4Q18A

Human dck c4s-s74e mutant in complex with udp and the inhibitor 4 [1-[5-(4-{[(2,6-diaminopyrimidin-4-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]-2-methylpropan-2-ol]
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
230
Chain Sequence
b'IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 230
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q18A00
2PBRA 1OJLA 2V8OA 4O3MA 2QP9X 4M22A 3X1XA 3K70D 4HLCA 4FN5A 2FZLA 5KU1A 5DYGA 3RWMB 3FOZA 1ZUNB 3UIEA 4KCGA 4URUR 1JECA 1HT2E 1PUIA 2QENA 1NBMA 5JSZA 4NYMR 3PEWA 1D6JA 3OIWA 3QQ5A 1N6IA 4A9AA 4CT5A 4P4TA 1UEJA 2FNAA 2QROA 2FH5B 3LXXA 3MWJA 4D26A 2Z4RA 3I1FA 1FFHA 3QKRB 2WSSA 4HDOB 3BB4A 6Q21A 4TQAA 5DO9A 2I1VB 3UMFA 5FI0B 5GJCA 5AR1A 3EA5A 5EP4A 1F2TB 3KXIA 4XIGS 4JLPA 2ZUDA 3CLVA 4BLPA 1Z83A 1MRSA 2WICA 4QGFA 1NP6A 4D2IA 221PA 4HZIA 1GRNA 1NLYA 4CRWB 4DEYA 4DB4A 3WHKA 4DCNA 1XD2A 4OQLA 1KSJA 2Q9CA 1BYUA 1Z6GA 2OFOA 2CJWA 3BC1A 4D4MA 1YZGA 3TQCA 3ASYA 2GVZC 3KTAA 3T1OA 1XCMA 4HLQB 1P61B 4DT1A 3GLFB 1B23P 3A1WA 2NMVA 1Z29A 1PLJA 3GLGE 4NU0A 4HAYA 3KDSE 3LVQE 4IFEA 1LF5A 3VR5A 4BLSA 1NMYA 4ILEA 4V02A 3FHOA 1N5JA 1R4AA 4KAXA 3SN6A 5JHGB 2W2TA 2NZ8A 4A8JA 1KDRA 1KGDA 1JR3E 1TPZA 1QHIA 1OXVA 2HF9A 4TWZA 1KKMA 1NIPA 2RGXA 4HB3A 5GVRA 2G0TA 4D4KA 1SQ5A 3QF7A 1XEWX 3H2YA 1ZINA 4BZXA 4TMKA 3LX5A 3IEUA 2IW3A 3IHWA 4JLBA 2GVDC 2JDID 3QY0A 2ZRIA 1XWIA 2R6CA 3LD9A 1JEDA 4LJ9A 2KWIA 1XZPA 3IGFA 2ZI4A 2CXXA 2HCJB 4OI4A 4M9ZA 4KYUA 2UZ3A 5G3ZA 1M1YE 2BDTA 3RS7A 621PA 4EJSC 3WP0A 2NOAA 4DSTA 5J5CA 3SJZA 4QBIA 4RD1A 1S9HA 1F6BA 4N0EA 1R0YA 4AKEA 3DMNA 1BO6A 2BMEA 4Q01A 1P75A 2ZJ2A 4RCZA 2VBCA 4L16A 4LZZA 3CPHA 4JSYA 3E70C 3VX4A 3BH6A 2ANBA 1Z28A 3GFOA 1G3RA 2GESA 3MJRA 2ZSEA 2OV2A 1Q22A 1WRBA 5EUMA 4PPNA 4ABYA 2H7VA 1TQDA 2OILA 4JL5A 3NTUA 1YU9A 1T91A 3I72A 3AP2A 1LY1A 1G7SA 4YMVA 1CR0A 2ZRKA 1KO8A 2QPTA 4H1UA 4Z1MD 3BXZA 1H65A 1QG4A 3HU1A 3EZ6A 3I73A 1CIPA 2Z5FA 4PC2A 3WNDA 5H1YA 4BFXA 4BEBA 3GQBA 3NEJA 4RY2A 2YJTD 1ZRHA 1G19A 5CJ2A 3HYRA 1P6XA 1XMJA 3CRW1 2FZ4A 4US0R 3K1JA 5DIFA 4HZUB 2XXAB 1UEIA 5HCNA 4TLCA 5LD2B 2ZPTX 4JLMA 3T12A 1UAAA 3RC8A 1P9NA 1AN0A 2CLDX 4PO1A 1E9EA 4MUBA 4WAUA 1F2TA 3GLIB 2GCPA 2C5LA 2XSZD 5LDDC 1HQYE 2KBEA 2Q3MA 3PCRB 2Z6VA 4US1R 5BXQC 3ZH9B 5LPNA 1DAIA 4LUCA 5GADl 3ONWA 4URZR 5TV2A 1NL3A 4LBZA 2J1LA 2JLRA 1J90A 3AKEA 4EPVA 2KE5A 5DI3A 2GF9A 1O3YA 1U0JA 1E1QD 1G6OA 5K8IA 4FXPA 4Q9HA 2W6JD 1M74A 4AKIA 3H4MA 2W2VA 1SXJB 4UNSA 1Z5ZA 2ZEJA 3I8XA 5CLQA 2X19A 2PCLA 5FPSA 3SR0A 4B6FA 4B3CA 5CB6A 4K46A 1OSNA 1NN1A 1CF4A 4OBEA 2X2FA 5C4GB 3RC3A 3UK6A 3BGWA 2ZE6A 5CIQA 2O8DA 1OXTA 1R5BA 5EE1A 4Q4HA 3LW8A 2D06A 3PENA 3IKJA 4ZV4A 2V7QD 1ZVQA 3HDTA 2OESA 5TXGA 1FMLA 4ZKDA 2J0QA 1IXSB 3UWKA 1YQTA 4DUGD 3D8BA 5KYKA 4G5GA 1KY3A 1VIYA 4URWR 4EQ6B 4KLZA 5DGXA 2RGGA 2IYUA 4XD7D 1G5RA 3TAHA 1XP8A 2BBTA 1OXUA 2DCUA 1P9WA 3W90A 1OW3B 4EJSA 2GJ8A 2A5GA 4AYTA 5DHFA 3NBXX 2GF0A 1XXHE 1HE1C 4FIDA 1OH6A 5F2EA 2R62A 2IBMA 2QZ4A 3BORA 1VG0B 2R6GA 4D25A 2WWWA 5E3HA 1KOFA 1XU4A 4Q18A 1BMFA 3RVBA 3W8NA 3HYTA 3HJNA 4LDJA 3ZD6A 3THXA 2ERYA 1OFHA 3BERA 4OQMA 3K0CC 5DE3A 4RZXA 2RB4A 4ZDKA 1XTKA 1GNPA 4GOXA 2WIBA 3WMEA 2BBWA 3NHBA 1BYIA 1TEVA 1E4YA 4TYQA 1Z22A 2WKQA 1OFUX 3PITA 5FOTA 1U98A 2VSFA 1E79D 4UXJA 1A82A 2AFHE 4MA4A 1WB9A 4QJ3A 4DLSA 3T1TA 3QJYA 1W4BA 421PA 1G8FA 3CR7A 2V54A 1EFCA 3BFVA 3EC2A 4DSUA 4URXR 1FX0A 4AD8A 5J4KA 1TF5A 1VMAA 4RJLA 4LJ4A 1YKSA 3A1SA 4ESHA 4O2RA 2H5EA 2NO7A 4Q7LA 2EFHB 3MGCA 3FGNA 1KMHB 3B78A 3VMFA 4NMMA 1G8PA 2MMGA 2CHVA 4BFWA 1YZLA 1ZM7A 4M1YA 1G41A 2WM9B 3LAWA 2P3SA 2QG6A 4IXMA 5FUXA 5G41A 3TMKA 4B71A 4PAQA 2BBSA 4PX9A 2QU8A 3GLIA 2CE2X 1OXXK 3HPRA 1H8ED 2H17A 2AK2A 1U2RA 1UF9A 3QXCA 1DBSA 2P0EA 3FKSA 1HA3A 3SZRA 3W6NA 4AYXA 4A82A 1X86B 3NH9A 2WKRA 4BLQA 2HYDA 2ORWA 1XNJA 3ZVLA 5L8VA 2CK3D 4Q4JB 1G18A 2FSGA 2L0XA 2A7QA 3QEOA 521PA 3PJRA 1SHKA 4BUJA 1ZM9A 1R5OA 2X8AA 5CYOA 3SFZA 3ZLJA 4C3ZA 2D3WA 2OLKA 3B60A 2AXPA 2FG5A 3FB4A 1H8HD 1ZU5A 5HZKA 3THWB 2H92A 1NSTA 1FW6A 4MGKR 2J0SA 2CDNA 1CR4A 1P72A 2YHSA 2O8EA 5GJWC 2XNSA 2GBLC 1ONBA 1W46A 1ESNA 1US8B 1M7BA 5EXXA 2YC4C 2R44A 4G01B 2N1BA 3SHWA 1UBEA 1ZCBA 1LNZA 1OFIA 2IF0A 3LA6A 3H1TA 1M6NA 2FPKA 4MITA 4DWJA 1ZD9A 2OT3B 2VTKA 4RVCA 1NJGA 3KJEA 4D0LB 3CH4B 4V0NA 1E32A 1E2FA 4GSYA 4TMZA 1CBUA 2A5FA 3N70A 1NNEA 2JASA 4Z8YA 4XWOA 1MV5A 2FSIA 2D62A 3BD9A 4A0GA 2J0UA 2GTPA 3IO3A 4BFVA 4LPSA 2WWGA 1RW4A 1KI6B 1G7TA 3SYKA 2ORIA 4KBGA 3QPVA 4AC9A 3UG6A 1ZJ6A 4D0NA 4B2PA 3WRYC 4FI3C 3NIBA 1KJZA 4OQFA 1OIXA 1EGAA 1DPFA 5AJVB 1OKKA 5HE8A 2HEIA 4UQOA 2WMNB 3HR8A 1KZ7B 4P33A 3PG5A 1J7KA 2Q3FA 1SKYB 2GNOA 2JJ1D 3LBHA 1F2UA 4GFDA 4HDQB 4EFMA 2XZLA 4JLJA 2HLDD 2GCNA 4V0OA 1E2QA 2ZYWX 4MUAA 2PT7A 3JZMA 4RD2A 3ICQB 4G5SA 4P3YA 4ZCLA 3K70C 2D74A 1W0KA 5JBQA 5SZJA 4WXRA 4YMUA 3I62A 1N5IA 2I3BA 4KO8A 3B1XA 3OAAD 4A1FA 4X8HA 4ZPXA 3U3MA 1EG7A 2W58A 4S2EA 1A1VA 1X8JA 2WJJA 2YZ2A 3B8HA 3OFND 4IW3B 4OQXA 4TYPA 2JLQA 2ZETA 5D3MB 4MDFA 4JLAA 1R2QA 2VF7A 3Q5DA 2MMCA 1IAQA 1S3GA 4BECA 2P5TB 3SC3A 1M7HA 1KSHA 