HVJA 1H22A 3DZFA 2I7VA 1CUFA 2O7RA 3IFSA 2I9PA 3HJAA 3TIIA 3M6XA 1ZIOA 4US2R 2Q0XA 2XMZA 5P21A 1A69A 1HFKA 1M2OA 1OT5A 2CVFA 3CUKA 4AM8A 2O57A 4QDTA 1KVQA 2AMYA 3MIIA 4QELA 1M34B 1W9HA 2WT4A 1G8SA 5GVRA 1J42A 1HTBA 1JZTA 3I9MA 4O33A 2BGTA 2JIRA 4IHKA 4CQJA 2JNWA 2Q29A 3KT8A 2OP0A 4C3OB 3TOZA 2CHQA 1YC5A 3VHXA 1MZVA 3OO1A 3R09A 1EK2A 1R5JA 4ZOQI 2BFOA 4WACA 3MJVA 3ED1A 2Q0QA 3UAVA 1LC0A 5K0FA 4AG6A 4EVRA 4FM9A 2F1IA 1S2GA 1IAVA 1QH9A 2JIQA 4RMJA 1WXQA 4RWZA 5AVYA 4AQYB 1GAQA 3FSEA 3H9BA 3VOTA 3VU3A 2Z5GA 1GKUB 2DFPA 4K05A 4RCZA 3UJ3X 4F72A 4AZ3B 4OBBA 4M98A 2YR0A 2KE5A 2J07A 3OQPA 3F4BA 1WAMA 2B4AA 3IIKA 1MDFA 1M2JA 3LBIA 3TZEA 1U2RA 3G23A 1RC8A 4HBZA 4JYPA 2V7PA 4NU0A 3DCYA 2DY0A 1H2ZA 3NC4A 4KE9A 2WAMA 3BH6A 2VBFA 2IYAA 1M2NA 2PH5A 1J22A 2X7XA 3TKAA 4E09A 1ZJWA 1MAVA 3H1BA 3MW8A 4KZPA 1XZGA 2K6GA 2NUBA 4OAQA 2JVJA 2JJYA 4JJ4A 3SAJA 1DQYA 3TKYA 1XL0A 2I1LA 1EFDN 5KQGA 2BMJA 3TOCA 4P5DA 4EB8A 2P77A 4UVGA 5HQTA 3MD0A 2PL1A 1XQYA 2XWSA 4ZP1A 3L4BA 3G9UA 1E1RA 1HZJA 4NMWA 1C8KA 4EW1A 3DEJA 4CM3A 1GRQA 1KVTA 3O8QB 4QEDA 3FFTA 2HQOA 3PNYA 3ZWXA 1Z6GA 3LUPA 2AMLA 3P9YA 1C41A 4KN8A 1Q20A 3V4LA 4DLKA 1VP9A 5C53B 3HB0A 5IM4A 4MRRA 4A8JC 2SECE 2ZDGA 4CQMB 3W4KA 1VLLA 1RFLA 1IQRA 2VNSA 3LLSA 4RL4A 1E3MA 1TM2A 4M8SA 3FBGA 2LIVA 5BSTA 2D5CA 3UKJA 2XBLA 3T7CA 4F38A 4V1CB 4L0CA 1X3LA 4IZOA 3F1LA 4FHZA 3SF8B 4FKZA 2ZRDA 3VNBA 3DL7A 4DJFC 2QLMA 5ALKA 2LUOA 1UOOA 4HNSA 3RAJA 3SS7X 2OKCA 2F3SA 5GJWC 1NJ6A 3WG9A 3AR3A 1NMXA 4KVAA 1R6DA 4O4LB 1U94A 2Y8EA 3SYTA 4EF5A 1ZP6A 1RW4A 2FPRA 1CEXA 4JMPA 5COBA 1ZHOA 1XFAA 1B76A 3A9SA 3A6HA 3HP7A 1OLOA 2OAEA 3B6MA 1A9PA 1G6Q1 2IP4A 5E4FA 3ZHVA 4KXYA 5FWYA 4K28A 4A0RA 2ASVA 1Y7TA 3NNSA 2B1IA 4HEQA 4I2VA 1U4SA 1BEEA 5ENDA 5IYZF 3KBBA 5E7JA 2M9MA 4TV8B 3BGSA 2CZGA 3T9CA 3BRCA 4M0KA 1UBSB 4V03A 4E2YA 