4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
4BFYA 1NBMD 3FWYA 3H84A 2G6BA 3SJBA 1ONBA 4E07A 2HT1A 5JWRA 2J7PA 2NO9A 2GZAA 4V0ME 1N0VC 4YMWA 3ZS9A 5JJLA 1CKEA 2R62A 1F60A 2AR7A 2Q9BA 4BGDA 1UPTA 1KO4A 3TNFA 2ZXUA 2WIBA 1X86B 2ZPTX 1HY3A 2GJ9A 4PXAA 2FEOA 4PZZA 4BLSA 4U00A 4QFMA 4AG6A 5E95A 2FFAA 2C5LA 5FBWB 2ODEA 1S9DA 3SDZA 2ZYWX 3PQCA 4CRWB 1HE8B 1RJ9B 3KZ1E 1DE0A 2OO7A 1D9XA 3BB4A 2G0NA 5FPTA 4DLUA 1QDEA 1E2GA 3B9PA 3AF0A 3GLHE 4PSKA 4XVQA 3WMFA 1E9EA 4CEJB 3VNUA 3B1WA 2AK3A 1VDZA 4LI0A 5HKKD 4QHSA 4XSGA 2QNRA 1ZNZA 2PBRA 2FPMA 3MD0A 1XEWX 2QPTA 1KI8A 4B75A 2PLRA 3QUSA 5GJWC 3RS7A 1ZU4A 1GFIA 3WMEA 4LCBA 1F2TB 2ZQ5A 3A1WA 3P4YA 1S3GA 4D6PA 1SZPA 3NC1C 4CW7A 4D26A 2ZS9A 5EE0A 2AWOA 2W0SA 2R2AA 4CEJA 2NIPA 1A2KC 2OV2A 4F4JA 2OCYC 3EPKA 4JJKA 1DAGA 4RCYA 1YVDA 2UKDA 2W58A 5EJEA 4YC7A 4QBHA 1F2TA 4AKHA 621PA 2HJVA 3MAAC 3U3JA 1QG2A 5LPNA 1NY5A 1R0XA 4X8MA 3PXGA 3QSYA 2D7DA 3OHMA 1Q57A 2R6FA 5HKKA 3H0KA 1HQYE 2F9LA 3WYGA 3AB3A 3L43A 1IY2A 1Z6TA 1FNNA 1J2JA 2QORA 3KKNA 3VR6A 3BGWA 5JS7A 1UAAA 3NHAA 3NC0C 4CF7A 2ZITA 4A15A 1Q0UA 2IEYA 3BFKA 2AN9A 2F1HA 5KDLA 5TXGA 3LXXA 1FMLA 1TMKA 2IA5A 3IO5A 5SZIA 1JEEA 1Q21A 1MRSA 2XB4A 4B48A 1YZTA 2C2HA 4IHQA 4W9MC 1KZGB 4HEJA 4DSNA 1ESNA 1N6HA 3TSZA 1FX0B 2C9OA 3GQBA 2GBLA 3BJIC 3CWQA 4LYAA 4Q48A 4LOAA 4RD4A 2W83A 4JVLA 1EXMA 2PJZA 2QZ4A 4XSHA 4QGAA 4EPXA 1RRCA 5ELXA 2GBLC 3AGQA 2PLFA 4URUR 5BN4A 1E9SA 4HZIA 4HUTA 2JJ2D 1ZD9A 5IF9A 1ODFA 1NVWQ 1NIPA 2GRJA 3KXKA 4QNRA 4JKYA 3SC3A 4KFSA 2K5UA 4AURA 3TW4A 2LWIA 5TV2A 3KUDA 3B60A 3ICQB 2JJ1D 3KUCA 2O8FB 1IAQA 1ZUHA 3BS4A 5E7IA 2PX0A 1X6VA 4BFTA 4RVCA 4IXNA 2Q9AA 2I1QA 3PENA 4OI0A 2RGGA 1E9FA 2H1LA 5FOSA 1RW4A 4BLQA 2JIZD 2MSDB 2QAGA 3ZVLA 1JALA 4A82A 3O47A 2HXYA 5DYIA 3FOZA 1JR3D 2IYWA 3EIHA 3HYRA 4A2PA 4AYTA 4DB2A 1RVDA 2AD5A 3BRWD 1NKSA 4JZKA 2KI5A 1L8QA 2B21A 2BVNA 4WZBE 1Q3HA 521PA 5SZJA 3MG9A 3DZ8A 2O8EB 4PFSA 3SE0A 4FMDB 2IYZA 4NTZA 1E0KA 1Q1EA 5KYKA 5GADl 2ODWA 4JJZA 5FOVA 1KKMA 2NO0A 4LBVA 1GNQA 2ECKA 2WKQA 3RS4A 3WBJA 2ORIA 4YONB 2QGZA 3P4XA 3Q7QA 4JLAA 3ZVMA 1NLZA 1UDWA 2OBLA 2QP9X 3E2IA 5AUQA 1KDPA 4EJSB 3K0CA 3MJHA 2HEIA 2OFOA 2IL1A 1XPUA 4IFEA 3KQNA 2QP4A 4QKQA 2QT1A 1ZMXA 3SJAA 2REXB 3FMOB 2JASA 2IYVA 3WP1B 4Q1CA 4JT2A 3K0CC 1RRFA 1UBEA 1P4SA 3QY0A 4RD6A 2OLJA 3M6AA 3FKQA 3KQHA 4F92B 2GKSA 2X2FA 4MQBA 2WJYA 2GAOA 1E2KA 1M2OB 2UVQA 3OE7A 4EJSA 1NN1A 4B3BA 3R8CA 1OH6A 3PJRA 1ETUA 1LB1B 3QF7A 1SGWA 3RRNA 4LHXA 3GJ0A 1CLUA 1JECA 1GRQA 3SOPA 1XPRA 1UBGA 4HAYA 3WNCA 1AZTA 5GVSA 3QPVA 4EJSC 1OXSC 1YRAA 3IPXA 3PUZA 5HR5A 3TJZA 4UNNA 1H65A 1YR9A 1L7VC 4C0QC 1XJQA 4KFTA 1JQJC 3OEHA 1G291 5DGXA 1WE2A 1YR8A 4D80A 4MRPA 5JS8A 2XZPA 1ESMA 2JA1A 4PPNA 3MWLA 3Q5EA 4RZUA 3OFNA 1N5JA 2OT3B 1RRPA 1M74A 4B35A 3HDTA 5BW8A 3CB4A 3I1FA 2GNOA 2AFHE 1YRBA 2ERYA 2Q6TA 4NCJA 1EFTA 1UKZA 2EW1A 3VTKA 2AWNA 1CS4C 1KTVA 3SR0A 3W9YA 4PAMA 3ZZUA 3IQXA 1RC8A 1EG7A 3AP3A 1P9NA 4QXAA 4Q18A 1DAMA 3CONA 1P72A 1TADA 2OBNA 2WWWA 3BERA 3GJ3A 1JJVA 2BM1A 2ZRKA 4WXPA 4A2QA 2WWYA 2H7VA 4XIGS 1RFLA 3N70A 2VEDA 3TQFA 1JQLB 4POAA 1F6BA 4Q01A 1P6XA 4GT1A 2AX4A 4P4SA 2QN6A 3KX2A 4TL6A 2XZLA 1MKYA 3KJIA 4XOIA 1G18A 1J8YF 1ZD1A 3DVLA 3B1VA 5FUXA 1BMFD 1JB1A 4KV9A 3HJNA 1NVXQ 1C9KA 1CJVC 2VBCA 4JLDA 1XF9A 2CLSA 2QU8A 3LQQA 3OIWA 1I4DD 3MWKA 1P2TA 1Z0DA 3NH9A 3VX3A 2CMKA 1Q20A 2A2ZA 4DEYA 1HUQA 1AKEA 4XTRA 1NIJA 4JKIA 5JHHB 4UQOA 4BEBA 1UBCA 4NL4H 2BBTA 2Q9CA 4A8JA 4TMTA 3AF3A 1IJEA 1Z8FA 3PUVA 3ZLJA 1E2NA 3W5JA 1LV7A 3GJ7A 3T06B 2L0XA 3DDCA 2BKEA 1XXHB 4JYCA 3RLFA 3KKOA 1NMZA 3K0FA 4Y0AA 2IYRA 3QNUA 2WVJA 5L3RA 4CEHB 4A8JC 1GL6A 2R6AA 1ZD8A 3K9LA 3LH5A 4B74A 5AWFC 3WRYC 1OKKD 1TEXA 2BMDA 2J1LA 3BWDD 1BH2A 3K0SA 2H5EA 3QPUA 3G82C 3MRSA 3GFPA 1XJ0A 5IK2A 5CJ2A 3LW7A 2P6UA 3U4QB 2PEZA 5J4YA 1L4YA 1VECA 2NOAA 3U3KA 2QM8A 1CR1A 5L3QB 1E2LA 1XXHA 1EFCA 1CTQA 2JDIA 2GXAA 3ZVNA 1EX6A 2G1JA 3ZGXA 1ZM4A 2KBFA 4G1UC 3Q3JB 4PHFA 3QF4B 4UNSA 4AD8A 3CNNA 3PUWA 3QXHA 3D8BA 1SHKA 3NXSA 3T34A 1G3QA 4PX9A 4AK9A 3WRXC 3D7MA 3U4QA 3LD9A 4FI3C 4RCZA 1E9AA 2PMKA 4M9QA 1AS2A 2XTNA 1N6OA 1U0JA 1OJLA 2QSZA 3EIEA 2N1BA 2VL7A 3PFIA 5C4MA 4MGIR 3R9XA 4D0GA 4NPHA 3CIOA 3K0EA 3Q7PA 5TB5A 4DUGD 1XEWY 2ZI4A 4N1AA 2VTKA 4UXJA 1XP8A 5SZHB 4ZI2A 1E0AA 1PLKA 2A5GA 2ZRPA 4BZPA 1UKYA 3UMFA 1T3LA 3C41J 4Z1MA 4Q7LA 1J90A 3AVVA 2XJ9A 5BQ5A 2P65A 1TQ6A 3MSXA 3NDPA 1Z6GA 3QKTA 4O2RA 2JLUA 1W49A 1QVRA 2CL7X 4Z54A 1W4RA 4HI0E 3FMIA 1WP9A 1BYUA 5F98A 2H92A 5CLLA 2ZRHA 4OI1A 2XTMA 1YKSA 1YZQA 4PQYA 5B30A 2IHYA 5AR1A 4B3GA 3R20A 3NTUA 1F5NA 3EZ2A 3KKQA 4G5GA 5EXXA 2OEPA 1G7RA 3O8BA 2Y8EA 4GI7A 3UIEA 3G0HA 3LBHA 3SU8A 4MUBA 2EFHB 1MR3F 2N42A 2ZVPX 4L9SA 2QBYB 