4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
3H4MA 4J0QA 4DLZA 5AK0A 1CR2A 3ECCA 2EFHB 5K8UA 3I4LA 3FOZA 4G5RA 3OEHD 1E4YA 3EC2A 4F38A 3RRYA 3FHCB 1FMLA 5GJWC 1SVKA 1HT1E 2CLSA 4PPQA 4MQBA 2J45A 2GZAA 121PA 3IUYA 2JA1A 3QKRA 5G3YA 1OH5A 2AK3A 1S8FA 4L16A 2WWGA 1Z6GA 4IVQA 2OCPA 5E7MA 4LJ4A 3MJHA 1E94E 4GDFA 1ZIPA 4M1OA 2BKUA 3D3QA 4RCZA 2BIFA 2BMFA 4AY2A 2F55A 1Z63A 1OB2A 2F9MA 4NU0A 1Y63A 2AR7A 4Q1BA 2EW1A 2ZU6A 4OI4A 2WWFA 1G64A 3BOSA 4TMWA 1G8YA 2IYRA 4GMXA 3CR8A 4RY2A 3UATA 4B74A 4AKEA 3U7HB 4D4LA 1XRJA 5EP1A 3HP1A 5KSPA 3K0EA 2IYUA 2V9PA 2ANBA 1B23P 2RCNA 1TX4B 3BXZA 3WHKA 1SGWA 1UPTA 4IHQA 5FOXA 5GJBA 3IKJA 5IF9A 3OIWA 4LY6A 4MKFA 3U3JA 1E98A 3EA0A 3L2OB 1EX6A 1S0UA 4M9SA 1SXJD 3T15A 3JZAA 1IN4A 1E2DA 2NO9A 1VCOA 2C98A 2IXEA 4D82A 2BJVA 3U7GA 4DKXA 3P4YA 5DYGA 4TLEA 3ZZ0A 4EPXA 2BVNA 1XD8A 2QQ0A 1YR6A 2B7BA 2WWIA 5FL7A 4FD2A 4BFYA 4RFSA 2R6FA 3VR2A 4TMTA 4PHFA 4PC2A 2ZJ5A 3RC3A 2DBYA 5HCNA 3GQBA 1E96A 1N0WA 2VSXA 1IAQA 1KMHB 1BOFA 4AYTA 1T0JB 5BYJA 3C15C 1NBME 3SJCA 2BCGY 2C04A 2WPDA 2DWOA 2UVQA 2XNSA 2HUPA 4TTQA 5DGXA 4LBVA 2JCSA 1II8B 1UJ2A 1U0JA 5CDFE 3BWDD 4IJMA 2VO1A 3VX3A 4BEBA 4B2PA 3UMFA 3TSWA 1AS0A 1XNJA 5EE0A 1YHNA 2JASA 3PXGA 2FPMA 4PZZA 2V6IA 1NLYA 2B7CA 5JS8A 1D2NA 2HT1A 1KHTA 4RFVA 2XTNA 1CJKC 1OT3A 2IYTA 3SNHA 1G5TA 2D74A 4MDFA 4PQYA 1UM8A 3A58B 2WJIA 3B7GA 1E9EA 4BLPA 3LFUA 2D62A 4O2RA 2AXPA 5CIQA 4PTLA 1KI6B 4JBWA 3LVQE 3BGWA 1JXMA 1UEIA 3ASYA 3ZQJA 1BKDR 5E3HA 2OFWA 5BN3A 1MABA 5SZKB 2WTUA 1FNMA 2WVJA 2VHUA 4M1SA 3BFVA 1CJUC 1KDPA 1M7HA 1ZBDA 2CK3A 3RNLA 5J4KA 1QHSA 5JHGB 4U7DA 3BS4A 4LV5B 4C7OA 1G4AE 3OZXA 3SJZA 1E2PA 1FL9A 1KNQA 3AVQA 3JZMA 4BFSA 3PUVA 3ADCA 1VG1A 2GJ9A 3K0AA 3GJXC 2XZLA 4OJKA 4R2IA 2PX0A 1LV7A 4TQAA 2HYIC 5P21A 1AA9A 4Q18A 4A0RA 2IW3A 4Q47A 3KFVA 1TAGA 3VKGA 4B47A 2ZE5A 4KFTA 5IDVA 2FZ4A 4OQNA 1ZIOA 1N6NA 4Q01A 4DT1A 4Z51A 2REOA 1NN1A 4C2TA 5FBWB 2F1IA 3R8CA 1ZRHA 2DWQA 1DAHA 5A5GA 3IDQA 3FVQA 2FZLA 2GCPA 3AVTA 4HAXA 5FI0B 1IXRC 4HLDA 1G17A 3RSOA 2V7QD 5E95A 5TVKA 3AP1A 3MMPA 1NVVQ 1YJ5A 1VIAA 2ZR9A 2Q3HA 1M74A 2V8OA 2BHRA 2HCBA 3H0KA 2AXNA 4U00A 5FPYA 4IDQA 4BLTA 3QOFA 1E2MA 4DIDA 5CB8A 1JQLB 3GLFA 1X1SA 4C0JA 2IS6A 3TW8B 3TE6A 2IF2A 1VDZA 4YQFA 3L8ZA 4DLTA 3GLHB 4DLVA 2G0NA 2ZJ8A 3LQRA 2XNDD 3U7FB 4NZYA 2A2ZA 3W5IA 3H86A 5FTKA 3LAWA 4QOSA 1ZM4A 3TGPA 5DISB 4OI0A 1IY0A 3BAFA 1OHHD 4V03A 4DLWA 4NMMA 5JJIA 2CBZA 4IOJA 5KSOA 3AF4A 2XJ9A 4CT5A 1N2CE 1IN8A 1XFAA 1SXJA 1ZC3A 3KXLA 3WP1B 5J5CA 5KDDA 4NYIR 1YZLA 2GA8A 1XMSA 3NHAA 4XTRA 3RHFA 2BOVA 2KB0A 4II7A 1VYVA 2FFAA 1OF1A 1UBEA 2O8EB 3I8XA 1KDOA 1KK2A 3BFXA 3RRZA 1XMJA 1YVDA 3Q7QA 4R98A 5KTYA 5EE3A 1E9CA 2OEPA 1W0JA 2IC5A 5C4GB 2CCKA 3O8RA 2R9VA 4TYPA 2OSBA 1GKYA 2AK2A 2FSHA 2F3RA 5CITA 1ZCBA 1SKYE 3IPYA 1G8FA 3OE7D 2W6IA 4BECA 3WYGA 1S3SA 2IHYA 1WCV1 4JLOA 2FEOA 4M1TA 4M1YA 2JLSA 3LA6A 2ZR0A 1CR1A 4UKDA 3K9LA 1JPJA 3CNOA 3RRNA 4QHSA 4WIAA 4Z8YA 4UNQA 3GFOA 4KFSA 1U0HC 1TQ6A 3WMGA 4D4KA 4H1VA 4QBIA 4TLBA 5FI1B 4DB4A 2JIZD 2WIAA 3AV0B 3SU8A 4TYYA 2UKDA 3WNBA 4D0LB 4DDVA 2REXB 3CUEF 3EPJA 4QHYA 2QGZA 2I1VB 1ZJ6A 4LPKA 3EIEA 1SKYB 2R44A 3MJRA 4C4PA 1ONBA 2YOHA 1KK3A 4HAUA 4CT4B 2OLKA 3AEZA 3U3MA 1EFTA 4E22A 1Z2AA 4POAA 5SZHB 1RRCA 2GJAA 2NPIA 3EW9A 1LW7A 4TQUS 4KXFB 4D4MA 3WY9A 2WIBA 4E09A 2GEDA 3AUXA 1YU9A 4HSEA 5IK2A 1Z29A 4AKHA 3NTUA 4PXAA 2PCLA 4C0QC 2ZVQX 4ZDKA 3MLEA 4NYJQ 2ODEA 2IYSA 1G7CA 1TL7C 3GFPA 3QPVA 3IHLA 3W90A 1KI2A 3E2IA 3CWZA 2EQBA 1AGPA 3NBYC 4OI2A 4MA4A 3CRVA 5H68A 4CEJA 3W9YA 3R9IA 5AJVB 2J0SA 2CCGA 2H92A 2BDTA 1P9RA 3K0FA 4HAWA 5FBQB 4CZ2A 5H8WA 1PVOA 4JLAA 4Q1EA 2RGGA 2YWHA 2ZRCA 3GP8A 4LYAA 2YOGA 1HYQA 1QRAA 3KB2A 3K0AB 2ZXUA 4M9QA 5JI3E 2AN9A 3E1SA 3RS2A 4Q9KA 1M6NA 2QT0A 4TMZA 3W8NA 2AHOA 4P0TA 2JLXA 4IKEA 4QXAA 4B2LA 4PC7A 3HU2A 2J41A 3MUFA 4LI0A 1TMKA 4JL8A 1ZD1A 4OHYA 3DO6A 1W7AA 3VR6A 2Z83A 5DHFA 4HLCA 4KFRA 2RB4A 1ZM7A 1RYFA 4LBYA 4LUCA 2CLDX 5KOYA 1KI7A 2J5XA 4FWIB 2YVUA 3ZS9A 1NVWQ 2OE2A 1MR3F 4KYUA 4NPHA 4US2R 4WW0A 3RDPA 2CHVA 3QKSB 4Q00A 4ERNA 4M1WA 2CNWD 2PX3A 1E6CA 3NG1A 2NO6A 4DEXA 3WMEA 4JYBA 1XTKA 1E2EA 1NY5A 4IDPA 3BH6A 3C41J 4CW7A 3CPJB 3CRMA 3MAAC 3BE4A 3K0CC 3NEYA 4H1UA 4AD8A 2IXGA 1M7BA 2QENA 3HWSA 4EQ6A 2EFDB 4I1UA 2EFCB 2HXYA 2YJTD 3A1WA 1OHHA 2O8BB 4JYCA 4KVGA 1TU4A 5EUMA 1NIJA 5EE9A 2I3BA 2CL6X 3TKLA 1J8MF 5J4HA 4MDEA 3K8YA 3DZ8A 2B6HA 2FSIA 2GHIA 1II9A 3IIJA 5FUWA 5DI9A 4B32A 2QMEA 2G77B 1X6VA 2VP0A 3CR7A 1J90A 2A5DA 8OHMA 4CGZA 2ZS9A 5GADl 1X3SA 3IBGA 2PJRA 1IY1A 1LS6A 2I4IA 2VBCA 3FYHA 4DWJA 2WWWA 1AJEA 3GJ8A 1OH6A 1KZ7B 5AJZA 2DWPA 2GCNA 2WJGA 3P20A 4JMPA 1ETUA 5TB5A 2O8DA 4AIIA 2N46A 3QPUA 2OCYC 2QTVB 2ZYVX 3NIBA 1X8KA 4QJ4A 2VHJA 2CLCX 2PZGA 2LKDA 1KNXA 1E2KA 2FE4A 2FNAA 4U02A 1A82A 2ECKA 1DS6A 1HY3A 4EPRA 3GD7A 5J4YA 4LJ9A 4JLDA 1KI3A 4AC9A 3FTQA 5HR5A 3OIUA 1NMYA 1NL3A 1QHYA 3IO5A 4QBFA 3V4RA 4JVLA 3Q72A 4LCBA 1XZQA 4UQOA 1H8EA 4HUQA 1YR8A 2OXCA 2ZIAA 2ZQ5A 3U44B 3K9NA 4KLNA 5JRJA 1G16A 3WNDA 3QJYA 3QY0A 3VX4A 