4I55F 2QAIA 2R96A 2NQTA 2G07A 4YRDA 2CFSA 1CZKA 1G66A 2Q0SA 3GLIA 2CN1A 5C7IO 4IDAA 3ZG6A 1R4MB 4GRDA 1IZ8A 4CM1A 1PUJA 3NPAA 3AB3A 3ABSB 1UXGA 1SZDA 2V0CA 4Q4JB 1KY3A 3PUJA 2VTVA 4UM7A 1U9CA 4FYWA 3WWZA 1FBNA 1TD1A 4L28A 5KU1A 3T12A 4L07A 4XE5A 4FFOA 4PNZA 3SQXA 2NUPA 2LCFA 3FKSD 2UVPA 4UTZA 2E7ZA 2ZJ1A 4DXDA 2GBLC 2F8TA 2NXNA 2YJ4A 4LJ6A 3C70A 1S0UA 2QRLA 2DX7A 1DQPA 4G41A 4NOKA 2I54A 4KPYA 2E55A 3TLXA 1JJIA 2R47A 3OU7A 3PXGA 4ZFNA 1TYZA 2X1LA 3PL1A 1R18A 1C9JA 3EUFA 4QPPA 4EL0A 2WWXA 5AM4A 3CONA 1NT4A 3O8BA 4MGEA 3NRCA 3NWBA 1MG5A 5BN5A 3HCWA 1Z2DA 1NBMD 1FDRA 2ZGVA 5HS6A 1O9HA 1Y6QA 4XCVA 4BATA 2QJWA 2F2TA 3R3SA 4G6ZA 2WWIA 3JD0A 2BMWA 3DFFA 1VSBA 4BXOB 1O57A 4FFDA 1HMPA 1NBAA 1UZMA 3GJ7A 1E6CA 1YIAA 4BYMA 5KTPA 2I8LA 1S3GA 2P9QA 1L4UA 1NRWA 3QBEA 1D0IA 1NLYA 3RS2A 3PP8A 4YAUA 3F3YA 2XTZA 4MA0A 1CQIA 4YP9A 3HXPA 4JI6B 5GVSA 2P35A 5T6BA 1N34B 4MQUA 2N1MA 3HI6A 3K5IA 4OBXA 2ICAA 4OXKA 1N8TA 1OILA 1R0BA 2J7KA 2WF7A 3JQDA 4JVNA 4MEAA 5AKHA 4C29A 4DLPA 1GPMA 1KF0A 5CDTA 1Q57A 1DQSA 3AR8A 4QLOA 4K9DA 2HMSA 4CW7A 1JYSA 2A1TS 4EB0A 1QP0A 3AL2A 4EUSA 1P0FA 3W90A 3U1TA 2DJ5A 1E7QA 1XDDA 4N7RA 4WLNA 4DHWA 1XZAA 3ZOZA 1I4DD 1QIFA 3H9JA 5L3RA 5LA6A 3AVTA 1WQ3A 3RIGA 6YASA 4AIIA 2NSDA 1XK7A 3FYUB 3PXDA 1WEKA 4UAVA 2PS9A 1D2CA 1R00A 4RD2A 1E3JA 1ID1A 3B1YA 3JQRA 4HADA 1KEUA 3RC3A 1GA6A 3RODA 4CF4A 1YMQA 3H8WA 3UENA 3QE9Y 2ZZKA 3QENA 3X1JA 1YQGA 2F8SA 4DLVA 3WQRA 2EDAA 3K9QO 3S1AB 3GJ0A 2B21A 2QQ0A 1OQAA 2I4TA 2ZWPA 3G0DA 1NA5A 3FMFA 1KJYA 4LGMA 2R48A 3ZW8A 1MTOA 4FMCF 3NNNA 4HEHA 3W1VA 4AYXA 1M2OB 1PAUA 4WKGA 1YO6A 3UMGA 1L4LA 4YXWA 3SYRA 5F76A 1FNCA 4ED9A 3RH0A 5IK2A 1IBCA 1QWSA 5A5DA 1NZJA 1P19A 2V97A 5JROA 3CB2A 3RF7A 3PNBA 4G8CA 4EW2A 2FRDA 3E0XA 3RG2A 3VHXB 2VBIA 1P8JA 2FG6C 2F4VB 3M81A 4NCIA 1CERA 1E5QA 4IZ6A 1V48A 