5HZHA 1N6PA 4V0LA 1N0UA 5CLLA 3VHXA 1K6MA 1YRBA 5FL3A 5SZIA 4QBGB 4LJ6A 2BEJA 3NC1C 1JR6A 3RS4A 1JPNA 1Y63A 1YR6A 4Q4JA 2VO1A 2X1VA 1E9BA 4Q21A 2B6HA 2CVFA 2CBZA 3FKSD 4N1AA 4RFVA 4C0HA 4PZLA 4EPWA 4NTZA 1NI3A 3SHFA 1MO3A 1T5IA 1BH2A 2YNMA 3LY5A 1G20E 1ZM3A 2FA9A 2ZSDA 2ZXUA 1F3OA 4BRUA 4OJQA 1U99A 4LBWA 1VTKA 1RPZA 3GFPA 3NVAA 1DO2A 3U6KA 2QA5A 3DKPA 3EWSA 1Z63A 1II9A 3SBEA 2GBLA 4B35A 2GXSA 3GP8A 2GJKA 1E9FA 2WIAA 3VR6A 1L7VC 5JI2E 4Q1BA 3X1ZA 3PUYA 2ZE8A 1SVIA 4OJKA 2R6AA 5GJBA 1M8PA 1YHNA 2FDCA 4YQFA 2RGBA 1QVAA 4OI0A 2IHYA 1KO1A 4NZYA 2IS6A 2FF7A 2OCYC 3QNUA 3SQXA 1TQ4A 4CEHB 5EQTA 1C1YA 5JWHA 1R0XA 4TLBA 3MMPA 2Q9AA 3X1WA 4G5QA 5EUQB 1E2LA 1HE8B 3DZDA 4HDCA 3SOPA 2HYIC 1VHTA 2JLYA 1NY5A 3NKVA 1EK0A 2ZUBA 4RFSB 1DARA 4D4LA 3IHLA 3TLXA 1VCMA 1LFDB 4GP7A 2IEZA 3B1VA 4HSEA 2QBYB 4BEJA 4MKGA 4O2LA 4WW0A 3FTQA 4PHGA 2ZJYA 2ZAMA 4KODA 5CM9C 1WBBA 1W36C 2DYKA 2BMJA 1KI6A 1JR3D 4D81A 2IWRA 4MKIA 3K9HA 2V4ZA 1S3SA 1G4AE 4QBFA 1VCOA 2ZI3A 5L3SB 3NEYA 2V6JA 4OHXA 3VKHA 3DPUA 1UPTA 1DE0A 1HQCA 3U3KA 4ON9A 3AH8A 1TTTA 2RHMA 3B7GA 4KSBA 3EX7C 1WF3A 2CNWD 4LOAA 4LHYA 4FMCF 2ECKA 4UNRA 1MRNA 3C8UA 4LJAA 4P4SA 5L3QA 3THYA 3SDZA 1YZNA 1DOAA 3B85A 2IF2A 3KX2A 5G53C 4TSFD 5C1BA 2GK6A 5FUVA 1D9ZA 1C4OA 5F98A 3K09C 2GXQA 1N0WA 2P2LA 4F4IA 2ZRPA 4IRUB 3QXSA 4JVSB 1BKDR 3U4QA 5SZKB 4K81B 5B2ZA 3TH5A 4PO9A 4IFBA 5JSZB 2G3YA 3U7HB 3R20A 3CF6R 4FCWA 3TRFA 2IYRA 1IN7A 5B64A 3T5GA 2VP5A 4DDWA 3ZGXA 3GLHE 1EX6A 4PFSA 4DIDA 1ZD1A 4LBVA 4ASUA 4AWXA 4O25A 4UJ5A 3ZVMA 2EWWA 1NKTA 4F91B 4WVFA 2Z4SA 1AK2A 1E2DA 3AVYA 4M1OA 4DLTA 2JLSA 3TUZC 1U9IA 4HB0A 2GDJA 4KFSA 1OH7A 3M4YA 4JL8A 1HT1E 3ZJYA 2JIZD 5IT5A 2HJGA 5HE9A 1XJQA 1VECA 4U02A 2WTUA 2OBMA 3FKQA 3OZXA 1XD2B 4C0AC 1RFLA 4CEIA 2DFKB 3WNCA 1W5SA 3OE7D 4C2TA 2QT1A 2CJWB 3NG1A 2AKAB 4Q4AA 4XH9B 1GP2A 3KKMA 1V5WA 5JFGA 4CVNA 2G1JA 3KTAB 3CWQA 2GEVA 1GKUB 3O8BA 4PZYA 3C16C 3WMFA 3MWLA 4C4PA 1XTRA 4DT1B 4EPXA 3GLFE 1R7RA 4IEIA 2XOKD 1YRAA 2G83A 3QG1A 4V0ME 1IJEA 1T3SA 1OYYA 3ETLA 3AKDA 2QQ0A 4PC6A 4QBHA 4F92B 3O8CA 3HPQA 4RD0A 4A8JB 4JT2A 1E2JA 1VG1A 3TK1A 3A1TA 1NLFA 4C0BA 3RRMA 5KNCA 4PC1A 4GP6A 2CCJA 2GEUA 2IYTA 4IVRA 3AUXA 1Z0FA 3NXSA 5JWOA 3UMRA 4W5JA 1ZM4A 4GOKA 3BOSA 1OH5A 3BH0A 1E9DA 3H0KA 3QXXA 4W5HA 4WZ6A 3C41J 1VG9B 2FU5C 3PUXA 4NYIR 2J0VA 4XTCS 2VF8A 5J47A 2J46A 4NCJA 2NPFA 3QKTA 2FSFA 4TL6A 1G4UR 3F0TA 3ECCA 1KI2A 3ZIAA 2RCNA 2P6RA 3GJ3A 3RS2A 2E87A 4B44A 1Q1EA 3SEAA 4AI6A 1LB1B 2V55B 4JSTA 5JLJA 4NCHA 1KYIA 2B92A 2QMHA 3CB4A 3DKVA 3AVWA 3ASZA 4PANA 4XWKA 1CRPA 4US2R 3RSOA 2A2ZA 4DCSA 1RRGA 1K8RA 5SZHB 1P5ZB 3W5JA 3K0AB 2BWJA 3W3AA 4Z1MA 5K8TA 4W9MC 3L2OB 2NQ2C 1JPJA 1ZM2A 2LWIA 4J0QA 2IC5A 4LYJA 1LS1A 3KB2A 1IXZA 2CHGA 2QTFA 4B3FX 3GPLA 1NVUQ 3L8YA 1RJ9A 3U3RA 4C0QC 2BJVA 4NDZA 4Q1DA 3W9YA 2XZOA 4XTRA 2ZJBA 4NCKA 1QHNA 1RZ3A 4PSVA 2ERXA 1IJFA 3DL0A 5CYPA 3EZ2A 1NG9A 3FMPB 1HV8A 3TSZA 2QPOA 3FMFA 2XSZA 1SKQA 4FINA 2ZM5A 4QFMA 2H8KA 1I2MA 2YOHA 2C9OA 2EYUA 2IYLD 4GPTA 1DELA 1LS6A 4JLKA 1XRJA 2QAGC 1JJVA 3O47A 3PIRA 4JJZA 1T3LA 4XVUA 4UKDA 1IHUA 1DAFA 5FBWB 2B7BA 1E1QA 3B6EA 4ASUD 3G5UA 4L8GA 2QE7A 4YMWA 5AUPB 5TMPA 1HURA 3OIYA 2W6JA 1EWQA 2OXRA 1COWD 5FTKA 2RGAA 5G40A 3VFDA 4HUTA 2FWRA 5DI3B 4URVR 1ZNXA 1Z6XA 4MH0R 3REGA 2VQSA 1YZQA 1U8AA 4QNRA 4BZQA 1II8A 3MFYA 4LCBA 2A78A 2ZU6A 4EKDA 2XB4A 1EFHA 1SXJE 2BBOA 3DM5A 4PQRA 4DRZA 4M21A 3QKSA 3AVPA 2V7QA 4M1WA 3AVOA 4NBSA 2X77A 1GRRA 3LX8A 1GKYA 4OHWA 4F4JA 2WBLC 1PLKA 4QM7A 2O8DB 2CVHA 4NCNA 4CT4B 3SJAA 4DUGA 3RYTC 1J8YF 2QM7A 4Q4HB 1KK0A 1ZBDA 2ANCA 4LJ7A 3ZD7A 1J70A 2H1LA 4JBXA 5KDDA 4AG5A 2IS4A 4XD7A 2YWFA 4IVQA 4U00A 2VP0A 2GJ9A 2WWHA 1LW7A 1W4RA 2CEAA 4KFUA 2W83A 5TARA 1E2EA 1XCPA 1X8KA 2EVWX 4BGDA 3EA0A 2Q9BA 1XBTA 3IPYA 3QENA 2VYFA 3EIEA 4EJSB 4TYYA 3DDCA 1W36D 1TUIA 3KQKA 3WNBA 4RZ2A 2EFDB 1A7JA 1GSIA 5DNYB 3BK7A 5FTNA 5FI1B 3LVRE 3CWZA 3DO6A 1NMZA 5IDVA 4RSGA 2AX4A 4HLDA 2OO7A 2F1IA 2ZRGA 3THXB 3VNVA 3K0EA 1E79A 2N46A 4RZUA 3AUYA 3FVQA 3ZIAD 2GAOA 4MKFA 4AG6A 4KFTA 4KJZA 3KFXA 5HCIA 2XTMA 3K0AA 5JJLA 3G82C 3B1ZA 4B76A 4C9BA 4TLDA 2XGJA 4IHQA 5FTMA 2ZVPX 2ZJZA 2KSQA 1Q44A 5CDFE 1FX0B 3FMOB 3P4YA 3U7GA 1EWRA 2F9LA 3NH6A 5FR1A 3K0FA 3LFUA 3D31A 3QBTA 1LTQA 3AVXA 4DZZA 2SHKA 4PR0A 4YONB 4E07A 3KJHA 4Z54A 5H70A 1Z0JA 4GI7A 4IJMA 4FMDB 1TF2A 1H8EA 4F93B 1CEEA 2GKSA 2RMKA 1Z0KA 4KVGA 3EPKA 4DDTA 2ZITA 3D3QA 1Q1BA 1AM4D 3P27A 3QIAA 3I5YA 1QHYA 4V03A 5A4JA 3I3SR 3FPAA 1E0JA 5DI9A 4LI0A 2CK3A 1MKYA 1L2TA 1TNDA 4C30A 4A0FA 4DBLC 2RHDA 2IS2A 3AM1A 1I4LD 4CDGA 1QHSA 1DEKA 2VP4A 3SJCA 3ZQJA 1IN8A 3KQLA 2UKDA 1GL7A 2F1HA 3NHAA 4GOJA 2FEMA 1MO5A 4IOJA 4RKEA 1RKBA 3C15C 4I1SA 4DLVA 2OAQ1 5DN6D 4JJKA 4HB2A 2QE7D 1KI4A 3MAAC 2P65A 1Z2CA 4M4SA 1LVGA 2C9CA 4OK5A 2ZYTX 1H8HA 1Z6AA 3TQFA 2W00A 1CJVC 1FPMA 3SE0A 4QGGA 5B57C 4LV8B 1R5NA 4QRHA 2OCBA 2ZJ8A 4IVPA 3R7WA 2QGNA 1XEWY 4B74A 1UDWA 3A4NA 1KY2A 1DAMA 4QJ4A 1VPLA 2F3TA 2G6BA 2UZIR 1U8YA 4LYHA 4KSCA 2WJYA 2ZI9A 4CEJA 4BE7B 3OF5A 1P2TA 2O0HA 1B0UA 1JI0A 2Q21A 3Q7PA 5UKDA 2O8EB 1E6CA 4MKHA 