4BFVA 4F4CA 2GZDA 5FOSA 4CRWB 4QG7A 1U98A 3X1YA 3ZDQA 1NVXQ 3T06B 4CYMA 4B44A 3T5GA 1CR0A 2VHCA 1JNYA 3HR7A 2JLYA 3QVUA 1Z0IA 2OFOA 3QVVA 2BEKA 4OK3A 1II0A 3VAAA 3SQWA 1TUEA 1ESMA 1KKMA 2ZJOA 2Q9AA 5KPDA 1G3MA 4LJAA 4PC6A 2RGBA 3EARA 2IL1A 4FMCB 4OQMA 3IIMA 2FPKA 2BMJA 1E2LA 4QM7A 1HE1C 3KKNA 4K81B 3NWJA 4AI6A 1KSJA 3DM9B 1XJ0A 3QKUA 1X1RA 2Q0HA 4QJ3A 5B64A 1XU4A 1ZP6A 4PPFA 3AM1A 2PMDA 2JDID 1D2MA 2QY9A 2A30A 4LJ6A 3LXXA 3AF3A 4EIWA 1S1CA 4O3MA 4YC7A 1R8QA 2CL0X 5JS7A 3L0PA 4KLZA 3EZ2A 1P5ZB 3QQ5A 1XCMA 3MG9A 3B9PA 4MRNA 3EAQA 4ASUD 4C0BA 3MWKA 1O3YA 1EWRA 2ZI4A 2XXAB 4XWAA 2OAQ1 4TLDA 1ZC4A 1DAIA 3LLUA 3SS8A 1W4AA 3QIAA 3K70B 3VNUA 1N6IA 2ZYTX 1Z28A 2ZJAA 5CDFA 2BWJA 4UJ3A 1GP2A 2ZYWX 4M2LA 1P7CA 2K5UA 4HI0E 2FGJA 3K70D 3GEEA 5CM8B 4GBMA 4P4TA 1BH2A 4HUTA 2EWWA 1VHTA 3TR5A 1UBFA 3CNNA 2D4HA 4Z1MD 2XZOA 3A4LA 1OH7A 1J70A 3CBQA 1XDBA 3W5JA 4A6PA 2XITA 4L9SA 4UJ5A 3A1SA 2E87A 3U44A 3OEED 4I1OA 5AUNB 4TL6A 3MWYW 4XVRA 2A5GA 2ZSBA 3RS7A 1R2QA 4ZV4A 4DDWA 3SBEA 2DHRA 4UXJA 1WQ1R 4YMTA 3A4MA 4KITB 5B58C 2P6RA 1HURA 2D7CA 3Q3JB 5KHOC 4DEYA 5G41A 1NG9A 3GLIB 4TSFA 1UDWA 1CEEA 2PJZA 2PZEA 5JWHA 1N0UA 4HLUA 2V7QA 5KYKA 2GXAA 2A3RA 2NIPA 4LYJA 3LWNA 1IONA 1Q1BA 4BRWA 1E2JA 2JATA 3C14C 3ZVLA 5FL3A 4JL5A 2CE7A 4JSYA 1A7JA 2IYYA 1PLKA 5DN6A 3R7WB 1DEKA 2HF9A 3G82C 4FW9A 4BLSA 4CEHA 1G3UA 1OXSC 2D3WA 3B85A 4A2QA 1JR6A 2QEQA 2RKOA 4LOAA 1Z0FA 3TUJC 2IX3A 4LX0A 4GMDA 1Z22A 1U8YA 3VHXA 1OLOA 2GBLA 2QN6A 3GLHE 1CKEA 5CYOA 1GNPA 1T6NA 3VTKA 2CJWB 4JLKA 1RW4A 2WJJA 3KXIA 4EAQA 3LO5A 4MYTA 2D2EA 1XX6A 4MYCA 1Z6TA 4C7OB 3DOEA 2GESA 1ODFA 6Q21A 3DEFA 3M0EA 5KU1A 3K09A 3RS0A 3CF0A 3WRXC 1NI3A 1SXJB 3BC1A 3KQLA 4EUNA 3B1YA 1VECA 3U4QA 4EDHA 1E2QA 3DKPA 2Q6TA 3AVXA 4F91B 2DYKA 2IXFA 1NKTA 1MRNA 2XAUA 2F43B 2KE5A 1TEXA 1KSFX 1TUIA 2R2AA 3VR1A 2FJUA 2IWRA 2OBMA 2BC9A 4JLNA 4ZIRB 2IS4A 3M1IA 5TDHA 4EQ6B 1W1WA 2F1JA 1W4CA 2AFHE 1DE0A 1HT2E 2CL7X 2W6ID 3OE7A 1NN5A 2E1RA 5EXPA 1T5LA 4HB4A 2QZ4A 3N2IA 4TTRA 4KSBA 1HEIA 5EP4A 1C9KA 3ZJYA 2JIZA 2QROA 2ZJYA 2ZROA 4QGGA 2ZRPA 1SZPA 2VP9A 1P3JA 2RH5A 4FMDF 5G3ZA 1FX0B 1SVWA 1U9IC 2HJVA 2A5JA 1GWNA 2QPAA 1UEJA 1ESNA 1TNDA 1W0KA 2MSCB 3U3OA 2QGNA 4Q1DA 1PUIA 1U9IA 3I73A 4CDGA 5BYKA 3MCAA 2NTYC 2FSGA 2J0UA 4N3NA 1Z0JA 2C9YA 1LF5A 2GXUA 1LTQA 1KIMA 2HT6A 5HE9A 3VU9A 3Q8XB 5LB4A 2VP4A 5JEEA 2JDIA 3VMFA 3HYTA 4NCKA 1BMFA 1AQUA 5TY0A 4EPTA 5KO2A 3GLFB 2CHQA 2D2FA 4AWXA 1GM5A 1C4OA 1WBBA 3NBFA 1W2GA 2C96A 2FV8A 3EASA 3DPUA 3PVSA 1U81A 1E2HA 1HH4A 4M53A 1KGDA 2VF7A 2O0HA 3B13B 1AN0A 1SVIA 5K8TA 4C0AC 1M34E 4D6PA 1OJLA 2ZTSA 4B3XA 3RABA 2W00A 3KTAB 1LS1A 4CEIA 1RRFA 3W6OA 3FE2A 4DSOA 3GLFE 4URUR 1G7RA 3LRPA 4R71A 3ADKA 5H1YA 4Q9LA 2FEMA 2XTMA 1E2IA 1RYHA 4Q1AA 2YOFA 2ZE6A 3PV0A 5KUTA 4OYHA 1NIPA 3IILA 3T5DA 3KQHA 2FN4A 1G4UR 4C0LA 1FUKA 2W2TA 1CJVC 1OIVA 4MRRA 1Q22A 4M0LA 5F2EA 3LH5A 1RRPA 3GJ3A 2J0QA 2YWFA 1HA3A 3DDCA 4LHYA 4TSFD 4XTCS 3I3SR 2ZRGA 1E9FA 3U3KA 1T3SA 4UNRA 3KB1A 4FCTA 4QL3A 1SULA 1J2JA 4FINA 3ZYCA 2G1JA 2QBYA 3GLIE 4RD4A 2IF0A 2GZHA 2OILA 3GJ5A 3TAHA 3BRWD 4P33A 3QXSA 3CZQA 1WXQA 4G5SA 2FGKA 1T91A 1OV4A 2CNWA 1VKJA 3UXMA 5DN6D 1P2VA 3WBJA 5F9HA 3Q7PA 2JEOA 3UK6A 4N1AA 2EYUA 4AK9A 3TRFA 1ZNYA 1US8A 1QG4A 1XMIA 4M21A 4JLPA 4DZZA 5EUQB 1GFIA 3WMFA 4G3XA 1BS1A 4BFZA 2GILA 4RZXA 1G8GA 4OHVA 1W36B 1U8AA 3GJ7A 421PA 2PLRA 2DFTA 3WYFA 1T3HA 3KX2A 2OCBA 1EFUA 2QMUA 1GL6A 2FG5A 4TMXA 4IVRA 1P4SA 4B35A 1AZTA 4JL6A 2Z0MA 1TF5A 4Q1CA 1II8A 1OXVA 1M1YE 2AKYA 1GILA 2J46A 1IXSB 4RKFA 2O8CB 3DM5A 1PUJA 3S1AA 4FMDB 1E0JA 4BPBA 1Q1QA 1KZGB 3PFIA 4OJQA 1UF9A 2FSFA 1Z6XA 2OUKA 2C77A 3EWSA 1OXTA 1AK2A 4E07A 3QEOA 1G5PA 5GJVC 4D2IA 3KQUA 4L5BA 4ZO4A 2GAOA 1ZNXA 3DL0A 1Z0AA 2ZS8A 2F43A 4M22A 3BFKA 1K8RA 2NZ8A 1GRNA 4FIDA 1AS2A 4US0R 4MGKR 2IWHA 3W3ZB 1Q1ZA 4P32A 2UZ3A 2ZUCA 3WXMA 1KAOA 3WYAA 3U6BA 2QE7D 2W6JA 1XTIA 4TYWA 4YMVA 3DZDA 4ITRC 3KDSE 4BFTA 2ZUDA 2RHMA 1DG1G 3OIYA 3PQCA 3PENA 2ZRNA 3KZ1E 3P27A 4M9XA 1WRBA 3CB4A 4MRSA 3UMSA 4Q4JB 1W0KD 1E69A 1XP8A 1H8ED 3EZFA 2WAYA 3IPXA 4V0KA 2G88A 1AKYA 3QG1A 1XCPA 2IS1A 2QORA 2WKRA 4ARZA 1FFHA 2H5EA 1XPRA 1CXZA 2G0TA 1XEXB 1XMVA 3D31A 3FB4A 3L0OA 1NLFA 5KDLA 2QAGA 1BMFD 5CB6A 4RZ2A 2BCJQ 4Q9IA 4FI3C 4LBZA 4X8HA 3B1ZA 3AVWA 3CH5A 4O2LA 2W83A 1F2UA 4LHXA 1W46A 4TYNA 4QBGB 2OBNA 2LCFA 4OHZA 3OF5A 3RANA 3A6PC 1KJYA 4DCTA 2QQEA 5BN5A 4M9ZA 3SYNA 2R6GA 1S4QA 3R20A 4JVSB 1T3LA 4QFMA 4RSGA 5UKDA 4BZXA 4B3DA 3VKHA 1GRQA 2FFQA 3K0CA 1OPXA 1W48A 4YMWA 5JRZA 2BBOA 3PR1A 3IBYA 1GDDA 2EYQA 1A2KC 3B8HA 5DSZA 4PSKA 4B34A 3EZ9A 5SZIA 4MGIR 221PA 4IDOA 3FDIA 2GVZC 4CIDA 2ZPTX 3TUZC 4EFNA 1MABB 3J81k 3C8UA 4QNRA 3F0TA 4ASUA 3T12A 1UDXA 2R6CA 3FWYA 2HYDA 1FX0A 3I72A 5FH9A 2R65A 4URZR 1CS4C 1GZSA 4Q21A 1YRAA 2ZRBA 3HJNA 4JJZA 5FBVB 1F6BA 2WICA 4BFWA 3PEWA 2QRNA 2IEZA 1VPLA 4NH0A 4IXMA 3TVTA 3TUIC 4A0FA 1LY1A 1RFLA 1NVUQ 4Z1MA 2QSYA 1ZUNB 5LD2B 1KK1A 4WXRA 1IOZA 3EXAA 1OW3B 1VHLA 2O8FA 1GRRA 3OEEA 5CIWA 3NBXX 4FMBB 4MH0R 5D3MB 3SN6A 3AB3A 3NDPA 4QGFA 