3GVPA 3K7EA 3W5VA 1SEVA 3CMMA 4X3PA 4F1KA 2JGKA 4QRIA 3FNIA 4B84A 3C8DA 2X40A 4R40A 1CR4A 2VH5R 2CKDA 1I7LA 1LBEA 3GCZA 1UMKA 1UDXA 3OJXA 1GZ4A 1BO6A 4WBXC 3A11A 3I2YX 3K70D 5BN3A 2WHQA 3QVOA 3O4VA 1DDIA 3BWDD 4EF6A 5FWAA 4KODA 4Y2GA 4E6PA 3UK2A 2KWIA 1JYFA 2XB2A 2GPJA 5L4NA 4GNRA 4CKXA 5IX8A 1DLJA 2ZWIA 5FLXA 3RK0A 3VNQA 1SNYA 1V6CA 4CM9D 1EVJA 2ZKLA 9ATCA 1TIKA 5TY0A 3LT4A 3F78A 3O91A 3Q7IA 4EKEA 4Q1EA 5I7AA 3LH5A 2F48A 1RPNA 1KH1A 2R5FA 2ZRPA 5DMXA 3W1WA 2PBRA 3N0XA 3ESRA 4K46A 4ECAA 2P9ZA 3QU7A 4B2LA 5CLIA 3ZEAA 3VHQA 3MQ4A 1QPGA 3OLWA 4PIVA 4L72A 1YE3A 4IWYA 4TGLA 1BEUB 4X5OA 4D74A 3G3EA 3ENZA 2ZB3A 3QNUA 2DWUA 4LWQA 5DBOA 3VYUB 5K4GA 5DM4A 2HHHB 3CWZA 4FLFA 2G04A 5IASA 4Z7OB 1VOTA 1XCMA 1BH2A 1KH3A 1FTYA 2PG3A 2HREA 3JATA 3NBKA 2EGHA 3CLVA 1DTWA 4UDNA 2XE7A 4E1AA 4YT2A 2VL7A 4BWGA 1F8UA 2IZ0A 2AW5A 3QA3E 3SNKA 4EG0A 1YTUA 5I45A 3AKCA 1I6WA 2YDXA 3NC0C 1G9XA 2C5LA 4NULA 4E7PA 1YA6A 4R54A 4H7DA 1BJRE 1L8OA 4X60A 4DNXA 2J0VA 2AJCA 2QNRA 4G0QA 2JG3A 1FOEB 2QN3A 3GRVA 1JEDA 2ZBQA 1E89A 1XCBA 5TGZA 3G5TA 5FWYB 1YT5A 4BVGA 3ETCA 3B7PA 4PVDA 3VMMA 3K0EA 3A7DA 1NFQA 2IOQA 3F49S 3FSJX 3F8WA 2P9FA 2A5FA 3QPWA 4BO7A 4EM6A 1NI5A 1Y9DA 1YE8A 3CLRC 1QNFA 2X15A 4UKDA 1ULZA 1OKKD 1VGQA 2EIHA 1NT2A 2YWFA 3BQMB 4BB0A 1L8QA 2QA5A 1U9ZA 2Z43A 2NTVA 1DQZA 1FFEA 3FSRA 3BSWA 4GOOD 4NCXA 4TMFA 2WJJA 3U62A 1L8LA 1VCNA 3C8ZA 3V34A 3GLIB 1DO2A 4QDJA 3U40A 3E9YA 4HB0A 2B1GA 4BNWA 3K1AA 1KYIA 3MGKA 4E7OA 1P6XA 3N2LA 1HSZA 2HJWA 1JIKA 2P9YA 2V3VA 1ZXXA 4MVWA 3TG2A 5EY5B 1GTG1 4HF7A 3T1NA 4Z1OA 1RRPA 4NMMA 4FHDA 2NUPB 3IP5A 1JDNA 3LBHA 3L43A 4M9UA 3SDZA 1DC7A 1YVDA 3PD7A 4NMXB 4BL5A 2UVPB 1R88A 2RAVA 4FYVA 3ZCTA 2P0YA 4CTMA 4G56A 4ZI2A 1N77A 2IIVA 3MFYA 4INOA 1ULUA 4V39A 4DQXA 2RJNA 1IBLB 2DPMA 3E8MA 3U3MA 5ITVA 3O47A 4F45A 1E18A 3HR8A 