2DWPA 5AJXA 2ZSAA 4Q9IA 4BASA 1P60A 2FMXA 4TQUS 2VLIA 4M53A 2WIAA 4US0R 1VYUA 3BC1A 2GEUA 2ZIAA 4DDUA 1AM4D 4OHZA 4JBWA 1DO0A 2GAAA 3UWOA 1AKYA 3NG1A 3GJXC 1ZP6A 5JCZA 2ZEJA 1OB5A 3GJ4A 1TQ2A 5FPHA 4ACBA 1G1MA 1DG3A 1YZNA 1XB2A 1S0UA 3NWJA 4M22A 2Z4RA 2QBYA 3OAAA 1E3MA 1N0WA 1FUKA 2FPLA 4IDPA 1G8PA 4W5JA 5EP2A 4F4IA 4IOJA 4QBGB 4LC1A 1VMAA 2XOKD 3VR4A 3QKRB 2ZJZA 1DAFA 3P20A 3BH6A 5IT5A 4LBWA 3EW9A 3GEEA 3H86A 1E98A 1JBKA 1DG1G 4R71A 5BN3A 1HQCA 4XD7D 1SKQA 1A4RA 4JL5A 4FN5A 4E22A 1NRJB 3CLVA 3A4MA 5EXSA 3T35A 2DFKB 4M21A 4I1OA 1KZ7B 1KJWA 5FUYA 2O8CA 5JBQA 2LCFA 2NO1A 1Q1BA 1XRJA 2QEQA 3TUJC 3HP1A 1XCPA 3RRMA 1MO3A 4CZ2A 3RC8A 2D2EA 4LJAA 3TH5A 4O25A 1KAGA 3SEAA 3QI2A 3T12A 4EUNA 1J8MF 5DH9A 1UKEA 2P5TB 1GUAA 4IDOA 4YMSA 1TEVA 2C77A 4Q9KA 1SKYB 1X3SA 2CCKA 3PUXA 4B2LA 4DSOA 3C4JA 2CLDX 2ZRLA 4NH0A 3WBKA 1D2EA 3GLFE 2WJJA 3AF2A 3GJ8A 4KYUA 3VMFA 1P5ZB 2W00A 3U7FB 4OQMA 4TYYA 4MGYR 2J5XA 1W0JA 4B33A 2V8OA 4TZ0A 2RCNA 1NSTA 3A1TA 4C0LA 3PCRB 1MO4A 4JLJA 1ZIOA 1I2MA 4I81A 4NKRA 3IHLA 5IRCD 3TW8B 1W5SA 1ZJ6A 2OZEA 2YC4C 3MGCA 4LJ5A 3ETLA 2O0HA 5L3SA 5EQTA 5CJPA 5J47A 1COWD 1OFIA 1NP6A 1G7SA 2VP5A 3PITA 4GOXA 5DYGA 4EDHA 3UKDA 4W5HA 2WWXA 4M0LA 3RS5A 2JLVA 3Q5DA 1VCMA 4F4CA 1JJ7A 2IYYA 8OHMA 1XD2B 2ZRAA 4I99A 3EIQA 2CK3D 2RB4A 4P32A 2AKYA 2FA9A 3I4LA 2FSFA 4RD1A 1KI6A 3EZ6A 4KSBA 5EZ5A 4HB4A 4IFBA 1E79D 5DSZA 3AH8A 2GJ8A 4LYHA 2IYTA 2IS4A 3ZD7A 3LRPA 3NBFA 1GL7A 1XCMA 1KI1A 2FU5C 2VF7A 2WZQA 1XD2A 2KSQA 3N2EA 2W6IA 5D3QA 2DWQA 4A0HA 2LKCA 3FDIA 2HUPA 5JI3E 3I73A 4A0FA 2RMKA 1E2IA 3AVQA 3TE6A 3VKWA 5FL3A 3U3MA 4K46A 1D5CA 1W47A 6Q21A 3ZDQA 2IUSA 2PZGA 5KOYA 2I3BA 1FL9A 2FGKA 1X1SA 4Q19A 3TUZC 5FOXA 1T6NA 1OXUA 3R9IA 1T5IA 4TT3A 721PA 4KXFB 1L4UA 2YWFA 3P32A 5J4HA 2A5FA 2WICA 3DL0A 2NTYC 3GLIB 2OCAA 4V0KA 3D6TB 4OI4A 5KUTA 4AKIA 3ND9A 3Q72A 1IM2A 2ZJBA 1LY1A 1US8B 5EE1A 1OHHD 4GRAA 2GCOB 2F55A 4B32A 5D3MB 1QHIA 3OEEA 3GJ5A 4Q4HA 3LLUA 5JFGA 1FPMA 3TUIC 1M7HA 3QXCA 3LVQE 3FKSA 1WA5A 4JMPA 2BCGY 2GVDC 1XTIA 1LW7A 5EP1A 4B76A 4C0HA 4BZQA 1WQ1R 4GMDA 3GLIA 3AP1A 4XJXA 2DFLA 4GOKA 4EKDA 2ZETA 4OJKA 3L0SA 2ZUDA 1GOTA 2O0KA 3KQUA 1OPXA 3ZZ0A 4BQSA 4IJMA 4IDQA 5D3MA 4ZCLA 3SQWA 3LV8A 4QJ5A 3TVDA 2ZE6A 1VKJA 3L8YA 5P21A 1KSFX 1G16A 2NPIA 2FZ4A 3MLEA 1TX4B 1HH4A 4E09A 4UKDA 1NG9A 2QQEA 2E9SA 1JPNA 4MKHA 2VHQA 3DOEA 2WMNB 1KGDA 1JI0A 1ZM3A 3RYTC 3X2SA 1DS6A 2R6DA 4NU0A 4DLSA 4TWZA 4XVUA 2GXSA 1OHHA 3A6PC 2P3SA 4N0DA 3THYA 3PIRA 4Q1DA 1E2MA 3FYHA 1E1QA 4ARZB 1JXMA 3GLGB 2ZRMA 2UZIR 2ZRNA 4NYIQ 2V54A 4PHGA 4ZCMA 4LWZA 2HJGA 4B2PA 3BD9A 4HAXA 4YDHB 1Z6XA 4DLWA 5J4LA 3AM1A 2A9KA 3K70B 3REGA 4E03A 5CK4A 3WYAA 3I72A 2H18A 1SXJB 1VCNA 3I3SR 4FD2A 1GVNB 3DM9B 2BHRA 3NDBB 2WHXA 2PT5A 4WW0A 1QHHA 3V9PA 3GLGA 2J0QA 1X8JA 4O3MA 4GNKA 1KAOA 1GNRA 4JIMA 1Z28A 2BJVA 4Q03A 1D2NA 3SJCA 2ZI9A 2NQ2C 4DEXA 4MGKR 1QVAA 2ZRGA 4HDQB 1TNDA 2JLQA 3FFBA 5E4FA 1SXJA 5DHAA 3RRZA 3IHWA 5FPKA 3EXAA 3IEUA 3QXJA 1E9RA 2OESA 3ZJYA 1XTKA 3U3RA 4B71A 1YE8A 1VG8A 4B2IA 1G5PA 1R6BX 1EGAA 3U3OA 3F5FA 3NEJA 3SNHA 5C1BA 1FP6A 3K70C 3KXLA 1YZKA 4LJ9A 4PC2A 4Q21A 1SXJC 3TK1A 1U81A 2G1KA 3DO6A 4QL3A 4RFVA 3FE2A 4L4UA 1FMJA 3AVWA 1CEEA 2KWIA 2HCJB 2R6CA 4CGZA 2EFGA 2QROA 3X1DA 1IONA 3QQ5A 1QHXA 2DB3A 3CR8A 3RS3A 4DLXA 3ADCA 3L8ZA 5JWOA 2H8KA 1QRAA 2VYFA 4HZUA 1N5IA 1E9CA 2CDNA 5TMPA 1NSFA 4GSYA 3T1OA 4Y0VA 1DAIA 4JL8A 1AQUA 2JLRA 3RVBA 4X8LA 4A36A 4A92A 2W6JA 3CWZA 3CZPA 2ODBA 2BC9A 1UEIA 1Z6AA 4KSCA 3IIJA 4AYWA 3ZYCA 1CJTC 2QAJA 2WAXA 3FVQA 5FBRB 3ADBA 3I92A 4FMBB 3EWSA 1WCV1 4DT1A 4KBFA 2DBYA 2RHDA 1G5RA 5KTYA 1XNJA 3EASA 1RKBA 2X2EA 2EWVA 2Q3HA 1OXXK 2ZVQX 3VHLB 2O5VA 4ZPXA 1YJ5A 4G0NA 3CRQA 4YXWA 4LRWA 3B82A 3GCGA 4HLUA 1Q1QA 5KSOA 3K8YA 4FMCB 3THXA 1II9A 5B58C 1AZSC 1KNQA 3LX8A 5K8LA 1VG0B 1X8LA 2MSCB 4N3NA 2WJIA 1Q12A 1A2BA 3C16C 3VKGA 2BDTA 2ZS7A 3SI7A 1OSNA 4HLUC 1GILA 3QXXA 4TLAA 4LJ4A 1KIMA 2A78A 4US1R 2FWRA 3DOFA 2IW3A 5CITA 4XTCS 3SQXA 2PZFA 1JAHA 4R98A 1JEDA 4UXHA 2VF8A 1U2RA 221PA 3DMDA 1Z47A 4AY2A 4NYMQ 1OXTA 4HLCA 3OZXA 4BLOA 4W7SA 1P9WA 1KSGA 4FWTA 3Q8XB 1YHNA 3G5UA 2BKUA 1G19A 3MUFA 4YQFA 2O8DA 1Q44A 5LB2A 4NCIA 2Q3MA 1RIFA 2RGXA 2W2VA 3T5GA 3X1XA 4DVGA 1JNYA 2QMUA 2GWHA 2ANCA 2IYXA 1ZRHA 2VPPA 1J99A 3LA6A 4ZI3A 3CRRA 5FTLA 5JZVA 1PUJA 2YVUA 3H1TA 5BYKA 5IDVA 1N6NA 4KVGA 4MKIA 1U8AA 2HT6A 5CIWA 3TRFA 1T8UA 3B2EA 1NF3A 4M9ZA 3BFXA 4WAUA 1UF9A 2GCPA 1CR2A 2C8VA 2A5YB 1ELOA 1SVKA 2QENA 2QAGB 5JSZA 1KY3A 1XTQA 3R9WA 3NBYC 1G8HA 2P6NA 1T91A 2ZSBA 2CLCX 1MO5A 2C99A 3ECCA 1G7TA 3BBPA 3MFYA 4B73A 1TUEA 4DSUA 5TARA 2IS2A 1ZNXA 4U02A 2O52A 2QY9A 1D8TA 2ZSEA 4PC3A 1T0HB 3K53A 3PEYA 2C95A 2NPFA 2OAQ1 1BO6A 1W0KA 2IF2A 