5GVRA 1XZPA 5HCIA 2O0JA 1G21E 1KTVA 3QXHA 1GAJA 5AJXA 1GUAA 2BBWA 2HJGA 2JLUA 1SXJC 2FFBA 4PQFA 4ZCLA 4ZDWA 4A0HA 3B1VA 2Q9CA 2WV9A 2GCOA 5AUOB 1P2SA 2JLRA 1G3QA 4PZYA 2PEZA 1E1QA 3KKQA 4Q4AB 3THXB 3EA5A 4B48A 4LV8B 2VA8A 2JJ1A 4P4SB 4G5GA 4C9BA 2JLVA 1CF4A 1GL9B 2G1KA 2WJYA 2X1VA 5GVSA 2IHBA 2OBLA 5EP2A 3SZRA 3F3YA 1YZTA 4PSAA 3VKWA 1IM2A 3RAPR 2XB2A 4MGZR 4UXHA 4GOKA 2G83A 3E70C 2VH5R 1AGRA 3PITA 2QNRA 1VIYA 4KYIB 3SJAA 3OIVA 4DB2A 1W2HA 3K53A 4PPGA 4HDCA 4HUQB 2HEIA 1SKQA 4NTZA 1CULC 1W4BA 4MYUA 5AUPB 2Z4SA 1U99A 4IXNA 4LHWA 3VR4A 3LY5A 1JAHA 2R6AA 3WHLA 2CJWA 5EP3A 4DUGA 4DT1B 4BGDA 1OKKD 5CJPA 3VHLB 4HYYA 4L15A 2QE7A 2W6JD 1E1RA 4A9AA 1GITA 2QSZA 4TZ0A 4XWKA 1Z83A 2A7QA 3CIOA 4IRUB 4P3YA 1PJRA 4ZKDA 2BKEA 1TTTA 2JLZA 3T1VA 1W5SA 2FH5B 3GFTA 4PSVA 4TT3D 4Q02A 3CNLA 1NY6A 2ZAOA 4IDHA 4JS0A 4C30A 1JJVA 1R0WA 3ZD7A 2A78A 3F8TA 2QM8A 3CX6A 3KKPA 1JALA 3C5CA 2IYVA 4YONB 2C8VA 4DLRA 1VCMA 2TMKA 1YR9A 2NGRA 3GLHA 4PFSA 3UG6A 1WDTA 3ZVRA 2WJVA 1W5TA 4Y0AA 1I2DA 4L4UA 1GL7A 3FFBA 4H9GA 3Q85A 2ONKA 3QXXA 3CONA 1PLLA 1M2OB 4NKRA 821PA 2H8KA 1Z6AA 5F3WB 1I4LD 3ZD6A 2IYQA 1SVOA 1NRJB 4HAZA 4DBLC 5F98A 1BIFA 2O8FB 1VYTA 1TF7A 1F3OA 1CLUA 2X77A 3B9QA 4JLBA 3TVDA 3PUYA 3GLGB 2REBA 1XWIA 2V6JA 2VL7A 1GIAA 2J7PA 1HUQA 4YLGA 3UG7A 4HLUC 4B3GA 1FOEB 2BBSA 4DCSA 3AGPA 4TTPA 1NJFA 3SJBA 1Z8FA 4NHOA 2P5TB 1JPNA 1YKSA 3L8YA 2W2VA 3IGFA 2OXRA 5EJEA 2PBRA 3RVBA 2HCJB 2VP6A 1EFCA 2ZE7A 3GJ6A 5FUVA 1BYIA 1RZ3A 1YZUA 3TMKA 3O8BA 1CRQA 5IT5A 521PA 4IFEA 4KBGA 5BN4A 4TL9A 2FF7A 2Y8EA 1E9DA 2ZSDA 5KNBA 1FTSA 2NO0A 2ZJ2A 1R6BX 2PT7A 1G18A 4B71A 1XXHB 2ONJA 4WXPA 1KI9A 2DFLA 1KJZA 4LYFA 3X1XA 3KJHA 5LDDC 5FOUA 2QAGB 4NYIQ 1QHHB 4JKYA 4TLAA 3KQNA 5HPYB 1LFDB 3TIFA 4CEHB 1F2TB 4RD6A 1G291 3BH7A 1Q3TA 1QZXA 2EVWX 3EC1A 4DJTA 5JBQA 3FPAA 4B6EA 1LF0A 2RGDA 3ZIAD 3SR0A 4V0OA 1JAIA 1A5TA 1L4UA 2VP2A 4B33A 1DOAA 4F92B 2NOAA 3X1DA 1DTSA 3U7EB 4ZKEA 1MH1A 3OHMA 1E3MA 3ND8A 1D8TA 2IYWA 3QSYA 1F5NA 2RGNC 5BXQC 4GSYA 1IN5A 3X2SA 5FOWA 1E1QD 4V02A 1T9HA 1KI1A 5KSZA 2AFIE 3I5YA 1XEWX 5JECA 4QC2A 3THWB 2DB3A 1UAAA 4Q7KA 2ZITA 2B8TA 1E9AA 2IBMA 3KFXA 3MD0A 4OQLA 5TV2A 5E7JA 3RRMA 2J87A 1G7SA 4G5QA 4JVMA 4R9UC 1TF2A 4HATA 1EFHA 4EFMA 4US1R 1XEWY 2XGJA 2GDJA 3LLMA 4HB2A 4URVR 1G8PA 5EZ5A 5DLQC 3GCGA 5CM9C 4DLUA 4PANA 4YMUA 5HKKD 1QHGA 3KTAA 3PIRA 2ZM5A 1E0AA 1KMQA 1ZUIA 4K8OA 3ZH9B 4DUGD 1ZM9A 4NCJA 3U4QB 1E1RD 1KOFA 1S2MA 3LW7A 1NN3A 2ORIA 2Q3MA 5CK5A 2RGEA 1RIFA 3AUYA 3X1ZA 1AM4D 4Q9JA 4DC9A 3ZGXA 3C5HA 1GNRA 4RD3A 4Q66C 4TT3A 2AD1A 4ZIRA 1OB5A 4LRWA 2NQ2C 1WP9A 2ATXA 1WE2A 4Z54A 4EJSC 3NXSA 4EPVA 3I92A 3OESA 4KAXA 4OK6A 3VFDA 2GETA 3VNVA 3NH6A 2G6BA 3CX7A 3EPHA 3CRRA 1IN6A 4RJLA 1CP2A 4KU4A 1WBDA 1NVVR 2MMGA 1XTSA 2WOJA 2VSFA 3T34A 3FFAA 4HLQB 5EQTA 4CF7A 1MRSA 1KO7A 2MMCA 4FXPA 5KNCA 3CF6R 2GRJA 4BZPA 4DLYA 4A15A 3Q5EA 3HU1A 1L7VC 2P6NA 4Y0VA 1EESA 3SFZA 3X1WA 1NKSA 3ETLA 3SQXA 3U6KA 1MO5A 2QAJA 4LJ5A 4Q48A 3THYB 2WKQA 3QF4A 4UNNA 4XVQA 5KNDA 3KKOA 4RZUA 2GNOA 4HEJA 3A36A 4PC3A 1OIXA 2AD5A 2J7PD 3MSXA 2VIIA 3M4YA 2QP4A 3ICQB 5C18A 3L82B 4L8GA 4JLVA 2OZEA 1Q21A 4JLMA 1OFUX 3PCRB 1NF3A 4U5XA 4XIGS 3TSZA 4EPWA 2ZRLA 5JJKA 4B2IA 1NLZA 1NP6A 1HQCA 4EJSA 1OXXK 1Z47A 3G5UA 3SYKA 4ZDIA 1R10A 1E4VA 2HF8A 3KJIA 3V4FA 3U5ZB 2YINC 4NCIA 5G40A 3THWA 1VMAA 2OHFA 1FMJA 5EZ6B 4I99A 1JEEA 4BEJA 3B1XA 3A1UA 1E32A 1DPFA 1H8HD 3CPEA 1KO8A 3I62A 3ZLJA 1UKEA 3THOA 3R9XA 3AVOA 5C1BA 1UKZA 5BW8A 3RS4A 2F1HA 4RD0A 4AKGA 5FPTA 4XVUA 3ZIAA 4OK5A 4LV6A 5KPJA 4DLXA 1F2TA 1OSNA 2FOLA 4Q7LA 4IVPA 5DYIA 2QAGC 2AWNA 2PL3A 3LBHA 3BJIC 4PHHA 2ZSEA 3IEUA 5KSYA 2BMDA 2YV5A 3RWMB 4A2PA 1N25A 3P26A 4GPTA 1XEXA 3BK7A 4NCNA 1W36C 1VG8A 4E03A 3FGNA 1KY2A 1Q20A 2H17A 2ZYUX 1NMZA 2ZI6A 1FUUA 3CKLA 2Z5FA 1SVLA 3QXCA 1FP6A 2QI9C 1D9ZA 2B8WA 4KJZA 1XF9A 3U2QA 4F7WA 3I5XA 3QEJA 2MSEB 1GTVA 1NN0A 2W58A 2KWIA 3CZPA 3FMIA 4DXAA 5HZHA 2GK7A 4LC0A 1VTKA 1G7TA 3K09C 3K1JA 4DIEA 2IUTA 3QG5A 1OYWA 3MGCA 2PH1A 1ZD9A 1XJQA 5HKKA 1DAGA 2QMHA 5K8IA 1ZW6A 1WA5A 1FZQA 1SHZA 4I81A 2IA5A 2JJ1D 2GXQA 1OXUA 4NBSA 2GJ8A 4XWOA 1Z6YA 4KCGA 4QHTA 2JAQA 2RGCA 4Q4LA 2WBLC 3RLFA 1E2FA 2KBFA 2VQSA 5JZVA 3B82A 1U90A 4GOJA 5FUYA 1HQYE 1KKLA 3A1TA 3D8BA 3CH4B 3LBIA 2J7KA 2OCAA 1IQPA 5CJ2A 3EPKA 3B2EA 1OH8A 2P0EA 4R7ZA 4DRZA 1N0VC 1CIPA 2CDNA 2RGAA 5J47A 3KQKA 3V9PA 1E0KA 1DBSA 3FHOA 3QPWA 3I61A 1Z06A 2IYXA 1A2BA 5F9FA 2P2LA 2WZQA 4MRPA 3E5HA 4DVGA 1ZD8A 5AUQA 3NHBA 2GWHA 1OKKA 2ERYA 2ZRFA 3GEHA 3SEAA 3QF7A 2QMOA 1GNQA 3AP3A 2IEYA 1DAEA 2XZPA 1E0SA 5TMPA 3QXJA 5KDOA 2ZRDA 3AVUA 2XB4A 1JJ7A 4KODA 3QKRB 4LWZA 4V0NA 1IJEA 1RVDA 1RJ9A 5DO9A 1DADA 3KJGA 4URYR 4UNSA 1LVGA 2V1UA 3TAUA 2B21A 3K0SA 4ZPXA 1VCNA 4PHGA 2BBTA 3C7KA 2WM9B 2H18A 2YWGA 2CE2X 3B5JA 1G3RA 1FP7A 4MUAA 5EE5B 1ELOA 1E9BA 5FR2A 2AL7A 5JWOA 4MYHA 3BH0A 1L8QA 5BWMA 5FBRB 3OFND 4EPYA 2RHDA 2XEXA 3KL4A 3PEYA 4YXWA 2ZRMA 5L3RA 4RZ3A 1YZNA 2OESA 2KSQA 1JI0A 1N6RA 1NJGA 1EFRA 4JJKA 3QUSA 4GRAA 4XOIA 1WMSA 5LPNA 3OAAA 2X2EA 1ZNWA 