2IYVA 2KI5A 1XCGB 2BVNA 3R9WA 2XEXA 4GDFA 1JXMA 1ZCAA 3CX7A 1XDBA 4QG7A 2R9VA 2PZFA 2YINC 1SXJC 3TE6A 3OESA 1DAGA 1XEFA 1CU1A 1KZGB 2VP2A 5AJZA 4AY2A 1R0ZA 4TMVA 5B30A 2F3RA 4Q19A 4D6PA 5BW8A 4B3GA 2QRZA 2QPAA 3CIOA 2PZEA 2Q6TA 1ZMXA 4LC0A 5FBLB 4RKFA 4HI0E 1Z07A 3LWNA 4LK2A 1P62B 2IS1A 3ZS8A 4B3BA 1OB5A 3WMGA 4DLZA 2J0UB 3LRPA 2PT5A 1OYWA 2IXGA 3EW9A 5FOWA 2IT1A 4PC7A 1KHTA 4PZZA 3OHMA 3Q3JB 2JJ1A 3LBIA 3RAPR 2HLDA 4LYFA 3D6TB 1UDXA 1E99A 4JYBA 1P9RA 4KXFB 5FUWA 2W2XA 3IUYA 3BRWD 2PJRA 1I4DD 4B33A 4KVAA 3RLFA 1JBKA 2W0SA 1Z6TA 4MRNA 1SKYE 2F6RA 3AEZA 1QRAA 4U5XA 1D2NA 1F2UB 1Z0AA 3EAQA 3NC0C 5EZ6B 4YXWD 4X8LA 2ZRFA 4CGZA 2C98A 4TTRA 4JVLA 2DHRA 3OAAA 4GRAA 2HCBA 1GL6A 2JLZA 2FGKA 1QDEA 4UXHA 4QL3A 2JLWA 2WPDD 3LNCA 1OB2A 3OFNA 4A2WA 3CX6A 1A5TA 4GZMA 5F9FA 1YR7A 3FYHA 1PUJA 1SULA 1OLOA 4QKQA 2CL7X 2QAJA 1N5LA 2EFCB 4I81A 4GT1A 3T1VA 4D0GA 1YR8A 1E9CA 4DLRA 1FUUA 2YVUA 2YWEA 2VHCA 1GFIA 4ACBA 1T6NA 1TAGA 2YWHA 2F1JA 1NVWQ 2QSYA 4ERNA 3LV8A 1QHGA 3DOEA 3U7FB 2D4HA 2EW1A 3CZPA 1E2PA 2QY9A 1SVOA 3AGPA 4EFLA 1EESA 3CPEA 3GJ5A 3GJXC 2G0NA 2IYXA 3FDIA 2ODNA 1W0JD 3UATA 5FTLA 1X1RA 3BBPA 3CM0A 4XWAA 4BFYA 4HAZA 1U8ZA 4HAXA 3WHLA 3RS0A 4PHHA 5ELXA 4LHVA 2ZI7A 2BC9A 4B3DA 3L8ZA 4DEXA 4UXIA 3W6PA 2HXYA 1RRPA 1S4QA 2ZU0C 1FNMA 2NIPA 2JLUA 1D2MA 3K53A 4Q9JA 2ZE5A 1RYHA 4N0DA 5EE9A 4NYIQ 3KUDA 4JLOA 3IBGA 1ETUA 2ODWA 2ZUCA 3AKCA 4ACAA 3UPUA 2WOOA 4B47A 1Z2AA 5BYKA 2IYYA 3C7KA 4LX0A 3KKPA 3GJ0A 3GLGA 2FFBA 2RAPA 4JKYA 4AURA 2D2FA 4DVGA 2BIFA 1KK1A 5G3YA 4Q7MB 1VYTA 1A2BA 4BFUA 1AQUA 2F1RA 3K0CA 3R8CA 3DEFA 4I1UA 2P6UA 1JR3A 3JVUA 4XVRA 2ZJAA 3UKDA 4X8MA 2UVQA 1M7GA 4D82A 4ZDIA 3H86A 2IXEA 3K9GA 3PR1A 2CMKA 1QZXA 2R65A 1EFRD 4QNMA 3O8RA 2CNWA 3MUFA 1XJCA 4MYTA 4A0RA 1IXRC 3MLEA 1AS3A 3JVVA 4LBYA 2IYWA 5FOSA 2OE2A 4BPBA 4LV6A 3W6OA 3H84A 3BB3A 4QOSA 1ZIPA 4TSFA 5BWMA 4LGMA 2Q0HA 4Q02A 1GKIA 1CRQA 1W49A 3K70B 4TT3D 4K8OA 4TYWA 4P4SB 1F48A 5L3QB 4F4CA 3THYB 1GRQA 2BMFA 1Q1QA 4TZ6A 5CK5A 2FFAA 1TU4A 5CB8A 3NBZC 4PPGA 5J4YA 3BS4A 4LJYA 3TGPA 1XD9A 4LV5B 2C99A 2QN6A 3THOA 1ZUHA 2F43A 1Z06A 2FFQA 1D9XA 1E1RD 1W2HA 4JYCA 4XJXA 4MGYR 4Q7KA 3U4QB 3BIFA 2FSHA 4C7OA 1NBME 2O8FA 3TSWA 1KJWA 1UKZA 3LDAA 3ZDQA 3A1VA 4Q7JB 2JA1A 2O8BB 2QP3A 4ARZA 2AWOA 4ZO4A 4A6XA 3C5CA 4RD3A 1W44A 4WXPA 4E09A 3KFVA 3A6PC 4II7A 3TIFA 5FBRB 4OK6A 3I92A 3ZZTA 4M9XA 1Q57A 3PEYA 4JL6A 2JIZA 5FTJA 1IOZA 5H8WA 1VG8A 1QVRA 3PEUA 1Z08A 1KKLA 1ZP6A 1OXSC 1YZUA 2FMXA 4G5OA 3ICEA 3CO5A 3ZVRA 3OE7A 4P4UA 1EFUA 1OHHD 2IEYA 2VHQA 4JMPA 4JIMA 5KNBA 1KJYA 1WP9A 3HU3A 5JI3E 3L0PA 1OFTA 2ZJ5A 3BH7A 4OHZA 1M34E 2HV8A 2ZR7A 4LHZA 2ZE7A 1F5NA 5BYJA 5EXSA 4KHZA 5DHAA 1E9SA 4DLYA 4CEIB 4WA7A 2XOKA 1TQ6A 3B5JA 3A4LA 1N6HA 3DOFA 3FHCB 3IIJA 4HLUC 4Q4AB 3J81k 2EYQA 2LKCA 2ODEA 4AYWA 1KI9A 1HH4A 2FPLA 2QI9C 1G3MA 1FTNA 2BM1A 4NE2A 4I99A 1TF7A 2Z0MA 1G3UA 1Q3TA 1TADA 4GL2A 2O8CA 1S8FA 2OZEA 1OT3A 4JZKA 1SXJD 5BQ5A 2ZS8A 4CF7A 3DMDA 5M04A 3TSOA 3Q72A 4NH0A 1UJ2A 3E5HA 3MJHA 4WZAE 2BHRA 2IUTA 3NBFA 4IDNA 2VP6A 1XTSA 2PX0A 2XAUA 2BJWA 3QG5A 1W5TA 5FH9A 2GZHA 4RD6A 2WV9A 5E95A 2NO9A 2O52A 5AJWA 2J87A 5HKKA 1L4UA 1MT0A 3OEED 1FQKA 2ATXA 1W47A 2CE7A 4TMTA 3RDPA 3RRYA 3KZ1E 1MOZA 4GMDA 1T0HB 4WBSA 3SU8A 1XXHA 5JJIA 4V0KA 4JS0A 3EIHA 2K5UA 1ZNWA 4XSHA 2ONJA 3QSYA 1E69A 3LQRA 1UKYA 3AF3A 3WBKA 4PPQA 1GNRA 3SBDA 4M8NE 5E7MA 4BASA 1HTWA 4IOMA 3CUEF 3VR2A 3KQUA 3GEIA 1D8TA 2WHXA 3RWOA 1N6LA 2W6ID 3PUVA 4LPKA 1HYQA 4LSGA 3TR0A 5C18A 4C0LA 3B82A 3AP3A 3QBVA 2JATA 5EXPA 5EZ5A 2Z43A 3U6BA 2HT6A 1GIAA 3U7EB 2VEDA 5JECA 3AVTA 4Y0AA 4KITB 3W5IA 1RJ9B 4Z8XA 2JJ2D 4IDQA 3CRQA 3IDQA 1CXZA 4G5RA 4Q66C 3BAFA 2OCAA 5A0FA 2LCFA 2VIIA 3IILA 2AKYA 2O8BA 3HWSA 4GBMA 5AJXA 3AVVA 3RRZA 1VDZA 1J8MF 1E9AA 1NY6A 2CCGA 2OFXA 4Q47A 3R8FA 4Q03A 2D2EA 3AVUA 3CNLA 5FOXA 1GOTA 3TKLA 2PZGA 4M1KA 2WVJA 3OIUA 2BKEA 1COWA 1G8YA 1XB2A 1FP6A 3Q8XB 4PHTA 5FBQB 3DZ8A 1ZD8A 3TUJC 3RABA 4PSAA 2REXB 4A36A 2D7DA 1CR1A 3QUSA 1T8UA 2JLVA 1SVLA 4R9UC 3HU2A 4PPFA 4YMTA 5EE3A 5L3RA 4HLUA 1AIPA 1CULC 2OUKA 1IN5A 3X2SA 5AWFC 2VHJA 1KAOA 5CK4A 1JB1A 1II8B 1MABA 3ADKA 3N2IA 3P1JA 3WY9A 3VU9B 3T15A 2FX3A 5F9HA 1RRFA 2ZYVX 1Q12A 2JJ8A 3B13B 3GCGA 3OEHD 4TLAA 2ZANA 3QKSB 4IOLA 1NVXQ 4IXNA 3OIVA 2FPMA 3A58B 3U3JA 4G0NA 1S0UA 5EXTA 1KI1A 4JBWA 1J99A 1VCNA 4MGIR 1KI7A 1MH1A 5JEEA 1UFQA 5CJPA 3SS8A 3U60B 2MSCB 1V43A 4R98A 1TEXA 1K5DA 4I4LA 2QMUA 5DLQC 2ZAOA 4IDOA 4WZBE 5DISB 3VX3A 4OYHA 4DCUA 2B7CA 2REOA 3K8YA 3LQQA 1XD8A 2WJIA 3SYNA 2DFLA 2J7PD 2TMKA 3SJBA 4BQSA 4EFNA 3U2QA 2J45A 4Q1AA 4KI0A 4TYNA 2C2HA 3GJ8A 4JVMA 3SQWA 4DSOA 1WQ1R 2C77A 1PLLA 2QL6A 4XSGA 1IONA 1JALA 2V9PA 2PJZA 2VSXA 3HR7A 4QC2A 4Q9KA 4AIIA 4PO8A 1NIJA 2YC2C 1RVDA 2A5YB 3K9NA 2AWNA 2VA8A 4P31A 5HKKD 4QGAA 4L15A 1J2JA 4A8JC 2A3RA 4GNKA 4M0LA 1P73A 1XMVA 3L0SA 3K09A 2Q3HA 3BB1A 3W3ZB 2KJQA 1YZKA 1KO5A 2BKUA 1N0VC 1OPXA 1RE0A 5DH9A 4TL7A 5KSZA 1II0A 4MGZR 1U81A 4Q1FA 2MSEB 2FJUA 3U3OA 3B2EA 4HYYA 2OBNA 3B1YA 2VRWA 4M53A 4C0KA 1OF1A 1T0JB 1FZQA 3K0FB 3EPJA 2WJGA 3P26A 4NYJR 5FPHA 