3HYTA 2ZRBA 1AGRA 2OCBA 5KHOC 2JJ8A 5EP4A 1NVUQ 1OH7A 2RGNA 3C15C 5KO2A 1XMJA 1Z5ZA 5C4GB 5EZ6B 2Z83A 2J9RA 1NL3A 5FBVB 2FFQA 3CPJB 3U60B 3QXSA 1XEXA 2YJTD 3EA0A 4H1VA 5FBLB 3SFVA 1A5TA 3OE7D 2RGNC 3BK7A 2GXUA 2AXNA 1AJEA 1PVOA 2QAGC 2I4IA 2QPAA 4PSVA 2QMEA 2GK7A 2OLKA 1XMSA 3IBYA 1H8EA 4W5WA 2VSXA 3EARA 3D3QA 5F3WB 2CE2X 5EXTA 3IGFA 1EFRA 3CF6R 1WBBA 3TSWA 1EWQA 5FI0B 1R0YA 3W6OA 3U61B 4D4JA 3OEHD 4M9XA 1TF2A 1GSIA 3HPRA 1NLYA 1Z06A 4DCNA 1IXSB 2WJHA 4IEEA 3CUEF 3VNVA 2NGRA 4RZXA 3OFND 4LUCA 3I8XA 1XMVA 2HLDA 2ZJ2A 1X1RA 4C2TA 1KI4A 2P67A 5G3YA 3F0TA 1IN4A 1P61B 1HURA 5FTKA 4EPTA 5FH9A 3AVUA 4OL0A 3TIFA 4QHTA 1XPOA 5DN6A 1LF0A 3TQCA 4AWXA 4DCVA 1Y3AA 4Q1FA 5JHGB 1E0SA 1ZNYA 3P1JA 4RZ3A 1XZPA 3K1JA 2GJAA 2GF9A 1YZLA 4MITA 1BOFA 2IYQA 1FP7A 4HAWA 1KO8A 3P27A 5L3VA 2Z4SA 4Q7KA 4A4DA 1SULA 1CRQA 2ZSDA 4NDZA 2B8WA 4NP6A 5JI2E 2MMCA 3EZFA 3EC2A 4MH0R 2A5DA 1I4LD 1R5OA 4TTQA 3SFZA 2CNWD 1P2SA 3HR8A 5B57C 2OM2A 2QI9C 5AJYA 3MMPA 4AKEA 3EZ7A 4II7A 1NVVQ 3M0EA 4P4SB 1VHTA 4BEJA 4CDGA 4PQFA 4ABYA 1VG1A 2WOOA 5CDFA 4PO8A 1KYIA 1SVOA 2FX3A 2J45A 2ZE8A 1T9HA 2BCJQ 4Q02A 2RGAA 4B43A 3BH0A 2N46A 4I4LA 3QG5A 4IDNA 1II8A 5FL7A 4A1FA 2GA8A 1HTWA 2VP9A 2ZTSA 4GL2A 3DM5A 3I8SA 4MYUA 1E2EA 2F1JA 3FHTA 3LDAA 2YC2C 2AXPA 3C7KA 3KQLA 1KI9A 3GLFA 4QBFA 3KB2A 1OYYA 4F93B 2LKDA 4A8JB 1G3UA 2C98A 5AJVB 2ZS8A 2PEYA 5IK2D 3TAUA 1R2QA 5CK5A 3RSLA 3B1YA 1KNXA 2CNWA 2GHIA 2R9VA 2YOHA 3E70C 1NBME 1SHZA 1KHTA 2V4ZA 2VP0A 3IDQA 1N6KA 3K0FB 4KJZA 4NBSA 4M1TA 3SJZA 2JDID 4UJ5A 4EIWA 3UPUA 1VG9B 1N6IA 2XTZA 2ZROA 3QENA 3U7EB 3K09A 4UNPA 4TL7A 4JLNA 1G64A 2FSGA 4RD0A 3LQRA 2OSBA 4LV8B 4O0MA 4V02A 5KSZA 1LS6A 3CH4B 4TYQA 3BFVA 2C9CA 2D2FA 2IF0A 3UK6A 5CB8A 2KJQA 4OQNA 2D3WA 1GWNA 1N6PA 3PEVA 2ZJOA 2WPDA 4NCHA 3TLXA 4QJ4A 2DWOA 3W5IA 4AI6A 3CR7A 1R0ZA 1P3JA 1Z6YA 2ZI6A 4PC1A 4C7OA 1RZ3A 1A82A 2RAPA 2ONKA 2ZR7A 2FF7A 3EWAA 3VX4A 2PZEA 2VP4A 1BKDR 1S1MA 4RD2A 2IBMA 2YINC 2CVHA 3GEHA 5C2JB 5AUNB 1NKTA 2NO6A 1XX6A 2P0EA 3B9QA 4HUQA 4Q4JB 3UG7A 2PCJA 2JEOA 4Z1MD 1E2FA 1KO7A 1AK2A 4PO1A 1ZIPA 4TTRA 5KNDA 1N3BA 4QGHA 2YKGA 3Q85A 4MRVA 4MKFA 2IWHA 4DIEA 1K5GA 2J0UB 1S8FA 4ZKEA 3UATA 4M1KA 2CHQA 1E69A 3CRMA 1Z0AA 1E6CA 4LX0A 4LZZA 5HCNA 4OHYA 1KJYA 2A3RA 4FMCF 5B2ZA 4YLGA 5EXPA 4HLQB 1F48A 2EQBA 1G17A 2QL6A 2GESA 1YZUA 4OHVA 4Q4JA 4TMKA 1U8YA 2V6IA 2QM7A 3RWOA 3TR5A 2EFCB 3MCAA 1QHGA 2REOA 4MKGA 2XNDA 3AP2A 3AVPA 2RGDA 2WBLC 3FHCB 2OXRA 2RGEA 3W8NA 3P26A 2J0UA 4MYTA 5FFMA 1X8KA 1GP2A 3O8DA 1VCOA 4ZIRA 4PHTA 1ZYUA 2XAUA 4DSTA 3VFDA 1OYWA 2CBZA 5DIFA 4P4UA 4QC2A 2CE7A 2HCBA 2JCSA 3AVXA 2V7QA 4OHXA 2IXEA 5DE3A 2W2XA 3TSOA 3IEVA 1ZUNB 3S1AA 4TMXA 3LX5A 2BBOA 2H16A 4C0KA 1CJKC 1T3HA 1EWRA 1T3SA 1KMQA 4LJYA 5TDHA 1OT3A 2GCNA 1Z3IX 3OAAD 1PUIA 1Z0KA 4U5XA 3THOA 3MWJA 2XEXA 3A58B 5A0FA 4UJ3A 3RS2A 1EFUA 1Q3TA 4LV6A 4RZ2A 2CL6X 1FNMA 2JLWA 2HXSA 1KI2A 2ZRFA 3AVOA 3QG1A 4PO9A 4Z8YA 2WV9A 2FG5A 1G4UR 3IUYA 1W2GA 4L8GA 1VYTA 5JJKA 2HF8A 2WM9B 4LHVA 4AG5A 3FMFA 3ZD6A 1SVSA 4OYHA 2AFIE 4KYIB 4URXR 3E1SA 4D0NA 3NKVA 4HB2A 2F6RA 5HPYB 2XXAB 1W44A 1NN3A 2J7KA 2V9PA 1E2HA 2O8CB 4I1UA 4FMDF 1Z63A 1GKYA 1JR3E 4MYHA 3RRYA 3TR0A 4V0MA 3ASYA 3LFUA 4RFSA 3V4RA 4ASUA 1W0JD 1XD9A 2JGNA 3GLHB 4GP6A 1G6OA 4LPSA 2FPKA 3R7WA 4JLMA 3QBVA 2XXAA 4KCGA 1G3RA 2DR3A 2OBMA 2IUUA 2VHTA 5LB4A 4P3YA 2IS1A 4BFXA 4BFUA 1Z83A 1RE0A 3FHOA 4NYJR 2ZR9A 4BLRA 1YR7A 1HT1E 2EVWX 5G53C 3J81k 1F2UB 2DY1A 1G41A 3PR1A 3GLHA 2KE5A 4GOJA 1Z2CA 2EU8A 4YDSA 3QVUA 2BV3A 4C0AC 3V4FA 3WHLA 5CIQA 4DCSA 1XJCA 1VCIA 3AEZA 5DISB 2ZREA 4ZDIA 3T1QA 1IY1A 5L3SB 3I5YA 3KL4A 5KPJA 1L2TA 1XU4A 4EFLA 1PV4A 3VQTA 3QPWA 1GIAA 4IEIA 3WY9A 1F2UA 1IHUA 3TAHA 1N5KA 1MOZA 2W6ID 4JBXA 1KK2A 3FPAA 2IXGA 4M1YA 1KI6B 1TUIA 2DPXA 1KOFA 1AQYA 1R8QA 4MRRA 3SN6A 3U6BA 3CF0A 5HCIA 2JATA 5CLQA 2A5JA 5J5CA 3WNDA 3N5CA 2QTVB 3C14C 1OW3B 2QMHA 4TT3D 4LDJA 4C0SA 4S2EA 4TL8A 2FEMA 4BWYA 2XSZA 1GL9B 4KAXA 1T8TA 1KY2A 4X8OA 2QRNA 4DLTA 4KITB 3O8CA 2QPOA 4U7DA 4KVAA 3SYNA 3T15A 3OEED 5SZKB 5H68A 2GZDA 1R7RA 1QHSA 4RJLA 3FKSD 3VR1A 3TBKA 4BRWA 1P75A 2G9NA 1KMHA 3KKPA 3AF1A 5JWHA 3CZQA 1DOAA 1YQTA 4G01B 1P7CA 4JVMA 2ZU6A 3U2QA 4B3FX 4C0BA 1TTTA 4BFZA 2V1XA 1U9IA 1XEFA 5LDDC 1R4AA 1H8HA 4M4SA 1GKIA 4XWKA 2AL7A 4L16A 2ZE5A 4Q4HB 4WZ6A 2WAYA 3SHFA 4B47A 3ND8A 2FOLA 1W36C 4TQAA 4R9UC 3C5CA 3ICEA 4MRNA 3I32A 1U9IC 5F9FA 1NJFA 1Z29A 3RAPR 1NN0A 4TYNA 1A1VA 1GM5A 2J0SA 3GEIA 2HYDA 4WBSA 1G3MA 4Q66C 2CJWA 1XXHE 4B6FA 5A5GA 2GVZC 4DLZA 4ZDJA 1AN0A 1N5LA 3HU2A 4URVR 1HT2E 3W34A 4HSEA 4ZDKA 4NHOA 5F2EA 3AKCA 2CHVA 1E1QD 1LS1A 5DO9A 4TMVA 4B44A 2NZ8A 1W48A 2R8RA 2H17A 3RDPA 1ZINA 3KQKA 1KI3A 3LWNA 1S4QA 1XWIA 1XCGB 2P6RA 