2PMKA 2Z4RA 2EFEB 3QBVA 1QHIA 3N2EA 4Q4AA 1I4TD 1H8HA 1I2MA 1UKYA 4MGYR 5FBLB 3FKSA 4LDJA 3VR5A 4IOLA 4DHEA 3TNFA 4PR0A 4B73A 3TW4A 1ZVQA 4TYQA 4MKGA 1DARA 1US8B 4F4IA 3BB3A 4GFDA 3PEVA 2G9NA 1DAKA 3DKVA 3AKEA 4BQSA 1QG2A 1GSIA 2ZAMA 4GNKA 4FCVA 1P60A 2AKAB 3N70A 2VF8A 2IUUA 3REGA 2CHGA 4IEIA 4LK2A 1R5OA 2PZFA 4GOXA 2ZRHA 4YDSA 5FOTA 3ADBA 2DR3A 3THYA 4DDUA 4QGAA 5CK4A 3PUZA 1S96A 2C95A 2WWHA 3IIKA 2NG1A 5FPHA 4LYHA 2ZRAA 2ZUBA 2ODNA 1VCIA 1N5JA 1HV8A 1NSTA 1MT0A 4TWZA 1UKVY 3TK1A 2KJQA 3GPLA 1IHUA 1W36D 2LKCA 4PZLA 4I1SA 1JEDA 3CF2A 2QP9X 5ANRB 3W34A 1K5DA 2V55B 1G5RA 4V0LA 1T8UA 3LDAA 3REFA 4DSUA 2QT1A 4IFBA 5DE3A 5B30A 3MRSA 4M1MA 2ATVA 2XOKD 4JKIA 3P32A 1Z0DA 1KI4A 5DIFA 4A4DA 1IN7A 3C4JA 3DHWC 5DI3B 4BWYA 4Q03A 1Z0KA 4ZCMA 2GEVA 1FQJA 3I8SA 4DSTA 3PG5A 2I1QA 4PC1A 4BLQA 3ZVNA 2WSSD 4TN1A 1P2UA 4ZDJA 3C16C 3KXKA 3MWJA 4HAVA 4ARZB 2O0KA 3FKQA 4KFUA 4LSGA 2W2XA 1R0ZA 1KK0A 2GBLC 1T8TA 1TQ4A 5TARA 1RRGA 5BQ5A 1OE0A 1KDRA 3LBNA 3TQFA 4IOMA 3HPRA 4KSCA 4LHZA 4QRHA 2O8CA 3NKVA 2GEUA 1E99A 5A4JA 3UMRA 3NDBB 5FR1A 1Z5ZA 4QJ5A 1EK0A 1UADA 4B3FX 2RGXA 1RE0A 1EGAA 1EX7A 2AX4A 2EWVA 2GK6A 4MITA 1PLJA 2ZETA 2D06A 3D6TB 5FTNA 4LGMA 3SBDA 1E2NA 1UFQA 4RD2A 3LQQA 3GLGA 4BZQA 5GJCA 4Q4HB 2R6DA 3PUXA 1JR3D 1AS3A 1QHHA 2GAAA 2GJSA 2EU8A 2XTZA 1N5LA 5EXTA 4O0MA 1L2TA 2IYZA 3RSLA 4LBWA 2OO7A 3BBPA 3AH8A 3GLIA 3EG5A 1GKIA 4YXWD 1KI6A 3A37A 1SXJE 2IT1A 1QDEA 3SC3A 2W0MA 3N5CA 2P6UA 4QBHA 3CLVA 1KDTA 2ZREA 2AWOA 2QM7A 3OAAD 4ZI2A 1Q44A 4X8OA 2ERXA 2GKSA 4MUBA 1N5IA 4O25A 5CYPA 1KO5A 1S9HA 1XXHA 2RGNA 3FKSD 3V00A 4A8JC 3BORA 4BLOA 3AF0A 4TLCA 1KYIA 1YR7A 1YZKA 3L0SA 3DMNA 1ZU5A 2ODWA 3MWLA 4A8JB 1ANKA 2G3YA 1D6JA 3A1VA 4A2WA 4Q19A 3BERA 2JJ8A 4UXIA 4CVNA 4ESVA 3NH9A 3B1WA 1HTWA 2BJWA 4BFUA 2ASEA 3AVVA 2JGNA 4KBFA 1MO3A 1T0HB 1XTJA 4A92A 2ZI3A 4XSHA 4TZ6A 3T61A 1BYUA 4AG5A 1TADA 1DELA 3CX8A 1G6OA 2X2FA 3W6NA 1K5GA 1P6XA 1E79D 4JIMA 1B0UA 1WB9A 2IYLD 4B6FA 3NC0C 1S3GA 4NL4H 4ILEA 2ZRJA 3LD9A 3GLGE 1ZU4A 2A5FA 1FTNA 1GVNB 4PQRA 4Z8XA 4PO1A 1W44A 2F7SA 4QGHA 5EE1A 3KKMA 1J8YF 5L3SB 5FTLA 4LPSA 4MKHA 2GTPA 3NC1C 2WWYA 5JEDA 4A36A 2GCOB 3VR3A 3QF4B 1KAGA 3CWQA 2H16A 4LJ8A 4FCWA 5G53C 2DY1A 5D3QA 1XD2B 3NEJA 1P9WA 4HDOB 3PEUA 4XD7A 4LC1A 1DO2A 3QI2A 3QKSA 5SZJA 3AKYA 2P5SA 2WSMA 2QTFA 4HZUA 3EPLA 3LVRE 2O8EA 1FQKA 1VYUA 1JXOA 2QU8A 1V43A 4HB0A 1P75A 2QTHA 5FPKA 2QG6A 4GP6A 1XXHE 1AIPA 1YZQA 4M4SA 5FOVA 4AG6A 4NDZA 2HV8A 3MFYA 4JZKA 4P4SA 3U3RA 5L3QB 4FMCF 4TL7A 621PA 1MV5A 3QNUA 4V0ME 3HDTA 1KY3A 2XJ4A 2YWEA 1OFIA 5A0FA 4IDNA 4Q4JA 4KI0A 1YQTA 4HAYA 3CRQA 4I4LA 2KBEA 1R5BA 3B60A 4B43A 4EKDA 3IO3A 3WP0A 2C03A 4EJSB 2QA5A 3RS3A 1YE8A 1Q57A 4NYJR 5DNYB 1S9DA 3QENA 1G9XA 3QKTA 4OQFA 1Q1EA 2FFHA 1KO1A 2NZJA 1W47A 2OLJA 2PCJA 4KVAA 1UBCA 5JSZA 1RC8A 3LX8A 2C99A 1XTRA 2ZEJA 1DVRA 1R4AA 2BEJA 2ZVPX 4LHVA 2ZU0C 4B75A 4DCNA 5FTJA 2FU5C 4B3CA 4MRVA 2YZ2A 1PZNA 1JR3A 5LD2C 2C5LA 4KV9A 1ZUHA 3A8TA 4OQXA 5AJYA 1SQ5A 1DG3A 4BE7B 4F4JA 2O52A 2J0UB 4XSGA 1KI8A 2P65A 1KSGA 1PV4A 4BASA 1N6HA 2FX3A 4WBSA 4YMSA 2J59A 2RMKA 1COWD 2QBYB 5IHPA 3UWOA 2VLIA 1AZSC 2C78A 5B2ZA 4M1KA 2L0XA 1MKYA 4CEJB 4D0NA 1S1MA 5JJLA 2ORWA 4OKSA 2NPFA 2RAPA 3UKDA 1BO6A 2F1RA 4IOKA 4N0EA 3SOPA 4KHZA 4A0GA 3ZZUA 3OFNA 1GG2A 2FPLA 1X86B 2FWRA 5EXSA 2IK8A 3ND9A 2KI5A 1F60A 3PJRA 5JCPA 3KUDA 4QM6A 4AKIA 2QRZA 2MSDB 1OFHA 3WBKA 1EFRD 5C4MA 2PLFA 4GP7A 1FPMA 1YRBA 2WMOB 1IBRA 1EWQA 4ZCIA 3GJ0A 3W8RA 1TQDA 3FHTA 2H57A 4IEEA 1SVSA 4A6XA 4PAQA 1OYYA 1G8HA 3R8FA 4PAMA 2OAP1 4R2HA 2YKGA 3IEVA 3UANA 2CMKA 2PEYA 4OHWA 5FTMA 3H84A 1W49A 3WNCA 4MKIA 4URXR 1DAMA 1DO0A 1NMXA 1QVRA 5HTKA 5JLJA 1N6KA 1N3BA 1SVMA 3TH5A 1CJMA 1Z08A 4C0SA 4B76A 5JFGA 5JWRA 3O47A 1JR3E 4RCYA 4BLRA 3ASZA 5HZKA 4PO9A 2XXAA 2N42A 1IXZA 1FNNA 1W4RA 1ZM2A 2GF0A 2QP3A 4RKEA 2VEDA 3NBZC 4LJ7A 3Q9LA 1CR4A 4FN5A 5M04A 3B6EA 2P67A 1RKBA 3TR0A 5JSZB 3K70C 3DMDA 5J4LA 4W9MC 1VG0B 1U8ZA 4WA7A 2R8RA 1E2GA 1T4GA 5JMTA 1Q0UA 1TU3A 4UNPA 1JB1A 3HR8A 4PPNA 4Q1FA 3QBTA 1J7KA 3FMFA 5DH9A 3BD9A 1NBMA 1U0LA 4HB3A 3RYTC 4M8NE 2QPTA 1R8SA 1XD9A 2OG2A 2ZI9A 4I1VA 2V3CC 4D25A 1G1MA 2DCUA 4ZI3A 1XEFA 3SDZA 3S1AB 4W5JA 4ABYA 2XOKA 1KSHA 1M8PA 4TQ9A 2YHSA 2HDNB 1F2UB 2HLDA 1U94A 1CBUA 2ODBA 4D80A 5TXGA 1KJWA 2CVFA 1MO4A 1IJFA 2GVDC 2NO7A 3EIHA 3NVAA 2CCJA 4NYMQ 4D81A 3AVPA 1VG9B 3EZ6A 4K46A 2C9OA 5JHHB 3W6PA 1ZYUA 3L0IB 4OI1A 1Z2CA 2WSSA 3ONWA 2Q21A 1N5KA 2YYZA 3HPQA 2QL6A 1D9XA 2C9CA 4TL8A 4TMKA 4C0HA 4QKQA 4NONA 4C0KA 4Q7JB 4QNMA 4WZBE 2Q9BA 2ZRIA 1X8JA 2VP5A 4XH9B 721PA 2H7VA 4S35A 4W5WA 1G41A 4GT1A 1G6HA 5L3SA 5CLLA 2B92A 1X8LA 4A82A 1QHNA 2FA9A 2ZI5A 1JBKA 2WOOA 4DDTA 3IQWA 4JLJA 2R62A 1CRPA 1AQYA 2ZJZA 4JSTA 1XD2A 3I32A 1XTQA 3KJEA 4PAOA 5B57C 3T1TA 2EFGA 2FMXA 1RJ9B 1M7GA 2VHTA 3TJZA 2JLQA 1COWA 1Q3HA 3GEIA 2ANCA 4WVFA 1D2EA 2F9LA 4NP6A 3O8CA 3VU9B 4ON9A 3SFVA 1CJTC 3H1TA 2W0SA 4DCVA 3BB1A 5CLQA 5K8LA 3I1FA 1MOZA 3K9HA 4WOPA 2BM0A 3AF2A 5HE8A 3JVUA 1O87A 4S2EA 2BMEA 3EZ7A 3M6AA 1XCGB 2CXXA 4NYMR 