1ADCA 1SC6A 2FFHA 1K2VN 1M54A 1XLTA 1G9SA 2YBDA 2I2AA 3FTCA 3PS9A 3SY8A 2CEKA 1S2NA 4M1OA 2B69A 2IW1A 2FSUA 2G9UA 4ZCMA 2NU6A 4YR9A 1GPWB 1MQ9A 4C4SA 2Z2YA 4M49A 2QJFA 4HUTA 2NX2A 1KAQA 1GPUA 3VJLA 3U5ZB 3HKEA 4LRTB 3M89A 3PQ7A 1CQXA 4LNUA 2IHVA 1JI3A 1G60A 3OPYI 4W63A 3TJRA 3VO8A 4B3IA 1SG0A 1DT3A 4NCKA 4LYAA 4KXNA 3AFNA 4QDXA 3PSHA 3ZY4A 3E4CA 5DBGA 4OK3A 4RFVA 1GU7A 1CQIB 4R31A 4II7A 1KWKA 3SZLA 4E30A 2XZLA 1W2GA 1X15A 2HDNB 1R4NA 4CEIA 3ONVA 1BCRB 2O2YA 2GMWA 1M5RA 1VI6A 3ZZTA 4C7XA 1XZPA 1QTNA 2Z9CA 4M76B 1KZYC 4NYJR 4PQFA 4FE3A 1R0KA 3Q8LA 1SIUA 2P3OA 4MEBA 2ZEJA 121PA 4TOIA 2NO7A 1LU9A 2XGMA 3O82A 3OQNA 1V35A 1Z5UA 5LA6B 3QBDA 3T4EA 4RXTA 3S1LA 3HKBA 3EZLA 3L41A 2X7HA 3R9KA 5JALA 4GYYA 5EIAA 3RWMB 4CODB 3FWHA 1U80A 1LK5A 3LM8A 3LRXA 4IOLA 4GFDA 4TQUS 2J3QA 5SZKB 4NQZA 1KRXA 3PDHA 5A1TA 5BOSA 4R2WA 1KDRA 1E69A 4E51A 4YUAA 3BCRA 4RLHA 1A7UA 3DAHA 1FJHA 1TW2A 2QI9C 4PLFA 2Z3WA 4HXEB 3UTCA 1JR4A 4MDEA 4D98A 4ZV7A 1I14A 2ZYTX 2JAOA 3RADC 4EX7A 3TSCA 1EJ0A 6PFKA 5JZOA 1SCAA 4JXJA 3OIWA 4P8RA 3S2ZA 2X9LA 1IN8A 1J7KA 4OGGA 3T0FA 3P0FA 2JZOA 1RTKA 1QQ6A 5FF9A 1E79D 3UJ8A 4QAQA 4YRJA 4YQFA 4KGZA 2YJNA 4NHOA 4XQGA 4D3SA 2F64A 5DHAA 4HNRA 4OHBA 3VPSA 1Y5MA 3W2GA 2H3HA 2XMDA 4U3JA 2IYWA 4DW8A 5B57C 5KBYA 4HEA6 1RKUA 1KK3A 1Q1QA 1IN5A 4P83A 1N92A 1DJPA 1TF5A 1PNVA 2PKQO 2RSLA 2YS6A 4W7SA 4ZVTA 4B4OA 1YVEI 1EJ6A 5D87A 5KNCA 2PQMA 4EA7A 1E1LA 1XK6A 3NHFA 5EMMA 2RAFA 5TE9A 5BWCA 2TYSB 1Z0JA 3GLTA 4L08A 3BMQA 5BNWA 3IUYA 3KDAA 4U7TB 3QY9A 5BN3B 1XYVA 1Q16A 4H0NA 4RETA 9GPBA 2AHRA 1TO1E 3CXUA 5TPWA 5CTJA 3VC3A 3CZPA 3ZWOA 3JD2A 3IPRA 1NOJA 3A1EA 3MRVA 2D1SA 2OCLA 2E1RA 3UPDA 1XZNA 3AXSA 1I2MA 2V4MA 4WPGA 5EN4A 4HO1X 5JSFA 1ECCA 4QASA 1Y8AA 3OF5A 3UAGA 4UULA 4JXZA 2OP1A 1GXSA 1Z88A 3EBPA 3QWIA 3GDGA 3M2PA 5EKUA 3S5UA 3D5TA 3NBXX 