4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
4QGHA 2Q3MA 3RC3A 4A36A 3EAQA 4TMXA 1ZNXA 4PHHA 4ZO4A 4MKFA 4H1VA 3B2EA 3A37A 1EXMA 4AYXA 1KDRA 1D2NA 1ZD9A 1NKTA 2H7VA 1XXHA 2HYIC 4LZZA 4A8JA 5IHPA 1IOZA 2FEMA 1NN0A 5J4VA 1CJVC 2ZI3A 5DGXA 2CMKA 2WOOA 1UBCA 2OZEA 2EFCB 4EUNA 1E99A 2P5TB 3U7EB 1E2JA 1T5LA 4LBZA 2I3BA 2QT1A 1NKSA 3NC0C 3WYGA 3A6PC 3FB4A 3WRXC 4NE2A 3C5CA 1IN7A 4TL9A 1OH8A 1HQYE 3I72A 2IW3A 4PO9A 1W7AA 2G0TA 2PZFA 4A0RA 1DADA 2XXAA 1P2SA 2VBCA 3HP1A 5FFMA 5E3HA 4KFTA 4H1UA 1AKEA 2VHUA 1HYQA 1UJ2A 4M1KA 2EU8A 4LBVA 1JJVA 1W0JD 1T5IA 4I4LA 1ZD1A 4YXWA 1N0UA 3FMPB 3RS3A 2O0JA 2IWHA 4DJTA 5FBQB 2XX3A 4OHYA 2ZYWX 1P9WA 4I81A 3AVWA 3L8YA 2CHVA 1I4LD 5CM8B 1QHGA 1TQDA 2PMKA 2DCUA 2ZU0C 1KK3A 3ZZTA 5GVSA 1U0JA 4IOMA 2GBLC 1S0UA 1X8LA 2WJVA 4X8LA 2HXYA 2ZJOA 1SVWA 3B60A 1GRRA 1Q3HA 1XMIA 2W6ID 3EXAA 4RZ2A 1TMKA 2X2FA 2FJUA 3ZS8A 5CJPA 4BLRA 2FX3A 3TLXA 1G8YA 1NP6A 1Z6YA 5K8UA 3W3AA 1R10A 3NKVA 1ZNWA 1SKQA 4M1YA 3VQTA 3LLMA 4JLDA 2ZSBA 3LLUA 3KQLA 2B8WA 1NIPA 1F2UA 2BCGY 3QF4A 1HUQA 3BFXA 1GDDA 3GJ0A 3RSLA 4E22A 1TQ2A 2GCPA 1XTIA 2RHDA 4TLDA 8OHMA 2JLSA 2WJJA 3SJCA 2NPIA 4L8GA 2ERYA 4US0R 4WXRA 2ZUBA 3GJ5A 2C8VA 1ELOA 1DAKA 1A7JA 4NCIA 3DOFA 4HEJA 3Q8XB 2GKSA 3H1TA 1RKBA 3AQ4A 1CULC 4Q1AA 5DI3B 3HU3A 1SXJA 4GNKA 2LCFA 1IXRC 2HT1A 1NVUQ 2PBRA 4DEXA 1A4RA 4A8JB 3WYFA 1IY2A 2JJ2A 2QRZA 2I4IA 4PTLA 4BLPA 2ZSAA 2WIBA 4GI7A 4U00A 4A2WA 1F2TA 3VR4A 1GL6A 2IS6A 2V6JA 3OE7A 4HUQB 3I62A 4R98A 5HCIA 2YOFA 1CTQA 4XWOA 3LQQA 2QENA 3MAAC 3TQCA 2IX3A 3VX4A 1OXSC 1E96A 3DEFA 2DFLA 2F9MA 2AXNA 2ZR0A 3UXMA 3NBZC 2H1LA 4TMTA 1YQTA 5J4YA 4Q9HA 4KBGA 3KQHA 1YRAA 5JJLA 3ADKA 1KY2A 3VKGA 2OILA 2IHYA 2REOA 1E2PA 2ZIAA 1FL9A 3KFVA 1W4RA 4URVR 4Q19A 1Q20A 1HE8B 4YC7A 3U3MA 1AGRA 2JLYA 1LF5A 4LJ5A 1XTKA 2WJGA 1G3IA 1MO6A 3IBYA 5E4FA 5FTJA 4JLOA 1VG9B 3ZLJA 4TTQA 2BKEA 2OLJA 2CK3D 1G19A 3QKUA 1YE8A 1EK0A 3FHTA 4X8HA 2BCJQ 3ND9A 3R8FA 3KTAA 1DPFA 4BFXA 3THYA 5TB5A 3EG5A 1S96A 4B35A 2GCNA 2KBFA 4HI0E 1A2BA 4Y0VA 2V1UA 4C0BA 1OJLA 2ODNA 1N6NA 2BBWA 2VTKA 3BS4A 2XJ9A 1GZSA 4KHZA 1YZGA 2HF8A 1U90A 1GNRA 4AKGA 1G16A 1P3JA 2QL6A 1HT2E 4AKEA 2DB3A 2R2AA 2V54A 1KJYA 2OEPA 1A2KC 4M2LA 2ZJ8A 4TL7A 4V02A 1NBME 5JI2E 3I8SA 2ZPTX 4DT1B 5FBRB 2DPXA 2FSIA 4KVGA 3ZJYA 1R7RA 3GLIA 1II0A 2H8KA 5FPKA 4LHVA 5CLLA 3VKHA 2ZRAA 4D4LA 3T61A 5JJKA 2QMUA 4RKEA 2G1KA 1LFDB 3CH4B 3X2SA 1R2QA 4TYQA 4OQFA 3DOEA 2F1RA 1R5OA 1BYIA 3SU8A 1G20E 4PHFA 3RSOA 1E79D 1IN4A 5EXXA 1FUKA 4Q00A 1J7KA 4ABYA 1N0WA 1XP8A 4E07A 3WNBA 4ACAA 2HLDD 2QORA 4JVSB 4MRVA 1NBMD 1NVVQ 4YONB 4DLVA 1U0LA 2HCJB 3O8RA 4A0FA 3U60B 1NI3A 4MKGA 3BOSA 2C95A 1PLLA 4NHOA 5E7MA 4DLZA 5AR1A 5KSZA 1OSNA 3U6BA 3ZDQA 2F6RA 4AG6A 2HLDA 1UADA 1R0YA 3B9PA 2WM9B 1E0AA 3IO3A 4OK3A 1V5WA 1U81A 4HATA 4PSAA 5EUQB 1BKDR 4KODA 1P2UA 3R9WA 2OAP1 1T3SA 5HKKA 5DISB 1BYUA 5E95A 5BYJA 4Q1FA 1Y3AA 2DHRA 3QBTA 1Z29A 1G41A 2Y8EA 3H84A 1W47A 1SVOA 3LBNA 1RRGA 5ELXA 4IEEA 4A1FA 1E1QA 4QM7A 3PR1A 4EFMA 1MO5A 4P31A 3A58B 1P9RA 3AF3A 5DH9A 4DIDA 3RRZA 4LOAA 1YZKA 3AF2A 3LFUA 3GLHB 4TSFD 1N2CE 4EFLA 4M4SA 2A3RA 4BECA 1OF1A 5HE9A 3GEEA 4QHSA 1WP9A 1E1QD 1SHKA 4WA7A 2QY9A 3SJZA 2P0EA 2NO9A 4Z8XA 4KJZA 2VSFA 3UANA 1GFIA 3B6EA 1R0ZA 1OFTA 4ZDJA 5IK2D 3SOPA 3LD9A 4RY2A 3EPKA 4JYBA 2QAGA 4V0LA 3WMGA 4J0QA 1UBFA 3GP8A 1II9A 3CB4A 1KDTA 4HB3A 2YZ2A 4HZIA 5CB6A 1CR4A 4KYIB 1YVDA 3W6OA 1YR6A 2ZR7A 2NZJA 3ZH9B 3CIOA 2D62A 1LS1A 3B1XA 4LJ4A 4Q7JB 3U4QB 3C15C 3SYKA 4AURA 3W8RA 1RRCA 3LQRA 3AV0B 2O0HA 5SZKB 3V4RA 1UKVY 3TIFA 1N6HA 1YR7A 4XD7A 2QA5A 3TW4A 2GJSA 1E9FA 1MR3F 1NBMA 1PLJA 1TF2A 2GF0A 2WBLC 3HYTA 4PPFA 2GTPA 2ZYVX 3VHXA 4F38A 3NH9A 3TUZC 2ZU6A 3H86A 4JYCA 4RZXA 2CCJA 4DDWA 4NH0A 1TF5A 4ACBA 2GCOB 3QG1A 4LC1A 1EESA 2CL0X 1GVNB 4PC6A 1KMQA 4UKDA 3TBKA 4DSOA 2QP9X 5HE8A 3ZVLA 3I4LA 3O8DA 4BRWA 1E32A 1R5BA 2NMVA 5L3QB 2FFBA 3V9PA 2OV2A 5KDOA 2ZYTX 4RFSB 1OKKD 1OHHA 2V1XA 3FFAA 1OXUA 2HEIA 5JWHA 2JLUA 3UATA 1E9AA 1R0WA 1OIVA 4OI4A 4CT4B 5H1YA 1PLKA 4HUTA 3VFDA 2CL7X 4ZIRA 4CIDA 2MSCB 2GXAA 2ZRGA 1A5TA 4UNNA 1MKYA 4ZCMA 5JEEA 3V00A 4HSEA 3SC3A 2YJTD 3IPXA 4R9UC 4DKXA 4CDGA 4ZDKA 1K8RA 1ZW6A 1ZUIA 3KUCA 1SXJD 4QRHA 1N25A 3AM1A 1P5ZB 3NIBA 4KAXA 4WW0A 2UZIR 5JEDA 2AWNA 1W4AA 3UMFA 2QQ0A 4RZUA 1OXTA 4TYPA 4DC9A 2ZR9A 4KV9A 2JLVA 2O8CA 1W4BA 1QHHA 3KL4A 5J4HA 3KQNA 1E4VA 2FU5C 2ZRCA 3K0FA 4PSKA 5A4JA 1ZYUA 1FZQA 1M74A 1P73A 4CEHA 3AVUA 4N0EA 3AUYA 4GZLA 2IXFA 1ETUA 5TDHA 1EWQA 3C14C 1N5IA 3I5XA 2VHJA 4ESHA 3TVTA 3T1VA 2WVJA 1QF9A 1VG8A 2AN9A 4F91B 1G3UA 2IL1A 1FTNA 4JT4A 2WV9A 2DFKB 5EP2A 2OCAA 3ZYCA 3AF1A 1U9IA 2GZHA 4KFSA 2FFAA 1FMLA 3QIAA 2BHRA 1IJFA 3VU9B 1PUJA 5G3ZA 5TY0A 4HLCA 1D8TA 3AB3A 4JBYA 4DXAA 2B8TA 2L0XA 121PA 1D6JA 2VP5A 5EXPA 4OQNA 3CZQA 5DYGA 4DLXA 2WSSD 1EFUA 2R65A 3CW2A 3K0EA 3VNUA 1KNQA 4EPWA 2J1LA 3LBIA 2C9CA 3IUYA 4GZMA 1DAHA 4HZUA 3WBJA 4B71A 4C0LA 4MDFA 2J0SA 3PEYA 1UDXA 2GJKA 5FL7A 2WWYA 2IEZA 5KNDA 5LPNA 2XGJA 4X8MA 1E1RA 1XEXA 3NBYC 3K9GA 1IXSB 1QHYA 3CNLA 1VDZA 