3FMOB 4W7SA 2XSZD 4E5UA 3R7WA 4L9WA 2BM1A 2ORVA 2FDCA 2YC2C 5FFMA 1TQ2A 2CK3D 1NNEA 4Q5IA 4FWTA 3ZQ6A 1Z07A 4PO8A 4GL2A 3AGQA 2LWIA 3LV8A 3T35A 1XPOA 4GI7A 1HE8B 5AWFC 2O5VA 3BIFA 3SE0A 1TEVA 5FUXA 4KO8A 4X8MA 3UPUA 1R0XA 2UZIR 3B78A 2VHQA 1P9NA 5DI3A 1OIWA 1LNZA 1WF3A 2ZANA 4DSNA 4N0DA 4D0GA 4G01B 4AYXA 4WZAE 3F5FA 4Q9HA 3ZZTA 1CTQA 1N6LA 1R0YA 2JJ2D 5IRCD 2VYFA 1XJCA 2IUSA 2QUZA 4JT2A 3SHWA 4W5HA 3PUWA 2F3TA 3GJ4A 1P73A 1T5IA 3P1JA 2Q3FA 2D7DA 2WKPA 5LBIA 3TBKA 1SHKA 3ICEA 2X8AA 1G19A 2GJKA 3OEHA 4OHXA 1RPZA 3G0HA 2VTKA 3IHWA 5H70A 1H65A 2YNMA 3UIEA 4G0NA 1JQJC 3AKCA 2GF9A 3TSOA 4WAUA 2QPOA 3EIQA 3TLXA 1E79A 2DPXA 2A9KA 2V1XA 4JVNA 3KUCA 3U61B 1V5WA 3CM0A 1ZMXA 1I4DD 3CRW1 4RD1A 5FPSA 2XNDA 4D4JA 2XX3A 5E7IA 4PX9A 1OFTA 1N6PA 4ACAA 1NBMD 3AVYA 1KO4A 1GKUB 1EG7A 2C2HA 3Q5DA 1C1YA 5D3MA 1KMHA 2NO1A 2OM2A 5L8VA 1UBGA 2ZI7A 3BB4A 4GZMA 4OL0A 4G1UC 1F48A 4URWR 3JVVA 1NSFA 3K0FB 4P31A 2HLDD 3HYRA 2WHXA 3AQ4A 3D7MA 1E9RA 1U2RA 1AKEA 1ZNZA 3K9GA 4DCUA 5AR1A 2A5YB 3L43A 1A4RA 2J3EA 2P3SA 4JBXA 2F6RA 3T1OA 1XPUA 4XD7D 5LB2A 3GMTA 4BRUA 2OT3B 3SI7A 1W0JD 4ESHA 1E9SA 5ELXA 3W3AA 4YDHB 2ZRKA 1K6MA 4D26A 3R9WA 4HZIA 4NE2A 1ZINA 2E9SA 4PHTA 2J1LA 5DHAA 1JECA 3EWAA 4HZUB 2PT5A 4OBEA 2OV2A 2O8DB 3P4XA 2WMNB 2IS2A 3O8DA 2JLWA 3AP2A 1LB1B 4Q4HA 1XB2A 3LW8A 5JCZA 4CEIB 3A4NA 1Z3IX 5L3QA 2DFNA 5JI2E 1J99A 3CW2A 3RS5A 1P2TA 5J40A 4A8JA 1IY2A 1QHXA 1QF9A 2BV3A 3QE0A 4X8LA 3H2YA 4HDQB 5FL7D 4DLSA 1P61B 3TQCA 2ZSFA 1ZAKA 2Z6VA 3T1QA 1D5CA 2V4ZA 3RC8A 2N1BA 2X19A 5L3VA 2DFKB 5J4VA 4GZLA 2ZE8A 4JBYA 4LJYA 3IQXA 2Z43A 4TMVA 2CEAA 4JT4A 1YZGA 4C3ZA 2V54A 4XJXA 1R5NA 3LX5A 1NG1A 4G5OA 2WJHA 2WPDD 4WZ6A 5E4FA 5EXXA 3RWOA 5IK2D 2NMVA 4Q7MB 4BFXA 5C2JB 2OFXA 1P72A 1P62B 2HXSA 3AKDA 4AYWA 3THXA 4RVCA 2XSZA 3SYLA 4EFLA 3U60B 3LXRA 2CVHA 4F93B 3CO5A 3DOFA 4V0MA 2O8BA 1QBKC 2GXSA 2VRWA 4LZZA 5C46F 4A1FA 5AJWA 1QVAA 3ZS8A 1ZM3A 2ZSAA 1CU1A 1N6OA 1Q12A 4B3BA 1L4YA 4BUJA 3CPHA 3WRYC 2WWXA 3ZVMA 1MO6A 1G3IA 1DAFA 1R7RA 2H1LA 2WAXA 4C2UA 4NCHA 2J9RA 2ZS7A 4AURA 3DVLA 1TPZA 2YC4C 3AF1A 1G20E 2J0VA 3UWKA 3FMPB 2ZR7A 3ADDA 1Y3AA 4IW3B 4P4UA 4RFSB 1GOTA 1ZCAA 3EX7C 1EXMA 2SHKA 1FW6A 1A1VA 2JJ2A 3HU3A 4ACBA 3SHFA 3LNCA 3VQTA 1XBTA 2ZJBA 2VPPA 2VSOA
chains in the Genus database with same CATH superfamily
3C70A 2A86A 3ABSB 4HFJA 3NEPX 1WAMA 1LPAB 3PC3A 5DOVA 2RHCA 3H2JA 4KEAA 2NXCA 3OI7A 2UZ0A 4J0QA 4DLZA 3V97A 5AK0A 5AVQA 2CNBA 2X4IA 4RIEA 3K92A 1FS6A 3I4LA 3K1YA 4WADA 3ZE1B 3FOZA 3OEHD 4AZ0A 3WYNA 4DMUB 1RE1A 1RP1A 2BHTA 5F7ZA 3RRYA 3FHCB 3ASVA 3KE8A 3L7IA 2VOEA 4IDGA 1XO1A 2ZBGA 5GJWC 1M5UA 1V2GA 3RG8A 3ZK9A 2CLSA 1LXCA 5KTMA 1Y9DA 2GZAA 2HADA 3QW4B 4TTAA 3TPFA 1G55A 3WNZA 4UHBA 4RTQA 5DFAA 2H5IA 3CSUA 4YRLA 5MF6A 2IZ5A 1S8FA 4UUNA 4L16A 3ZWVA 5K6AA 1DC5A 1WCIA 5E1OA 5C7YA 3PGKA 3MJHA 4MO9A 4GDFA 4L4YA 4M1OA 1P91A 2VK1A 1QRSA 1AO0A 5IC5A 3O8QA 3O95A 2BIFA 4AY2A 3UH0A 1Q0RA 2JGIA 4FGLA 4J16A 5A6SB 5I5EA 1OB2A 2F9MA 1Y63A 5D8DA 3ILXA 4MX8A 2AR7A 4X54A 3OQNA 4FSHA 2PX8A 4UDOA 1N1GA 2CVPA 2WT4A 2WWFA 3A31A 4NE7A 4OJMX 4TMWA 3F5MA 2PSHA 3NT4A 5HOEA 5JS1A 4RHEA 4B74A 5NLLA 4YI5A 5CAEB 2ZT7A 2GCGA 5DTJA 1XRJA 3MHPA 4QQFA 2F8TA 3ZWOA 1A2OA 2R1TA 3K0EA 2QTWB 4BFLA 3MINA 5GP1A 4I46A 1IQUA 5ICEA 1XT6A 5T6BA 1WM1A 4AO8A 5MN5A 4DV3B 5AI6A 3E1KA 1XYYA 4ZXPA 4PGAA 4IHQA 2R1VB 3F67A 4FKBA 3G85A 3IKJA 5IF9A 1UWKA 4RH0A 4R8SA 1WIWA 3IRVA 3ZUGA 3U3JA 3S2ZA 5LKRA 1EX6A 2EZUA 4GMKA 4LRYA 5ALVA 1T2DA 4LMRA 5GOZA 1NGSA 1UPCA 2Y6UA 4FDUA 1L5FA 3OCVA 1VCOA 1ZOOA 4UEQA 5AW3A 2IXEA 4D02A 3FLBA 3SZGA 2VLBA 3VYVA 3H1BA 2AH5A 1R50A 2Y77A 5CVJA 3TRHA 2RCYA 4EPXA 2DPGA 4ME6A 2BVNA 1R27A 2PM8A 2YMQA 3O03A 4IFIA 3L6UA 2P9EA 3LKBA 1V4NA 4HS9A 5FL7A 5ITSA 1B6SA 1DINA 1A8SA 3C3YA 2IVFA 4FD2A 4BFYA 2R6FA 5KOJA 4QPZA 1CZHA 3C7DB 3SHTA 1JVNA 4OA5A 4WKGA 2B4KA 5AVJA 5LBUA 4B45A 3R4CA 2VSXA 2P0AA 4KOAA 1WO8A 4EI9A 1T0JB 1I6MA 1SBTA 2AOVA 4PSUA 4P7GA 2YXEA 3G79A 1NBME 3ELYA 2WPDA 1PYOA 4M36A 1HL7A 2O3RA 2XNSA 3FAKA 3SJCA 1Y3CE 2ZWIA 4DIFA 1II8B 3LHKA 4IJMA 2E4AA 1OI7A 4B3MB 4OMFG 3DFZA 2Q5IA 3FKJA 3UMFA 2C83A 5JPIA 5TF0A 5EE0A 3RD5A 3RPEA 3A0UA 4GMFA 1C30B 2GHTA 1VBKA 4ZK2A 2Z3ZA 1IB6A 3U3DA 1XVIA 2FPMA 2EKZA 1RPNA 2XY4A 4H1TA 4BGEA 1C9JA 4FEGA 2YMPA 1KHTA 1H2FA 4YIHA 1JRLA 4WTOA 2WD8A 1NATA 3E9QA 3WWZA 2ZAYA 3OD1A 5TQ2B 3K1AB 1NBOA 2V59A 3U7IA 1FF9A 1ABBA 2DH5A 4C05A 4PQYA 2WJIA 5B1SA 4MW2A 1M33A 4QXMA 1OOEA 3PA6A 3R6TA 2X8JA 4IDCA 4O2RA 4EUFA 1O08A 3EUFA 1EHIA 1X2EA 3O7MA 3QHAA 3ASYA 2OFWA 4XJTA 2VAXA 5AI9A 4KI7A 3WK4A 3HHPA 1F8FA 1U5BB 5H9VA 3L84A 3PD7A 4PNEA 4GIBA 4KMMA 1L9KA 1PJLA 2PGIA 2VHUA 4M1SA 4EG3A 1AG9A 1H2ZA 1CJUC 1KDPA 1M7HA 1XDSA 2CK3A 1QHSA 4LV5B 3PU6A 1G4AE 2B1QA 3SJZA 2QE6A 4YACA 3PUVA 3ADCA 1VG1A 1EEHA 2GJ9A 1WXFA 2IUFA 2XA9A 3N59A 3KIPA 1S02A 2PX0A 1SXGA 2CXRA 4MYDA 5TJ9A 4RM3A 5LL6P 4B47A 2ZE5A 1Y37A 4KFTA 3SC2B 3OWHA 3Q87B 2REOA 5LU8A 4C2TA 1FUYB 5FBWB 5GY7A 2F1IA 3C97A 3R8CA 1ZRHA 3TFOA 1UBNA 2ADFA 4YCMA 1UFOA 3U4GA 3U1BA 1CHNA 4MB6A 