4EY4A 3ESZA 3KVOA 4EYOA 1MEEA 1T5HX 1YK0A 4OI4A 4M38A 4GXRA 2QVBA 3I61A 2DTEA 1BHSA 4EJSA 1J1UA 2O8EB 3PXCX 5JZMA 5H9VA 4RFLA 1XROA 1VI2A 4ZOBA 1KRWA 4DS3A 2I4RA 1JQKA 1HQDA 3DH0A 3T3PB 5LDDC 1Y4UA 4OIFA 3D59A 1Z07A 3SEZA 3V3KA 3FVQA 4BO9A 3JATB 3T1TA 2D2FA 2LR0A 1OPXA 1H05A 3PUXA 3V8QA 1OFTA 1DTWB 1Z6PA 2XQKA 3NFRA 5E2BA 1FNDA 5JXIA 4BV9A 3KEOA 1FU7A 1Y5IA 2GCPA 2ZIFA 3DYBA 3Q7QA 3LIIA 4U2FA 2CVHA 2DGDA 2LDXA 2XEXA 4AULA 3LC1O 4IJMA 2JANA 3MJHA 2WNIA 1KJ9A 3CS3A 4NDZA 4KR3A 1T0HB 1UP6A 3C6KA 5JSUA 2H51A 3K9LA 1WW8A 4FGZA 1BDJA 4YRBA 5BSVA 4RK6A 1I7NA 4DLNA 5JFTA 2FUNB 4OI1A 2OPHA 5BRAA 2GZHA 1UBNA 1QZUA 4E13A 3QU5A 3IB3A 3RGWS 1FNSA 3RSSA 1XRSB 1MPXA 3IBYA 2HIHA 2FETA 5I9TA 3SE0A 2VDOB 5HZGA 1W4BA 3ESYA 1L4MA 3ZTYA 4KO2S 4Q37A 3IAM6 3ILHA 2FHPA 3LWDA 2FH5B 3BHJA 3GJSA 1LRKA 1M1NB 3MBOA 3U2QA 4CUJA 3K1AB 3C1UA 4GWKA 4EHBA 2WAOA 3E3LA 5F1OA 4HL6A 3STWA 2QRZA 3WLIA 5B58T 2PM8A 3PZRA 2IH4A 1B23P 4RORA 4YHHB 3DNPA 1U2GC 4IGAA 1PLKA 5KAPA 4MVYA 5ICEA 4MGHA 4DUGA 4IQ0A 5KOYA 1KJ8A 1R12A 5KMGA 2PA0A 1Y8RA 2VEDA 2UXBB 5JJCA 4J6FA 3TXXA 4AY4A 4YH1A 4X66B 1C7EA 2HH9A 2IUFA 3N75A 4KQ9A 5I51A 4JB8A 1Y48E 3K53A 3OIUA 2ROQA 4KXQA 1DJMA 1DWOA 5AXAA 2Z95A 4JS0A 2WLSA 2G8NA 4CHTA 2BHLA 3IUPA 3PDIB 4JB2A 4UDYX 3TQRA 1TO2E 3BFKA 3WMGA 4IJQA 3PI6A 3CVJA 1ULAA 1FFBA 2PIAA 3H8VA 4HG2A 4IRMA 4QOIA 2NU6B 3PEEA 5EQFA 2WG1A 3F46A 4F3KA 1FUIA 1KEVA 2RGNA 3C16C 3DVRX 4NE9A 1PZXA 3HKEB 4WVLA 3C8HA 5ERGB 2DM6A 2PJUA 1POWA 4LNUB 3VU8A 5ALPA 1SHTX 2C07A 5IJ9A 3Q8KA 2GM5A 1T6BY 1OA0A 1UXKA 2FMXA 3DV0A 2GPSA 4J03A 1ENPA 2JCGA 4LK3A 4Y1EA 2PVCA 2VJNA 4M8IA 3X2SA 4DM3A 4I3FA 1WDWB 3NGMA 4BUJA 4PHGA 3IBFA 1PJSA 4BFSA 5EJFA 1TVMA 1R4NB 1RC0A 3KQHA 4CEIB 2ZKIA 5LMNB 4JL8A 2Q5IA 3LUAA 4JP1A 3S2FA 3N28A 3CFYA 2IDJA 2ZTUA 3R23A 3IYLW 1TTTA 3QXCA 4UAUA 