3BBPA 3OEHA 5BYKA 2WSSA 1RYFA 1QHXA 1G7TA 1G5TA 3FVQA 2PLRA 4Q9LA 3SYNA 5FUWA 1XTRA 3EPHA 5F9FA 1T9HA 1NN3A 5CK4A 1XCMA 4UNPA 1GG2A 3U3RA 4BZPA 2NOAA 3A4MA 3OE7D 2ZS7A 1CLUA 3LDAA 4MUAA 2O8EB 5EE0A 1SVSA 4M8NE 2GETA 1JJ7A 2IYXA 1MRNA 3RNLA 4LYAA 1FP6A 1KYIA 3NWJA 3AH8A 3EZ7A 2JIZA 5FOUA 2X1VA 4KCGA 3DM9B 4BFTA 3FGNA 1JALA 3C7KA 5CDFA 2WWXA 4HUQA 5KSPA 1VYTA 4G5QA 3NVAA 2QQEA 1MV5A 4AG5A 1VCOA 4D6PA 4C0SA 5B30A 221PA 4LHYA 1N5KA 4FWIB 3C16C 4V0OA 1OB5A 4FMCB 4PO1A 4JLKA 3SZRA 1PVOA 3WRYC 4N0DA 4BEBA 5FOTA 4IRUB 1G64A 4G5SA 1J8MF 3TUJC 4JLAA 3OIYA 1NVWQ 2X2EA 4Q1BA 2ZSEA 4L16A 4OHZA 2J7KA 1DOAA 3EX7C 4Q7KA 4KITB 5KO2A 3LA6A 1FTSA 4KLZA 2GESA 1RJ9A 1HQCA 1U94A 1U8AA 4HDOB 5A5GA 3CF0A 5JZVA 4PAQA 3K9LA 1I2DA 3ZVRA 3R8CA 2NIPA 1TL7C 4FINA 3NBFA 4NYMQ 3Q5EA 2QUZA 4Q1CA 3TQFA 2WJIA 4TLAA 4XJXA 4RD0A 2RH5A 3SE0A 1Z63A 4XD7D 2J0VA 4HDQB 4M9SA 2GVZC 2CBZA 2HUPA 1AA9A 1NJFA 4UNRA 3W6NA 3BAFA 2OCBA 4HAWA 2WMNB 1X6VA 2ZRNA 1E2KA 1G9XA 1NN1A 2IYTA 2VLIA 3GLGB 4LRWA 2Z5FA 1HT1E 2J7PD 3X1YA 1RPZA 2BBSA 1ZUNB 1LVGA 1G4AE 1T0JB 2OFOA 2AD1A 4MA4A 1NN5A 4ZPXA 3GLFB 2KBEA 2OCYC 2ZQ5A 2WSMA 4QG7A 2OESA 2AKAB 1AK2A 4RD2A 3BFVA 4QXAA 3RANA 1P6XA 4M1WA 4BFUA 1FNNA 3GJ6A 4G5RA 3GPLA 1TQ4A 4PAMA 5H8WA 3ASYA 1Y63A 4R2IA 4TSFA 4XWAA 2F9LA 1ZM4A 3MWKA 1KK2A 2DWPA 3PUVA 5J40A 2C9YA 2IYWA 2WOJA 1G3QA 4HLDA 2OO7A 2A30A 1Q0UA 2FSFA 4NL4H 4DRZA 4CEIB 4GP7A 4PZLA 3SHFA 4B34A 1RW4A 4EQ6A 1P62B 2A78A 3IIKA 1Z3IX 1N6OA 4K81B 5ANRB 4DCSA 2NG1A 4US2R 3I8XA 2ORWA 5D3QA 2ZRFA 2OLKA 2ZI7A 1YZQA 5F2EA 1NVVR 1S3GA 3Q9LA 2VP6A 2YC4C 4DLSA 3E5HA 3BWDD 3X1DA 2XTNA 2IYUA 3QSYA 5TV2A 521PA 3PIRA 1DEKA 4TMVA 4LC0A 4NCKA 4F4IA 1KJWA 1KZGB 4PR0A 1EX7A 1XRJA 2D74A 2XZPA 2ZREA 1FUUA 3BERA 1KGDA 3D31A 3VTKA 5HPYB 3AVXA 1HEIA 5IF9A 3S1AA 3LBHA 2IYLD 4K8OA 2XSZD 1NRJB 4DCVA 5J47A 2CHQA 5CJ2A 3SS8A 1OLOA 1AGPA 5DSZA 3ZS9A 4BFYA 1YHNA 1VYUA 1XTJA 2ZRKA 5FI1B 4TZ6A 1G8HA 4QJ5A 4LCBA 1N5JA 4FI3C 2WTUA 1QHSA 4A9AA 3B85A 4NPHA 4O2RA 4M9XA 4Q03A 1R8QA 3LNCA 2B21A 3KXKA 4P3YA 3AEZA 4TN1A 2JAQA 3P32A 2NO6A 1TEXA 4UNSA 2C77A 2FA9A 2VP0A 3OZXA 4CVNA 3Q85A 1F2UB 3M0EA 3PV0A 2KSQA 2DY1A 2ZANA 4UNQA 2GEVA 5EP1A 4ERNA 3BFKA 4DLWA 3VAAA 4DLYA 1UEJA 3ZQJA 1J2JA 3QF7A 1B0UA 4MGIR 1OYWA 2J0UB 1P75A 1XEWX 1AJEA 2QMEA 1NLZA 3CR7A 1JR3D 1WXQA 3LV8A 2GILA 1SGWA 2CCGA 3MGCA 3W6PA 2O8FA 4DCNA 3B1WA 3CWQA 3LX5A 2ZRBA 4TQ9A 4DT1A 3CX6A 2RB4A 4X8OA 1G21E 3L82B 3QXHA 1YKSA 4Z51A 2O8BB 1H8HA 2G77B 1SHZA 3TR5A 3LVQE 1VHTA 1GAJA 1RRFA 1TAGA 3MWYW 4MKIA 2FOLA 2EVWX 3N2EA 4QKQA 3TUIC 3B82A 4G1UC 3U7FB 2V3CC 1IXZA 2JJ1A 1NSTA 3RS0A 3ADBA 2BBOA 3LW8A 3M6AA 5LBIA 2CE2X 3FYHA 3MJHA 4MYTA 1VCNA 4LSGA 4QGFA 3GJ4A 4DDVA 2XOKD 1ZC3A 5KU1A 3AGPA 1E9EA 1T8UA 2C9OA 2QMOA 4LJ9A 4DSNA 2GBLA 2J45A 2XXAB 3DPUA 1XEWY 4U7DA 5KPDA 5FR2A 4Z8YA 5K8IA 3KKPA 4JLMA 1FX0A 3U61B 3CNNA 3QF4B 2KB0A 3HYRA 4G5OA 5JBQA 4HAUA 2YOGA 3EZFA 1NVXQ 2PZGA 5CK5A 4AYTA 1WMSA 4ON9A 5JWRA 5L3SA 3MG9A 1FQJA 1F5NA 4ZI2A 2VF7A 2CDNA 1VG1A 3PCRB 1ZRHA 1CP2A 5JJIA 1S2MA 1T3LA 2QBYA 3IDQA 4B2LA 2J0UA 3AP3A 1YU9A 2XB4A 2GDJA 4MKHA 1H8HD 4G0NA 1G18A 3F5FA 1GNQA 4RZ3A 4P0TA 4NP6A 4PPGA 4C30A 5JECA 1W0KD 3EZ6A 1HA3A 2OHFA 4OKSA 2ZS9A 2OBMA 2XJ4A 2WWHA 4ASUD 4DLRA 4PFSA 1TF7A 2WPDD 2CEAA 3ONWA 4HAVA 5EE9A 1U99A 2OG2A 1ZNYA 4LHZA 1KK0A 5EUMA 1L4UA 3SNHA 1LTQA 2UZ3A 5TVKA 3EWAA 1MABB 2V6IA 4Y0AA 3AKDA 4DZZA 1HY3A 2Z4SA 4FCWA 4DCUA 3CR8A 4RSGA 1W2HA 4HAYA 3MWJA 5BWMA 5LDDC 3LXXA 2KJQA 2E9SA 4JKYA 1JEEA 5KUTA 3L0OA 1UFQA 3F0TA 3OAAD 1MOZA 2BWJA 2GF9A 5CIWA 4YLGA 5C4GB 2O0KA 4D0NA 4ZCLA 2WWWA 2CK3A 2QU8A 2ASEA 2AL7A 2FZLA 4JLNA 1GILA 1JBKA 4FMDB 1J99A 4EPVA 1Z07A 3CRMA 2REBA 2JASA 1AKYA 1VG0B 1P72A 1YJ5A 3RRYA 4MYCA 1JPJA 1F3OA 1ZNZA 1DG1G 4QBFA 1KKMA 2Q6TA 2XOKA 4XH9B 4QNMA 4BZQA 2ZJ2A 4PANA 1ZUHA 2W0MA 1S1CA 1ZU5A 1ZIOA 4FMBB 1E79A 2QP4A 4D0GA 2V7QD 4QL3A 1U8YA 4GDFA 1R6BX 1MT0A 3GLHE 3AVVA 3TAHA 4Q66C 5FPHA 2YINC 4JLPA 2D06A 4DCTA 3G0HA 1ZU4A 2FE4A 5F3WB 1AQYA 2EFDB 3NTUA 5FR1A 1E1RD 2HJVA 5FBLB 2SHKA 1RVDA 2VH5R 3QKSA 3B13B 4WBSA 5F9HA 4O2LA 1XX6A 5EP3A 4BFZA 1OB2A 4M53A 3B1ZA 3FTQA 1A1VA 4FXPA 5K8TA 4HDCA 5IT5A 2GJAA 1T3HA 2JATA 4OHXA 4OJQA 5EXSA 4B74A 4IHQA 2D4HA 2D7CA 2E87A 3GJ7A 1CXZA 1XJCA 4IEIA 3FOZA 4DSUA 1J70A 4EJSB 1DAMA 1B23P 2VQSA 1SKYE 1QHNA 4D4MA 4M9ZA 1TX4B 2VSXA 1ZJ6A 1F60A 2OUKA 1IN5A 2YYZA 3CPEA 2D7DA 5UKDA 1KI6B 1NSFA 1FFHA 2VEDA 2DR3A 4Q01A 3ETLA 2HV8A 2A5JA 2YHSA 1KO8A 1S9DA 1XTSA 3OIUA 4D4KA 4YDHB 2JGNA 2QSZA 3PEUA 1Z6XA 4TMKA 2P3SA 2WWIA 3K0SA 3KKMA 3Q7QA 4M0LA 3GJXC 4B73A 3I3SR 1IY1A 2O52A 3Q3JB 2VHTA 1RJ9B 2FWRA 2ORIA 4IOKA 1AM4D 5H70A 5KPJA 3VR2A 2FSHA 4MRNA 2K5UA 2R62A 2QPOA 1DARA 1NIJA 3D8BA 1X8KA 4Q47A 2H16A 2F3TA 1TU4A 4BRUA 5DN6D 1Q21A 2JA1A 2NGRA 3GD7A 2B7BA 1T0HB 3LO5A 1TPZA 4IDHA 2PCJA 4NCJA 2VL7A 1LV7A 4A0HA 1V43A 1Z0DA 4GP6A 1DAEA 2P6RA 4YXWD 3UG6A 3IIJA 1KAOA 4JZKA 2ONKA 2DWOA 3R9IA 1AQUA 2VP4A 2H5EA 4PQRA 3RS4A 1Z06A 4IXNA 3ZIAA 3EWSA 5HCNA 3ZVNA 3CX7A 3HPQA 2O8DA 1MH1A 1Q1EA 