3TW4A 4TQUS 2BMDA 1ZC3A 4ESVA 3TBKA 1KI8A 2QQEA 5AUNB 4DB2A 2LKDA 3PFIA 2GILA 3Q5EA 2BEKA 4F7WA 4HEJA 3ND9A 2ODBA 2H18A 2EWVA 2WJVA 1TU3A 3GLIE 4AKHA 1QHXA 1E2HA 4HAWA 1RIFA 1G5TA 1RYFA 2OLJA 5J4HA 2QT0A 1ZIOA 5DN6A 5JHHB 4DDVA 4DKXA 2VPPA 5KDLA 1YZTA 3KUCA 5FPKA 4FCTA 2GCOA 2I1QA 1G8GA 5JS7A 2ZROA 3B9QA 4DXAA 4IOKA 3GLHB 4QHYA 2QUZA 1C9KA 2ZREA 1YVDA 2Z83A 2ZR0A 4HUQA 5C46F 4A15A 4OK3A 4MRPA 2YWGA 3IBYA 3BJIC 3IQWA 4LRWA 1G17A 1ELOA 1FOEB 4M9QA 3R7WB 2H57A 5JRJA 3GEEA 2YOFA 1E2IA 1KDPA 2PEYA 4Q1CA 4BLTA 3U44A 1TQ2A 2NO1A 2F7SA 1TMKA 4DLUA 4CEJB 4EUNA 4DLXA 1IBRA 4UJ3A 5BN4A 3GFTA 2ASEA 2CLCX 1DG3A 2F9MA 1ZNZA 3EASA 3WYFA 4RCYA 5CM8B 1WBDA 4A4DA 4B43A 2GWHA 2ZRLA 2PLRA 5D3QA 2NGRA 3AF2A 3IO5A 3M0EA 1CTQA 1XEXA 1YJ5A 4QHTA 2PH1A 3AP1A 3GJ6A 2XNDD 3CRRA 3KKOA 1G21E 4B75A 1JAIA 2ONKA 3GEHA 1MO6A 2YYZA 4BRWA 5BN3A 3S1AA 4EPTA 1W7AA 1WXQA 1HUQA 2J9RA 3GMTA 1Y3AA 3T61A 5KOYA 5EE0A 3KQHA 5E4FA 2QNRA 2OG2A 2NO0A 3QF4A 4S35A 1XPOA 1XMIA 1GNQA 4W5WA 3VNUA 2QRNA 2C03A 2V1XA 4PAMA 1CKEA 1T5LA 4TLEA 2RKOA 2XB2A 3EZFA 3F5FA 2ZJOA 1Q1ZA 4ZKEA 1ZNYA 3X1DA 3KB1A 1KAGA 3LW7A 4ZDWA 3A1UA 1YR9A 5TDHA 3E1SA 2C8VA 4YXWA 1S96A 5KPJA 1E0KA 4A2QA 1BOFA 1XF9A 5H68A 2E9SA 2QORA 1ZYUA 4E5UA 2WOJA 3NDPA 1JEEA 4BFZA 3L0OA 2WPDA 4PAOA 4NONA 4KFRA 3QEJA 5EP3A 1KK2A 4I1VA 4H1VA 3BFXA 1N5KA 2CLSA 2J5XA 1Z8FA 3VR1A 2QAGA 1ZC4A 4W7SA 3DHWC 3KXKA 3VU9A 1JQLB 1P3JA 4EPRA 1E3MA 2C04A 1Q20A 4LC1A 4YDSA 2FEOA 1EX7A 3I61A 1E9RA 2WKPA 1CLUA 3TVTA 3UXMA 3AGQA 4C2UA 4FMDF 4Q48A 4XOIA 4TZ0A 2FE4A 1IY1A 2QM8A 2VH5R 4KBFA 4Q9LA 2HJVA 1XFAA 2BM0A 4QJ5A 2OAP1 5KHOC 2DR3A 1AS0A 1GTVA 3CPJB 1E4VA 1W0JA 2CL0X 3C14C 4TMXA 2NO6A 4M1MA 1XZQA 1AKEA 1T4GA 2GAAA 3GLHA 3PEVA 1NBMD 3QKRA 4M1TA 3U5ZB 2WWXA 3ZS9A 2ZI5A 3BWDD 1A2KC 1DTSA 1GZSA 1SHZA 2OFWA 2VL7A 1S1CA 3KKQA 4EPYA 1XTIA 2ZR9A 4MQBA 1JAHA 4JLDA 1KMQA 4LHXA 4QXAA 4TL9A 5LD2C 2WSSD 5CITA 3UANA 4JKIA 4NPHA 2QSZA 2ZRNA 4JLVA 1NKSA 2ORVA 1FP7A 1SVMA 3RRNA 1NVVQ 3CONA 4B2LA 1Q3HA 4A6PA 121PA 5JJKA 4LHWA 4G3XA 3TJZA 1UM8A 2VLIA 4PQFA 4UNPA 3ZZ0A 2IK8A 1PZNA 5AUOB 4R71A 1G6HA 2A9KA 1FMJA 3TUIC 3A8TA 2H16A 2WWFA 1T9HA 3GD7A 3GLFA 2GA8A 2O0JA 4A0HA 3EPLA 4OI2A 4URYR 3PV0A 3I8SA 2BCGY 3UMSA 1XPUA 3PUZA 1P60A 4V0MA 4ZCIA 3GLGB 5F3WB 4BFSA 1KSFX 1G5PA 2BCJQ 4FD2A 3R9IA 1UKEA 4TQ9A 1SZPA 2RGEA 1P2VA 5EP1A 2DFNA 2ZRDA 4JT4A 5BN5A 2QMEA 1KNXA 3CZQA 1KTVA 1CJKC 3HP1A 1UBCA 1EFRA 1U90A 4JBYA 2O5VA 1PJRA 2HDNB 3LH5A 1G291 3QVUA 2P5SA 5C2JB 1T3HA 5KNDA 2REBA 2X2EA 4OQNA 2FN4A 2OCPA 3T35A 3O8DA 4UNNA 1G64A 1U94A 4LJ5A 1M2OB 1SVKA 1VIAA 1JXOA 3V00A 4E03A 1W48A 1GVNB 2ZS9A 1VCIA 4DC9A 1YE8A 4TT3A 5IF9A 4OL0A 3FFBA 1RRCA 3SYLA 4Z51A 1W1WA 3T06B 1EFTA 4I1OA 1X6VA 1N3BA 5FPTA 1NF3A 4LYAA 4GMXA 1GILA 2QTHA 5FFMA 1KSGA 1OIWA 1LF0A 1E1RA 1DAKA 2GJSA 2FOLA 4KYIB 5DYIA 2DBYA 1WMSA 2BV3A 2RGCA 4DIEA 2OM2A 2GXAA 1OIVA 5HR5A 5JCPA 2ZSFA 3MD0A 2EFEB 5LBIA 3ADCA 2RGDA 2F43B 4PQYA 3AQ4A 2R6FA 1CS4C 4G1UC 2W0MA 4C7OB 1S9DA 1S2MA 1WDTA 2C78A 4B32A 2O8FB 1Z6YA 5TVKA 1Z3IX 3E2IA 1N6NA 4O0MA 2R6DA 4LWZA 4D4JA 2GHIA 3QXJA 4POAA 4PTLA 4ARZB 3AB3A 3I5XA 3CBQA 4B3XA 1UKVY 2DWPA 2A30A 2G9NA 2CCKA 3ZQ6A 2GJAA 2OEPA 4C0JA 1W4CA 3VAAA 1OHHA 4DJTA 4YMSA 3KQNA 1N25A 4HZUA 2XXAA 2ZRHA 1CJUC 2B21A 3K9LA 3EPHA 4LJ8A 3TW8B 1NLZA 3WBJA 1AS2A 2ZYUX 2J3EA 2PMDA 2ZQ5A 4NL4H 5GJVC 3EG5A 3DVLA 4JVNA 1KK3A 1X3SA 1P2SA 1ZUIA 3RS3A 3RSLA 2WMOB 3CKLA 3CR8A 3K0SA 1BIFA 3Q85A 2WWYA 3QE0A 2C9YA 5KSYA 3T34A 4BFTA 2GZAA 1R6BX 3TVDA 1Q21A 2DWQA 1FL9A 3CF2A 1I2DA 4YDHB 5AUQA 2XITA 3QKUA 1SXJA 3IEVA 1BS1A 2A5JA 4DCVA 1PV4A 1N2CE 3R9XA 3AKYA 3MSXA 1LV7A 4HATA 4F38A 2IX3A 4ZDJA 5J4VA 2NPIA 4XVQA 3AF0A 1HEIA 3VQTA 3ZZUA 2O8CB 2P6NA 2FV8A 3W34A 5E7JA 3GJ7A 2B8TA 3N2EA 5E7IA 3KKNA 1N6OA 2D7CA 3GJ4A 2FFHA 2PEZA 3MWYW 4E22A 1A4RA 2HF8A 4B48A 3OEEA 1OH8A 1IQPA 4CIDA 2ZIAA 3Q9LA 3Q7QA 1ANKA 3MRSA 1AGRA 2A5DA 1Z0IA 3CF0A 1IY2A 4EQ6A 2DWOA 1VHLA 1E2NA 4NCIA 4YLGA 1MO4A 3VKGA 1XMSA 1AKYA 1D5CA 4C0SA 2RGNC 1E98A 3A37A 4X8OA 1JQJC 1T8TA 2ZI6A 1GL9B 4Q4LA 1G9XA 1KO4A 1QHHB 1R8QA 2VSOA 1XXHB 3RANA 4DCTA 4A92A 5JMTA 3MCAA 2CHQA 4DSNA 2G88A 2XTZA 2W6IA 5TY0A 4DHEA 4NHOA 2KBFA 2AHOA 1SVWA 2R2AA 2OHFA 1XPRA 4B2IA 3AF4A 3KJGA 1AJEA 1U0HC 1W2GA 4R2IA 2DB3A 4NYJQ 4IDHA 2ZRJA 5KDOA 2N42A 1P2UA 1BMFD 2JJ2A 721PA 1MR3F 4DLWA 5EP2A 3C5HA 2OSBA 1ZW6A 3SFVA 1L8QA 2J59A 4FWTA 1AZSC 3A36A 5KO2A 2WJHA 3B1WA 5KTYA 1G1MA 4P0TA 1KI3A 4ZI3A 1JJ7A 1QG2A 5B58C 4NYMQ 3NDBB 3EWAA 2ZVQX 4ITRC 2DFTA 2ATVA 3EZ7A 5CDFA 3RS5A 4EDHA 1QF9A 1E0SA 3PXGA 3U61B 5AJYA 1UBGA 4H9GA 8OHMA 3A4MA 2O0KA 1G16A 1KMHA 4B34A 1Q0UA 1UBFA 5JZVA 1GUAA 1NRJB 2XTNA 2NG1A 3L0IB 1RC8A 4MRRA 1GWNA 3X1YA 1QBKC 1WE2A 4M2LA 2HT1A 3CNOA 4TTQA 2PX3A 2GXUA 2IL1A 5CIWA 2XJ4A 4L9SA 3BFKA 5FOVA 4WOPA 2IYZA 3LO5A 3RNLA 5JEDA 1CP2A 4MYHA 3WRXC 4IEEA 4ZI2A 4KU4A 1KO7A 3REFA 3OEHA 4RD4A 4NP6A 3ZYCA 5K8UA 4PHFA 1E96A 4MYCA 1P7CA 1MABB 5LB2A 2PMKA 4RZ3A 4OHYA 1IN4A 2J41A 4QHSA 3V4RA 2ZRAA 5DSZA 5KPDA 2KB0A 1AA9A 4KV9A 3FE2A 5AK0A 2DY1A 4ZIRB 3ADDA 2XJ9A 4TN1A 2AXNA 