1E2MA 1NR1A 3TGWA 2I6XA 3C5EA 1BJTA 1PYGA 3KM0A 3U7RA 3WDSA 2ZBEA 3WXMA 1W93A 4B3CA 1L4KA 1TK3A 1W48A 5A4IS 5H8WA 3NTXA 1WMBA 2Q3MA 2QZJA 1NP7A 2JGNA 2HU7A 1CUBA 2D2XA 3HKBB 1J90A 3L6EA 2VI5A 3UMRA 2NO4A 3AF1A 4FFMA 1V7QA 3G2OA 3ECSA 4MS4A 3VZDA 3ANXA 1YB2A 1Z75A 4EG4A 2AD1A 4F9GA 1BMQA 2JGJA 3LRPA 5B30A 3OQ6A 3GA7A 4DDVA 2LZ0A 4HNVA 5BOSB 1VKOA 4OMCA 2W6JA 3WO1A 1MX3A 1YUMA 2FFAA 3MTDA 3GOHA 4QXOA 4Y2JA 5CW2A 5G3ZA 4ZCIA 3JYPA 4WCVA 5EXPA 5I8ZA 4CTOA 3TW0A 2WKRA 2WF8A 4BTEA 5SY9A 2WYIA 2Z98A 3IQDB 4BZZA 4YMWA 3DP7A 1Q14A 3BE6A 2XCTB 3V4OA 1FFWA 1Y8ZA 2A8YA 3AR5A 5JFOA 5BP7A 2Y1WA 5EPUA 1EBUA 3NAMA 4OYYA 4CV1A 4C4XA 4U3JB 4ZDJA 1C9DB 1BN7A 1Z4NA 1K5PA 1QYVA 1JTVA 2Z1DA 3PLAE 3VOSA 4NOJA 1G3IA 4QOEA 4K1LA 5LIRA 4O4LF 4RFSA 4B4VA 5AQEA 4RK7A 4LYDA 1OX4B 4LC0A 4AZ0A 2BMVA 2DY1A 2XYRA 1J0CA 1RXSA 3FMPB 3H9CA 4PZLA 4Z6KA 1Q7BA 3AERA 4RS4A 4CCAA 3BMQB 1PFWA 3UAWA 4DLAA 3DLHA 3JZFA 1QIIA 2NWQA 3SQOA 3RJTA 3WLQA 5HBRA 4DARA 1Z0SA 2Z8ZA 4OHYA 4KYIB 4M9RA 1YDWA 3IVXA 4U5QA 1H0HA 2ATEA 4WT7A 4JJ8A 3WB0A 5TPWB 3LVQE 4TV8F 1Z62A 3Q3EA 5FTWA 3WGYA 4EEKA 1T2CA 4PYLA 3S27A 3OP1A 4BJ1A 4IUBS 4WINA 2PZMA 5BR7A 1ODTC 1IM8A 3IEIA 4BNVA 3CUTA 3SK0A 4ZCTA 2J5BA 2QTBA 1FNMA 1ZK1A 2REQA 4YJHA 4QLAA 1GXSB 1A8HA 1N9GA 2JF0A 5ESRA 2WTAA 4M8NE 3V6LA 1TGVA 4FYJA 4KNYA 3HYLA 4DC9A 2PV0A 5KAMA 4CF3A 5ALEA 4ZZ1A 1V4VA 1KEZA 3R41A 3WISA 4QGGA 2ZIXA 2FSVA 3C7AA 2HXGA 4B79A 2PD4A 4EJSB 4PQGA 5E4JA 2CZQA 3WSTA 2UUPA 3DE2X 3IEKA 1H3FA 1JIXA 2FDCA 2VYQA 2VDNB 3VNRA 3RU7A 3ZPXA 3FIJA 3IIJA 4RY2A 1H8ED 2AEMA 1FFDA 4E94A 1DDGA 4UUPA 4X93A 2YVKA 2DPGA 2EFJA 4N48A 1DKMA 4PG8A 1WXXA 2IZ6A 5TX7A 4BRSA 3B1FA 3GCDA 5TARA 4Y6LA 4JROA 2OV6A 3QMMA 3NKLA 1V5FA 4J0QA 3PYLA 3FOFC 4YJ3A 5JSQA 1U7HA 4XA8A 3FWPA 2VZLA 3M6WA 4KP7A 4RPIA 4YY3B 1XXHE 1HQYE 2G5TA 4D41A 