2C03A 1XDBA 4AIIA 2GJ9A 3AVPA 1UKZA 3L0IB 4ITRC 4EPYA 2ZETA 1TQ6A 1G3MA 2IXEA 3WMEA 4URUR 2QI9C 3QKSB 4QHYA 2YNMA 4A6PA 1W5TA 5EP4A 2FFQA 2A2ZA 3CF6R 4LGMA 3EC2A 3PFIA 5SZIA 4D2IA 4FD2A 1XBTA 1YR8A 2HXSA 2OCPA 1CEEA 3EASA 1NG9A 1SQ5A 2IYSA 3FMOB 4NTZA 3P1JA 4PHGA 3RHFA 2IXGA 2ZVPX 4NCNA 1KSFX 3NH6A 3RAPR 3K0CC 3B1YA 1W2GA 4Q9KA 4MH0R 1M7HA 2J7PA 1YZTA 2JIZD 1PJRA 5JFGA 4PO8A 4ILEA 4Q7LA 3AKEA 1T4GA 5G40A 2ZXUA 3BK7A 5KSOA 2WKPA 1BS1A 1SZPA 2QBYB 2XEXA 4F4CA 5IDVA 1GRQA 1GL7A 5JRZA 1QDEA 4HB0A 1IHUA 5DI3A 3K8YA 3ICQB 1XMSA 3C4JA 1GSIA 3IIMA 3QOFA 1W36C 2ERXA 4JKIA 1XPUA 1ZAKA 4LJ7A 4LBWA 2HYDA 4W7SA 1P4SA 3R7WB 3GFPA 3QXXA 3BRWD 4ZKEA 3BH6A 3J81k 1E0JA 3VR6A 4C2UA 3QVVA 2PT7A 5FTKA 4DDTA 3CWZA 1Z0AA 4II7A 1OH7A 1EFCA 4TWZA 3OF5A 1N6KA 4PAOA 2LKCA 2VA8A 1W0JA 2C98A 1YZUA 4IOJA 4DSTA 2ZI4A 2A5FA 3D3QA 4MUBA 3RDPA 1G7SA 3SN6A 2BIFA 4N3NA 3ADDA 3ZZUA 3AVYA 1ZCBA 2RMKA 1W48A 2GAAA 4XSGA 3T5GA 3WNDA 4GPTA 3IEVA 2JLQA 4M1OA 5B64A 3HWSA 3LY5A 4G3XA 6Q21A 1OIWA 1TNDA 3SBDA 4WAUA 2GK6A 1G17A 1KK1A 2QN6A 2XTMA 3R20A 4GFDA 4Q1DA 4BPBA 3UPUA 4I1SA 3GJ8A 1SULA 1W46A 2JDID 4MGZR 4NONA 1FW6A 1VCMA 5G3YA 2XZLA 3IPYA 1ESNA 2ZJ5A 3DHWC 2H17A 4CEHB 4W5HA 4PXAA 4MGYR 2R44A 1W1WA 4I99A 4PPQA 1XD2A 1CRPA 5KTYA 5DI9A 1SVLA 1S3SA 4HYYA 2JLRA 4NCHA 4EJSA 5B2ZA 4RVCA 4D4JA 3O8BA 4NYJQ 2JJ8A 5H68A 3KJIA 4GOJA 2ODBA 2G88A 1AZSC 1TTTA 1KMHB 3PENA 3IHLA 3R7WA 5BN4A 1G6OA 1N0VC 1IQPA 1OXVA 3E2IA 3TSZA 1Z2AA 1AZTA 2H18A 4Q02A 1ANKA 2MSEB 4TTPA 4DDUA 1XU4A 3H0KA 3SDZA 1OE0A 1U8ZA 3HU2A 3QKRB 1EGAA 5JRJA 4UJ3A 3UWKA 2R9VA 1N6LA 1NY6A 4CRWB 3R9XA 3IILA 2PEYA 1AIPA 2P6NA 3OEHD 2EFEB 1ZCAA 1VYVA 3QQ5A 2AWOA 3I92A 2ECKA 1RRPA 2B92A 4P4UA 3PXGA 1NLFA 2YOHA 3RS2A 2F3RA 4FWTA 5DHFA 1ZIPA 5FBWB 4YQFA 1LY1A 1K5DA 2PLFA 4OI1A 4C0AC 1C1YA 4BASA 4C0KA 5EE5B 2GXSA 2RGDA 4KLNA 1COWA 1SXJE 1W49A 2R6CA 1CKEA 4PQYA 1VIAA 1UBEA 5FOSA 3KUDA 3HU1A 1II8A 3A1UA 3EZ9A 5FPTA 1E3MA 2YWHA 1JAIA 3C5HA 1GTVA 4AKIA 4TL6A 1KDPA 1QVAA 2BMDA 3RABA 1FMJA 2QRNA 3REFA 4XTRA 3TVDA 3QXJA 1P60A 3OAAA 2VP9A 1J90A 1OT3A 2GZDA 2F1JA 3PUZA 3U3OA 3BIFA 4WZAE 1XEFA 1XWIA 3KXIA 5DE3A 3TR0A 1XXHB 5IK2A 2B6HA 2BC9A 4CEJA 4B3DA 1GUAA 4FN5A 4MITA 3BB3A 1N5LA 2DYKA 2FN4A 2ODWA 2QGZA 4O3MA 2QMHA 1KTVA 3OIVA 5A0FA 4JL8A 4RD3A 4RD1A 5EZ5A 2WPDA 4PPNA 2OXCA 1BOFA 4F4JA 1W5SA 1X1SA 4OQLA 3UG7A 3A4NA 2H92A 1H8EA 3WBKA 4TQAA 2W6JA 4F92B 3THWB 1IAQA 4QJ4A 3ZZ0A 4B48A 2ZM5A 5JS8A 4GT1A 4C3ZA 4B3BA 4B3XA 4RJLA 3FPAA 3EARA 4DLTA 1Z6AA 2J46A 1JXOA 5EZ6B 1W4CA 1UKEA 3QE0A 1XZQA 3KJGA 1CR2A 3T1QA 1ODFA 3TSWA 1N3BA 4CW7A 4MQBA 2WIAA 4GOXA 4Q21A 1WE2A 2OFWA 2IBMA 3A8TA 2OBLA 3GFTA 4V0NA 4XOIA 3NDBB 2AHOA 3BH0A 2ZE5A 3I1FA 4B76A 2PX3A 2AFIE 2QG6A 2PZEA 2O5VA 4BLQA 1XXHE 1LS6A 3MSXA 2OFXA 3SBEA 1OH5A 2CLDX 5CB8A 3KXLA 3B1VA 3TK1A 1EFHA 3GLGE 1LW7A 1KI9A 2R8RA 2F1HA 4XVQA 5J4LA 3BORA 1GNPA 1E2MA 2JJ1D 1C9KA 1WA5A 1MO3A 4HLUC 4NYIR 3BB4A 4QGAA 4PX9A 1QZXA 2Q9BA 4HAZA 3WMFA 4HLUA 4DLUA 3CX8A 3AVTA 3QXCA 2EYQA 5F98A 4EPTA 4TZ0A 1D5CA 1JR6A 4Q5IA 4JBWA 1BO6A 2GK7A 1WBBA 2O8FB 2WWGA 1NLYA 3MMPA 2DFNA 5L3SB 2LKDA 2O8EA 4URYR 4LWZA 3CRQA 2HF9A 3SI7A 4BEJA 2FMXA 4TMWA 3MUFA 1KMHA 2XAUA 4ESVA 3W3ZB 4LPSA 1E9DA 1K6MA 3WYAA 4TYYA 1JR3E 1CJMA 1JEDA 1KZ7B 3T1TA 1HH4A 4LV8B 1ZD8A 2ZYUX 1HURA 1R0XA 1WQ1R 3KKOA 4Q4JA 3RS7A 4RD4A 5KYKA 1Q1ZA 4LYJA 4W5JA 5HKKD 4WIAA 1EFRA 3HR7A 1ESMA 4JL6A 4M21A 4TT3D 3Q7PA 5FUVA 3C41J 3QY0A 1SVIA 3I61A 3TH5A 4D26A 3IKJA 1TUEA 1CJUC 5JCZA 1GRNA 2ATVA 4RFVA 1W36B 1LF0A 1M2OB 4R7ZA 4WXPA 1VECA 1E9CA 3A1VA 3EIQA 2J3EA 4L15A 1ZP6A 2ZRJA 1G8FA 3BJIC 3GCGA 1ZM3A 3OEEA 4B3FX 1KI2A 2C99A 2ZRLA 3NDPA 2KWIA 3U5ZB 5HZHA 4LBYA 4V0KA 2JDIA 2W2TA 5DYIA 2IC5A 4QHTA 1E2HA 1KJZA 1EWRA 3DM5A 2ZI6A 5M04A 4YMUA 3SEAA 3I5YA 4RCYA 5BN3A 3EIHA 4G5GA 3X1WA 2WKRA 3T5DA 3KJHA 1XD8A 2W0SA 3CONA 4C9BA 3CRW1 2OM2A 4OQMA 3OEED 3RWOA 1DS6A 4URWR 3RYTC 3GEIA 1F6BA 4IW3B 2ZUCA 4ZI3A 2OE2A 5AUOB 1CU1A 4OQXA 1R8SA 2RGGA 1EFTA 3THXA 2ZAMA 1WB9A 1UM8A 3IO5A 2BOVA 2RGAA 5G41A 4YMSA 5EQTA 3JVVA 1XB2A 4A8JC 1M34E 5AK0A 3SHWA 4JSYA 1MABA 5DN6A 1GITA 5FI0B 4OI2A 3PUYA 1NNEA 2WICA 1Z5ZA 2XNSA 4EDHA 3AF0A 4Q9JA 1P2VA 2RGBA 1I4DD 3L43A 4TLBA 3THYB 3K0CA 2YC2C 4OK6A 3TE6A 2WWFA 5G53C 3IQXA 2Q9CA 4YMTA 2GEDA 2VO1A 1ZBDA 2QNRA 3U3JA 5SZHB 3SQWA 4IFEA 3THXB 2QROA 4BE7B 4JJZA 3WNCA 1HV8A 1XCGB 4KBFA 3V4FA 2ZRIA 3E1SA 3P26A 1JQJC 4POAA 4CEJB 1UKYA 2ZRMA 2EFGA 2Q21A 1US8B 1U0HC 3I32A 4JVMA 2IT1A 4MGKR 3ICEA 2QAGC 4B75A 5L3QA 3H4MA 2AFHE 2Z43A 4IDNA 4U02A 2FZ4A 4CZ2A 3PJRA 2QE7A 3UIEA 3DDCA 5JHHB 4FMCF 4Q4AB 1W44A 4OHWA 3QEOA 2PT5A 3PUWA 2GVDC 4FCTA 4XVUA 5EJEA 2W00A 4OBEA 3CKLA 4JLVA 1SVKA 2VRWA 2MSDB 3KQUA 3NBXX 3NC1C 2HDNB 2MMCA 2FG5A 3AP2A 4L4UA 1E2QA 2PH1A 4US1R 4B2PA 1XZPA 1KOFA 2ZRPA 5FL7D 2F43B 2GRJA 2GHIA 2ATXA 1Z08A 2G3YA 2ZRHA 3CM0A 2JJ2D 3W5IA 3S1AB 3CRRA 3SFVA 1UAAA 2GJ8A 5AJYA 1XD2B 3FHCB 3EPLA 5GJCA 2EYUA 3VKWA 1LB1B 3A4LA 2CLSA 4B43A 1XPOA 1JNYA 2RGCA 3THWA 1OV4A 3W8NA 1IM2A 1AN0A 1JECA 