3TAUA 2P67A 4HAUA 4MDEA 3V4FA 2R8RA 4CYMA 1PVOA 1X8LA 3QPUA 4M1SA 1G3QA 2AD1A 4TL8A 1XJ0A 1U9IC 2J7PA 2QTVB 2JGNA 3NWJA 3RHFA 4EIWA 1R8SA 2JEOA 3THWA 1IM2A 1G8HA 2MSDB 3EZ9A 3F3YA 3G0HA 3SNHA 1NVVR 3AV0B 4JLNA 4PXAA 1W36B 3CH5A 2PL3A 1KDOA 1G7RA 1US8A 2RGNA 4L4UA 4TTPA 2V3CC 3LLUA 5EE5B 1DAHA 1VYVA 1TL7C 1ESMA 2PLFA 3PVSA 3FHTA 2EFGA 1GM5A 3B9PA 4MRSA 1E2KA 3AVQA 2J7KA 5KSOA 3UG7A 1EXMA 1JNYA 1SVSA 3CX8A 4YC7A 1AZTA 3N5CA 4P32A 5FBVB 4M9SA 4BWYA 2GETA 4QM6A 1N6KA 1KIMA 2OXCA 3QOFA 1NSFA 1QHHA 5IK2A 2G1KA 3T5DA 4UNQA 4FMBB 2AN9A 2WAYA 5GVSA 2XX3A 1E2GA 2ZRCA 1FUKA 1CR2A 4Y0VA 1HY3A 4D80A 3KL4A 3WYAA 5HPYB 1S1MA 1X1SA 1Z47A 2XZPA 4MYUA 3P32A 1DVRA 4Q5IA 2JAQA 1DO0A 2QEQA 4B6EA 2OBLA 3ZVNA 3P20A 2ZSAA 4IKEA 3F8TA 5P21A 5FL7A 1DS6A 2NZJA 3V9PA 2GEDA 2IUSA 4FMCB 3IIKA 1VKJA 1ZAKA 1NN5A 4B73A 4NKRA 1L4YA 1WA5A 1XX6A 3VR4A 3WP1B 1UADA 2RH5A 1WCV1 2C96A 2IUUA 2E1RA 3KXLA 4OI1A 4BLRA 2GZDA 4AK9A 2V6IA 2VP9A 5FOUA 4BLOA 1GITA 1R10A 2AK3A 1IY0A 3EIQA 3NBYC 2ZSBA 3VTKA 821PA 1OKKD 5J40A 1AQYA 4Q00A 5TB5A 2F55A 2VHTA 4DDUA 1SGWA 3WYGA 4HB4A 4AKGA 4U7DA 3AF1A 1ZU4A 1KDTA 3VHLB 4FW9A 4TMWA 1XTQA 3FWYA 3EC1A 1D2EA 2CL6X 2QP4A 2JCSA 5KSPA 2FGJA 3IPXA 2WWIA 3I32A 1DAEA 3PUWA 5HTKA 1W0KD 4LY6A 5IHPA 2WSMA 3FFAA 2GCOB 5D3MA 1G7CA 1NG1A 2YOGA 4KLNA 1O87A 5KUTA 1NN0A 1R0WA 2EU8A 1E2MA 4PSKA 5JCZA 3MG9A 2ZRBA 4HAVA 4CW7A 4FWIB 1NJFA 1DG1G 1XTJA 5K8LA 3DM9B 1FNNA 4BZPA 1GAJA 3EARA 3L82B 4HUQB 4ZIRA 1CJTC 3LLMA 1IN6A 2YKGA 3EXAA 3ND8A 4A2PA 5A5GA 1GG2A 2V1UA 3PQCA 4R7ZA 5J4LA 4L5BA 1NN3A 5JS8A 1P4SA 1OV4A 3CRVA 3LXRA 5L3VA 3QI2A 4ZCMA 3U44B 3FMIA 2AD5A 2ZRMA 3QXHA 3IIMA 3MWKA 4OKSA 1E0AA 3TR5A 3M6AA 3UWOA 1K5GA 2Y8EA 1GDDA 2AR7A 1E94E 1KNQA 2XNDA 2G77B 1U0LA 4FCVA 2HUPA 4N3NA 2IHBA 2JLXA 3VKWA 2DPXA 1I4TD 4CEHA 1XEXB 1TX4B 2HXSA 2ZS7A 3CW2A 2IXFA 1FQJA 3BE4A 2VHUA 3KJIA 4Q9IA 1VYUA 5IRCD 1TUEA 3M1IA 4OHVA 1AGPA 2JDIA 3SI7A 3D7MA 3L43A 3S1AB 2QGZA 4RFSA 1NMXA 1N6RA 2C95A 5EJEA 3CNNA 2IYSA 3C4JA 3P4XA 3QF4B 1OE0A 2GK7A 2QBYA 4Q1EA 3TNFA 1ODFA 5IK2D 3ADBA 2IWHA 3CRMA 2ZTSA 2PCJA 3LBNA 2YV5A 2WAXA 5JWRA 2B8WA 2QMOA 3IQXA 3QPWA 1F60A 4MRVA 5LB4A 5ANRB 4PC3A 3W8RA 5L3SA 3WXMA 4GZLA 3VR3A 2IA5A 5FR2A 4R2HA 2I4IA 5FUYA 2EQBA 1DADA 3JZAA 4IDPA 5FL7D 3QVVA 4QGHA 5C4MA 5JRZA 4EAQA 5FPYA 1FTSA 1G3IA 1W4AA 2NTYC 2AFIE 2GRJA 2WZQA 3I4LA 2QAGB 4L9WA 4WIAA 3T1QA 1Z0DA 2AL7A 2BOVA 2IYQA 1CJMA 4CZ2A
chains in the Genus database with same CATH superfamily
2AUNA 4FUQA 4DN6A 1OJLA 2V8OA 5HS4A 4O3MA 2J85A 2QP9X 2GPSA 1ID1A 3IP1A 3ESRA 5DM1A 3X1XA 3ER9A 4KQKA 1CERA 5CH5A 4S1PA 1Q7TA 5E6UB 1JKXA 3RWMB 2YXBA 5J5AA 2L42A 3NBUA 4KCGA 3UIEA 4UOQA 1PUIA 2QENA 4EGFA 3TQHA 4NYMR 3EYAA 4KWIA 4N6GA 2PUEA 2AOUB 3PEWA 3HK2A 5K45A 4Y2GA 3QQ5A 3ZU6A 1RKXA 3Q2IA 3GN2A 1RYMA 4RTKA 4I3FA 3GDWA 2FNAA 3O38A 4YAWA 2FH5B 3FLEA 3HJRA 1OVMA 2REQB 3LXXA 5KYUA 5D00A 3MTDA 1H2RS 3JQBC 3B38A 4HDOB 1VJGA 4JT9A 4RVNA 3SDBA 3PKJA 1EUCA 2XRFA 5AIBA 3QFFA 3TS1A 1AUQA 3JU3A 4KPUB 4XIGS 4CMIB 4M87A 2HSZA 4EHAA 5JOQA 2BFCB 4ND2A 3KQOA 1WOMA 4AU1A 1XNGA 4MB0A 1UK6A 1XZMA 3H2BA 3D1LA 2OC4A 1WVMA 4AWAA 4HRVA 1NLYA 1V8BA 2HWXA 3F9CA 3OLWA 3QHAA 5BWOA 4DEYA 1VE7A 2GN8A 2O7NA 2C9BA 4KXLA 4TWBA 4DCNA 2AR0A 1YMUA 3H5TA 2JGKA 1GZ3A 2HNAA 4GMKA 3TCNA 4N76A 1AGXA 4DJEC 3ZBUA 1TT5A 1V4NA 2I34A 2JGEA 4TWAA 2CJWA 3TDNA 3UW3A 4D4MA 4H0NA 1YZGA 2JI8A 3G8CA 3C4QA 5B3JA 1SBYA 4LTNA 1P39A 5EI5A 4DT1A 2GLXA 4EY6A 2JAOA 3ZU3A 1CD5A 4HDSA 3A1WA 2NMVA 3R09A 2OKCA 1PLJA 4UFOA 5I9SA 2NZYA 4NU0A 4ENPA 2XWJI 3QFHA 4HAYA 3AZPA 2XD9A 3KDSE 3OBBA 2KW5A 2CXSA 4ZOLF 1M1XB 1WUIS 4HGQA 4Q82A 1VIVA 1ZJ4A 3HA7A 4PLTA 2GD2A 2X9GA 2NV6A 2W2TA 1EM8A 2GM9A 2NZ8A 1X3LA 1VHJA 4MX8A 5DX1A 3ZXSA 5JJ5A 3ZDEA 3GZJA 4BP1A 1JR3E 1FYVA 2C0PA 1OXVA 2FPOA 2HY7A 3ES9A 4IINA 4HB3A 4EOGA 1W19A 3OT1B 1A98A 1BZYA 1XEWX 3EEYA 2Z04A 5IBCA 3L4BC 3LHDA 1GCAA 1LC3A 4BN4A 4BZXA 1I3KA 1YVUA 1H66A 3IEUA 3LX5A 1KXJA 3B7PA 2H85A 1PD0A 1PR3A 3LD9A 4FP9A 3PNBA 1DMSA 4IRXA 5AHWA 2B99A 4HP8A 4DM7A 3RC9A 5AVXA 2AW5A 1N5OX 3RTEA 5JSFA 4XEUA 2D1SA 1Z5WA 2X5OA 2X8LA 2HJWA 5FUQA 1BGVA 1FXWA 3HB7A 4MAAA 2UZ3A 1YB5A 5G3ZA 5EQJB 3C3CA 4D3SA 2F8TA 621PA 4EJSC 3FVVA 4TTJA 4W8OA 2FE1A 3GH3A 5ERXA 2EIHA 5KTPA 3OJLA 5J5CA 3E53A 1ZH6A 4B6JA 1S9HA 1W8DA 1LI4A 2ILVA 3AY6A 1M2FA 1RXSA 1ZK3A 3R7SA 2VATA 3DMNA 1V3VA 4AKEA 4X1YA 5IC6A 1BO6A 3OM1A 1P75A 5EG5A 1XQVA 3KTOA 2EV9A 5EMKA 4LZZA 3PNYA 4QO8A 2ZUSA 3ELYA 4AZWA 4KPGA 4FOTA 2R25B 5A4KA 4O4IA 4Y0NA 4RDHA 1B26A 1EFVA 3ILSA 5CB4A 5CT5A 3DEHA 2FQXA 3PGLA 2OYCA 2X1LA 2FKNA 2OBBA 2WYIA 1Q22A 1MX9A 2JFXA 3L02A 4IG4A 4PPNA 1FUEA 4LF5B 2QUKA 1TQDA 1OOEA 3FUXA 4BCBA 1MAAA 4E31A 5K7SA 1AZWA 4S05A 4BYGA 3EUWA 4BIMA 1CUHA 1GV1A 4YT2A 3AP2A 1LY1A 3IAFA 3ZCVA 1IRXA 1G7SA 4DCJA 4YMVA 1CV2A 1L1RA 3A06A 3IAEA 3JQGA 3O9VA 1DT5A 4H1UA 4EZBA 1BCRA 1PNTA 1QG4A 2Z1MA 4NQZA 4R84A 5J58A 1SUPA 1D7OA 1TLFA 3I73A 3V8QA 1EXDA 2Z5FA 4DAOA 3MT0A 5TQ2B 2NU6A 1ZBQA 3PSHA 1LK5A 4BEBA 1JMYA 1SCUB 1UPFA 1XL1A 2AEFA 1XYGA 3BDIA 3GFGA 4K5QA 5KVQA 4Q3CA 