2Q0HA 4IWXA 1U98A 5EUBA 5JDIC 3SWWA 1V5IA 1MQAA 3ILXA 2WSYB 4OIMA 1PS9A 1R64A 4PLYA 3H05A 3C2QA 1XZFA 4FS3A 4MAAA 4MW1A 8ABPA 5KTYA 2Q6VA 1FFYA 3IHTA 1Z12A 3DZKA 1GPBA 2J3JA 3C87A 1Z5OA 5AFSA 3COZA 821PA 1IIRA 3PWTA 3T3GA 1YJQA 3CH5A 5JI2E 3JQ7A 4JI2B 1QOZA 1E2HA 3WFIA 3R74A 4RW0A 3GPDG 1XRJA 2NT4A 2A7QA 2RGBA 2ZOSA 3R3JA 3KQYA 4OA5A 2C9OA 3QVUA 4EYSA 3WLMA 1YRAA 4MUBA 4NY1A 3VR5D 3UHOA 4YAOA 4GR5A 4HB3A 3L40A 3RNLA 2R44A 4R2XA 4JI3B 2W6NA 1GGKA 4FUQA 4JOSA 1Z6TA 4R8LA 3RUEA 2XPCA 1KR2A 2C0CA 2VNIA 1NDQA 2W0MA 2Z4TA 2MSEB 3UUWA 5B7PA 2PGXA 3P9RA 4RZ3A 2JJQA 2WD7A 3PHBE 1N1MA 2ODQA 4HMQA 3KLMX 4N9WA 3DAGA 2PBFA 3DEHA 3OY7A 3UJDA 3WVNA 3ANSA 3S2EA 5LQMA 1N78A 4K9MA 1X7WA 1Y8RB 2NV6A 1Q6ZA 2PMDA 3A36A 3BULA 4IGKA 5GOTA 3ZTTA 5KB3A 4Q9IA 5IMBA 2HYDA 1KBQA 4Z2YA 5EJ9A 4U2CA 4Y2HA 2IUSA 1YRLA 3IALA 1ENOA 1CF2O 2BH9A 2F90A 4M0UA 4UFPA 3CLTC 1HDOA 1JKIA 1ZN9A 2BCGY 3D8BA 5LMZA 5LB4A 5G41A 1Y6ZA 3LYHA 4CR6A 2BJWA 3ZE1B 4O5OA 3VTAA 1G21E 2VTBA 3HHEA 2ONCA 5HTKA 1JE1A 1M72A 1T5SA 3ZNNA 2PLAA 1A04A 1XZKA 2WHEA 3A25A 1U99A 3FW1A 1SOMA 3B5JA 3OAAD 1T2VA 3HYNA 2YN2A 4LYJA 3SSNA 4D0GA 1C5KA 5K8LA 4DV1B 1USUA 4CLDA 2HIAA 4L4ZA 4MCAA 5IJ9B 4WXEA 3B1JA 1LPOA 4JUFA 1DFHA 1X8KA 2QR5A 1YI8A 3DV0B 3GZJA 4D5EA 1TLFA 3RJ9A 1K8YB 2IOHA 4DKXA 2FFJA 3UMSA 4RGYA 1PZNA 2JAQA 1BX1A 1R7RA 1WF6A 3KSUA 5EMHA 4NH4A 4FB5A 2YXNA 4ZEWA 4MUFA 1MT0A 2FPWA 1GAJA 3C45A 1EE9A 1H2AS 4J16C 4PC3A 4U9IS 1D4FA 5KOHA 1Q19A 4EOGA 5CITA 4MOWA 4OGFA 1HYBA 3C24A 1KKLA 1KAGA 2GF9A 1PWXA 2K7FA 1ZKDA 2NW6A 1QVVA 1JDBB 1JPNA 1SXJA 4X1YA 1C81A 1F51E 2PWAA 5E0OA 4O02B 3W5DA 3LGSA 1QB8A 2PZAA 1JHDA 2OILA 1PFGA 3PEUA 3URKA 1KFBB 3FMIA 3QLUA 4YN3A 3GUYA 3JRXA 3NDPA 1UXOA 4EI8A 2HADA 1M2WA 4Z7QB 2AL7A 1BE8A 4AW9A 1U7TA 5DM70 3TTVA 1UDAA 4MS4B 3H5RA 4C4ZA 2RDMA 1ZBQA 4FLEA 3IEVA