4LHYA 4EQ6B 5IHPA 4QG7A 3FFAA 3QKUA 1GNPA 2R6GA 4Q7MB 3W90A 4FCWA 3AKEA 5B64A 3THYB 4CIDA 3RNLA 2GJKA 5FR1A 2GETA 3WXMA 4OK3A 1IN8A 4JYBA 4GPTA 4DB4A 1P62B 3SHWA 3U5ZB 5J4KA 1JR6A 5FI1B 2CHGA 2QRZA 1CBUA 4HATA 2R65A 3T1VA 4URWR 3UMSA 3VHXA 3VU9A 3I62A 3U44A 2EWWA 3LLMA 1MABA 4EQ6A 3K70D 3NEYA 2MSEB 1E2JA 1K5DA 1XDBA 2RGBA 4RSGA 2BEKA 4A6PA 4PPGA 1SXJD 2V55B 5CYPA 2VP2A 3NBZC 3ZIAA 1QHHB 3B5JA 4YMTA 3AF4A 1TAGA 4Q4AA 2C03A 3GP8A 1DTSA 2F3TA 3AKDA 1U90A 3HPQA 4MGZR 3T61A 3ZZTA 2PL3A 5HE9A 5GJBA 1IN7A 1Z2AA 2GXQA 2R44A 2ERXA 2F43A 2W2TA 2OHFA 5A4JA 5M04A 1M7GA 2ZAOA 3IBGA 2AD1A 1J70A 2CCJA 4M1SA 1CR4A 1FQKA 2GDJA 2ONJA 1E2QA 1PZNA 2VRWA 5J4VA 2QE7A 2WKRA 4DRZA 1DAEA 4Q00A 1HYQA 1DAHA 1LFDB 4TLCA 2BMEA 1T5LA 2W6JD 3A4LA 4LV5B 4BFVA 3B1ZA 3KXIA 5J40A 4DDVA 4Q5IA 1GITA 2WSSA 3CRW1 2Z6VA 4KFUA 1GAJA 4BRUA 4B3XA 2FNAA 4HZUB 1WMSA 4FCTA 1QF9A 4MYCA 4Q9JA 3H2YA 2MMGA 2NG1A 4I1VA 4GZMA 4ITRC 4YXWD 4MUAA 4PC6A 1QZXA 1SVIA 3DZDA 4TQ9A 4FWIB 2QSYA 4A0GA 1BIFA 3EPHA 4S35A 3QKSA 4PR0A 3RABA 3QJYA 5K8TA 1E1RA 1A7JA 4DT1B 1YZGA 4JLOA 1CP2A 4TSFA 5KNBA 4ESVA 1T4GA 3RHFA 4PZYA 3QOFA 4US2R 3OIUA 4CEIB 4BUJA 5DI3B 2YOFA 1WDTA 3CF2A 4DCTA 2FV8A 1N6RA 2OXCA 5EUMA 3LXRA 3KJGA 3THXB 3CPEA 5JECA 1FZQA 2OFWA 4IVPA 4KU4A 2IC5A 2WMOB 4ZDWA 1E4YA 1WXQA 1ZUIA 3DKVA 2XGJA 2GEDA 1XTJA 1LVGA 1NJGA 1I2DA 4EPVA 1EK0A 4CEIA 4DXAA 2X8AA 3DHWC 1W4CA 2DCUA 1NMXA 5DI3A 2ODNA 1OH8A 3KB1A 1N0UA 2J87A 1CIPA 1NBMA 1TL7C 4DKXA 5KDOA 4TYPA 2Z0MA 3EPJA 1KDRA 4EPRA 2BJWA 3ADDA 1KO5A 2BM0A 3BOSA 2YWHA 2O8DB 2IK8A 2YOGA 5E3HA 1TU3A 1V5WA 1RJ9A 2ASEA 1JXOA 2Q21A 4CYMA 2H57A 2FDCA 2XZOA 3EA5A 2CXXA 1HEIA 4MDFA 3UANA 1WRBA 1SKYE 3EZ9A 4KFRA 2OG2A 1W1WA 2PX3A 3THWB 1MRNA 1MV5A 3CX8A 3CRVA 4M9SA 3I61A 1O3YA 2ORVA 2YHSA 1CF4A 1W4AA 4X8HA 4L9WA 3JZAA 1W0KD 4HLDA 3WNBA 1ZCAA 3X1WA 2V3CC 3TGPA 1ZVQA 2QUZA 3LBNA 1KDOA 4KLZA 5JSZB 1OH5A 2B8TA 1WB9A 2FN4A 4LC0A 3M1IA 1M8PA 4BE7B 4QM7A 4IOLA 4Q1AA 2WJVA 5FUWA 5K8IA 4GMXA 3VAAA 4FW9A 3IILA 2G83A 5BXQC 4OK6A 3LNCA 4NYIR 2FH5B 5CB6A 3THWA 2QT0A 4IOMA 4F7WA 2D7CA 3B78A 4HAUA 4BLPA 5AJWA 1KSHA 1H8ED 2KBEA 3PUYA 4HAVA 4K8OA 4DLRA 1EFHA 2PCLA 3B7GA 2JLXA 4QM6A 2D62A 3TVTA 2IEZA 2FSIA 1EFRD 1S2MA 4Q9LA 1I4TD 1JPJA 1XEXB 4V0OA 1OIXA 1ZNWA 3CBQA 1II0A 2OCPA 2XITA 4C0JA 3JVVA 2EFDB 1R5BA 1E9BA 4NONA 1M7BA 3IIKA 5BYJA 2YWEA 3OF5A 5K8UA 1RRGA 4F91B 2GK6A 2VSOA 1D2MA 1OV4A 5FTJA 2HV8A 5FTMA 2HLDD 4WZAE 1G7CA 4TLEA 3B1XA 3W3AA 2HDNB 4CT4B 4NCNA 2ZI7A 1KK1A 3IIMA 5HE8A 1M34E 4BECA 1RYFA 2FFHA 4LJ8A 5JRZA 4LK2A 1G4AE 2ZR0A 1FX0A 4D2IA 5JMTA 1LNZA 3OESA 4KHZA 3B6EA 5AUOB 1QHYA 2YYZA 4M2LA 2IT1A 4BPBA 3PVSA 3VR2A 1Z22A 5DN6D 2F1RA 2FFBA 1W46A 3KTAB 1E4VA 1R5NA 2ZJ8A 4ZV4A 4PAOA 3K9GA 1G21E 1ZC4A 1OB2A 3GLIE 1OLOA 1XZQA 2BMFA 3GD7A 3HU1A 4JLBA 2ZU0C 4P0TA 4K81B 3LBIA 3AKYA 1HV8A 3UWKA 2DFNA 1ZM2A 4C4PA 5UKDA 3OIYA 4KODA 2O8FA 2IS6A 2VO1A 4BFSA 1UEJA 3KTAA 1Q22A 3X1YA 3E5HA 4DLYA 4JLPA 2Z5FA 1IBRA 5EUQB 1OE0A 5G40A 3RSOA 3PEWA 2G3YA 2JJ2A 3BB3A 4UXIA 3CM0A 3HWSA 2BBWA 2O0JA 1KK3A 5DLQC 4UNQA 2BMJA 1KK0A 1J7KA 2RGCA 2JJ1A 4PANA 5FL7D 2O8EA 821PA 2Q3FA 1FOEB 4MA4A 4FIDA 4GDFA 4KLNA 1AIPA 3L0OA 2JIZA 1KDTA 4MRSA 2VQSA 1G6HA 1JR3A 4WVFA 4FINA 4OJQA 4QGFA 4IXMA 3CW2A 4LHWA 121PA 3BH7A 1VIYA 4PPFA 1II8B 1EX7A 3GLGE 1OXVA 5DI9A 4NYMR 5DHFA 2YZ2A 2GZHA 4JVNA 4P31A 2QMOA 2KB0A 1OFHA 3KJHA 3ZH9B 2HYIC 1AGPA 2GJSA 3GLFB 2V6JA 2WWHA 5E7JA 1SXJE 3REFA 3C8UA 2PT7A 4NE2A 1DO2A 3A8TA 4D81A 2CEAA 3SYLA 1CJMA 3A36A 4OI2A 2B7BA 4R2HA 5JLJA 2F1IA 3B8HA 2WPDD 4OBEA 3DPUA 1Z08A 3GJ6A 4G5RA 3CNLA 1S96A 1XTRA 2RHMA 2P2LA 3NIBA 1HE1C 4JBYA 5BWMA 4PZLA 2Z43A 3BE4A 5FOTA 1KO1A 2XNSA 4OHWA 3W3ZB 3KDSE 2IX3A 4NCKA 4G3XA 4QJ3A 4IKEA 1NLFA 4WIAA 5FPYA 2XJ4A 3WP0A 1E32A 3IQWA 1SVMA 4Q7JB 3SYKA 4DWJA 2P5SA 4P4TA 3AQ4A 5F9HA 1GDDA 3RC3A 4CT5A 3EG5A 5HZKA 1TPZA 4C7OB 4JS0A 1FW6A 2ZJYA 4EFNA 2FSHA 4H1UA 4M1MA 1WBDA 1KI7A 4EFMA 3CNOA 1KSJA 3JZMA 4HUQB 3K09C 1DAKA 5EE9A 3K9HA 1P2VA 2YV5A 1G3IA 1LTQA 3BAFA 5CM9C 4E5UA 3WYFA 5JRJA 5FUVA 2F7SA 3UXMA 4YMVA 4ON9A 1WF3A 3K0AB 4OQXA 2XNDD 1GKUB 3KJEA 3IKJA 2J0VA 3AUYA 3AGPA 3TKLA 4GP7A 2CCGA 4URZR 421PA 4C9BA 2J41A 3U6KA 5E7MA 4RKEA 1CULC 2G88A 3HR7A 4LGMA 3VR5A 2OAP1 4DIDA 1RYHA 5H8WA 2QA5A 3ADKA 1VHLA 4XVRA 3QEOA 4OQFA 4AC9A 4PSAA 4DHEA 3LW8A 4HDOB 5KPDA 4TLDA 3U7GA 3K9NA 2V1UA 2WWIA 1AS3A 1HA3A 2OILA 3QEJA 3X1ZA 4CVNA 1G20E 2BWJA 1FTSA 1FTNA 2V7QD 3K0AA 2REBA 5DNYB 3CX7A 3Q9LA 1VPLA 1OIVA 2CVFA 3D31A 1PLJA 1F3OA 2ZI5A 5JEDA 4HB0A 3SBEA 1XBTA 2CL0X 1BMFA 1GG2A 3EAQA 4ZIRB 1RPZA 4TYWA 1TF5A 1U8ZA 4NYJQ 3W6NA 4DCUA 1D6JA 1Z07A 1UBFA 2YNMA 2FJUA 5FR2A 2ZUCA 3T5DA 2OUKA 2VIIA 1S3SA 4URYR 4TMWA 