2BEKA 1CJTC 4NYIQ 4QBIA 2QP3A 3KB2A 3VMFA 1D9ZA 1Z0FA 2IHBA 3O8CA 5AJWA 2W58A 1E2EA 3DKPA 2GAOA 1G8GA 3FKSD 2IS4A 4P4SB 4OI0A 4A4DA 5CITA 1IBRA 3UK6A 2Q3HA 4Q7MB 2IYYA 2EWWA 2ZJAA 4XIGS 5P21A 4ASUA 4K46A 2G0NA 4NDZA 4E03A 1TUIA 4EJSC 3QVUA 3REGA 1YRBA 1Z0IA 1Z22A 5FL3A 5GVRA 1ZC4A 3FKQA 2ZI5A 4GBMA 1S4QA 4EAQA 5K8LA 1G291 2XNDA 2Z4RA 3CF2A 3DVLA 2NPFA 2FFHA 2BDTA 1X86B 3F3YA 2FV8A 2HCBA 1NMZA 3B9QA 2OSBA 3DKVA 2UVQA 4IVPA 3SJBA 1FPMA 3NG1A 2AX4A 2PJRA 5IRCD 3LVRE 3IEUA 1U9IC 2CXXA 4DB4A 4JSTA 2GNOA 2ZE7A 2OT3B 3PUXA 1II8B 2PMDA 3B8HA 3LH5A 4P32A 4PC7A 4CGZA 2AD5A 4LHWA 2G83A 1T6NA 1Z0KA 4UQOA 5AUQA 3MLEA 5KNCA 3L2OB 1XFAA 1D9XA 2A7QA 4NBSA 821PA 2ZRDA 1U98A 4W9MC 1G1MA 5KSYA 2WJYA 3P20A 4ARZB 1M7GA 4MDEA 5KHOC 2CVFA 2IEYA 3ECCA 1WCV1 3FE2A 3U44B 1JXMA 1E2DA 3RLFA 5TARA 3IHWA 3G5UA 4LYHA 4ZIRB 2QT0A 2OBNA 1KNXA 4DB2A 2O8BA 1G4UR 1Q12A 1UF9A 3DMDA 2FSGA 3CUEF 1QG4A 5AJZA 4D82A 1KI1A 1IJEA 4G01B 4KVAA 1I4TD 1S1MA 2QTVB 3DO6A 3FWYA 1T91A 3LW7A 2GCOA 2A5YB 4ZDWA 1R4AA 1G5PA 4FIDA 5DHAA 3UMRA 2QSYA 1VCIA 4MRRA 4Q1EA 4HB2A 3NXSA 3QJYA 3KDSE 4WZ6A 3OHMA 1YZLA 2YWGA 3FMFA 3PITA 5KOYA 2A5DA 1VTKA 2ZS8A 4JT2A 2VHCA 3KKQA 3GQBA 3CNOA 3K0FB 4LJAA 1NJGA 3BC1A 2GWHA 3PVSA 4KI0A 5DO9A 3OFND 1OH6A 2HT6A 1S8FA 3TNFA 1P7CA 4PZYA 3GLFA 4PC1A 2PX0A 2RGNA 1U2RA 3QG5A 3NHAA 2EW1A 3QKTA 3QXSA 4LJYA 1DO2A 3UMSA 3N5CA 2IYVA 5FTNA 4CF7A 4O0MA 2X8AA 1HE1C 2N1BA 3MWLA 4Z1MA 3F8TA 4IDOA 3M1IA 1YR9A 2AK2A 4I1VA 4Q4JB 2BJWA 2XTZA 3SYLA 4BLOA 2CCKA 2ZTSA 4ZKDA 5FBVB 5BW8A 4ZCIA 1PV4A 4MYHA 2ZJBA 3K70B 3LX8A 4AI6A 4B6FA 1WRBA 1F2TB 1W0KA 2CE7A 5CYPA 4LJ8A 3BGWA 4P33A 4NYMR 3AVQA 5JSZB 4A82A 1CF4A 4A6XA 3K9HA 4D0LB 1E2GA 3T34A 1D2MA 4M22A 5EE1A 1SXJC 3K70D 1SVMA 3QKRA 3AUXA 3ZD6A 5AUPB 4C2TA 2HJGA 3K0AA 2BBTA 1GWNA 4Q18A 3U44A 4ZDIA 3CH5A 1KDOA 5GJWC 1OYYA 3OIWA 2IWRA 1OXXK 3WP1B 3KFXA 2BM1A 4JVLA 4PC3A 4JVNA 4Q4HB 4LK2A 1KSJA 4S2EA 2NO0A 1E2FA 1G8PA 4KSCA 2F55A 1C4OA 3AVOA 3TKLA 1VMAA 4RKFA 3JZMA 3DZDA 4KFUA 4D80A 5J4KA 4E09A 3D7MA 2OAQ1 2C78A 2ZSFA 5LB2A 2YVUA 3Q72A 3N2IA 3X1XA 3A1TA 4C7OB 4D25A 4M1TA 2LWIA 3VNVA 1XEXB 1G7CA 3VR5A 3FDIA 1IN8A 3VR3A 1OW3B 5AJVB 3BB1A 2RGEA 4EIWA 2J87A 3AF4A 3KB1A 1YZNA 3QPWA 5C1BA 4Q9IA 1M7BA 2IF2A 2ODEA 3G82C 4KSBA 2OXRA 5CYOA 5KDDA 4JMPA 1AS2A 2RKOA 1Z28A 1Q22A 1IN6A 1CR0A 3HJNA 4TLEA 2VPPA 3KX2A 4L9WA 4RFSA 4C0QC 3BH7A 2CVHA 2R6DA 4IVRA 2WZQA 4IOLA 4OL0A 2N46A 1OFHA 3AGQA 3RC8A 1P61B 4JLJA 3W9YA 4LI0A 1MO4A 1RYHA 1KIMA 5EXTA 5EE3A 3ADCA 3WP0A 4Z54A 2ZSDA 1JQLB 1E9BA 4TMZA 1O3YA 2D2EA 3E70C 1WBDA 1QHHB 2V9PA 4MRSA 4UXHA 1CS4C 4B6EA 2BV3A 2Z6VA 2ZROA 1QBKC 4HLQB 2VP2A 1BMFA 4PZZA 4DUGD 3K53A 2JCSA 4QBGB 3B7GA 4Q48A 3P27A 2IS1A 1L4YA 1UEIA 3WHLA 2Z83A 3ZIAD 4A92A 2NO7A 2PJZA 2YWFA 4V0MA 5FPSA 2FPLA 3CBQA 1RZ3A 2W6IA 2NTYC 4LV6A 4Q4HA 2A9KA 3K0AB 1FQKA 1OFIA 1DAGA 1FX0B 5BN5A 3U7HB 1E2IA 2YV5A 3NHBA 4OYHA 1M6NA 1Q3TA 5HZKA 2NO1A 3VU9A 4OK5A 4W5WA 1Z8FA 2X19A 4UJ5A 5DNYB 4URXR 621PA 1KO7A 2R6GA 4B47A 2W83A 5JLJA 3QPVA 2JLWA 4C0HA 3MFYA 2CLCX 3K09C 1ZMXA 3AKYA 5C46F 1KI6A 3A36A 1SKYB 1F48A 5C4MA 5CDFE 2ORVA 3TGPA 5C18A 2IS2A 5GJBA 1Q1QA 1NMYA 4OHVA 2QM7A 3A1SA 2QPTA 3T15A 4AYWA 2J41A 4IKEA 2BVNA 4NYJR 2VHQA 2Q3FA 2R6AA 4LV5B 2CJWB 2I1VB 3MRSA 5CIQA 1BIFA 1CJKC 5LD2C 1EX6A 2V8OA 4GMXA 3AP1A 1KSGA 4KXFB 4EFNA 4IVQA 1ZM7A 3LWNA 1XTQA 1ZM9A 5L3RA 1CR1A 3FKSA 2J9RA 1E0SA 4EKDA 4D81A 4DEYA 3NEJA 3A1WA 3T06B 2P67A 2ZAOA 1DAFA 2YKGA 2AXPA 4FMDF 1JB1A 4RD6A 3PQCA 4JL5A 1NMXA 4HZUB 4DHEA 1DELA 3KJEA 721PA 3HPRA 2QTHA 4NMMA 5L8VA 1K5GA 2VSOA 2ONJA 1KO1A 4P4TA 2YWEA 1P2TA 1T8TA 3FHOA 1X1RA 3Q5DA 1OPXA 2FNAA 5GJVC 4YMWA 1IONA 3THOA 4AWXA 3KKNA 4IFBA 3U7GA 1WF3A 4L9SA 4DWJA 2FEOA 2ZE6A 2W2XA 5D3MB 5SZJA 1OIXA 3VR1A 3BE4A 2WJHA 1HTWA 4NU0A 5FTLA 3EW9A 3L0PA 2BKUA 1L8QA 4AY2A 3EZ2A 4OJKA 2X77A 4WVFA 2FPMA 4LPKA 4UXJA 2ZJYA 2FF7A 4B32A 5JWOA 1KO4A 4XTCS 4YMVA 3AKCA 5TXGA 2PCLA 5FOWA 2ANBA 2B7CA 1JAHA 4C4PA 4M1MA 4LJ6A 1Q44A 3HR8A 4JJKA 3RWMB 4U5XA 4B44A 4LX0A 5KNBA 2RAPA 2P65A 1BMFD 1E9SA 3HDTA 2VF8A 1E2NA 4L5BA 4LHXA 3K9NA 3MD0A 4DUGA 4PQFA 5L3VA 4V03A 2EWVA 4EPRA 2BMFA 4BUJA 4TT3A 4QGGA 2CJWA 3I73A 2FPKA 3ASZA 5BXQC 4IDPA 1KI8A 1O87A 4E5UA 3ZD7A 1QG2A 1VIYA 3GLHA 4YDSA 1FP7A 3TSOA 4C7OA 1NY5A 2GXQA 3D6TB 2W6JD 2QTFA 1NL3A 1N6RA 1H8ED 1JPNA 3DL0A 3W5JA 4TYWA 1XMVA 5FOXA 2ZITA 4BFSA 3U6KA 1PUIA 2DBYA 4XVRA 2FGJA 1VPLA 1PZNA 4A2QA 1UBGA 4QNRA 4F93B 2IYRA 2REXB 2IUSA 5GADl 3CZPA 4S35A 3GLFE 3K1JA 5DLQC 1DO0A 1D2EA 2W2VA 1QRAA 3DMNA 5D3MA 2CL6X 2J0QA 4I1UA 2AR7A 4ARZA 1MRSA 1N6PA 2G6BA 1Q57A 2G1JA 3QUSA 1DVRA 2MMGA 2VIIA 3EPJA 5B58C 4UXIA 4QM6A 1SXJB 1JI0A 2ZEJA 1X3SA 1L2TA 2QGNA 3EIEA 2IUUA 1TADA 2D3WA 4MYUA 3OFNA 4KO8A 421PA 5HR5A 4JS0A 5FPYA 4B3GA 1P9NA 2C2HA 2J59A 1KAGA 2F7SA 4BFVA 1TU3A 4WOPA 2IYQA 5JHGB 1E0KA 1J8YF 1KI7A 3O47A 4M1SA 2RGXA 2QAGB 2ANCA 1E69A 2ZVQX 1KO5A 5FUXA 1OKKA 4DIEA 3QI2A 3CLVA 2Z0MA 4DBLC 3IBGA 3QNUA 4FW9A 5HTKA 4GL2A 3RRNA 3BD9A 3GMTA 2EQBA 1G5RA 3ZVMA 3JZAA 