4BN5A 3NBQA 3CW9A 1K86A 3V4ZA 2UXCB 4I4IA 4G0ZA 4TLCA 5LD2B 3WFZA 1HYEA 2EXXA 3T12A 1P1CA 3NLLA 1P9NA 1D04A 3NTOA 2J30A 3LG2A 4Q39A 1F2TA 5K3BA 2XLBA 3PFGA 1JLRA 3EQ7A 4XI9A 3IDFA 3JQ9C 1HQYE 5EJMA 3SKXA 3OCJA 4CBVA 1JFSA 4US1R 1CDDA 3O4GA 3FRHA 3K2QA 1DAIA 4MDYA 4LCEA 4BVFA 4C4OA 1SUFA 4DDKA 2A1TR 2OXEA 2B2CA 3FPCA 1E4EA 2RAVA 3RVRA 1J90A 2EHDA 1TKBA 1YKFA 4ZN6A 5NLLA 1UPAA 5HVNA 1CFJA 2DF8A 3P8ZA 1BX3A 4D8VA 1E1QD 3MS2A 1V9CA 3COWA 4CCYA 2QOEA 3QVGB 5JQGB 3BEDA 3JQAA 1N8KA 1QIEA 3BXFA 4QBTA 1P77A 3P2EA 1RP1A 2JZOA 4UNSA 5CLQA 2X19A 3JQFC 3LQ1A 1ZMBA 5FPSA 2LCQA 3SR0A 4OSOA 2R1TB 3RIHA 3U3DA 1F8FA 1OSNA 4NOLA 1QLJA 3UK6A 3UCFA 1WVGA 4O1MA 4DQDA 4ZYVA 2FUG1 4K6HA 5EE1A 4L6AA 3ANNA 2XAAA 3HB1A 4EEZA 4ZV4A 3BBLA 1UJNA 2VHYA 4RGVA 4X92A 2JKZA 2MDTA 1ADCA 3RHZA 1U7DA 3FZGA 3UMCA 3TRKA 3SMQA 1WB4A 2J0QA 3OHPA 4J49A 3RF6A 5LQJA 4DMGA 1YQTA 4I3GA 3OTIA 4K9MA 4M9CA 5ECWA 3G7NA 5H7XA 1IIRA 1M76A 2NXWA 3DDHA 3E3OA 4NRDA 4URWR 3UHFA 2I87A 2JLAA 2RGGA 3H9GA 3LOPA 4R1LA 3SNKA 4DPMA 1NT2A 3KYBA 1QGDA 4YRGA 1M8JA 1X77A 1BHJA 3UY4A 2O50A 1OW3B 2O2CA 4N8SA 1M1ZA 4J4HA 2A5GA 3VV2A 4MZDA 5T8KC 3Q3CA 4D9BA 1H93A 3OEWA 2GBIA 1HE1C 2Y9MB 5TJ9A 5H3HA 3QEBZ 1OH6A 1YQWA 4TVKA 5FUMA 3EVBA 4R0MA 3BORA 4IHKA 5AOAA 2R7MA 4E7PA 2WWWA 3O83A 3E2MA 3U81A 4CUKA 1ARZA 4Q18A 4DBZA 3LOUA 1GTZA 3HJNA 3CTPA 4IH9A 4LDJA 2CXNA 3ZDFA 4QLOA 1OFHA 4B4WA 5JS6A 3THXA 4OQMA 5DE3A 4XDYA 4M0KA 1C2TA 2EFJA 2QJWA 1OZ0A 2PYIA 2RB4A 3N0VA 1GNPA 4MWOA 4ZDKA 7AT1A 3W5DA 4RTMA 1MEOA 3NHBA 3IB6A 3DFMA 1IAVA 2A9VA 3ZE0B 4PTZA 1MC8A 1ADYA 2ZIEA 3LGSA 2VSFA 4Z0TA 4UXJA 3UXHA 5BVGA 3EE6A 1KWKA 1RU3A 2DVMA 2QZ9A 1TT7A 2AG6A 5EJ7A 4U39A 4FDLA 4Q16A 3WWOA 1XRQA 1MGPA 2CDRA 3M6UA 1G8FA 1PBNA 1EFCA 5FFFA 3SZOA 4K0KB 2EGUA 1VSVA 3OECA 4DSUA 4URXR 1VMAA 3G6WA 3NRCA 4EW3A 1CLEA 1T5TA 4DQ0A 4UW9A 4IQGA 2O5CA 4FS8A 3B6MA 1NRXA 4PAWA 1L9XA 4M83A 2NX2A 2ZB2A 3TRDA 4CQMA 4H2DA 4NU6A 5EL0A 1KVRA 2NO7A 1TD9A 4Q7LA 1XRLA 1OZHA 3JD4A 4RGQA 2W6QA 1KMHB 3LMKA 3OZUA 5KIAA 4L95C 4PZDA 1SHJA 4UUNA 3MJFA 4CUZA 3D7LA 4L07A 1C3EA 4M1YA 3H5IA 4W1SA 1GQYA 2VFAA 5G41A 4PAQA 2IEBA 3PDIB 2BBSA 2PXHA 2QU8A 3DT6A 2QD2A 3PHHA 4PX9A 4QIHA 5AT1A 1XRNA 2WUDA 4HHEA 1T8PA 1OXMA 4WWHA 4AF7A 2AJ8A 5TGTA 2R8XA 2WHPB 4C7JA 3BA1A 4R2MA 4OLAA 4BO9A 3NYQA 3FKSA 4XLTA 3EIXA 3PCTA 1HLPA 1T9KA 1YBVA 1PYGA 5JCXA 1RXCA 3NAQA 4JI4B 2HYDA 1YDWA 1WAMA 2CK3D 3TOSA 3TTUA 5G02A 1IXKA 3M3PA 5T41A 1KRWA 5L3SA 3VVLA 4IV5A 5CYOA 3ZLJA 4JROA 1T1EA 3QLUA 3IE2A 5FX2A 2ZWMA 4YPFA 2XODA 1P4RA 4BX0A 4UHJA 3TM5A 2DHCA 3ILHA 3JQAD 3KCNA 4U9UA 2AXEA 2FG5A 2V7VA 2R8ZA 2GYVA 4HQRA 3VVMA 1ZU5A 4CFSA 2A3NA 1FW6A 3TLGB 1LLFA 3BREA 4U6NA 3KAPA 4MQ4A 1G0OA 1XDUA 4NNJA 1QNLA 3R24A 3KYDA 5CVUA 4EG0A 2GBLC 1CHNA 1W46A 3AM5A 4WOJA 1RLUA 2YBDA 3HKBB 3ORFA 5AKGA 1KJJA 3OCUA 4G01B 3GV0A 2ET6A 1IEXA 3VVBA 3UJ7A 1UBEA 1ZCBA 4L8WB 5AH0A 3LA6A 1FFXA 2LP4Y 2W42A 2FPKA 4DWJA 3AU8A 1JKFA 3CLSD 1DAPA 3A9VA 2YH2A 3K5WA 5K0SA 2WNIA 1OX4B 2FVXA 3K1AA 4DA6A 5A71A 3HCFA 4PBSA 3DZJA 4P81A 4Z9YA 1JIUA 1UOEA 4RQAA 1Z9BA 2C3PA 4RO0A 1JNXX 3AHDA 2HDWA 4KRGA 1XUOA 4Z8YA 4XWOA 3HHPA 1C9DB 2F3SA 2I3DA 1NBEA 1U04A 3LT1A 5IZ4A 3BD9A 3JZIA 4A0GA 4EFKA 2GD1O 4BLUA 1N5RA 3A14A 2WWGA 1BA3A 5AJTA 3RKSA 4FZVA 2HLPA 2GHTA 1YHZA 4JB2A 4HAOA 3T3EA 1UQUA 2PVSA 3UG6A 6AT1A 1EQ2A 3LPCA 1A4XA 2XT0A 3M4XA 3R7BA 3UB2A 1ZH8A 3NIBA 4JK3A 4RGBA 3FWPA 3RJZA 4EA7A 1OIXA 3ESBA 1DPFA 1OKKA 1QXSA 2QTBA 1E1CB 3OWOA 5F7ZA 3EXEA 1IWPB 1EK2A 4MPDA 1DI0A 2C2BA 2V74B 3T7DA 1SMKA 4ZAFA 5KOJB 3O73A 4U7FA 1P91A 4HDQB 4GFDA 5IZCA 3OZDA 3ZDRA 3CKYA 2ZYWX 1UBRS 1SOMA 4K9NA 2VYNA 1CZLA 1PNOA 4ZVQA 4CI9A 2FRXA 2ZZKA 3ICQB 3JQ8A 2CZCA 4LZJA 5IUNC 1N8TA 4WNYA 1QKJA 2HUNA 1NP7A 1EWKA 1T5OA 2H51A 3JD2A 4M7OA 5CDYA 2J6IA 1N5IA 4KO8A 2CDBA 1HWYA 4K28A 2FEKA 4E46A 3E6AA 3A6ZA 4ZPXA 1EG7A 1TMGE 4CKEA 5CA0B 3BYZA 2ZRQA 1IUPA 3U4IA 2WJJA 4B3SB 3E7XA 4IXDA 5DFAA 5D3MB 4JBIA 5AOCA 1C7FA 3IJRA 1QAOA 2IUFA 3L6RA 1FLDA 3Q5DA 7ADHA 1SRQA 1IAQA 2JGAA 1S3GA 3BXEA 4M0EA 2HCTA 4DJ5X 1RFGE 4FEGA 1UBJS 2GB4A 1N5DA 2K4MA 3KZMA 1BD4A 3G79A 1ZGAA 1YR6A 4XYGA 1CY6A 1NBHA 1J0CA 1SB9A 3A1CA 3DE4X 3FKSD 3HU5A 1EUDB 1BKYA 2OMEA 4PZLA 1MZPA 4IMRA 2C00A 2WUVA 3FUVA 1MO3A 1ES9A 3WSVA 1T5IA 1BH2A 3ET4A 2AE2A 3RFTA 3ZWYA 4S1WA 4PYLA 2ZXUA 4BRUA 1L4FA 2WDPA 1U99A 4FE7A 1VTKA 3ZWXA 3MWGA 1RPZA 2QI9F 2WFZA 5CPFA 4Z9AA 2QA5A 3DKPA 3WV5A 1II9A 2HA4A 3UFXA 4MI6A 4R3UC 4WBNB 5LZ2A 4YRRA 1WMAA 2GO7A 1R12A 4OTZA 3N59A 5A6SB 3GP8A 3ZNPA 4CLDA 4F72A 3HCAA 2R6AA 2DPGA 4Y2RA 1SCJA 1T1IA 1YHNA 3CKKA 3KZNA 3LUAA 5ILGA 3WDMA 4I8IA 4YQFA 1W5AA 2QDKA 2JGDA 2QYOA 1JVBA 2YN0A 3BMQB 1KO1A 5LNK1 4OI0A 2OCYC 3QNUA 4E7OA 2L18A 1HDRA 3ESYA 4QVIA 1MMFB 4IO1A 4ZMBA 4UAUA 1QQTA 2Q5HA 4LXYA 3K9BA 4G4IA 4GBGA 3MRTA 3NAMA 3LUHA 1R0XA 4RPJA 1FS4A 2ZBEA 5IFLA 5LYJF 1G8SA 3SOPA 1Z17A 2ZAIA 4YREA 3RF7A 4RPIA 1WSDA 1NY5A 1Z56C 1EK0A 1QYWA 1KYWA 3EY4A 2R8YA 2X4IA 4RFSB 1DARA 4D4LA 3IHLA 2HU2A 3TLXA 5JZBA 4DZTA 3JPWA 2N3ZA 1R0BA 1N77A 3CN9A 4HSEA 4U5QA 5FJIA 4CU5A 4QDUA 1PJLA 1FFYA 