3CKLA 3ONWA 4M1OA 3S1AB 4CEHA 2D06A 2VA8A 3W8RA 2QP3A 2ZRCA 4QRHA 3ASZA 2IYSA 2VH5R 3ZQJA 4D4KA 1V43A 5FBQB 1NY6A 1VIAA 1E0JA 1R0WA 1E99A 5TY0A 4LYFA 1CRPA 1UJ2A 2ANBA 1GRRA 4IVRA 5L3QA 2XB2A 4YMUA 3QE0A 5KSPA 5LD2B 3ZQ6A 4AIIA 4LBYA 5C18A 2VHUA 5LBIA 4A9AA 1JAIA 1Z0JA 2X77A 1OKKA 3DEFA 3QF4A 4TTPA 1NVVR 4IDHA 1U94A 1G8GA 5CYOA 4HYYA 3UMRA 1T0JB 2A30A 1W4BA 2A7QA 1IY0A 3V00A 3VKHA 5G41A 3DMNA 4Q1EA 2RH5A 2O8BB 1BS1A 4Q1BA 3H4MA 2WOJA 5GJCA 4ASUD 1N25A 4DZZA 1UDXA 2AHOA 5G3ZA 4OQLA 2JLYA 3U7HB 1CXZA 5FPSA 4G5QA 4Q9HA 1E94E 4PPQA 2BOVA 4C3ZA 3M4YA 1CJUC 4HB3A 5ANRB 2PJRA 1MO6A 1NG1A 2NMVA 5AUPB 1QHNA 3LY5A 1AA9A 4GFDA 1DVRA 1LF5A 3WMGA 5LD2C 2NO7A 1DELA 3B13B 2ZYVX 3PV0A 4JT4A 1IN6A 2WSMA 5L8VA 3PG5A 4RFSB 4EPWA 2WWGA 1M1YE 2O8BA 4ILEA 1EESA 1U99A 3NH6A 5FOWA 2NZJA 3KKMA 4FXPA 3R7WB 1TU4A 1XFAA 3CX6A 1R10A 4DUGA 4GZLA 3W6PA 4NMMA 3KFVA 5AJZA 2C9YA 4EAQA 1ZC3A 1IQPA 5KDDA 4XWAA 4M1WA 3AVTA 1ZCBA 3BORA 3CPHA 4LY6A 3HU3A 3FTQA 4NZYA 2WKPA 2EYUA 1QBKC 3C5HA 4QOSA 3AUXA 1VYVA 1OIWA 2JLZA 1MT0A 3SS8A 5KU1A 3I5XA 4RD3A 3RS0A 4RY2A 5HZHA 2VHCA 4V03A 1K8RA 1UKVY 2TMKA 4V0LA 4L15A 2QTFA 2ZI3A 3N2IA 2W0MA 1B0UA 1UADA 4IW3B 5BN5A 5JEEA 1UFQA 1U0LA 1ZAKA 3CO5A 2XSZD 2BEJA 2Q0HA 4ESHA 2B6HA 1Q1ZA 2ZRJA 5EE3A 3GPLA 1AS0A 3QBTA 4PTLA 4I1SA 1XMIA 1E9DA 2E1RA 4RKFA 1E2DA 4B6EA 4R7ZA 3B85A 2ATVA 4JLVA 2SHKA 5CDFE 3VR3A 3NBXX 4DLVA 4PHHA 3QKRA 3F3YA 5JJIA 1C1YA 1P2UA 2FGJA 1W36D 3L0PA 1W7AA 4WA7A 5KSYA 1B23P 1MH1A 1ANKA 4DDWA 2ZUBA 1NMYA 4ERNA 1W2HA 3ZS8A 4ZKDA 1H8HD 3IO3A 4HDCA 4JSYA 1G9XA 3T1TA 3JVUA 2AKAB 3KFXA 5AK0A 3MJRA 2QGNA 2XOKA 4KI0A 1O87A 1KMHB 4O2LA 2ZJAA 4TMZA 3OIVA 3ZVRA 4LJ6A 2QQ0A 1W36B 1SVLA 3L0IB 3R8FA 1UM8A 2FE4A 1DBSA 2ZRDA 3A37A 4QNMA 4XD7A 4IRUB 1DADA 3NVAA 2ORWA 1D9ZA 4L5BA 2PMDA 4LJ7A 2YWGA 1M6NA 1U98A 1G8YA 4JSTA 4N0EA 4P33A 2VP6A 1ZM9A 1K6MA 2F9MA 1BYIA 5EP3A 1OFTA 1ZW6A 3O8RA 1CR0A 2ZYTX 3CH5A 3QVVA 1W5TA 1IXRC 1IOZA 2G0TA 3EX7C 2ZANA 4AKGA 4G5OA 1GRNA 4JVSB 4H9GA 2IWRA 2XX3A 2X1VA 4GBMA 3F8TA 1NN5A 2FZLA 2CJWB 2J59A 3WHKA 1FFHA 3GFTA 2GTPA 2C04A 2IHBA 1NI3A 2QG6A 1PLLA 3SZRA 4D4MA 2VHJA 4DDTA 2WTUA 4PQRA 1CU1A 4R2IA 4Q47A 3GMTA 1N6LA 1R8SA 3FGNA 2OFXA 4B34A 4ZCIA 5FOUA 2IYUA 2D4HA 2E87A 3BXZA 1U0HC 2G77B 2ZJ5A 4DBLC 5C46F 4D0LB 3LVRE 4F38A 5KNCA 1E2PA 3A1UA 3DKPA 1YR6A 3LAWA 4IOKA 2D74A 4Q4LA 2IXFA 5H1YA 1OF1A 3BIFA 2AK2A 2EYQA 2ATXA 1IN5A 1IXZA 2GEVA 2DYKA 2WWFA 4Z51A 3AV0B 2EFEB 5H70A 3ZIAD 3MWYW 4TL9A 2PH1A 2QTHA 2WJGA 1COWA 2OE2A 4J0QA 1TF7A 4Z8XA 3VU9B 5TVKA 4A0RA 2ZRIA 1GZSA 4PC7A 4UNRA 3U44B 1MABB 3NHBA 1DARA 5GVRA 2UZ3A 2ZM5A 2F3RA 2CK3A 3PEUA 3GFOA 4LPKA 2I1VB 1NNEA 4B3CA 1TQ4A 1KJZA 1ZM7A 4EPYA 4ZO4A 1OFUX 3EPLA 2J3EA 4M8NE 1E79A 3UG6A 1G8FA 2ZYUX 3IPYA 4WXRA 3A1SA 4C30A 4BZXA 1FQJA 4KO8A 4Q4AB 2QE7D 4AYXA 4JLKA 1Z0IA 1FUUA 2GILA 3FMPB 3SBDA 3L2OB 1SQ5A 1Z0FA 4LHZA 2RKOA 4A2WA 1N2CE 4D4LA 3AVYA 1YU9A 3QIAA 1S1CA 3TMKA 4D82A 2F43B 2C96A 4B3DA 1IJFA 1KKLA 2WSSD 4JL6A 1US8A 1XTSA 2GCOA 3RANA 2B7CA 3A1VA 4ACAA 1E96A 1XD8A 2DFTA 2VSFA 5CM8B 4LBZA 4MDEA 1S9HA 2ZAMA 4DJTA 4PAQA 1GTVA 4XWOA 4D25A 1DPFA 2JLSA 5FTNA 2J7PD 3L82B 5EE5B 2B92A 1C4OA 2BBSA 1E1RD 3LO5A 4XH9B 1SVWA 4BFWA 4OKSA 4WOPA 2DHRA 4TSFD 4A6XA 1Y63A 2C78A 4V0NA 4TZ6A 1PJRA 4C2UA 1G5TA 1ZBDA 4QGGA 4KBGA 1VTKA 4LSGA 4FCVA 2GF0A 5JCPA 2ZE7A 1P73A 2JAQA 2ZSFA 2BIFA 4IVQA 4QHYA 4BLTA 3QKSB 1QG4A 5GJVC 4DC9A 4QBIA 2X19A 4LYJA 3BB1A 4G5SA 5HTKA 3RWMB 1DEKA 2J46A 3EC1A 4TN1A 3FB4A 4TLBA 1ZU5A 3A4NA 1TQDA 4OK5A 4ARZA 4HAZA 2HF9A 2IYLD 2IUTA 1P9RA
chains in the Genus database with same CATH superfamily
1KIFA 3OQBA 2XA1A 3FWYA 2ZJ1A 3BCUA 3VPXA 2HTEA 5KNLA 5NLLA 4YQEA 4LECA 4R4JA 2YV3A 3NYRA 2A1UA 2J7PA 2R68A 3K6JA 1YXMA 1DX9A 5DBFA 2WSYB 1PSDA 2A67A 3G1TA 3ZS9A 2PUGA 1GFSA 5JJLA 2REQA 1ZHHA 3TNFA 4IINA 4XGRA 3VHRA 3ZHRA 1Z36A 2XBUA 4MV6A 3OKAA 2BLLA 2Y05A 2ZPTX 1N7JA 4J43A 2BZ0A 1ZN8A 2OCIA 4QFMA 5AW0A 1E6UA 2FFAA 4FX2A 2J30A 3SLGA 1QH8B 1S9DA 3IYLW 4M38A 3SDZA 2I99A 1BCSA 5B4VA 3UAOA 1QP8A 1SKBA 3BGOS 1UP7A 5FPTA 2OO7A 1D9XA 1S2OA 2G0NA 2IJGX 2QN9A 2ZFUA 3I4CA 3KAPA 3IE1A 2XIQA 1E2GA 2Y1FA 1U3WA 4KQIA 1MU0A 3GLHE 4YRLA 5CVEA 1IDN1 2GD1O 4KDRA 4CV3A 5CYFA 5A6VA 4LI0A 1BE8A 4QHSA 4DLPA 3QLUA 1YB6A 5LUBA 1Z2DA 3ZI0A 2LGJA 2FPMA 3PRJA 3FDXA 2QPTA 2ORYA 3T7IA 5GJWC 1WZCA 1I01A 2ZQ5A 3UCEA 5C5DA 4WINA 4YRPA 5AESA 2O2XA 3Q7IA 3CEAA 5EE0A 1PT9A 4EMBA 1DCKA 1H2BA 3DXFA 5AVTA 1N7IA 1WKVA 4XD2A 3FCXA 3IPLA 2RAFA 4FNOA 5HJ2A 5EFOA 5CFQA 5A9RA 1CZUA 4WEQA 1YVDA 3LT2A 2VJQA 3IHKA 1MA3A 3ROXA 5EJEA 3WL7A 4YC7A 5CVUA 5BNWA 5I7EA 3U4AA 2WNIA 1MT3A 1VBKA 3PD1A 4NOJA 4I55B 4BOYA 1NY5A 4TTJA 3W3AD 1VE5A 4JI0B 3BJMA 5E6SB 