3IA2A 2P40A 2FZLA 3JAKA 1Y81A 2J5QA 4RC9A 3AUKA 5AI0A 4HFMA 4HLDA 1G17A 2J31A 3KR1A 4EUSA 2FAXA 2BM8A 5IHXA 1EB9A 2ACEA 4JB0A 5E95A 5LXTA 1FMFA 1YTUA 5DCYA 1XTTA 1NVVQ 2IPLA 3AINA 3Q9SA 5BMVB 2YNMD 2X8BA 4Y6OA 1DWPA 2ZULA 4F4HA 1C8LA 2HGZA 2O8VA 2QG4A 4EJ0A 4YMTA 2AXNA 5FPYA 4XCVA 4BLTA 4RXMA 5EJ8A 1CUBA 1X1SA 1ZVMA 3U3ZA 1XZBA 3TE6A 3U17A 4EJMA 1RXUA 4EHFA 5E2BA 3E35A 3T1YB 4NZYA 2A2ZA 5FTKA 1RWKA 4ZALA 1RJWA 3IP1A 3AR7A 5FNZA 4EX7A 1GNSA 2MSWA 5E8RA 1N9KA 5JBIA 2VAVA 3M70A 5DISB 2VDVE 3A6GA 3H42B 3TRIA 3BQNB 3CVOA 2C54A 3OD5A 4YRTA 5IKXA 2JFPA 2R96A 2NYRA 1IN8A 2TMYA 3KXLA 4M0MA 4CT5A 5B3LA 5KDDA 3V2GA 1Q0PA 2GA8A 4P54A 4AXXA 3LF1A 2NSHA 1K8YB 4HLNA 3RHFA 3WKDA 4HDSA 4JA0A 2I2XB 4OBWA 4H4CA 4CMEC 3GFGA 1L4HA 4RAOA 1Z18A 2VRBA 4I50B 1OF1A 4MVWA 1STOA 1UBEA 3E22B 3H1EA 3I8XA 2O8EB 3A9SA 1KDOA 2P11A 2WIGA 5BRJA 4ARIA 1XMJA 1YVDA 3Q7QA 2H2AA 2J3MA 2OM6A 4R98A 4DAOA 1E9CA 1GGHA 1UZUA 1I51A 2FZ5A 4NMXB 1GLGA 3O8RA 3TRKA 3W3AD 3AJDA 1KBQA 2Q3CA 2W2LA 2P4QA 1FUIA 1KQOA 1VRCA 2BF7A 3O3NB 4JHLA 4M0EA 4M46A 4HMOA 1HXHA 4YRCA 1G8FA 3AWDA 3DFFA 3NHMA 1B6GA 4WNAA 3RIHA 3OX4A 2JIQA 3WYGA 3RYCA 5J23A 3W8EA 1FDRA 2GOYA 3LA6A 4UKDA 5ALOA 1QRDA 3CNOA 1VJGA 4HWPA 4Z0TA 1WZEA 4X94A 3MLBA 1ZJYA 4D4KA 4TLBA 1VYHA 2JIZD 5IXYA 1P4AA 2VT7A 3V8NA 2WIAA 4JC5A 5GAJA 4BZZA 2UKDA 3EJ6A 1LRJA 2Y0CA 4RGYA 5JISA 5LP6A 5DM70 4RTMA 4BVKA 1TQ8A 1WB5A 3EIEA 4EA7A 3DOJA 3MJRA 2OFFA 1ONBA 2YOHA 1KK3A 3BJEA 1HT3A 2WJAA 2Y99A 3U3MA 5EPOA 4DNPA 2GM3A 4E22A 1EFAA 3WWYA 2CF5A 3ZDYB 4E4TA 5BSEA 2C1EA 5DT2A 4E21A 1RRCA 4RPCA 4KWHA 4XGQA 1GQSA 2NPIA 3F6SA 3AEXA 3EW9A 2H63A 4D4MA 1ZK4A 4AIRA 4FZRA 2YN0A 3CJRA 2H4FA 2MWMA 3HXLA 4X6XA 1A9RA 2D2IA 5IK2A 2H2FA 2JBHA 5CCDA 3TYXA 3K4PA 5T4BA 4AKHA 1R9GA 2ZVQX 5EIBD 4NYJQ 1Y9AA 2IYSA 3B7WA 1NU8A 2EG9A 3BRCA 3G2JA 4P58A 4X1KA 3RYHB 1DHTA 3NHPA 5AKXA 4FLFA 5E6SB 1E7YA 1KYYA 3CWZA 3IP5A 4ND1A 3SZMA 2XVZA 1AGPA 3NBYC 4AJHA 4JODA 4YUVA 4MA4A 3CRVA 1SCUB 2R8ZA 4RFLA 3ZNNA 1G4HA 2YWRA 1CUIA 3DWFA 4G8BA 4JP5A 2DQSA 4LQLA 1P7PA 5CW1A 4DR4B 5FPQA 3C74A 3HKCA 2CCGA 3JRNA 1MAWA 3I28A 3G13A 3OCWA 4OBXA 4WOKA 5FBQB 3RBAA 4BX8A 2IHUA 5A03A 4C7BA 1ULUA 1GA1A 3PDWA 5AVSA 4JLAA 5JW6A 1GZ6A 4Q1EA 1PEKE 3GLVA 2YOGA 1V47A 1YKFA 4GM1A 1SELA 4IDEA 3KB2A 3T9BA 2ZXUA 3K71B 3BGIA 2LIVA 2QYSA 3S68A 5L4SA 4FYVA 5TPWB 3VISA 5LQCA 2QT0A 3W5BA 2DVMA 3OJEA 3W8NA 1CV2A 3CJQA 3QUAA 1I1QB 1FMTA 3DZGA 3Q8MA 3MAGA 4F60A 4ETIA 4YUXA 1VLMA 5AYVA 3CG0A 5ICFA 4JL8A 3DL7A 3A7EA 3JWPA 5CW2A 3IR6A 3JQ9A 1HNZB 5DHFA 5HF6A 1E0DA 1M72A 2J5XA 4XPIA 3HZOA 2YVUA 1PX2A 1SBHA 2YVLA 1A04A 1NVWQ 3S7TA 1N4DA 4K88A 4WW0A 4Q00A 3EAFA 4BU0A 3E3LA 4MNTA 1XVLA 3DV2A 1SUWA 1QQAA 1E6CA 1KH3A 1MVNA 3L1JA 1BGXT 2Y1GA 3B6JA 3FGZA 5DM2A 3AY7A 4D9NA 5GONB 3I58A 3BH6A 3V2HA 4CV0A 2ZUFA 3DVAB 3CPJB 3CRMA 2Y1EA 1LA2A 2LW7A 2SBTA 1XKTA 4IXTA 4KH1A 3NEYA 3NKLA 1GGVA 4M0KA 4AD8A 2IXGA 4ZOLF 2WLSA 4FYWA 2EFDB 1G20A 1KZHA 3L04A 3ANYB 1RPAA 1GGFA 4ERXA 3WK7A 2CJPA 4HH4A 5CB4F 1SR8A 2O8BB 4KVGA 1U6IA 3TNDA 5CEJA 2QUIA 3E5RA 3V3TA 1EXVA 2CL6X 2KS6A 3NHYA 4BJ6A 2EV9A 3WA6A 2ZRQA 3SOZA 4A0QA 4BC1A 4MDEA 4CUKA 1A4IA 3AQIA 3KS9A 2GHIA 1GA4A 1M2GA 3QUTA 5DI9A 2G77B 3DV9A 4OO3A 1OZGA 1X6VA 4UBIA 4YMIA 1M2KA 1J90A 4EGJA 2FY8A 2GWRA 4REQA 4Y6QA 2ZS9A 5GADl 1X3SA 3IBGA 4L2IB 4BTLA 1LS6A 4DTCA 4DWJA 5LQKA 3DT6A 2H4YA 4KO3S 4X93A 2JHPA 1T8PA 1LK0A 3DE0X 4MVJM 2Q6VA 4D98A 1HPLA 1Q15A 3P20A 4QBKA 4KR2A 4GZ5A 1T8RA 4FGKA 2O8DA 4AIIA 3T41A 1RWVA 1TTPB 1GRCA 4P9NA 1T2FA 1DJOA 3ER9A 1A9OA 2C00A 1SZJG 1V4BA 2ZZKA 4E5KA 2WJ6A 3LP8A 3T7RA 2UDPA 3N75A 2WQZA 4AS1A 3ROFA 4BQFA 3UGQA 1NNI1 4MCAA 4U02A 2ECKA 3V1YA 2I1WA 3ZX5A 4J0IA 2WFZA 3GD7A 1C1DA 1YUMA 1U8UA 4JB3A 1T9DA 2A0XA 2W2PA 4LJ9A 1OU4A 3ZI4A 2Y9MB 3JR7A 3H4VA 1KI3A 3WAJA 4LZPA 1S89A 4H3SA 5HR5A 1ZVVA 1IEWA 3PYMA 4DQKA 1NL3A 1J8DA 1VI6A 3LT4A 3HL0A 3M6LA 4JAVC 5T3YA 3JWGA 3SDSA 5A9SB 4X41A 2ZIXA 3TX2A 1PWHA 3PA8A 5DASA 5ALPA 4C07A 3RRFA 5I7RA 1RJFA 4OPMA 3VZRA 1H8EA 2ZIAA 1QE3A 2FCAA 3K9NA 3ZU4A 1FFBA 3KLNA 5JRJA 3JSAA 3WNDA 1Q19A 3K4HA 4MP6A 4FCCA 3VX4A 4BFVA 2D1RA 3DT9A 1ISSA 2GZDA 4F4CA 2ID4A 4Y9TA 5K3SA 2UYOA 1YC5A 3X1YA 4FMPA 2VTDA 4E1VA 1ISRA 4I0WB 2GPWA 4PM4A 2FW9A 3IOCA 4R9SA 3QVVA 1GGJA 2C57A 2RD2A 3O2NA 3FGOA 1ESMA 3NNDA 5LFAA 2CXSA 3IERA 1G8KA 2DR0A 2ZJOA 5KPDA 1K7YA 2V7EA 4BO1A 1SHLA 1HYHA 1QMPA 2HC9A 3TXXA 4GGMX 5HK8A 3VZBA 3NETA 4OQMA 1FXSA 2HTFA 3IIMA 5AOCA 1N1EA 1V8DA 5EESA 5CLFA 3KQOA 1T26A 4QM7A 4R41A 4CQLA 4ZTBA 3NWJA 4YXFA 1KSJA 2XODA 1QAQA 2Q0HA 1XXLA 4L95C 3PCTA 4JBGA 1XU4A 1O5IA 3K96A 3F3MA 4PLGA 1I7QB 2PMDA 2GF2A 3G2NA 1LDMA 3PKIA 4LJ6A 4HCJA 1G21A 1W88A 3FTCA 3LXXA 5CNKA 1S1CA 4O3MA 2YUTA 2W5UA 1LDNA 4IV5A 4HQRA 4KLZA 4UHFA 2R79A 1YVPA 3LHSA 2OYRA 4W5OA 3EAQA 3L8HA 4XQEA 3TNJA 2FTKE 4XYLA 1BDIA 1JSXA 4BXOA 3EYAA 4CV1A 2PS0A 1GG9A 1EDEA 1QFSA 1T5HX 1VRVA 1DAIA 1EVLA 1S01A 2PSEA 4E3ZA 2JIDA 3VNUA 2XRZA 4ZQIA 1TCBA 3M4ZA 2ZJAA 1X3LA 2OECA 3VI4B 2ZYWX 3HDVA 2K5UA 3LOQA 4M2LA 2FGJA 2GZRA 