2QBYB 2AOTB 2CZGA 1XA0A 1RI5A 4EGQA 2HA5A 4MWBA 1FJXA 2EL7A 3N7TA 1W36C 1A5AB 1IOWA 2FAXA 4A2CA 3ZHUA 1KI6A 3NZEA 4P7FA 5TF4A 5TGDA 1BD3A 4MKIA 3QIVA 1HBJA 1G4AE 3EF3A 4N18A 1PWXA 1U4OA 5L3SB 3WGHA 3NEYA 4FYYA 3UHPA 4MIYA 4UTVA 2BEVB 5KMGB 2GD6A 2FR0A 3DPUA 4K03A 1KMCA 3M5CA 4AKSA 4AJ2A 1YB1A 4HEA6 3WL3A 1LBTA 1FY2A 3AH8A 1VPEA 2QHXA 2CNWD 3O82A 4LOAA 1NQWA 1KP2A 5HRAA 3ICCA 5A3RA 1ODLA 1M2KA 3MMZA 3EG9A 2BKXA 4ZT5A 4D8XA 5D2CA 3H1EA 3PR3A 4L57A 4AM8A 1YZNA 4RETA 3B85A 1P8JA 3ZDBA 2W4IA 3KX2A 4XYBA 2E0IA 2MSLA 2HM7A 4V3BA 1D9ZA 1VLMA 2IE8A 3DWFA 5FUVA 3WLMA 5F98A 2BYTA 1JEYA 2QUBA 1YDGA 2O4CA 2QSJA 2FXVA 3HWRA 2J5KA 1CJSA 2AFHA 4G2TA 5JD5A 3U4QA 4IGAA 2FQ1A 1UKCA 2GPTA 2VF2A 3B2QA 1RWMA 3PFCA 5B2ZA 4S0XA 4JP5A 4YAKA 3O94A 2BGJA 1NASA 2HXGA 5KJEA 4UC0A 1M67A 5T64A 3ZHBA 5ALHA 3SMVA 5FLEX 5AHXA 3CF6R 4L2IB 4Z0NA 1EZZA 3TRFA 1CW2B 1LJ8A 1U8CB 3GYBA 3RTAA 4WFKA 1WDKA 3T5GA 2PWYA 3WO1A 1Q0RA 1XZEA 3GLHE 4U3JA 3ZGXA 4AECA 4AQ7A 1MVLA 4DS3A 2YVQA 1VMKA 5JQWA 3HXQA 5AJHA 1ZHFA 4EJ0A 2IEAA 1NONA 3F98A 4POOA 1GVHA 2HRQA 4R2LA 4R41A 4LVCA 1MTOA 2YXDA 1AK2A 3AVYA 4XJSA 1D03A 2JLSA 2WFMA 1ND5A 4URHA 1D2HA 4EF6A 2PH7A 4JP8A 1BG6A 5AKZA 4ZVRA 4CMJA 1OA1A 3ZE6A 4ILKA 2JIZD 4QPPA 1KVTA 1TM7E 1U2SA 2HJGA 3IQIX 2G9ZA 1XJQA 4JFRA 1CK4A 4MCAA 3M89A 2BM9A 5HE9A 1VECA 1WXDA 5JJBA 2OBMA 4FFPA 1OC4A 1M34B 1RLJA 2QX9A 5FEMA 1RFLA 5C31A 3K6RA 1T36A 4IM7A 3BULA 1PJ8A 1QORA 1V11A 5KNBD 2XWPA 3NG1A 2AKAB 3G2MA 3QRWA 3KKMA 4DNXA 3GUYA 3KTAB 1DB3A 3WB1A 4PZYA 3MWLA 1GAQA 1XTRA 2O06A 3HXKA 4LHEA 2EP5A 4FSDA 1P0MA 2ZGVA 3WHPA 5KINB 5KYGA 1QFZA 2X41A 2YVKA 1YRAA 2G83A 2Z9DA 3B12A 3DQZA 3QG1A 1N36B 5ILQA 4FS3A 4KKVA 3IIIA 5B4UA 4PC6A 2C1EA 2UUPA 3R3XA 3CC8A 4B4UA 4II2A 1R66A 2MINB 3STYA 1RMYA 4N40A 2G63A 2WT4A 2QTZA 3HPQA 5G0VA 5T6MA 4A8JB 1E2JA 2R11A 3WYBA 3NGLA 1NLFA 1PG0A 1XF1A 3RRMA 4C0BA 5KNCA 4GP6A 2BP7B 1UP7A 1U0BB 7MDHA 2C5AA 4I5DA 5KCMA 3UMRA 3A6EA 3LHKA 1ZM4A 2YR0A 4GOKA 2OB2A 1OVGA 1QJ4A 3BH0A 2AS0A 3H0KA 3FSJX 4NBWA 4WZ6A 4HMQA 2XYHA 3H2GA 2QD3A 2J0VA 1K2WA 2BHNA 2P6MA 3EXHA 2FF5A 3G9UA 3ND7A 3WIOA 3QKTA 5LQCA 2FSFA 3KR2A 3MYYA 2VQ6A 4MLCA 1G4UR 2X7HA 4CR7A 2WKSA 4AMYA 5DP1A 5IN4A 1ZGJA 3O92A 3LF2A 2HK9A 3ECCA 3M1LA 2HJ9A 2PLAA 4C0XA 5CX1A 1E4OA 3VPCA 4CF4A 2J31A 4XX0A 2M6LA 3PVCA 5ALLA 2SKEA 1JTFA 4PSDA 3BD7A 3RS2A 2GPJA 2IYEA 4JSTA 1U2GC 2JJQA 4GL2A 1B0ZA 3CB4A 3DKVA 3AVWA 4ZV7A 1CRPA 4US2R 3JZDA 5TVGA 1LPOA 4IMJB 4DCSA 5HF8A 4RK1A 2G8LA 2HQRA 4PQEA 1E2BA 2ROQA 2BFNA 4I19A 4K7JA 2H65A 3WGTA 4HH0A 1P5ZB 2DBQA 3K0AB 1FNBA 4Z1MA 5K8TA 3L2OB 4I7EA 2TS1A 3T38A 4RELA 5HQ3A 5FAXA 1FW8A 2BTOA 4J0QA 5T3YA 4YGYA 4DBLE 3F4KA 3FNBA 3ZE7A 1IXZA 1JUDA 1AUOA 3HFRA 3IUEA 4EI8A 1NVUQ 2W98A 3GPLA 1F5SA 1RJ9A 1QM5A 2FB9A 3U3RA 3KXPA 4DJDC 3HN6A 5PNTA 4KQ2A 4YAOA 3TOCA 5BSVA 1O94A 3ZHSA 4OXKA 3LQYA 4TS9A 4PSVA 5FHRA 4G0WA 1E3TA 1OV6A 2WVAA 1J2TA 3EZ2A 5CU7A 1PGOA 2ZLBA 3TSZA 4DABA 1JFVA 1CY8A 4DMFA 4EI7A 1SKQA 4FINA 4CKXA 1F9AA 3ZQUA 5LZ5A 2YOHA 3ZG6A 4YB8A 2C9OA 2EYUA 2IYLD 3I42A 3ILXA 1LS6A 1PK9A 1DX4A 3EFEA 3ZCSA 1JJVA 3F5DA 1UT5A 1JJAA 1T3LA 5TF0A 4MKXA 2NT4A 3ELDA 2I2CA 4YGXB 1DAFA 4GYKA 1SD1A 4KIUA 4QULA 2JAUA 5TNXA 3VO1A 2B7BA 5IVIA 2BR3A 1Z39A 2KM1A 3AB7A 3UUEA 4YMWA 1O6GA 3TB6A 1HURA 3COJA 1W6RA 2W6JA 2EFYA 1SU4A 2C4WA 1VI6A 2EZUA 1RQXA 4R1SA 3H2KA 4PN7A 2Q5LA 5CVVA 3P9YA 2W6NA 3ESZA 2A9RA 4TT8A 3NDIA 1ZNXA 1W59A 3REGA 3ZU5A 2VQSA 3K8QA 4P0QB 2JFNA 4RA9B 3UJ8A 2AZDA 3ODGA 3GQVA 1QAMA 1BSVA 4L5CA 2BI4A 1H3FA 1EFHA 4PQRA 3VPAA 2J9ZB 3KWJA 5J43A 4OJYA 1IIBA 4FZRA 3RYCB 5LKAA 3ZW8A 5U9CA 1YWGO 3SM9A 3GFFA 3E4CA 2I6XA 1U9YA 5JADA 1LCIA 4F4JA 5KYTA 3T52A 3VJKA 3WWEA 2D59A 4QM7A 3JVIA 1KEEA 5TEWA 4HWTA 4CT4B 1I7PA 1MQ8B 3RYTC 3QTLA 3HSSA 2YV4A 2YMLA 1ZBDA 4O4LA 4N5HX 4P4LA 2XQJA 3OPQA 3FBWA 1B4DA 3W7VA 3A3YA 2YWFA 4WKCA 3IKLA 4WZBB 2P2GA 4R2XA 3WA7A 2QRPA 1I7NA 1FMTA 1W4RA 3N2KA 2HHAA 2W83A 2OAEA 3DLBA 1DOZA 1EBFA 3MIZA 4O5AA 3EA0A 5L45A 4D99A 1XBTA 3COPA 2OD7A 2O2DA 1HDIA 1UBKS 5DHRA 3I1YA 3R6GA 3WK7A 5IASA 1EVKA 2GOYA 3G5TA 1YB4A 1KH2A 3QVMA 3KQKA 2E5FA 3U49A 3WNBA 2WU0A 5ER6A 4Y7DA 1JIKA 1NOJA 2NN3C 4OLJA 4QYMA 1RC0A 5DPMA 5TT0A 3VTZA 2G07A 1I10A 1NRIA 4DCMA 5K3FB 1NMZA 5IDVA 4QU9A 4B85A 1ISHA 5JYCA 1I1QB 3GDHA 4TYMA 1HDZA 3VNVA 2ZRGA 1X7ZA 3RRJA 2HQSA 2AC2A 3D3EA 1E79A 2XUFA 1ZIDA 1WM1A 5FWAA 5IC5A 5D8DA 2C2KA 4OMFG 2CVQA 4MKFA 3RSGA 2Q2WA 2BGRA 2IZZA 5TSDA 1LXCA 3B89A 1FB5A 1OFUA 5CG2A 5HIMA 1HSOA 3B1ZA 1VKNA 2IHTA 4OKNA 4D9HA 1SH7A 2XGJA 4E1BA 2ZVPX 4S12A 1PO7A 2KSQA 3TX2A 3RTCA 5EVJA 1T9GS 2ZYRA 1Q44A 2C61A 2L19A 4JI1B 2GD0A 1QHFA 4FR0A 3U7IA 1P2FA 2ZPAA 3TECE 4PR0A 4Z0HO 4IKOA 1YTLA 3KJHA 1L8LA 1U65A 4Z54A 3D6JA 4EA6A 5IDWA 4H7KA 1U5BB 3AUKA 3BL8A 4DR7B 1UFKA 1KZ4A 3CUVA 1H8EA 3QX7A 1WIWA 4M89A 4PR3A 1RAHA 2GKSA 4Q3AA 3DXYA 4L78A 3NTRA 1UJ6A 1DRVA 1O94D 3EQ6A 1JLSA 4KVGA 5DSTA 3ZY2A 4DDTA 2OCIA 1IVNA 3WWYA 3KT0A 3E22B 2IHUA 1O96B 1OYVA 1AM4D 3P27A 3QIAA 4P3PA 1QHYA 3ZPXA 1WEKA 3JWEA 5I47A 3PD0A 5K8VA 5JS1A 2DQKA 1DGQA 2AOVA 3DMRA 5BT9A 