3OHMA 4EG5A 4YRRA 2A7XA 3QYPA 3LBFA 4EY7A 4O4LA 1VMKA 4WBNB 3AB3A 5IBCA 1TW3A 1B14A 2DE0X 2V7WA 4QYSA 1VJCA 3EPPA 3N0XA 1A8SA 1J2JA 3KKNA 5JS7A 1E1DA 1U1GA 4HN2A 1CUGA 1N2JA 3C3EA 1ADYA 1LW6E 5GZ3A 4A15A 4FFDA 1L1RA 2IEYA 2AN9A 2I6TA 5KDLA 5TXGA 4S1WA 1Y6RA 4QUIA 5A4MS 4GP9A 1DQNA 1Q5PA 1VKRA 3DS8A 4JH0A 4REOA 5K4HA 1YZTA 2C2HA 3QWHA 4NS1A 2ID7A 4Z0TA 1HK7A 1N6HA 3M82A 3S4YA 1MTZA 3AR5A 4UQPA 3MB5A 1JFLA 2C9OA 1BWQA 3GQBA 4Q48A 4RJJA 5K8JB 4RD4A 4LOAA 1R1DA 2VJKA 3FSJX 4DQ0A 2PGDA 1X7YA 4L7QA 3H11B 1NXTA 2AE1A 4YDQA 2CNLA 2YASA 3OQIA 1RLOA 5CCDA 5HGXA 3L7LA 4BX9A 2EJVA 2RH9B 4JVOA 4FS8A 1KAQA 5ELXA 3L7AA 2MYPA 3CT6A 4QUKA 5CU7A 1LV8A 3DV0B 5CAEB 5K45A 4HZIA 4HUTA 1K97A 4L4YA 4IYRA 1J2RA 1JKJB 1NVWQ 1HE5A 1NIPA 3TTUA 1U9JA 2JIOA 4DQVA 1CE8B 3TTSA 4QUAA 4CU5A 1T6BY 4G6ZA 1T35A 2O8FB 1JXAA 2WV7A 3KUCA 1IAQA 4O0LA 4P54A 5E7IA 1ST3A 3HKDB 1ISSA 4K6KA 4R69A 5B6IA 3HM2A 5AVYA 4YGYA 4IXNA 5JTTA 2Q9AA 4HDNA 2XKJE 5KVQA 1JW9B 2AVDA 3L7OA 3R7NA 3RW9A 4OI0A 3PQ6A 3AY7A 2H1LA 2XTJA 4F0JA 1U7PA 1JGTA 1RW4A 3ZVKA 1UBJS 1GLNA 4Y2SA 1IHOA 1WLYA 2HXYA 2GM5A 3BMCA 1YI0A 2QSJA 1QV7A 1HT0A 1BKYA 2V45A 3EIHA 3PVCA 4JUDX 4R1MA 5LKAA 2AD5A 2C4HA 3BRWD 1UQTA 2FMIA 3B6MA 4RH0A 5LKRA 2AFIB 2B21A 1ZK0A 2HJHA 2VATA 5LYJF 3HC7A 521PA 3FIUA 3UAWA 4D1YA 4FMDB 1QB8A 3HWRA 1Q1EA 3RRXA 4W5RA 2C9BA 3OJOA 1IY8A 1HOTA 4R1OA 4ZVLA 1Y3BE 1R4MA 4NAVA 3H2SA 5F1PA 2XCOA 2I7XA 1C3JA 2ORIA 3WAGA 4AWAA 4NHEA 1J20A 3UBMA 1F8YA 1NJ2A 4UUMA 4YVFA 4Z53A 3E2IA 2X0JA 3SF8B 1GRVA 4EJSB 3CVUA 2EKLA 3E9NA 2G09A 3I34X 4UDXX 1XPUA 3EIXA 1U7DA 3RT1A 2AOUB 1JSRA 2N1MA 1QE3A 4BO3A 1Q0QA 1ZMXA 3E3MA 3P2JA 4ER3A 3SJAA 1BGVA 4FSXA 4XJSA 1QYVA 4XX0A 3TJMA 3LA8A 3GDGA 2IYVA 4I50A 1PTJC 3WP1B 3RAGA 3I5AA 4N54A 1RRFA 5LU8A 1FSGA 3I04M 6ADHA 3QY0A 4G97A 2OLJA 3M6AA 3FKQA 4AMVA 8MHTA 5AK3A 3ONEA 1CZHA 4QPNA 4EY6A 1K3UB 1I1NA 3DNFA 3EUFA 1E2KA 1OH6A 4BRSA 3PJRA 4KH1A 1JYSA 1KQPA 4KC0A 1SGWA 3GMSA 4A03A 1FFSA 2NV2B 5JO0A 1QK5A 1SBQA 1J8FA 1QZZA 3GJ0A 4A6EA 1SWWA 2O3SA 1ZI9A 3WISA 1RNLA 3H2HA 1UBGA 2YY5A 3NAGA 5FULA 4X94A 5ES4B 5ICMA 5KTSA 4LZWA 3QUTA 1AMOA 1ZJYA 3MT9A 4DG8A 2NUBA 5F35A 4YJGA 3Q8MA 1Y7TA 3KQMA 5AM4A 1OXSC 1NVEA 5KYUB 3TJZA 3H0CA 3JARA 4C0QC 3GJQA 5CA0B 3BRCA 3D7LA 3TQOA 1BWRA 4CGYA 3P4UA 2B4TO 3B2NA 2GAFA 4O4HB 3ROEA 3EDQA 4MRPA 2XZPA 4A3SA 1OGIA 4PXYA 2QR2A 3HCCA 1RRPA 1M74A 4B35A 1DJNA 1GL3A 2GN2A 1T24A 2G9RA 2R1UA 3FZNA 3QUQA 4E5YA 1ULZA 5JISA 3S29A 1DJQA 1KL7A 1W75A 2GHTA 2WTXA 5HOEA 4A10A 4RACA 3WGOA 3ZWAA 2AWNA 1ZXLA 2YH2A 2IZ1A 2O2IA 5TEVA 1AQJA 3BD7A 3W9YA 3TJRA 1QP7A 3VPGA 1QV9A 1F17A 1RZRA 3IQXA 1DIRA 1EG7A 1B0AA 3SZLA 3EFOA 3HA3A 4JOQA 1VZ2A 1YJXA 2ACVA 1ZISA 4OKIA 4Y3UA 3WGLA 4B74A 4DIKA 4E21A 2BM1A 1F2VA 1YHYA 4FGWA 2WMYA 3GV0A 4Z2YA 2O2SA 3FF1A 1KRHA 1NOIA 2FZVA 1YT5A 3LYLA 4OHOA 4Q9AA 5DYTA 1MGOA 1SIWA 4POAA 3D6VA 1P6XA 2D1SA 3DTVA 3ZKWB 1QM5A 3F7MA 1GARA 5T64A 4N4AA 2QN6A 1N92A 1YE3A 1SK9A 3PDCA 5B7PA 1P18A 1J8YF 1DXYA 1UMKA 3B1VA 1HORA 1QHEA 3HJFA 2VYVA 2Q41A 5K2MA 4BO9A 4AJ1A 2GN4A 1JIKA 1CJVC 3QUBA 1WABA 2H1RA 2GT1A 3FLEA 4XR4A 2CLSA 2XODA 1QPZA 3LQQA 1EWVA 3X1MA 1Z5GA 2WIFA 3NH9A 5CB4F 4XWWA 2PKYX 3VX3A 2AZXA 5K6TA 5DBHX 4NX2A 3D3JA 3D8UA 4LIPD 3LL4A 3NYWA 1EIZA 4S1VA 3K32A 3O92A 4XI9A 5HIMA 2VK1A 4QTTB 1PZHA 1UBCA 2HQSA 2JNWA 4WOCA 4BEBA 4NL4H 2BBTA 5L40A 4DLAA 1KE1A 1PW7A 3L04A 3N8NA 3AF3A 4YR7A 4RPCA 4ZO9A 1C3LA 4HNHA 1RYYA 3DDCA 2DBZA 4E1BA 1XLUA 3KKOA 4MUKA 5IF3A 1O0SA 2PXHA 1I7DA 4MJ3A 4FOOA 5KQMA 2H4XA 3FH0A 3RUCA 1N77A 2R6AA 1ZD8A 2HFKA 2V65A 1LPBB 5AK5A 5AWFC 1N3LA 1UZUA 3CE9A 1BH2A 1P1BA 2P0AA 2ZGVA 1LJLA 3KYCA 1UWCA 4GI2A 4HHEA 1EE9A 4PSUA 3M81A 2JHAA 3M9XA 1E4OA 1KEEB 2OLEA 1T36B 1XJ0A 2AG5A 3QPUA 4RMIA 4ZOAA 4OQZA 3LW7A 1JEQA 4HRXA 4KXLA 1PEYA 4GHWA 4KN8A 1P5FA 3T8YA 4CQMA 2YHIB 2QM8A 2EP5A 2ADOA 3DZKA 4OHFA 3ZDEA 1MB4A 2CNKA 1EFCA 3L8CA 1V47A 3U4DA 1CQIB 2QT9A 2G1JA 2XAAA 2I2DA 2X9LA 4P3NA 5AI4A 5COQA 1ZD3A 3Q2IA 4G1UC 5IVDA 3Q7RA 3QF4B 1OPRA 2G5CA 4UNSA 4EFKA 4BFLA 1KDVA 4YYZA 3D8BA 1SHKA 1THMA 3EBOA 4DOMA 3ZWOA 4UM7A 3ZDAA 2A14A 1TAQA 4Q05A 2QZJA 4WOJA 4FQ8A 4HAOA 1E9AA 4BNMA 4OSOA 3OOYA 1N6OA 2QSZA 2WD7B 1JP7A 2N1BA 3PFIA 3TEMA 1WZIA 1ZGBA 3FLBA 4GMGA 1SU7A 3IBFA 3PPIA 4MW6A 5EHIA 4D0GA 3IOCA 3K0EA 4WGFA 3EQ7A 3QFSA 1CFJA 2BFBA 4MP6A 5BUSA 3H5RA 4LF5B 1KRWA 1EAYA 4MP3A 3QTBA 4IDCA 1NJ8A 5FFFA 1L4EA 1WL8A 3J80A 2ZBGA 4RHEA 1CY1A 3T94A 3IMGA 3UA4A 2VTKA 4JELA 4X6YA 3TGLA 2Q1UA 5SZHB 1E0AA 3AL0C 1PLKA 4EGAA 1J0DA 2H5JA 4ZFNA 3GAMA 2ZRPA 5AXCA 1ZX1A 3NAQA 1JAXA 3P9CA 5AW3A 3VGPA 1PEKE 3N3BC 4ZTUB 2WUFA 1WPXA 1RHJA 2YXNA 4Q7LA 4BP3A 4RS4A 5BQ5A 1G98A 1TQ6A 5BWBA 1H69A 4O2RA 2B69A 2Z8XA 