4XJVA 3PUJA 4HXFB 3GEEA 2FFJA 4GBMA 1RFGE 3IH5A 4WOCA 3O4JA 1BH2A 4P4TA 4HUTA 4Q7QA 5BSGA 1K4MA 3W2IA 7MHTA 5AOBA 1ECLA 2Q4EA 4MVJG 4A6PA 1SKBA 2XITA 3LHIA 2E87A 1B93A 1O96A 3OEED 1VE9A 2C2OA 2FQ1A 2G6TA 4AJOA 3EVZA 5JYEA 3OQIB 3GGSA 5ALGA 1PEDA 2X3UA 4DANA 4MVJF 5ICGA 2DHRA 3QWIA 4UXJA 2X0EA 3RYHA 1N2ZA 4PF1A 1HURA 2D7CA 1DEOA 3D5QA 3IKLA 2QT9A 1UOPA 5B58C 4QJIA 1DBPA 3WS7A 1NG9A 2HW8A 3MIZA 2R8YA 2V7QA 4OXXA 3T99A 2C5HA 3HJTA 1MEJA 4HVLA 4MHSA 4R2WA 4MUFA 4GL4A 2HPVA 2JGFA 3AHGA 2CE7A 4JL5A 4NICA 4JSYA 1AQIA 2F3SA 3RK0A 4NC9A 2ISSD 4QARA 1WF6A 5KJ1A 4FW9A 4U9IS 1GADO 4G0MA 5E1DA 4FDMA 4PZEA 1PW5A 3E3AA 3EQ6A 3D54D 2RKOA 3DYIA 1FFGA 1FDVA 4LX0A 1LPBB 3OTWA 1Z22A 1RM4A 2OHHA 1TVCA 2YFQA 2GBLA 2QN6A 3GLHE 1CKEA 2C0QA 3BYZA 5CYOA 2C9ZA 3W9UA 1DBRA 4JLKA 4WL0A 4EAQA 3F3KA 3LO5A 3OJCA 4MYCA 1XX6A 1J5PA 1QYXA 5IUKC 2UZ1A 3IVRA 4C7OB 4IPTA 1ODFA 3CVUA 4TSKA 5CRIA 1MRZA 2OP0A 4RACA 4HGPA 2YZNA 2E18A 4YJHA 3CF0A 4B3RB 4ZAWA 1NI3A 2HQRA 3BC1A 3GDOA 3KQLA 4CM9A 5H16A 4EDHA 1FE8A 3EDCA 1LV8A 4Y2UA 3QU7A 2Q6TA 3AVXA 1VL8A 4E33A 1IRXA 4RJKA 3MMXA 2AW3A 1NKTA 2EBFX 4D43A 2F43B 4F21A 1OWPA 1YS4A 3R3VA 1TEXA 4FFNA 1E1CB 1TUIA 4C0WA 4ZVSA 2VJOA 1GR0A 2C5FA 2OBMA 4P38A 2BC9A 4EJ2A 1CE8B 2YJ6A 4HR7A 4L76A 2HMTA 2OVFA 1W1WA 1MMFB 2F1JA 1T2AA 2AFHE 2XXBA 3OE7A 4XX1A 4AJEA 1TYDE 3F4KA 3FPKA 3K15A 4G0OA 5ALQA 4EEZA 2L19A 5EXPA 3VH4A 1Q1NA 1T5LA 3WGTA 4NR0A 5LUAA 3C48A 1C9KA 1P17A 4YAKA 3N0XA 2NACA 1WMDA 1Q7BA 2I6SA 1VA5A 2ZJYA 3LCRA 1MC5A 3DONA 2ZROA 3QBEA 2NN3C 4QGGA 1AU9A 3HN6A 4YJGB 1X9GA 5FYQA 3FNIA 3TE7A 3UOWA 3W7VA 4BAZA 1EUYA 2J4FA 5HJ7A 4F8EA 5G3ZA 3VU0A 4XI9A 1J39A 1FX0B 1V1MB 3H05A 4KDCA 4O4HB 2GM9A 2DPYA 2QPAA 3EG9B 5JPDA 1JJIA 1DC4A 4C3OB 1QNFA 1W0KA 3U3OA 4CR7A 4Q1DA 3EWIA 3ILHA 4HADA 3W5UA 1QX4A 5BYKA 7REQB 3MCAA 5AM2A 3CH7A 1FZTA 3GCWA 3IP9A 1T5TA 3ZWNA 1Z0JA 3KVRA 1AQJA 3OIDA 1SG0A 1M34B 5GV8A 1LTQA 1KIMA 4GUAA 4D9KA 3Q8XB 5LB4A 3I34X 3C1TA 4GZ6A 4I6EA 4P5PA 3RE1A 3VPGA 4DY6A 1JWBB 3HYTA 1M66A 4IIHA 3C6KA 1AQUA 4L6AA 4MMYB 4NCKA 3WR5A 4F12A 4O02B 1H6DA 1GM5A 1HDOA 1SC4A 1YS7A 3CXRA 4WEOA 3JQAD 1WBBA 3CEJA 3TZCA 2P91A 3FRJA 2V6GA 1W2GA 3GP5A 5AP9A 3VAZA 2AZXA 2QVGA 4DA7A 4N5MA 2V6FA 3EASA 5AVRA 2E21A 4FFPA 4YPOA 1WV1A 3DPUA 3PVSA 3DTVD 4IDAA 1HH4A 4EBFA 1KGDA 2VF7A 3EDOA 1AN0A 3HLKA 1V7ZA 5J9FA 3ZHVA 4C0AC 4UBLA 4GEGA 4BO5A 5JNVA 4X1KB 4OHFA 3CFYA 5DW3A 1HO3A 1KAHA 1W6UA 3PXAA 1XZGA 4H08A 3KTAB 2BMVA 4EY5A 3CG4A 5IDWA 1MUUA 1N5RA 2MR5A 1A3CA 3FE2A 3KHKA 4LDQA 2ZT8A 3QJ5A 1SUBA 4URUR 3VPCA 3AKZA 1G7RA 3SF8B 5DNDA 2HV9A 3CRNA 2PFKA 3R77A 3DXYA 2YOFA 2J3KA 4Q1AA 4C4TA 4WK0B 1Q0HA 1SXIA 2G72A 2E4VA 2AV6A 3BHJA 1G4UR 4N48A 3HCNA 4OQPA 4B83A 3GGDA 2J30A 2JAPA 2W2TA 1CJVC 1FP4B 2WSYB 4K7JA 4BP1A 2C4TA 3L93A 5F1KA 3E05A 3H04A 1Q22A 4M0LA 5LLTA 4IICA 5F2EA 2ADMA 4XYEA 3CTPA 1GPLA 4LHYA 3DDCA 2O20A 1U8FO 4XTCS 1BXGA 2XDWA 4WNAB 1E9FA 1W85A 5H3HA 1T3SA 4PCLA 1ZI9A 2ZTMA 4BEVA 4E7PA 4ESOA 4UNRA 8MHTA 4FINA 4KZKA 1AUPA 3EMDA 3ZYCA 1MX9A 1JDUA 2FMUA 3BRWD 4P33A 4PCVA 2O2JA 3GQVA 5HX7A 5J43A 1MJNA 1T91A 2OV8A 3IMKA 3FCUB 2O7RA 4HFNA 1P2VA 3VH2A 3WBJA 5ITWA 3Q6NA 2O2ZA 4XFDA 3G2LA 2ZSJA 3R0IA 4BMOB 4X90A 3U9SA 1TUGA 3FFXA 4IIEA 2OR3A 3TLAA 1RC0A 2QXYA 2EKLA 1JHZA 1MW9X 4CV3A 3SK0A 3MCUA 4BXOB 3SR3A 1TYBE 2JGDA 3DEKA 2I4OA 1OLXA 1QGAA 5D01A 4OHVA 3TZLA 5JAQA 1XQXA 4D4IA 3ZJUA 1G9SA 2QQFA 3T3PB 1BD4A 1EFUA 3LQYA 4R8MA 4YK7A 4B35A 1QQBA 2A0UA 3RARA 3QV2A 2Z0MA 4NZMA 1TF5A 2AF3C 5ICSA 1VC2A 3CTMA 3V33A 5DLDA 3NBQA 3I12A 1F9EA 1JG4A 2VT2A 2A9FA 5KYUB 3D1VA 3PRYA 1IXSB 3IDAA 2O8CB 4IIVA 3IUQA 4H6WA 1IDN1 1E0JA 1MZPA 1KZGB 1HKUA 1JDPA 3PFIA 1KEVA 1WY5A 2YIJA 2C77A 3OLCX 1KU0A 4JOBA 1X13A 2I8LA 2JD1A 3NT2A 2BGTA 5E4JA 1AXEA 5GJVC 4D2IA 2FMFA 1D2AA 4L5BA 2DG2A 4LXIA 1ZNXA 3L6CA 2OY0A 5LKAA 2ZS8A 2VEOA 2Z58A 4M22A 5DYWA 5ARBA 1K8RA 1H9AA 1QYRA 3R44A 3U40A 1HTTA 4FIDA 4K6GA 1GCGA 3GFRA 5BSRA 1Z38A 3OZUA 4DHWA 1WHSB 1EZ4A 1TMGE 1LLUA 4C06A 2GN4A 4IHJF 1VSTA 1XTIA 2PYIA 1DX6A 1N2CB 2JGEA 4YMVA 1P74A 3R9KA 2FUG1 4BFTA 4MLDA 2RHMA 2Z8YM 4R1OA 2QXTA 3IXQA 1YJAA 1E6EA 5JLAA 3JQ8A 3PENA 4LNUA 3KZ1E 3MN1A 3C1AA 1KFEB 4M9XA 4ZRNA 3UMSA 4PN7A 5KTTA 4J94A 1E69A 3FYCA 4D57A 2QD2A 3EZFA 3IELA 1Z0ZA 4V0KA 3ZX4A 2PUAA 1AKYA 3HDJA 2PBLA 2HIMA 1K08A 1L7OA 2GUGA 3OT1B 5GGYA 2IS1A 2EKQA 3ODPA 5CD9A 1PQYA 2IYNA 5DNCA 1XPRA 1XNHA 4Q34A 1XEXB 3DMTC 3D31A 5K0LA 3P71T 3WB1A 3VC3A 1CQPA 1QVWA 2QAGA 1CY0A 3QMPA 3WV4A 2NPOA 3UJCA 1H4QA 3U4MA 1KHHA 2I62A 2FQWA 2ZATA 3QYJA 1L7RA 3CMMA 3HFGA 3CEAA 4GC5A 3TOSA 3L40A 4F3YA 1I30A 1B43A 1TLFA 4IEFB 5SY4A 4BAGA 2W83A 1J2EA 3I5UA 3KR9A 4XWTA 1IG3A 2C88A 2R8EA 4LHXA 4X1OA 2M2IA 4DZTA 3KT6A 3TAXA 5AVTA 2BFFB 1RU3A 2GBFA 4Y2YA 2QQEA 2VXCA 3ZTTA 2PGNA 1CEXA 4JVSB 4MR9A 3R20A 4I36A 4UBJA 3FCXA 4QFMA 4YI3A 4GX5A 3WWPA 2OV4A 4CGYA 1X15A 4Z49A 2EP8A 3H7AA 4KN9S 1OPXA 2G08A 1PSWA 3IAFA 1B0ZA 1IZ0A 1PT7A 2WIKA 4OLFA 2Q5HA 4MA5A 3ZE0B 4TV8F 5A1TA 1NUPA 2JI8A 1GDDA 5JC1A 3K9FC 5AKGA 4OFBA 5DSZA 