3D4IA 4Z1OA 1ORIA 1WCIA 1NGSA 1FRNA 1H2WA 4X97A 4CKWB 3OI7A 1TJ4A 4D9KA 2CXPA 3LUCA 4H08A 3PEFA 4YFVA 3R6WA 1VLZA 1I4LD 3MT9A 5G0SA 3PQ3A 3AM1A 1DEKA 2VP4A 2F1HA 3DTTA 3NHAA 3TLYA 4BNFA 1DDGA 4QYIA 3C15C 1VJ0A 2OAQ1 4KG7A 4LNHA 1BXGB 1LKZA 1RHRA 4N47A 1KI4A 4ZCRA 1Z2CA 4YUAA 3GLTA 1VBNA 4ZVOA 1DJMA 4R3NA 6ADHA 2JI9A 2C3YA 4OK5A 2ZYTX 1H8HA 2IKSA 4DWVA 2W00A 5GPBA 1CJVC 4YYEA 2NNWB 1O54A 3HE3A 2QQGA 4JH0A 4LV8B 1PDOA 1R5NA 2OCBA 2V58A 2ZJ8A 3E9NA 4IVPA 5J63A 1KY2A 1DAMA 1Q84A 1X80A 1YQXA 3P45A 3L93A 3UK7A 2G6BA 1Z7EA 1QSGA 2WJYA 2ZI9A 1B76A 3JYNA 2OPBA 3O1LA 4QA9A 3U0BA 3OF5A 3L4BA 1FIUA 2VT2A 5DHQA 2O0HA 1I36A 1NOIA 4JC5A 3PJGA 1VXRA 4GKVA 3GP3A 3BGSA 1T43A 4JJ4A 3QLTA 5EKUA 3RKUA 4QTUB 4IDDA 2IYVA 2M32A 3DEJA 2P2CA 1QUFA 1S2LA 2VCEA 1JLLB 1DJOA 2WJZB 5TX7A 4AS1A 2XE4A 2EQAA 2UYYA 4KACA 5M2QA 4QODA 4OVKA 4YJFB 1VSQA 1A96A 4Q0MA 2WP8J 2YINC 2ZUEA 2QTWB 2HHCA 1T2FA 3T99A 3TTVA 4MUFA 1XEFA 4JI2B 4TMVA 5A7HA 2F3RA 3IUBA 4V0QA 2EX0A 5G4KA 2I6QA 5DZSA 3SKYA 1CC1S 5FNVF 3QV2A 1SXHA 1PR1A 3R0VA 1ZGHA 5G0UA 5DBOA 1PAUA 2PZEA 3PE6A 1ZMXA 3SEZA 3WA6A 4ARIA 1K4MA 1HRKA 1P1FA 3T1HB 3GRUA 1QX4A 3D9QX 2A4MA 4G0MA 4LK2A 1Y4ZA 5GM2A 3ABZA 3HCNA 1K8QA 1YQQA 3SYRA 3ZS8A 4AFNA 1TLLA 4B3BA 2J08A 4NV1A 1Y7IA 2PT5A 1QCDA 1GAXA 3K5PA 2IXGA 3AZOA 3PJFA 1IH8A 2DPLA 4RM2A 4PZZA 3L1JA 1WCXA 2ZIWB 3Q3JB 3K30A 3H9QA 2JJ1A 5JNWA 2IZ5A 1YOBA 1QB7A 3FYCA 3WZMA 4I5GA 3GROA 2P79A 5ALOA 4LYFA 2WFAA 1RWWA 3VBEA 1WL8A 3HRIA 3ER8A 3L8FA 5FWNA 1YKGA 1TEZA 1P1BA 1JBKA 3KSBC 1KFCB 1I94B 4HQ6A 4MRNA 2F6RA 4PS0A 1LLUA 1NXXA 1QP7A 4X41A 3RODA 1F2UB 2VBIA 3NHFA 1DHRA 1QYDA 3NC0C 4LZNA 3ZOKA 4YXWD 2WTBA 3KK0A 4TTRA 3DCNA 2OZKA 1NF8A 1A95A 1AB6A 3ENWA 3A1FA 3OAAA 4KI7A 4BQPA 3MOIA 2D5IA 3BXGA 1KR5A 2FGKA 1K3FA 4UXHA 4EYGA 3O90A 2VG8A 4BPRA 2Q8NA 3ROTA 3BFPA 4EJ6A 4DSAA 4ARAA 4BX9A 3HDQA 3CX6A 1A5TA 3EIFA 2CZQA 3A4IA 5BUZA 4GZMA 5DBGA 1DBIA 3KAQA 3KLBA 2XMPA 1YI1A 3FYHA 3K8OE 1SULA 4QKQA 4JEUA 1FFCA 4H1TA 4K6KA 2JIPA 1DQPA 3H7AA 4BE4A 4D0GA 1C3VA 3B70A 3GHHA 4TMYA 5IKPA 4FILA 3SSNA 1M1NB 4RADA 1DKOA 1W2WB 3JATA 3PUIA 1J06A 4F5EA 2AUMA 2YVUA 3W5UA 2EKPA 4D3YA 4N3CA 2MIIA 1T6NA 2YXPX 1UC8A 4MQ5A 4MWZA 2QSYA 4DLKA 1UKBA 2YFHA 4EBFA 1UP6A 5A6VA 2XOEA 3U7FB 4DIFA 5LZ9A 2EW1A 1V1JA 2QY9A 1SVOA 1Q0LA 4KFCA 1EESA 2E4AA 1T1JA 3GJXC 1K7YA 2IYXA 2JFBA 4KN9S 4RVDA 4F4FA 1O58A 3MERA 1JR2A 1W0JD 4LKOA 2UUCB 5LXTA 2PS1A 3G9XA 1IHDA 4QDZA 3UATA 2BMVA 1KS2A 3JRWA 2F9FA 3H05A 1HQDA 1UT8A 2H2FA 3HUUA 4ZQIA 3TXXA 3QZUA 1JX6A 4D9FA 3RS0A 5IJ0A 4BMZA 2RAFA 4L0MA 3HFSA 1F8XA 2Q4RA 4JBNA 1NNI1 2H5IA 2VT7A 2XYVA 3CIFA 4FJ1A 5U1PA 1JV2B 1W87A 1D7AA 1EKXA 3W79A 1AKRA 2NIPA 1D2MA 3GFRA 3C70A 4GMGA 2ALJA 2GSWA 1HYBA 2WA1A 4N0DA 1H42A 2HAEA 1H22A 3ZDYB 4ACAA 4AY3A 2ZUCA 3AKCA 4NLLA 3UPUA 2P2SA 1Z2AA 2P9YA 2IYYA 3HP4A 1Q2UA 1T1RA 1CB0A 3KKPA 3GBSA 1Y5MA 1Y6JA 3PFNA 1AUPA 3CINA 2RAPA 4OQPA 1GTJ1 4TLLB 1WBJB 3QFTA 1HNNA 2HJSA 2D2FA 5DCYA 2CYBA 5CA1F 4KK4A 4Q7MB 4XB2A 1SIWA 1VYTA 3LZCA 4Q93A 3RVMA 4E13A 4NZ9A 3E03A 4HUJA 2DERA 3DEFA 3OQ6A 1JKJB 1KPHA 4GXQA 5JIBA 3DC2A 4LNAA 4G0VA 3HV2A 3JVUA 4XVRA 3GNQA 1TW2A 2B98A 2NVUA 4YRAA 3RVLA 1HNXB 4J3JA 1M7GA 4JJ7A 1PCXA 4ZDIA 3IQHX 2IXEA 1ISPA 1PHPA 4WVLA 3PR1A 4WJZA 2R65A 5H82A 4EKYA 2ZYAA 5IBPA 4MYRA 1M2OA 3LDUA 2V96A 1ECPA 1G6KA 1BFKA 3HDVA 1WWKA 2SCUB 4LBYA 1KE2A 2WHEA 3DB2A 3X2EA 2IYWA 4NCXA 5KNDD 1KGSA 1GQQA 4FHGA 5HK9A 4BPBA 4ZHQB 3MHPA 2LVBA 4QD3A 3BB3A 3Q7RA 5JDIA 1A8HA 1YK0A 2Z3WA 4LGMA 2Q0HA 2R1ZA 3VNRA 4MJXA 4UHDA 2RI6A 3K70B 3T0IA 3H8VA 4JQSA 1L4HA 1PJZA 3L7KA 4IIXA 4CETA 2VQEB 3EHEA 2FFJA 4E21A 2UDPA 3RJTA 1ZN9A 3W06A 1TU4A 1YA6A 4ZALA 3RBXA 2WMDA 1YIOA 2JBAA 2IYAA 3HJFA 1XD9A 1PK8A 3NUZA 3NM5A 4LV5B 1HYGA 2GDZA 3THOA 1ZUHA 2F43A 3WFJA 2VYQA 3W8DA 2QB5A 1D9XA 4XJXA 1C7JA 3I9OA 2RC6A 3T5BA 5CTAA 4C7OA 5AO9A 4YFYA 2YJ6A 3V7NA 3QMMA 4E32A 3ZY4A 1I4EB 2B34A 1ZVMA 1F7VA 2V7BA 3NOVA 5ALJA 3LDAA 1F7UA 1Z7GA 1VXOA 2QJOA 2GM4A 2QP3A 4I1IA 5IAJA 3OWXA 1ZK2A 4F3NA 4PS1A 4R68A 1O0BA 5FBRB 4M9XA 2ZSUA 5DDIP 3JPYA 4E3ZA 1Q57A 4GEGA 3PEYA 5H8WA 5FTJA 4E33A 4DIOA 1KARA 3L6BA 3FZQA 2HH9A 1BVHA 3DSRA 1Z08A 2AZTA 1QKKA 2ZWVA 1A7UA 1ZP6A 1NQTA 1MU0A 3AM3A 3EODA 3JSXA 4GE0A 6ABPA 3L06A 3WI7A 2Q7DA 4MS3B 3H16A 1A76A 2IEYA 5KWJA 2VHQA 4JIMA 1KJYA 2I6FA 2AQKA 3L0PA 3BIWA 3T0FA 5JMOA 2XMZA 2XI4A 3P9ZA 4UTXA 1NMEA 2XRMA 2ZE7A 4A0QA 5EXSA 2VDOB 1E9SA 3EGWA 2R4QA 2XOKA 3MF4A 5DMHA 1N6HA 5KWVA 1ZL0A 1MB9A 4HLUC 4Q4AB 5CFQA 1ABBA 2I76A 3PNOA 2IDMA 3J81k 2LKCA 3GEGA 5IKOA 4AYWA 5JVDA 1KI9A 1ZY2A 4YRFA 1CQIB 2QRKA 1JHYA 4P84A 3OQNA 1HH4A 1PEKE 4A16A 1SC6A 1YJAA 1PS9A 4RMGA 4KR7A 1GZ5A 1AA6A 3RCBA 5GGXA 2Z0MA 5KVAA 1F12A 4FU0A 4PNPA 4Z6KA 2OZEA 1OT3A 3IAUA 5BQ5A 3PUKA 4MYSA 2VDVE 5M04A 1A5BB 1SFRA 3K6KA 3ZW7A 4CM9D 4DPKA 5KYYB 4NH0A 4RTJA 2JCGA 1CDOA 2BFFB 2OMKA 5GV7A 1JDJA 4H6VA 3UGQA 1ZCJA 1FCJA 1XTSA 5TPWB 3V8PA 1NUUA 3OLYA 3PX2A 2GZHA 3INTA 1LTKA 2P9ZA 5CAEB 4L5IA 2QE6A 1KF0A 2NO9A 1DLJA 1FA9A 1VJDA 3OOEA 1J9GA 1L4UA 2Z58A 3S5UA 2QTNA 2R84A 1TTPB 2ATXA 3L0BA