4R2JA 1QVRA 2CL7X 1LPMA 1PV2A 4HK4A 4CDNA 5MN6A 3LBYA 1BYUA 5CLLA 1RYDA 3SX4A 4U0JA 4ABYA 3AW8A 3R75A 2XTMA 1MA0A 4CKCA 4DMFA 2OAEA 4PLZA 1CS0A 4LRUA 1GCAA 3M34A 4U63A 2PUDA 3HA5A 4NEGA 3DFKA 3HZOA 2OEPA 3OVMA 4LDZA 1IZ8A 3OQ6A 3W2IA 3ZWNA 2XUKA 1FDRA 1NF9A 3KPWA 4GI7A 4XGQA 5HOQA 3SU8A 2J48A 4MUBA 2XQFA 1RADA 3BHIA 1AGXA 1N2SA 3QVWA 4L9SA 1R9JA 1YRHA 2ZTUA 3NPAA 1XROA 1V4NA 4ZVUA 2QBYB 4QOHA 4ADSG 4EF6A 3SNKA 3Q9NA 1JHRA 3L8HA 5TMDA 3U4CA 1KFJB 2WABA 3WGQA 4YK7A 5ARCA 4TQUS 2Z8ZA 3VR3D 4P7JA 2IDMA 1YBAA 4B85A 2WIAA 3UHAA 1C30B 1KPHA 1I4OA 2I2CA 2W2LA 5ALDA 3GJXC 3WSWA 4GL4A 3IMEA 5LLTA 4Y0NA 1QFSA 2ZEJA 1MB2A 2GZ2A 4WKGA 1K2WA 1DG3A 3NWJA 2GBCA 4F3YA 3BZBA 3HBNA 3ADOA 2NSHA 5BRAA 1RM0A 2FPLA 3MF4A 1FLVA 4IDPA 3WGTA 4F4IA 4D44A 4IOJA 3ZWMA 3KDAA 1DAFA 3PDHA 5BT8A 5LQNA 4HF7A 3GEEA 2MYUA 3H86A 5K3BA 4PSDA 2VYNA 4FS3A 1Y4AE 1R0CA 4IIFA 2CJYA 3EXG2 3REOA 3UK1A 3ZX4A 4CR8A 3ICPA 5HS4A 1Z75A 3AFOA 2F3PA 1V7ZA 4E22A 3L0BA 5AVUA 1CQJB 4RKQA 4WFIA 1QTNA 1UANA 2VJOA 3IH5A 2YQ4A 3DFIA 3O3OB 4CIVA 1KJWA 4EYSA 2O8CA 3GRAA 4RWEA 4YREA 2NO1A 1Q1BA 4ND2A 1XRJA 8AT1A 3FWZA 3KELA 4C6TA 3QPCA 3OF3A 1MEOA 3JQAA 3T9EA 1DWUA 1RJWA 1IIRA 2WDZA 2QEQA 3G2OA 3BFJA 3RC8A 4CZ2A 1CZKA 1JQAA 2D2EA 3USES 3FYTA 5IAGA 3TCKA 3LT1A 5DH9A 5EQJB 1VJ5A 4WXYB 3KYDB 1LH0A 4F4HA 1UBSB 1VRWA 2UAGA 4IJVA 4KFCA 4BJ5A 1SKYB 3OD5A 1X3SA 5KYYA 1H6AA 3ZGVA 3U4MA 3RVPA 1N1DA 1RS0A 2CLDX 2I6SA 3TIGA 3D5QA 1FNCA 1D2EA 4YRFA 4BN5A 5AIAA 2ZBPA 3Q6MA 4KYUA 4EG0A 3PKJA 4YCDA 4E32A 4I3HA 4TYYA 1CEYA 3HCWA 4R54A 3H5AA 2J5XA 4YH1A 3E9ZA 4EL0A 4B33A 1XA3A 1N9GA 3A9RA 1LI5A 3E8XA 3CISA 3EGEA 3KTDA 3PCRB 5B3LA 4OM7A 1JG1A 3DUWA 4KL8S 1VRVA 2BEWA 1KOLA 1K5HA 3AEXA 3NQ41 1R6AA 1NBOA 2YC4C 3B3GA 2HX1A 3OQPA 4JD5A 3AEKA 3FPCA 1L4KA 1QSGA 4I0WB 2PRJA 4LJ5A 3ZY6A 1DRVA 1OFIA 1O97D 2NO4A 3CLTD 3PITA 1REQA 1WX1A 3LVFO 5LWQA 3UKDA 3QVKA 1O08A 1T15A 4W5HA 3N39C 4BGVA 2JLVA 2QRJA 2X8JA 1FNSA 1GT6A 4M0MA 4F4DA 2CSUA 3DLHA 1WV1A 2QVXX 5AIBA 2RB4A 4P32A 1BFDA 2N9UA 3HLKA 3V7NA 5JXHA 1P0QA 1T0BA 2Q2WA 3H42B 3N8DA 4BX3A 4BJ6A 2JH3A 4R51A 1KI6A 2YXLA 2AJCA 2CVOA 3EF0A 3EZ6A 4BAGA 5LP6A 1E79D 1ISJA 2X4IA 3AH8A 2GJ8A 2ZPAA 3N6VA 3EC7A 1XYVA 3J7AC 3TS1A 3RF6A 3IR6A 4CTOA 4EO7A 4H7EA 3VC1A 3VPAA 5J2TA 4A16A 3TSCA 1ZIXA 1ZH6A 5T5QA 3LCCA 1GL7A 1JIIA 4IILA 1T1JA 1KI1A 2VWPA 4MQFA 2HHHB 2J85A 2WZQA 2VWGA 4GI3A 4LXQA 4BMCA 1YB7A 1O89A 4A0HA 2LKCA 3EGOA 4J16C 4DC1A 1QCDA 2DMRA 2BI7A 3JTEA 1L7RA 4G4GA 1ZL0A 4A0FA 3LKDA 3TE6A 4UD2A 5TPZD 6Q21A 1LU9A 3WL8A 4OTZA 3ZDQA 4H4EA 4BBJA 1KGSA 1NUHA 2OBBA 1X1SA 3TUZC 4DY6A 1N9ZA 2M6KA 1Y48E 4UTVA 1JFFB 1AHPA 5HUQA 3OWXA 1ZD4A 2VNHA 1UUFA 3Q7EA 2PT9A 2VAVA 2YWFA 4NWIA 4RK6A 3DQQA 4MCIA 4WZAA 5DLDA 3DLPX 4DNQA 4A2CA 2OCAA 5JYEA 5KUTA 1CY7A 3PKZA 2IHJA 3ND9A 3TQHA 1QNFA 2ZJBA 4KO2S 1ICEA 1O97C 4ETNA 1USUA 4EW3A 5D3MB 1QHIA 2VDVE 3OEEA 4JROA 2A58A 3ZBUA 3LLUA 1H2YA 1CYDA 1FPMA 1A5BB 3FVWA 1M7HA 1X9GA 2DLNA 1V6CA 1JT2A 2VPXA 2Y6VA 3CF4G 3FKSA 1ECFA 2ETXA 4H7IA 4LHSA 2GVDC 2KHZA 3ZNPA 1Q0HA 4R2XA 4Q0MA 1FVXA 1Y6GA 4QDOA 3Q6NA 2UDPA 1FK8A 4Y9TA 2XGGA 4FFVA 1KXZA 3I2KA 4U9HS 2G4VA 1KFKB 1G0NA 1V9LA 1XU7A 3DWEX 4TTAA 2Q46A 4AMGA 5SV2A 4EW1A 3GAFA 4W63A 3NHMA 2PU5A 4UBNA 4U9IS 1W581 4G2TA 4LRSB 3ROFA 2NPIA 4GZ6A 3RHTA 4E09A 3EODA 2H00A 3FDZA 4MKHA 1J1UA 3ICCA 3HKBB 3OZTA 1J1IA 1W4LA 2B1QA 1A7UA 2WF7A 3I1IA 2XMSA 4J1QA 5DX8A 1FLAA 1JI0A 3OUZA 3T3EA 1EHYA 2VPWA 4S2UA 3O4JA 3WV4A 1DS6A 2R6DA 3X2SA 3BZUA 5AI0A 2P79A 4M8SA 4G4SP 2DT5A 4OIFA 2O5EA 3I28A 4N0DA 4UASA 1LI7A 4Q1DA 5DKFA 3CVVA 3FYHA 1E1QA 1Q15A 4ARZB 5F33A 3LOQA 1IH8A 2ZYDA 3IAUA 2NT4A 2UZIR 3KDPA 1QLHA 4NYIQ 4C7XA 2D2IA 3S81A 3ETEA 3WK7A 3ZD9A 1WOMA 1TM1E 5T6BA 3EEFA 4Q3LA 3EVCA 4IFIA 2A9KA 4JV5B 3REGA 5CK4A 1F0YA 4BHTA 2LXNA 5TJ9A 1K08A 1EVZA 1SXJB 1VCNA 3AJRA 3I3SR 3SQMA 3V48A 1P45A 4FD2A 2IU6A 1GVNB 3DM9B 4JU9A 3GNQA 3K1YA 1WZEA 3H8SA 2Z5VA 4RY9A 1HDZA 1KYQA 4ZZ2A 2QW0X 2D6FA 3GLGA 2Z1MA 2IV3A 1O5IA 5F76A 1L5GB 4KVZA 4JIMA 5EKTA 1I80A 5TF0A 4ZQBA 4BUJA 3FPKA 2DR0A 5FX2A 1D2NA 1GHTA 2HPAA 3SJCA 5BWOA 4DR4B 1I3NA 3ZJ5A 5IWAB 1YK1A 5BN3A 2JLQA 3FFBA 1G9SA 2YWRA 3NWBA 3CRZA 1ULTA 1YQDA 1XOIA 4TRNA 3IEUA 4DCTA 3PFCA 4B17A 5FAKA 3U3RA 3UXYA 3UHJA 5AVRA 1G5PA 3PHLA 1J5XA 1R00A 3F5FA 3NEJA 5C1BA 2DETA 1SD2A 4IKOA 4MWDA 3AR4A 5JJBA 3ENZA 2V7BA 1TI7A 5F7ZA 3TK1A 5KYXB 1RM4A 2JGDB 4O2AB 2DQKA 4RULA 4QL3A 4E4TA 1Z8DA 5F7OA 1BHO1 2XUIA 4YI3A 2SKCA 2KWIA 4JWTA 4IHKA 4XZ3A 1HX7A 2R6CA 4LOKA 1ZRMA 3B7WA 4MYDA 3X1DA 2OAGA 2GYYA 1IONA 4FUQA 4BO6A 3SHTA 4TVKA 3IVXA 1QGAA 1V26A 2WDPA 3ADCA 1YIOA 3P8ZA 5JWOA 4MS3B 4ZODA 1UDRA 4MR8A 2AOTB 5FLYA 5B1HA 3OZEA 1RCFA 3KB6A 4F5DA 4K9DA 