1L7VC 2BMEA 5LB4A 2QAJA 5CM9C 3CRVA 1Z83A 2V7QA 3EC1A 2F1IA 1ZM2A 1M8PA 3FFBA 4EQ6B 1Q1BA 1EFRD 1RFLA 1DBSA 3GLIB 2WMOB 2KI5A 3L0SA 2CNWA 3SJAA 4BZXA 5AUNB 2DWQA 2JEOA 4CT5A 2FGKA 2WAYA 2V55B 5E7IA 3TAUA 4MRPA 4QOSA 1E9RA 3PEWA 3GFOA 3IGFA 4PHTA 4AC9A 4BWYA 2ZI9A 1VKJA 3KZ1E 1E2LA 1NF3A 4JBXA 1AS0A 3KQKA 3CPHA 3SQXA 1G3RA 1DAIA 3C8UA 4KU4A 4LYFA 2RGNC 1Z47A 4WZBE 1KY3A 4R71A 3TW8B 2RHMA 4FCVA 2RCNA 1KSHA 3U4QA 5JI3E 4QC2A 3T12A 1G7RA 4Q4LA 5J5CA 4B3CA 4Z1MD 2GA8A 2P6UA 3RVBA 3P4XA 1EG7A 1M1YE 2A5GA 1XMJA 1RIFA 2BMJA 1OFUX 2IF0A 3N70A 3W90A 2WAXA 1ONBA 1UPTA 2QEQA 4A15A 4A2PA 1X8JA 1KKLA 1TEVA 2FH5B 2XNDD 2Q0HA 1XPRA 2XB2A 1KHTA 5TMPA 1UDWA 4JLBA 2Q9AA 4JIMA 2IA5A 3WXMA 1QVRA 1GM5A 1E94E 2GEUA 4URZR 1BH2A 1A82A 2WKQA 1RC8A 2H57A 2XSZA 3QEJA 1OHHD 1E4YA 3B5JA 2AK3A 3DZ8A 1KI4A 4TLCA 1GOTA 2PEZA 2DFTA 1DE0A 4IXMA 4P4SA 4BLSA 1E6CA 4NZYA 4AK9A 2KE5A 3MJRA 2GZAA 1I2MA 3TRFA 1XNJA 4QJ3A 2C04A 3K70C 2G9NA 2P5SA 3EA5A 4BQSA 4XSHA 2FDCA 2WHXA 3WY9A 1XF9A 3T35A 1WDTA 3CPJB 2D2FA 4B2IA 5FTMA 3M4YA 1H65A 1RE0A 2J5XA 4DVGA 5C2JB 4M9QA 1ZINA 3GEHA 4A0GA 3GLIE 3NEYA 1AS3A 5FOVA 4KFRA 2IK8A 3QENA 2BM0A 2O8CB 1QHIA 4C0JA 2UKDA 4H9GA 4GOKA 5JMTA 4IJMA 3JVUA 3B78A 1JR3A 5DIFA 1E98A 3GJ3A 3SFZA 2JLXA 3LXRA 4PSVA 2ZJZA 3RRMA 1GKYA 2XITA 2QE7D 3OESA 4BLTA 1N6IA 4LDJA 4Q4AA 4TL8A 5JS7A 1Z0JA 5LD2B 2O8DB 3UWOA 2NQ2C 2PL3A 1W36D 1G6HA 4HB4A 1ZVQA 3VX3A 4XWKA 2EFHB 3MCAA 1GP2A 4V0ME 2I1QA 1S9HA 1Z2CA 2XZOA 3ZQ6A 3X1ZA 1XJQA 3EA0A 5AJXA 1XJ0A 4CYMA 1GL9B 3CO5A 1GKIA 4F7WA 2BEJA 2GXUA 3PG5A 2VYFA 3SR0A 4TQUS 1FNMA 4CEIA 2JLZA 2BJVA 3PEVA 4BFWA 1XD9A 4AD8A 4HAXA 1CBUA 3ND8A 5AWFC 4EPXA 2AKYA 3GLGA 3LAWA 1LNZA 2QM8A 3U3KA 4TTRA 2CNWD 4LY6A 3WHKA 2R6FA 2QPAA 1GIAA 2IYZA 1IY0A 3T1OA 1COWD 2V4ZA 1NG1A 2E1RA 5KDLA 3QBVA 3VHLB 1KI3A 2TMKA 1CRQA 3IQWA 2NZ8A 3KTAB 1US8A 1VHLA 3P4YA 4R2HA 4GSYA 5JSZA 4QBHA 5B57C 3QPUA 4O25A 4KYUA 1CIPA 2IUTA 5BQ5A 4GMDA 4GRAA 3UKDA 4AKHA 3TMKA 4B33A 3W34A 4ZV4A 5E7JA 1XCPA 2ZE8A 4NKRA 1R5NA 4PC2A 2N42A 4RCZA 4I1OA 5FUYA 2P2LA 4LUCA 1DG3A 4BGDA 3U2QA 4TYNA 2ZUDA 5FH9A 1DTSA 5CLQA 1GKUB 4IDQA 1FOEB 2C5LA 2CHGA 2F43A 3BXZA 3K09A 4N1AA 4QFMA 3TJZA 5JCPA 1Z6GA 2C96A 3H2YA 3L8ZA 3ZGXA 3FMIA 1Z6TA 3LRPA 2QZ4A 3RS5A
chains in the Genus database with same CATH superfamily
3DDHA 4FKZA 5E8RA 3EVEA 1BX3A 2C4UA 3F2VA 5DGDA 4AUMA 5CDHA 1H1LA 3OCUA 4WKOA 5K45A 3PTAA 1UXHA 4TMXA 5DX1A 4ZCSA 4PVDA 1JDZA 2I2AA 4KX5A 3V8BA 3RJ5A 5TJ9A 1M2OA 5K0CA 3PKJA 4L4XA 1D2NA 3JD1A 4JA0A 1KMIY 3AHIA 5HMMA 5G02A 2GH1A 4X45A 2HYIC 4WNIA 3JWGA 2ZBPA 4I9FA 2K7FA 3ER8A 5IHPA 1BFUA 3QVTA 3L8FA 3SNKA 2X86A 3LP6A 5DOVA 4BVEA 4QO7A 4ZQBA 4EF5A 4ND6A 2J5RA 3HUEA 2HR1A 2OZEA 2BN4A 3UCEA 4G36A 1JF8A 4LBZA 2I3BA 1AE1A 2QT1A 3KUUA 5H59A 3FB4A 4FFBB 5INTA 1HNWB 1Q15A 3ESDA 3OJ0A 4TL9A 2DETA 3Q11A 3OZTA 1TM7E 2OK8A 4JXKA 5C3MA 1RYMA 1DADA 4K05A 1L5HB 2QX9A 2VBCA 3NEAA 4KFTA 3DV0A 4NOMA 4M1KA 4V3CA 4EITA 1M0TA 2GD0A 3HDVA 2GT1A 2Y1DA 4YI5A 1W0JD 2A9OA 3OA2A 1M0SA 1NW7A 1T5IA 2QKYA 1SCJA 3K1AA 4QFDA 5KCMA 3QMWA 4RIFA 3C6BA 2XX3A 3PDUA 4C05A 3GC6A 3V46A 4I81A 5DEOA 3AVWA 1YH3A 2CHVA 2WJZB 3L8YA 5CM8B 1MJFA 1BDMA 1QHGA 1ULUA 3F6SA 1Y1SA 1H2ZA 2DCUA 2D54A 5A4AA 2QDXA 1G60A 1TPYA 1U0JA 3PQEA 4IOMA 2GBLC 2BRUA 3ULKA 4LCJA 1I6MA 4EYSA 4X8LA 2CEKA 2BSQA 2B1QA 2ZJOA 3IVXA 4UUMA 1TM1E 3B60A 3FUUA 1ND5A 1YS2X 4QDOA 1GRRA 4LYDA 2MINA 4DY6A 4JP8A 4GOOD 1NXOA 5LDGA 4AY5A 3E7XA 2AOWA 3L7KA 3QMVA 1EJ6A 3EXIB 1NZDA 1VMIA 1NP6A 1HFJA 3BL6A 2HBYA 2KYRA 2QTMA 5K8UA 1GCOA 4MVJH 2CMGA 4K7JA 1AQJA 3T3OA 1LBTA 2JAHA 1U1IA 2F3SA 2JGEA 3LLMA 3R74A 4MVJE 4S1WA 4AICA 1PJZA 3EVTA 1CUFA 2B8WA 3QF4A 3TGWA 3TOSA 3BFXA 2AIRA 4CKYA 2RHDA 4PNHA 4TLDA 4YCLA 1G63A 3BEDA 3GFGA 1E6MA 1TJ4A 3A70A 4UTXA 4F04A 4DYVA 3CXUA 3ELDA 2JS7A 4K87A 1OOEA 5EJ4A 1DAKA 4CIXA 4NCIA 4MW0A 3E0XA 2PYDA 2V3WA 2VT7A 2NU8A 4C01A 1QMPA 1IHPA 4Q1AA 3HBNA 2XNKA 2JIBA 3I01M 1IXRC 2HT1A 1PW5A 3FOBA 4R0NA 1DWOA 3TBFA 3CCBA 4Q39A 1QE0A 4KQMA 4DA9A 4HR7A 1IOWA 2XT9A 4GYJA 1ENYA 1H0SA 1XZLA 5DBIA 1QOPB 2QRZA 3M89A 4BNZA 5HNKA 1M1NB 2ZSAA 1U31A 4MUFA 4A2WA 5D1NA 1GKKA 3GDWA 3K1YA 2PKWA 5FHQA 3P0FA 1OA1A 4JQSA 3UENA 4B7CA 1RAHA 4W82A 5HFJA 3HBFA 3NHYA 3NTOA 1BVUA 3KOZA 3EFBA 4R98A 1IPFA 1CUIA 2E4VA 4ZAYA 3L7BA 5HCIA 5CB4F 3A1DA 2JBAB 4PRYA 4DIFA 3VX4A 5JDIC 5CLHA 1E96A 3I6QA 5A9RA 1JQ3A 3DP7A 1OI2A 1PTKA 3UJ6A 1ZNQO 1W88B 4MULA 2NLOA 3RIEA 3WXBA 4HWTA 4IGAA 1M76A 2GZMA 4Q9HA 3BPSA 3NU1A 4JQOA 4O2AF 2IHYA 2C82A 1U7ZA 4DQLA 4K0KB 3C8DA 3GZ4A 3L84A 4OP2A 2AJ8A 3U3MA 1R15A 1KVUA 1OWNA 3B9RA 1LF5A 2GAJA 2C7QA 1JBQA 1TRHA 1MO6A 3M1AA 3VH3A 1E8MA 2PH3A 5E4FA 4CM7A 3ZLJA 1PR1A 4PTZA 1LQTA 3NOQA 3ZHTA 1V25A 2BEUA 3DBLA 3GX1A 3HMQA 4MI3A 4BVJA 5A2GA 2XF8A 2BEVB 1NMEA 1OR8A 1SZDA 4X7RA 4N9QA 2QRLA 2WVGA 2WJAA 3FHTA 3SM9A 2BMWA 4B2YA 1RQ2A 4P5DA 4OXNA 4BKUA 3D6FA 1G5IA 3KTAA 4FYIA 1LQUA 2BCEA 5TB5A 3GNSA 4BOYA 1S96A 4B35A 4YAOA 3IIIA 1S2DA 3QU2A 2V1UA 1ULSA 2BBWA 1ZOIA 2I76A 4KHZA 1WLYA 4HH4A 2PT6A 3WB2A 