3IIIA 4O1HA 2P90A 4G1MB 1OBFO 4IDOA 1H1TA 3FDIA 2XMZA 1ULHA 3GROA 2ZPTX 4KQXA 3TW8A 1OUMA 4UPVA 1UR5A 1ZONA 1LWOA 1QCZA 3OG9A 4ML3A 4QOJA 3PFGA 1HDZA 4QNRA 4ZQHA 3ZXUB 5AESA 1XP5A 1T2EA 4OP2A 4UPDA 3ZWMA 1RC1A 4IGEA 3BSFA 4Z86A 3UV7A 4AJ1A 2QIOA 3DQPA 1FX0A 3PNMA 1IC6A 1P1FA 1I3KA 1CS4C 1Z26A 2ZRBA 5JSYA 5FBVB 3G0CA 5FLEX 4CEIA 2WG0A 2OXIA 1F6BA 3N8DA 2YBDA 3LFTA 3V8EA 4UCFA 1VMKA 3V46A 4AF8A 1L5NA 3H9UA 4BKRA 1FFEA 3JQBC 4O1MA 4BVJA 3H3FA 4CQJA 3OH8A 3A6HA 3HLYA 4WXRA 5F73A 1IOZA 1LKZA 3DDWA 3EXAA 1OW3B 3PHGA 3Q98A 4WACA 1GRRA 1RM0A 1IEXA 4LE2A 4TLMB 4ZU6X 1THZA 3SY8A 3W8DA 2IHNA 1J0EA 2EXXA 1EFPA 5ERGB 1R0LA 4FUTA 5GVRA 2O5EA 4HDMA 4H0FA 1KTVA 3QXHA 1GAJA 4ETWA 5GVSA 1PEAA 4MUIA 2BBWA 3ZWBA 1L5HB 1M0EA 1EJBA 2FEAA 1D7OA 4NEHB 4FIZA 4D9EA 4DM3A 4PQFA 1M2EA 1CY7A 3AR5A 4ZCLA 4ZDWA 4A0HA 2OD2A 1RAFA 1P2SA 3FPBA 1KDZA 5CG2A 2HAEA 3B3AA 3V8BA 2PEZA 1E1QA 3KKQA 1KQNA 5K1ZA 1PZMA 3VKFA 4LV8B 2FW0A 2VA8A 1TCCA 1RJGA 2HIAA 4RSMA 1GL9B 4WY5A 4WA8A 2NP7A 2BZ0A 3JR3A 2G1KA 3GB9A 5J47A 3Q6IA 2IHBA 3FCOA 4W5TA 3D6NB 4HTAA 2GRAA 1IB0A 2BM9A 3VKWA 2CFSA 4EGFA 4MGZR 2FW8A 1YE5A 4GOKA 1RZRA 4YALA 3OQPA 3ES9A 3CN7A 3IKMB 5F1OA 3I64A 1VIYA 5ILOA 1FP4A 2E2WA 2W8BA 3AHHA 1KFBB 1FJHA 1CUYA 2GTHA 3EQ7A 3OIVA 2IV3A 3K53A 1SO8A 4HDCA 1DHRA 2GUWA 4MV7A 1W4BA 2E89A 2Z4SA 1QLJA 2NQTA 4IQ4A 4ZO6A 1QB7A 4L0CA 3VR4A 4FNMA 4WDQA 5H83A 4CKEA 1C3VA 1EUCA 4JI7B 1JAHA 2R6AA 1P31A 1J8FA 1PFKA 2DWUA 3DYVA 4WECA 3GPBA 4DT1B 1OKKD 5CJPA 3U1VA 1YI0A 2QE7A 4A9AA 2QR5A 2AC7A 5K01A 1RYBA 1TZKA 2OZVA 3PC6A 4QULA 1ZMTA 5KYNA 4HYTA 3ZYZA 4TZ0A 1E4EA 5DBEX 2WTAA 4P3YA 1PJRA 3EXHA 3A1NA 4FUQA 1CDZA 1VI2A 2QZ9A 3QMVA 4JP8A 3RSQA 4TT3D 3E9ZA 3B12A 4MINA 3CNLA 1NY6A 1W73A 2X9QA 4LJKA 1FRNA 4X24A 3I45A 3KQSA 1R0WA 4GQBA 3K30A 4M37A 3ZD7A 5CVUA 3CX6A 3Q9UA 3MJEA 1GTL1 4FK8A 1QYCA 1XLVA 2DLDA 3KEMA 4M49A 4DLRA 4Z2AA 1VCMA 3CLSD 1ZIDA 1KRHA 2B94A 1O4WA 3FNHA 3GLHA 4QSMA 4N01A 3RU7A 2WJVA 3VBEA 2QRUA 3SXUB 3FFBA 2PQ2A 4W9NA 3SAJA 1I2CA 3NATA 4KXNA 1QG6A 1CUEA 3CONA 8ATCA 2XBLA 2XF2A 5HIIA 4ZU1X 1PRYA 2H7XA 3ACCA 1DO8A 3PSAA 1I4LD 4TV9A 1R18A 5JZBA 1T9GR 1JKMA 2Q99A 3L05A 2R1ZA 3D0QA 5EHZA 3M5CA 2EATA 4YR9A 2O2HA 1PAUA 2V5UA 3DMRA 1Z5UA 2PFSA 4O4JB 4QOEA 4GVPA 1WD7A 1F3OA 2IRWA 2QZJA 2OTCA 4J1NA 1LK7A 1NURA 2A59A 5FD8A 1LZLA 1NF9A 1NONA 3PUYA 2REBA 1KWGA 3GLGB 1L4LA 1DJPA 3M9LA 3ZOKA 5C32A 2WIDA 2XYPA 4KX3A 2LTAA 1WLSA 3QW2A 3R6DA 5IJAA 3U62A 4B3GA 1N2JA 2XNJA 3WGJA 1N36B 2HHLA 3PPWA 4B6GA 3ETCA 1HX7A 4ZRDA 1U2GA 5GINE 4UFPA 1Z8FA 1FU8A 2P5TB 2VHWA 3L8YA 3PX2A 2OXRA 3WO1A 3PPYA 4OKIA 2HCJB 2ZZNA 2VK4A 1T1IA 2VJNA 3F5QA 3G7SA 3SG0A 1SWWA 2BT4A 2ZE7A 4UREA 1JLMA 3M49A 4YDQA 2I7VA 2V6MA 4PYIA 1YZUA 2QMYA 2PU7A 3D4OA 3EVDA 3MTAA 3O8BA 4Y1RB 3NP9A 3TMKA 4KBGA 2Z3WA 2Y8EA 1QNLA 2ZSDA 3RTBA 2HSGA 3OKPA 4M0DA 2ZJ2A 2PL9A 2PKRA 4Z9BA 2PT7A 4Z3KA 1G18A 3SIPA 2PMEA 1DWUA 1XXHB 1K3UB 4AJ9A 2ONJA 3VXKA 5D7BA 1C7FA 2DFLA 5G1OA 1YI8A 3O1IC 3NNSA 1IVSA 2IPOA 3PHJA 5JU6A 2VPWA 1WHTB 1MN6A 1W30A 1C2TA 2QAGB 2YY6A 1QHHB 2BR3A 3PQFA 4TLAA 2QYHA 3SF8A 4D3FA 4YJFB 2DTEA 1EBBA 2J3JA 5HPYB 2GHRA 3AHJA 3TIFA 4CEHB 1NHWA 2EBWA 3EC1A 4LDZA 5JBQA 3FPAA 3UICA 3EOAI 2RGDA 5IANA 1JAIA 3UT5A 5J5VA 4UM9D 5AJUA 2WF8A 4F92B 4RA9A 1V37A 1MH1A 1WPGA 5AW8A 2V0GA 1NUAA 5BRAA 5EY5B 1OX5A 3F90A 3SEQA 2RGNC 1MJFA 2QW0X 3HQ4O 2O9JA 1WV0A 3GGOA 3L7AA 1T9HA 5KSZA 3L4JA 3MD9A 3H9CA 3GFVA 4PTZA 1XEWX 2BUCA 1X77A 2A88A 2CXOA 2KM1A 1EI9A 1NPTO 3MEQA 1UAAA 5TF4A 4LX8A 5EKSA 2B8TA 2ZTUA 3H17A 1KE1A 4UOZA 3SD7A 3E9EA 5H3LA 3MJCA 3RRMA 2WKWA 5LDGA 1W52X 2J87A 4RHCA 1CX9B 4ZCPA 2VZ8A 1QIDA 3UUWA 5IN5A 4R9UC 3TSYA 1Q50A 3CVYA 1B8NA 4X95A 1W59A 3E9CA 3TIVA 4CMHA 2H9AA 4G6ZA 2X15A 2JGAA 3FVVA 4HQNA 4DCPA 2ZM5A 1F20A 4YMUA 5JO9A 2AMFA 3AR8A 4K8OA 4DUGD 1XDWA 3QLVA 1AE1A 2VQDA 2PBFA 2VDKB 3D4PA 4NJMB 3EBPA 2GJ4A 2FZCA 2Q3MA 4X65B 2DZDA 2RGEA 3KYDB 2Z2ZA 5BP7A 1MCZA 3ILYA 1J0BA 2EJCA 4Q66C 4JJ4A 2AD1A 2GBCA 3WSTA 4ZIRA 3W4JA 1IHPA 3N86A 4LY9A 3KC2A 1WE2A 4B17A 4ZOLB 2ZIWB 1QTNA 4GRDA 4Z54A 4EKYA 3A3KA 4CCSA 2GETA 1U0RA 3MERA 1LJUA 3DB2A 3CB2A 3GO4A 2G6BA 4E88A 4F3CA 4MMZB 1IN6A 3V32A 1CP2A 4CTOA 3G5AA 1VKRA 3HSKA 3V8QA 4MTLA 5KYXB 2VUSA 3F3SA 4I3GA 3COJA 4JI0B 5AQ1A 4JDUA 2C4WA 4BNNA 1B15A 1IBKB 3B2NA 3DMYA 1F8XA 2C42A 4FFLA 5LQDA 2EZTA 3OZIA 3TCKA 5IX8A 1MRSA 3VHRA 4CLDA 2MMCA 1BG6A 4IWYA 3I9MA 4N5DA 4E5DA 3Q5EA 3HU1A 1MVLA 2NO5A 5FTWA 4LYGA 4RY8A 2G8LA 4JI1B 3KWJA 5ILQA 5DNUA 1NKSA 3SQXA 3KJNA 2RHLA 4LKOA 2W93A 1DT3A 3S27A 1RI2A 3R74A 5B37A 1L8OA 2H4HA 4UVGA 3THYB 3QF4A 4UNNA 3O3CA 4FT4A 5KNDA 1RQRA 4RZUA 5F5XA 1UPAA 4QUIA 2J08A 4DL9A 3MS4A 2P75A 4Q9AA 4QTZA 1A9QA 1ND6A 4JCOA 3ICQB 5TQ0A 1C0PA 5C18A 1JAXA 2JCVA 1JEJA 3IDFA 5LQNA 2CV0A 2FWBA 2FW1A 3KEFA 1NF3A 3DZFA 4IIYA 3IKTA 4EPWA 2PWYA 1E3IA 1VIMA 2NZ2A 4B2IA 1NP6A 3VNSA 4JLUA 1CJCA 4YWJA 1OXXK 4FR5A 4EJSA 1YD7A 3L4EA 4LDPA 2JGLA 1E4VA 3V4FA 4QXQA 3OX3A 5DGCA 2YINC 1O5OA 3BXOA 3U5ZB 4NCIA 2J9ZB 4L73A 3THWA 3U7QB 4EZEA 4UOEA 4BTVA