4RJJA 1ZQ1A 3SS9X 5I7HA 4PSCA 3THSA 1GNRA 1NV8A 1CJBA 1G16A 2QL6A 1AQIA 2Y0DA 3D81A 4AZ3A 4Z4FA 2R2AA 3FOCA 3R3YA 1KJYA 4IIDA 4YWJA 2MTBA 5BSVA 1A2KC 2JD2A 4M2LA 2ZJ8A 3BTOA 4XDYA 4OXRA 5JI2E 4DT1B 1ORWA 1Y4AE 2WF6A 5FBRB 4MJLA 3VA7A 5FUBA 1FNDA 1CS0A 1FEZA 4AL4A 1VPEA 1PWZA 1II0A 2WC1A 1U3FA 5FPKA 3VKHA 2ZRAA 3RVLA 3J7AC 5F5LA 4RKEA 2HMUA 3UA4A 1AY0A 1Z5VA 2OWEA 1LFDB 3CH4B 1MHPA 3IESA 4XFJA 3VXKA 1JP7A 4K9QA 3B36A 4OQEA 3UK2A 3AYXB 2W71A 4G86A 4OQFA 5BUSA 3PR3A 1W29A 2F1RA 3N2YA 1R5OA 4PHFA 4G0YA 4RZHA 1QK5A 2VZLA 4BO1A 3RSOA 1Z16A 2IPMA 4O2AA 3W4KA 3GLUA 4TWRA 1IN4A 4IYRA 3BMQB 4IF4A 4CV0A 1BDBA 5COBA 1RJEA 5AO9A 3AF6A 4JVSB 1NBMD 2YXEA 5DLYA 2BMVA 3DBIA 5KBYA 1M2GA 1DT3A 1P0IA 2BMAA 3ANSA 1EE9A 3H0EA 4MKGA 4IO0A 4XAQA 5ALQA 5KYUB 4AN1A 5KSZA 1C0IA 5AR1A 1OSNA 1JLRA 2Z08A 3ZDQA 4YCJA 4AG6A 5H3HA 5B3AA 4UFOA 3V1KA 3EXHA 3HCAA 1ID1A 2WM9B 3HSSA 3K20A 4QNNA 5KNBH 3HA7A 4E7OA 1E0AA 1ZJ4A 3GI1A 1KKUA 3HMKA 2VWPA 5HKKA 2D2XA 4XD2A 3I2FA 4AUKA 4PICA 4E7PA 1GAWA 3E9DA 3OUTA 3QVOA 2Y8EA 4D3ZA 5KJCA 1W47A 1SVOA 1N1GA 4W9NC 2ISCA 2XCTB 3VKFA 4EFMA 1DXQA 2HU5A 4B81A 4P31A 4CM1A 4WDQA 4IUCS 4DIDA 1XVUA 4KXNA 3PK0A 1HYHA 1K7YA 2QLMA 3RRZA 4LOAA 3LFUA 4B7ZA 4C3UA 3TCNA 2YCLA 5JTUA 2HRRA 2I3AA 1Z56C 4BUZA 4M4SA 4EFLA 5LQRA 3ILYA 1L4EA 3KWFA 4GC5A 3TCKA 4C4TA 3WWPA 2Q46A 1WP9A 3KJNA 4L8YA 2WF7A 5CA0F 2VDOB 1E1QD 4FZVA 1GT6A 2Z9BA 1KFEB 1GCIA 4F9GA 1ZMTA 3LT0A 2NO9A 2YXDA 3MIZA 4RXUA 5A1JA 4YUAA 2XGOA 3HB1A 1Q7CA 4KJZA 4YPVA 1OWMA 2A58A 1CW2B 2JFXA 3B6EA 1JQAA 3V7UA 2IHJA 4ZDJA 1KQGA 1LJ8A 2CXTA 3TLJA 4RY2A 2FJ0A 2M98A 1ZGAA 3HRHA 4JYBA 3WMGA 1FA9A 5JTTA 4J0QA 5CNKA 8ABPA 2NUPA 4A8PA 4DNQA 4WCFC 3KQQA 4F6CA 4BAGA 3A9VA 1JRLA 5EJGA 2YS6A 3KETA 2IH5A 3K6JA 3ZUPA 4GEKA 3B1XA 2XYQA 4FDAA 4F7DA 5CNIA 5CG1A 3RH0A 4OBBA 3O7MA 5C7YA 1U2DA 1UKVY 1ZXXA 1E1CB 1YR7A 3CF4G 4HQFA 2GJSA 3RG8A 3TW4A 5ADWA 3NJRA 3UPTA 3C6QA 1NBMA 1ZSNA 3D6AA 3DE5X 4UHBA 3W79A 5FAKA 3FCUB 1EK2A 4PPFA 2ZYVX 1WAMA 3I9JA 2Q8NA 3D4IA 3NH9A 4EK9A 4MS1A 4RZXA 4DQXA 4AFNA 4MCAA 4TTSA 4NH0A 4C87A 2BGLA 4PC6A 2HK8A 1C9DB 4DSOA 4ZP1A 4FQ5A 4X6UA 4LXTA 2NMVA 5L3QB 2PNFA 1UWVA 4EKNB 2NN3C 1BA3A 2QV0A 4DXHA 2OV2A 4YCSA 1PZEA 3IURA 3QMMA 1L7MA 3L3BA 5KDOA 3A9WA 3DEAA 4RFSB 5KYYB 1OKKD 1L8OA 4TS4A 2QTTA 3H4IA 2D59A 4UDNA 1R0WA 3QE3A 4DBLE 4CT4B 1R74A 2P9QA 1IM8A 3NVKI 3EWNA 1U0SY 1G8SA 4R2WA 2NTVA 2HA5A 2R87A 3KU4A 3LWDA 3DTVA 1E63A 4E5KA 1JVBA 3K92A 1C3OB 1NPTO 1N34B 4CI9A 1K8RA 2JANA 2Y9MB 1ZUIA 1NJSA 3BTUA 1G38A 1SXJD 4U8GA 1BSVA 1VE9A 3EF3A 3JZFA 3RUHA 2GCGA 1YS1X 3PSHA 4KAXA 1YTUA 5A3VA 4F5WA 5JEDA 5K3BA 5DGTA 1CY8A 1GTJ1 3I12A 1C30A 2JLVA 1W4BA 1QHHA 3KL4A 1Z45A 2W5UA 1WKBA 3K0FA 1EP1B 1EJ0A 3R7LA 2HNBA 3KZKA 1KBOA 3AVUA 1BX0A 3DTNA 2IXFA 1ETUA 2GEBA 3S7ZA 1EWQA 1G42A 2LP4Y 2PD4A 3I34X 1N5IA 1TVEA 2VHJA 1IZYA 1M66A 2GRUA 5LUBA 3NAQA 1MGOA 3T1VA 3TVTA 4HK4A 1C8VB 1XRQA 1GTSA 4B3TB 3S5UA 2AA3A 4F9EA 4B17A 2NAPA 1E4EB 1L8AA 1ZMBA 1MORA 2WV9A 4F6RB 3GRCA 5GTDA 3G7NA 4PLPA 1GNSA 5F7XA 3ZYCA 4BB9A 3R0JA 2XQIA 2CWDA 1KEZA 2H4HA 3HLKA 1Z2PX 3O1JC 5C1PA 1Y5MA 1M5UA 1IJFA 4G8DA 3VU9B 5G3ZA 4K9MA 3OTWA 4Y6RA 1NE2A 2EBHX 1D8TA 3AB3A 4NV0A 2C83A 1JIKA 1OPRA 1XZJA 1JIVA 2VP5A 2Z3VA 4NE7A 5EXPA 5BW6B 4KTVE 3CZQA 2WSSD 1EFUA 1A5BB 2QMZA 3VNUA 1KF0A 1U9YA 3JTEA 1RYBA 3UXEA 2JK0A 5JS2A 1FVFA 3IUYA 1DAHA 4PG5A 3S1LA 4BAUA 2DBRA 4N6OA 4M8IA 4C0LA 4LJSA 1UDXA 2XUKA 4JFAA 2XGJA 4NV1A 3LQ2A 1E1RA 3R77A 4IL5A 2CXUA 1EINA 4JEMA 4NZPA 4WK6A 3K9GA 5AXBA 4R1SA 4WLEA 3OEHA 5BYKA 2H7XA 3V48A 2P91A 3C3WA 2CD9A 2X41A 4NEHB 2Y4NA 4RNCA 3WG9A 3FVQA 2BFBA 4BO4A 3FYDA 3U17A 5BWNA 1QC5B 2WAOA 3KALA 5AH0A 3O8OB 4Q9LA 3WGIA 1S3FA 1NSYA 5FUWA 3OJOA 5HX7A 3E3LA 4HPWA 2HSWA 4OKIA 1O97C 5CK4A 4I9HA 1FFXB 1MX3A 1W34A 3O5AA 2BM8A 1SK8A 4BZPA 4RKYA 2ZS7A 3KCQA 4V1CI 3TSAA 4BS9A 3U4IA 1LU9A 1SVSA 2VT2A 2XKBA 1JJ7A 3ISTA 1F2DA 1MRNA 4ZT4A 3A7DA 3RK4A 3WADA 4H35A 1L7PA 3C98A 3NWJA 3D6VA 3FNHA 4BE4A 4OXXA 5D3KA 3OZIA 4OJMX 2FP3A 1LVUA 3DM9B 4HEA1 3LNTA 4EY6A 3ZQ4A 5IPFA 4JA2A 1ADJA 2I80A 1I01A 1YBFA 1MV5A 2QQEA 3FGZA 2O2EA 1VCOA 3OMXA 1FDWA 4KI7A 4C0SA 4D6PA 4R1PA 2FPIB 1BQ4A 2D5LA 2E4YA 2VAVA 4CTMA 4V0OA 3L1VA 3OCXA 4DC1A 4JLKA 3C3DA 3IEXA 3T9BA 3M5CA 1TW3A 3QLUC 3O2NA 3ZK9A 4BEBA 1EIZA 3PICA 4HDSB 5AVRA 2I7TA 2FZEA 2QJWA 3CLSC 2Y0CA 3W0LB 4ENWA 2WINI 1BCSA 2AJTA 3FMIA 3OM8A 3TB4A 2UUCB 5EKDA 5E4YA 3LLCA 4MVJA 4P83A 3COSA 1PR3A 5SY6A 5T5QA 1WCYA 3VDMA 1P8AA 3G5MA 3S40A 1UBTS 1XQYA 2QRVB 3ROKA 4I50B 1LW6E 1P80A 3LE8A 3OVMA 5LBUA 1LRKA 4RK7A 1UINA 4UASA 3U7IA 1VGRA 1WP4A 3L1IA 4QOFA 3GDOA 4HXGA 4KLZA 4UU7A 3RYCB 3QTTA 1M2NA 1RJ9A 1HQCA 4DTIA 1U94A 2JVKA 2ZJ3A 2WMDA 3G3EA 1DL5A 3ZV5A 1KH2A 3OZAA 1NRWA 1ZIYA 3FFWA 4NY1A 3R8CA 2NIPA 1TL7C 4AZSA 2NU7B 5JU6A 1QM5A 1T9ZA 4RY9A 4NYMQ 1WDLA 3NFRA 4J0HA 2PX6A 1TZJA 4TLAA 1FJGB 1R6VA 4XJXA 3NGXA 9GPBA 2RH5A 3IAHA 2F8MA 1XROA 4HO1X 4NX2A 1DBVO 2A94A 4CLHA 1ZH6A 5ECYA 4H3SA 3NETA 4IO1A 2QN9A 3Q6NA 3KT8A 5IJAA 2JIOA 3IOBA 3OX4A 2VPWA 3BAFA 5EI5A 5JNWA 1GPNA 4D6XA 5ISMA 5TIIA 1E2KA 2HMTA 4GGOA 5JZOA 3RF7A 1XWFA 1P1HA 5DK6A 2J7PD 3U1VA 3GT4A 2QLBA 3KAKA 1ZUNB 4OTZA 4IP0A 1T0JB 2AE2A 3EBPA 4YDQA 3LHKA 1QZTA 2ZJ1A 4H27A 3H5VA 2YN2A 2WSMA 1NXPA 5EJFA 3MWGA 3THRA 5A3JA 1E1DA 3FH0A 1T9GR 3KPJA 3PI7A 4I9NA 2ZXFA 4YJFA 5EMJA 2EZTA 4AUNA 4JKOA 3QBJA 3RANA 3B52X 4HFJA 1K1EA 4M1WA 4BFUA 3MJDA 2HHAA 3BSFA 1USVA 5AJUA 2YZGA 3I4FA 3ASYA 3V9AA 3PQFA 4P80A 1OYOA 2ZYIA 4R2IA 4TRJA 3ZU2A 3MS7A 1GG5A 2O2GA 4TSFA 3MWKA 1ZM4A 5JT1A 1FNBA 1ZH2A 5AKKA 1AQLA 3PUVA 1DJOA 1P5FA 2X58A 2YV2A 2V98A 3PD1A 2EKPA 2OO7A 2I8LA 2CYCA 1YIOA 2JNWA 3ROPA 5HP4A 4CEIB 1DKLA 3SHFA 4QPDA 5BXYA 5CLJA 1RW4A 4WBNB 4KK4A 2M32A 1N6OA 5ANRB 3V8MA 2YYSA 2NG1A 2P4UA 2QRGA 3B6KA 3CSUA 3I8XA 5D3QA 3ZBUA 4YV2A 4CETA 1W75A 4F5YA 1NVVR 2E55A 1UAYA 1T8YA 1Q77A 3OF3A 4K9DA 5I9LA 3EFOA 5TV2A 1AXRA 4RVNA 3GA5A 1IL0A 2ODQA 4TMVA 2BKVA 4NCKA 4ZA2A 4CCSA 1KZGB 4PR0A 3VR2D 1RCUA 3H2IA 3VR6H 1XRJA 2PO5A 3FDZB 4BGUA 1FUUA 2UU9B 1KGDA 2Q6KA 3SD7A 5AK6A 3AVXA 4DCJA 4XGQA 4EA8A 2ZT8A 3AWDA 3LBHA 3O73A 3Q0IA 1GUYA 3TE7A 1LWNA 1M8GA 4INJA 4RGVA 4IZ6A 4MXDA 5CJ2A 3T3EA 5J47A 3K7EA 1HE2A 2OHJA 1VLQA 1AGPA 2IEBA 3KKZA 1L5MA 1U8UA 1G8HA 1TCAA 1NATA 3GRYA 4QJ5A 4UREA 1R4NA 3D7LA 4AO6A 5EHZA 4IGIA 1EX9A 3B85A 3JD0A 4NPHA 4Q03A 1BFDA 1OAKA 2Y66A 1ISHA 4JD5A 4TN1A 2Q27A 1TEXA 5JNSA 3H04A 1JU4A 2C77A 1THGA 3IB6A 3AYZB 2QRMA 4W9NA 3E2PA 1F2UB 3A32A 3WR5A 2KSQA 2EV9A 2F9FA 3EK2A 4K6FA 4M76B 4R05A 1G55A 5DX0A 4UNQA 2GEVA 3AQIA 5EP1A 3RQIA 3LPNA 3RWBA 3VAAA 3WWYA 3ZWBA 3EWIA 4DLWA 1S2NA 2BFFB 2ZJ4A 1B0UA 3Q2OA 4TV9A 5KQRA 4TM7A 1NLZA 3CR7A 2PGLA 2GILA 3VGJA 4PONA 1JHVA 3MGCA 4ZO9A 1VMDA 4OXKA 1P1JA 2BEWB 2IZ6A 3VJLA 3LX5A 2ADFA 4MIKA 4RLQA 4V3BA 4DT1A 3CX6A 4X8OA 1U5AA 2I78A 2NNWB 5JAQA 1Z4OA 3QXHA 1YKSA 1RWOA 4QEKA 3C3PA 4NH4A 3INNA 5CEJA 4MGHA 4J75A 4ZT5A 3RFCA 3RKUA 1RDFA 1GAJA 5ICEA 3U60B 1TAGA 4MKIA 4CE6A 1F0NA 1Q1NA 2C7RA 1VL2A 1G2OA 5CVEA 2JKZA 2AMFA 2G6TA 2HCRA 3HB4X 5KOJA 3WLSA 5AW8A 5E0KB 4R69A 4AQDA 4AMGA 4YCNA 2CE2X 3DBVO 1NNUA 3A0RB 4LSGA 4ZVLA 3TD6A 4UEJA 3GJ4A 1D4OA 4UC0A 3AGPA 4ZANA 2QMOA 4IHJB 4DSNA 2C9ZA 4U9HS 3Q8LA 2GBLA 2WM3A 4PTYA 4ILKA 3OECA 1WX1A 3ZJ5A 1GLVA 1Z35A 3ZCVA 5J2TF 5AW7A 2ZBUA 1WMAA 2A33A 4YLYA 2J67A 2H63A 4KXQA 2V7GA 3TSCA 3KKPA 5KNCD 5LKRA 3U61B 2VOJA 5E9WA 4ALLA 1VB5A 3V97A 2KB0A 1BE1A 4G5OA 2YJ3A 5TT0A 3WGVA 3RU3A 2P2CA 3EZFA 3I8OA 3K8OE 4FCCA 1NVXQ 1SIUA 4HGQA 1ADCA 1Q74A 4AYTA 5IXJA 3URMA 3MG9A 4DG9A 5PNTA 3WL7A 2XMPA 4Q7EA 1B2RA 1RAAA 1GPYA 2CFRA 2HN9A 2RHJA 2CDNA 3ITNA 3PCRB 4OHFA 5LKAA 3ZD6A 4TV8A 1K5PA 2BZ1A 4RPCA 2VHXA 1DBQA 4XWWA 4OYYA 3IDQA 2FVXA 3AP3A 3NHRA 3LC0A 2DLNA 3ZDXB 4EF4A 1CEYA 4I50F 2H0RA 2XB4A 2GDJA 5JE8A 4QTTB 4BTLA 4DR4B 1AHNA 1YZFA 3F5FA 4FGUA 4FOTA 3A6DA 1BXRA 3DS8A 4BU0A 1MC8A 1HKHA 1QCYA 4P0TA 4NP6A 2D00A 3U4DA 1GZ3A 4B4DA 2Q99A 4EI2A 3EZ6A 4LE2A 5DOZA 3NX4A 2RHOA 1WXEA 3DLPX 3OPYI 2HZBA 2XJ4A 3UAWA 4DLRA 3N8HA 3OZWA 2OYCA 3JARB 3R7SA 4RW0A 4MJ3A 3ZOKA 1ZNYA 3O1IC 4LHZA 1KHHA 3GFVA 1L4UA 2V7PA 2H5JA 4ECEA 3EWAA 4OX9Y 2C2GA 4IH9A 4F71A 3C39A 3BT7A 3V3KA 2QL9A 2WP8J 4H31A 5F4ZA 2JARA 4BN4A 3WRWA 3DLHA 3PQ6A 4RSGA 5ULLA 1W2HA 2GZ1A 5LDDC 4HX2A 4GWKA 3ON5A 3EGOA 5A9TA 5LQMA 3GD5A 1JEEA 1FDVA 2DZDA 2WD8A 2H2AA 3L0OA 4GVXA 2PAFA 5HXAA 1YK0A 2GF9A 2BWJA 3EVBA 3PGLA 4YLGA 3K9WA 4ZCLA 2CK3A 2JGRA 2UYGA 5CVTA 2J09A 4IAOA 1MDBA 2FZLA 2XRYA 4JLNA 2JH3A 2FSPA 2XCIA 3A10A 4JP2A 1L5FA 1AKYA 1P72A 3RRYA 4MYCA 1RYDA 2VRBA 1JPJA 1ZNZA 1VSBA 2E85A 3Q12A 3PT9A 4RA9A 1KKMA 3IEPA 1FXUA 1XWWA 4LI3X 1GCUA 5IZ4A 4PANA 5J58A 1S1CA 3BHJA 1ZIOA 1E79A 1QIEA 4QL3A 1ZQ9A 1U8YA 1DFHA 1MT0A 4CQLB 2NSJA 4Q66C 4L9RA 4P4NA 2YINC 4DCTA 5BRJA 3FBTA 3Q6MA 5F3WB 1AQYA 2EFDB 4PHCA 3L46A 4L4SA 1E1RD 3VTAA 1N7JA 3I37X 2TECE 2HJVA 3KB8A 4KG7A 5AICA 5FBLB 2O2HA 2QYOA 2SHKA 3OTGA 1I3OA 4UUOA 4LVOA 3WZLA 1T9AA 1V8ZA 5B4VA 5CFOA 3ZY2A 4TKMA 3B13B 1E1LA 4WBSA 5BO5A 1AURA 1NF9A 2HX1A 5F9HA 4O2LA 1XX6A 5EP3A 1G8MA 1U8TA 3L18A 1R0CA 2AG6A 1MENA 2VAMA 4H7KA 2NU6A 4DA7A 3RVRA 3IE1A 4FXPA 5K8TA 4A5SA 5C8XA 3LYUA 1OGJA 2GJAA 3KR9A 4OHXA 2QX8A 3QX3A 5JANA 4IHQA 3FZGA 1EQUA 2AN1A 2D4HA 2PN1A 3IR7A 4XE5A 4IIBA 2W6CX 1J70A 2YWXA 3JQAB 3I04M 1Y9EA 3WRVA 4X54A 1QHNA 1DC4A 4D4MA 1E5DA 2ORED 1UR5A 3LHDA 4M9ZA 2R8XA 3MRTA 4AJ2A 1XLWA 3ZE7A 4RDIA 1KI6B 3SZLA 4Q01A 4P58A 2Y05A 3T7KA 1REQB 2HV8A 1Z8NA 3LU1A 4J3FA 2IKSA 4NVRA 4F60A 1KO8A 4RHEA 3WJ1A 5AI0A 1U7XA 4YDHB 2ZM6B 2I4LA 3I64A 3OJFA 2B4TO 3UMCA 3HXKA 5H3LA 3ZLVA 4ZHQB 1L5QA 3W5AA 3EGDA 1KORA 3NM5A 1P5HA 3EVGA 3Q7QA 1IY8A 1EYZA 3MAGA 3PQ2A 4TOIA 1WOMA 2O52A 4UEOA 3PQDA 2P6MA 1RJ9B 1VFPA 4QQFA 1C50A 3UAGA 3HFGA 4RK6A 1I33A 5H70A 3WA6A 4AKSA 3CNBA 3L7AA 2PL1A 3N7AA 5KPJA 4BJ6A 2W98A 1NIJA 3A7EA 3VSDA 4CLDA 3GJQA 5CBKA 1U02A 2UYOA 5HA5A 1NZFA 1UBRS 1UJ6A 2F3TA 2CL5A 4PAGA 4C14A 5L4SA 1GO2A 1YCFA 1UPFA 2JA1A 1YJAA 1U2GC 2B7BA 1QG6A 2P1ZA 4UUAA 3T5CA 1TPZA 2J08A 4PVCA 4Y1GA 4NCJA 5JZMA 2VVTA 4A73A 4G1FA 5EKTA 1JSCA 4R54A 1DAEA 4YQEA 2VNAA 3V42A 3EQ9A 1POWA 2DWOA 2ZPAA 1Z82A 1L7RA 4IXNA 3TLKA 4CQNA 1JJBA 3ZIAA 3EWSA 1G1AA 4PRKA 2ZBFA 5ETJA 1X2BA 2VPYA 3AFOA 4L75A 1Q1EA 4WZZA 1XDBA 2VATA 1GGVA 1ZVMA 4WINA 1H3FA 3L79A 1UK7A 4QQNA 2XB8A 1B3RA 2UDPA 3L0IB 1K86A 2X76A 1IHXA 2IXEA 3WMEA 2QI9C 3AEKA 2PZ8A 1TT5A 4QHYA 2YNMA 4G5FA 1W5TA 4KR2A 4ZD6A 2V0NA 2YFYA 5AVOA 3N9IA 3TLGA 4QUAA 3MNFA 3SGLA 5REQB 3WMWA 1EUCA 1OFUA 3I9FA 3B5IA 3I0MA 4H16A 4RVDA 1YAHA 5U1PA 2IXGA 1K6JA 1MZVA 2NTJA 4FGSA 1PTJA 4JJAA 4Y9UA 3TWOA 4I1PA 5K8CA 5HQTA 3E3NA 1PK7A 4K0RA 1OWPA 4RH0A 2DQZA 2NU9A 1H6CA 1M7HA 2YXLA 2CV1A 5FPPA 4RELA 4TGLA 1PJRA 5JFGA 2BFNA 4ILEA 4PO8A 2B37A 1EFVB 4OB7A 4DIBA 2BZ0A 4H7HA 2ZXUA 4QYMA 3AM5A 3WLEA 2BF4A 4X62B 1N0HA 3HLYA 4CODB 1BS1A 4XA8A 1RYYA 3GELA 1VDMA 4AIRA 3ST7A 1RXWA 3MBIA 5IDVA 3TRKA 4YRFA 4F6LA 1GL7A 3NHWA 2QX7A 3JRNA 3IHKA 1LNSA 3K5PA 3F4KA 1DX9A 1K68A 3VVLA 2IEGA 1IHUA 5DI3A 3SIWA 4E4TA 3DAHA 1SWVA 3T9EA 3C4JA 4EGFA 4EHJA 1REQA 3QOFA 1L7BA 1UDCA 3RC9A 4EI9A 4C88A 4JKIA 3FLBA 5ITZB 4KR3A 2HYDA 3O8LA 3GFPA 3P19A 2QVZX 4PS0A 3BRWD 1WZ2A 2R11A 4XR9A 2FEAA 2GFHA 3BH6A 3D0OA 1NVGA 3OZRA 3Q9UA 1X9HA 4KYVA 3T3DA 3BEOA 3E4DA 4EB6B 3WK9A 1ILEA 3BWEA 3WYNA 1NX6A 1LK7A 1T5TA 3W78A 1OH7A 1EFCA 2UYQA 3M7IA 3GL9A 2PGAA 4L3OA 4TWZA 4PAOA 1K97A 2O06A 1K9SA 1W0JA 3VU1A 5B4TA 4IOJA 4WXHA 3LQ4A 4ZOBA 3NTVA 2D1TA 4L02A 3HNPA 5CEEA 1G7SA 4UBNA 4IQ4A 4U9IS 4GO1A 5HUJA 1N3YA 1J39A 3JWIA 5NLLA 4MSUA 2GK4A 5CA1F 3PNSA 4GPTA 1WNTA 2OV4A 3FG9A 1WEKA 4ZMSA 3RRBA 1XAJA 4UTZA 2MCFA 4OFXA 5FWXA 1FFXA 3L01A 2Q62A 1NT2A 2ZYSA 4G84A 4WAUA 5DBEX 1GPKA 3SBDA 3V5NA 4QAJA 4ZAWA 1UQRA 4I1SA 4QT0A 3D64A 1KZ6A 1W46A 4CMIB 4PCAA 1FW6A 3NATA 3ROGA 2VRCD 3DD1A 1ESNA 1XKTA 1JFLA 2QR2A 3P52A 5AJHA 5EXEA 1U2TA 4EL0A 5LZ7A 3G9XA 3A6FA 1W1WA 2A57A 5AVXA 3AR5A 5AXAA 2J9YB 2QSUA 2Y1KA 1Y0BA 4PIVA 1FTQA 1YBAA 5AI5A 2G7MC 2BHLA 1S3SA 3ITEA 4DABA 3MTJA 1ZI9A 4HYYA 2Z2KA 3RYCA 1XQ1A 3P4UA 5AKHA 3HI6A 1RQLA 4HH3C 1T9DA 4LYEA 4RVCA 3TB6A 2HHJA 4NYJQ 4HVTA 1B7GO 1ODIA 1W1IA 2DC1A 4NAHA 5IAKA 2QUBA 4N0MA 3QFSA 4BNHA 2CFCA 1F9AA 4UZSA 1TTTA 2CLLB 1KMHB 1R9NA 4P7JA 5BN4A 1Z4NA 4LG1A 2GK3A 4R8VA 1HDZA 1IEQA 1IB0A 4AS3A 1IQPA 1ZK2A 3VR0A 1BJRE 1T5HX 3LVFO 1Z2AA 2IZ1A 4RWEA 2Q5OA 3TSZA 1F8UA 4U2DA 3ZWMA 1FFGA 1T10A 1XI2A 1VZ2A 1YCDA 3UWKA 4GZ6A 3IILA 2PEYA 2ZATA 1DWUA 1Y9DA 4RZIA 4DWWA 2P6NA 2YVLA 1W9HA 1DUIA 2NM0A 1GN9A 4CNQA 1VYVA 3ZWOA 3K9BA 4NMLA 4WXMA 3I92A 3S2SA 4CTJA 3FWNA 1RJFA 1KZ1A 1N2ZA 3PXCX 5JAIA 1Z5WA 1T2CA 3PNBA 2YWDA 4ENPA 3RS2A 2F3RA 2VC2B 5C8ZA 5I8PA 5DHFA 1NHGA 1NXTA 1QZZA 3LRTA 2PD3A 2Y0PA 5FBWB 5FNZA 1BX1A 5A05A 4KR6A 4H7DA 1K5DA 4L6IA 5EVJA 5C8YF 1UUFA 1HNNA 4BASA 2VDVE 4B5KA 3NV9A 1K08A 3H1AA 3U4HA 5EPEA 1UBEA 3BZUA 5FOSA 3CCFA 4GLOA 3LUBA 1IVSA 3GUCA 3TQQA 5GONB 2VWHA 3BGVA 2W70A 3VC2A 3QHQA 2NUAB 1YO6A 3FVVA 5K3DA 5KNLA 3Q41A 2JFNA 4TXLA 4GIBA 1JAIA 4ANFA 5TQ2B 4TL6A 1A95A 1QVAA 4B46A 4V0QA 1X7HA 2BMDA 3O75A 4GI5A 3H5IA 4FDMA 3RABA 2E37A 2QRNA 2R84A 1E1KA 4XTRA 3PXUA 2I29A 2VP9A 3VO2A 1BN7A 4BZWA 5C7OO 1AA6A 3PUZA 3LXMA 5EJ5A 4YAUA 2NXCA 1LPPA 1K9VF 1K7FB 3KXIA 1QP7A 3C1OA 2AR0A 5IK2A 4IJVA 3U19A 3EDCA 4RIGA 2P2YA 4JELA 4B3DA 5A03A 1TYCA 4FN5A 3BB3A 3HKCA 1GPJA 2Y67A 3TDMA 4O3MA 1NTRA 2QMHA 2QQFA 1KTVA 4A15A 1ZEJA 4RF3A 1I6KA 1RPNA 2KW5A 4RD1A 2A0FA 5EZ5A 4EY8A 1KMMA 3T94A 3EGEA 1UANA 2VNHA 4PPNA 3RIHA 2AVDA 1OWLA 1V16A 1P3Y1 4F4JA 3UG7A 5BV2P 4X65B 1NKVA 4B6OA 3MQ4A 1Y1RA 4AMVA 1H8EA 1KFKB 2W6JA 1CIJA 4GI3A 1JDBB 2XDYA 3LO8A 4MARA 3HJAA 4ZGWA 4QDKA 2XW6A 2H1SA 4JB2A 4MMYB 2JGMA 4MQEB 1H2FA 1Y6ZA 4E15A 5ER9A 2UZ1B 5FJIA 5A4KA 1YZVA 1Q11A 4B3BA 4EG4A 5H02A 4B3XA 1QR6A 3FPAA 3QPAA 4DLTA 4AWAA 4TXMA 3PX2A 3OJEA 1J9EA 1QZUA 2I2CA 5DYYA 1JXOA 4F2HA 1EKXA 2Y71A 3T1QA 1M67A 3S2GA 1XZQA 3V7NA 1ODFA 1Z39A 1W8DA 3TSWA 4EHNA 3KYIB 1WE2A 4W9MC 3V2HA 3PF9A 1TI7A 3BE6A 3FHLA 1EAMA 3RUFA 1OTHA 2C9BA 4LSZA 2AZ4A 3CX3A 5F7OA 1R8YA 2ZE5A 3USES 1YC2A 3FZEA 3I1FA 4AT1A 4B76A 3B1JA 2PX3A 1L1RA 5GWXA 1RWNA 3RVJA 1YB2A 2H48A 3CUTA 1PR9A 2OFXA 3KCNA 3FOFC 1TAUA 3ZE1B 1E60A 3B6ZA 3TK1A 4BO5A 1XHLA 3G2PA 4RPKA 5IZCC 3J80A 2M1ZA 4G23A 5SYMA 5J23A 1QH9A 2HREA 3JD4A 2F1HA 2XUZA 1GU1A 2I22A 4ODIA 4W9RA 1C9KA 1WA5A 3VPFA 5L51A 4B3RB 4QGAA 2VJYA 4NATA 4EELA 3BTVA 3AWIA 2Q9BA 1FLNA 5CVUA 5JSHA 3ETCA 2RG7A 4G65A 1Q6ZA 5FWYB 5JBIA 4HVLA 1D5CA 3TW6A 3ZV7A 1XAGA 2X40A 1WW2A 3TX6A 1BO6A 4W99A 1GPAA 4DV5B 1WBBA 1NLYA 5CTAA 1OFGA 4MVYA 2G08A 2LKDA 1EG2A 2HADA 3SKVA 1WMDA 1JIJA 1FFCA 1IEWA 2HF9A 4WKCA 1LZLA 3WLRA 2L18A 4XQEA 2EGUA 3WJ7A 1QO7A 4ESVA 1G98A 4HWOA 4DG5A 1LJLA 3W3ZB 1NVBA 4LPSA 1B00A 1RP7A 4DMHA 5CLFA 1JR3E 3ORYA 4Q3OA 3O2JA 1VLMA 1JW9B 1WUIS 2XMSA 4MV9A 3LHSA 3T1TA 4OMCA 4V38A 4F4HA 1WQ1R 1NHWA 5T6MA 4MRAA 1J2EA 1KRWA 4D41A 3DEJA 4JQCA 2H4YA 4JL6A 3MMSA 4TT3D 4ZT2A 5J5VA 5BNTA 1H9CA 1U6IA 5FUVA 2EKZA 3C41J 1DKMA 1T35A 3TLEA 1D0VA 2E4UA 3QY0A 4Q3KA 2FN9A 3KWMA 2GYYA 3BMXA 2I7DA 5BOVA 1TUEA 4ETWA 2P11A 2ROQA 3PRJA 5SY9A 5T64A 4CQJA 5KJ6A 3V8NA 1W36B 3DHNA