2XCSB 4DNOA 1DAIA 1X7XA 1MPXA 1AQUA 2PRSA 4EHAA 5I4BA 3RVBA 4U6NA 5H9VA 4IO1A 4QXRA 4CKYA 4A36A 2W6JA 4PX5A 2ODBA 1ZPDA 1Z6AA 3KHKA 5KX5F 5JRDS 1V71A 1CJTC 3ZYCA 5FBRB 3HXOA 1Y1RA 1EGMB 1HYEA 1FA9A 1JN0A 1AKMA 1UAYA 1PGPA 1V37A 1S8OA 3L07A 4WLEA 5AHKA 3P5BA 5BSUA 3S70A 2HDOA 4QYWA 3SMQA 3K5PA 1OXXK 3VHLB 3EVAA 3RIYA 3ANSA 3F4KA 5EMLA 4C4XA 1E62A 1FCJA 1OZAA 4CCSA 1YJ5A 1T2AA 2BMVA 4G0NA 4YXWA 1M3SA 1QUEA 1YBHA 3A05A 4PLFA 5JBIA 5IYZB 3UKOA 1G20B 1QLWA 1U0TA 3VBCA 3CE6A 2BN4A 1V5FA 2RHWA 2X8WA 2M6LA 3ESDA 3K8YA 3STHA 1II9A 3BRQA 4JUBA 4DLNA 5B58C 2P2YA 2BGJA 4KACA 1D7OA 1CERA 1ULSA 3LX8A 3QMVA 4WD3A 4DYDA 4MYSA 1TGYA 4ML3A 3DTNA 4RVUA 1C7QA 1OX4B 2WJIA 3W5CA 1A2BA 3VKGA 2A33A 3FNFA 4QO7A 1ONPA 3H87A 4Q3DA 3U39A 5FEUA 3OZAA 4HX2A 1VXRA 2ATEA 4ROTA 3W05A 5ER6A 3DOFA 4ETMA 2FP3A 2IW3A 4HQ0A 4BO8A 5C37A 1PT7A 1JLLA 4KIFA 3GIWA 5KQLA 2ZJFA 4R98A 5BO5A 1JEDA 1K4MA 2VF8A 1GQQA 2QWXA 3NBKA 2C3YA 2FX2A 3HXTA 5HKAA 1UXOA 2YW2A 4BLOA 1JH8A 1WUTA 2GBPA 3AIMA 4I8DA 3Q8XB 1YHNA 2BKUA 1G19A 2KLBA 3L46A 5EJ6A 1Q44A 3RC9A 4K9RA 4HGZA 4BNHA 1GZ3A 3W5HA 3O93A 5COBA 1XVAA 5BN4B 1V1RB 1JNYA 1MRZA 4KR7A 2JAWA 1R8XA 2QN1A 1KF0A 3CRRA 2OMKA 3KLMX 5KYVA 2EJBA 5CNKA 1KQFA 4H16A 4H1WA 2VF2A 5IDVA 3HP7A 4KVGA 1DBWA 3DW1X 5AM5A 1QXSA 1KZ9A 1T9GR 1AZLA 1T8UA 2O7RA 4K3UA 5T8KC 3TRFA 4CIWA 3PJFA 3PWKA 5U4XA 1T1GA 4PTZA 1ODIA 1UF9A 3U1VA 1RQXA 3OC0A 2MSLA 4FJ1A 1HNNA 1CQPA 1ELOA 1QQ7A 1VMIA 2QQGA 1C3EA 3I6MA 2QAGB 3PSHA 5JSZA 1XTQA 3N9IA 3WWYA 3R9WA 3NBYC 1G8HA 3GBPA 1T91A 4WY5A 5KWJA 1O96B 1G7TA 3MFYA 1TUEA 4LYYA 4JI2B 3TZBA 4HV4A 2Y1KA 4Y2TA 3RUIA 5AXDA 4U02A 1D6MA 1MP0A 4ZRNA 3WJ2A 5I7FA 2O52A 1P33A 2ZSEA 3D3WB 4EA8A 2RGYA 2Q4EA 3K53A 3PEYA 1FDOA 1G8MA 1L8OA 4AN4A 1B42A 1AGRA 2OCBA 2VDLB 3BVPA 3JCZA 3KJQA 5KOHB 3E7PA 2N0SA 4C06A 5A5EA 4ZC1A 5C4GB 4EUSA 1Q19A 4EGFA 2HBYA 3EB9A 1OREA 4JP8A 4O4IF 4F5EA 5CCEA 3RVKA 2IEBA 5EJ9A 1NL3A 2EFYA 4IGEA 3WFZA 1FNDA 5FBVB 4IGIA 4PGGA 6NULA 3IP6A 4FB5A 2E0IA 2PIDA 4JBNA 3SLRA 6REQB 10MHA 4H1VA 2OGSA 1PG0A 2JI7A 1KMNA 4YBZA 3DZFA 4Q3CA 4G9BA 1JWBB 4H7PA 4PSVA 2BHSA 3I0MA 3M8KA 4DMGA 1XMSA 2OP1A 3AETA 4LOJA 2OGZA 3D3QA 4C87A 2JGIA 3PT9A 4C01A 4RHUA 2BHNA 4JBGA 3NT5A 4PG4A 5CG2A 1J24A 3HXMA 3TSWA 3TZQA 1AB6A 5FI0B 5EZQA 1K6XA 3SDSA 2CZCA 1L7XA 4M9XA 2C9DA 3WLQA 4XPZA 4DCNA 3D1JA 3HY3A 4FXOA 4IEEA 2H1VA 1I6MA 3KP1A 4RZXA 1QYWA 3VNVA 1M2JA 4CFYA 1XMVA 3VSCA 4RENA 4HPWA 4C2TA 3ANNA 3I9V6 3PGKA 4MEAA 4UTNA 1TJYA 1M2WA 2YHBA 3EVDA 4G0UA 3R5KA 4J1NA 5G3YA 4HKTA 4KUHA 3FWKA 4Z86A 1HURA 1Q50A 1Z2OX 5FTKA 4EPTA 1GQOA 5IAAA 4LN1A 2C2YA 1RZRD 4K6GA 1YASA 2QNBA 4HNRA 4S0ZA 2O9JA 5FA8A 5LQMA 2BEUB 4F2GA 3SQDA 3O73A 3CNBA 3QPDA 1E0SA 1TCAA 3QK7A 5CPFA 4EJFA 3M7IA 1Z18A 2GJAA 1WIWA 2C0CA 3OM1A 4MO9A 4OPMA 3S40A 3UAVA 1QC5B 3R7AA 5LQRA 3G2HA 4YQZA 6CHYA 4F3KA 1HMPA 2GB4A 3EAFA 3GVHA 4L4ZA 1O0BA 5DTIA 2V6GA 4RVNA 5EGSA 3A4YA 2KS6A 4WQMA 3TXYA 4QELA 1OI2A 4NDZA 1XZNA 4NP6A 3T7KA 4MH0R 3TOSA 2A5DA 4BKMA 2FUCA 4RH3A 4HYEA 1D3AA 2B1JA 4TTQA 3SFZA 5IPFA 2G76A 5FLEX 1K92A 4UUQA 1X2EA 2OM2A 3UICA 5B57C 3BT7A 3P9KA 4I2VA 3RM3A 3RVJA 3K6SB 3FPFA 2FPUA 1XZGA 4C7BA 3DZGA 3CEPB 4M86A 1R4NA 1KS2A 4P4SB 4D42A 2V7XA 1ZK4A 2WF8A 3K16A 1VHTA 5DP1A 2PVSA 1SA0B 1JNXX 2FMHA 4FVTA 3ONDA 2FX3A 3GXBA 5G02A 2BCJQ 3HYSA 4Q02A 5ITWA 4I4LA 2N46A 5JVDB 4M8IA 5DV9A 1II8A 3F97A 4A1FA 4Y2JA 2FXIA 3DTYA 3PR2B 1MIOA 3DM5A 1FBNA 3HNPA 4BLUA 3I8SA 4F06A 1H4QA 1E2EA 2F1JA 3VV2A 4V24A 1R0SA 3LDAA 4MB6A 4M60A 5ALYA 1OBCA 3BTOA 2AXPA 1JHZA 1N5MA 3OHPA 3W6UA 4NQRA 4H7DA 4EL5A 2V3WA 4CKEB 3RVOA 1MAWA 1WSWA 5FWXA 4QBFA 2P5UA 3KB2A 3VDXA 2Y67A 2JI8A 4LZOA 4F93B 1VHWA 5H0IA 5BXYA 4E51A 1B4DA 1ECPA 3C48A 5I9NA 1M8GA 5K20A 1YJBA 2ZS8A 4OQYA 5DJ5A 1KORA 4YAOA 5ARDA 1EXNA 1XHEA 1R2QA 1H5UA 3A1FA 1Y1TA 2V5UA 5C1DA 1ZHOA 1JHOA 4CMEA 1Z7BA 2YOHA 3A70A 5EJAA 2UUBB 3UFXA 1SJ9A 2DSNA 1XMOB 4KJZA 3GRUA 4EIWA 1GAXA 2VXBA 2O19A 2I6XA 1VG9B 3KTOA 1NTOA 2V7VA 2GZSA 3QENA 1EJBA 4NPCA 2BGMA 1Z73A 3JQBC 3K09A 3F6EX 1G42A 5BMVB 2JGJA 3K7EA 4ZU6X 3LQRA 2EIHA 1WV0A 2OSBA 4LV8B 4O0MA 4V02A 5AJUA 4F2PA 5KSZA 1EDOA 4TYQA 1J5PA 2CXHA 3BFVA 3ZHYA 3F5DA 4ID3A 4IDFA 2WD9A 2PLWA 5CB8A 1PS0A 4GGMX 2P9BA 1N6PA 2NZWA 1D1PA 2VTEA 3PEVA 4ZHQB 1Y5NA 2A0UA 2FPRA 3PTZA 4QJ4A 3TLXA 1V1MA 2DPMA 2V74B 4PGMA 5TQ2A 1Z33A 3W5IA 1L5WA 2DUUA 4FU0A 1PJZA 1USIA 1WZ2A 1FDVA 3HVKA 1A82A 2GAIA 2ZQZA 2RAPA 4I7EA 3T41A 4UM5A 1GNTA 1RXEA 721PA 3R5SA 3EWAA 1GZVA 2XVAA 1MZVA 4M6WB 2HDHA 4Q3NA 4BO1A 2IBMA 3KOZA 1NKTA 1ZZEA 3B9QA 5CT6A 4H60A 2PRYA 2VN8A 3DTTA 4J75A 5LDGA 2QUHA 5ICGA 2JEOA 2FR8C 2L18A 1E6MA 1NVAA 1PJCA 1ZIPA 3K2QA 4ANFA 2C84A 1FFBA 5KNDA 1OLXA 4O4LF 3AUKA 1YZFA 1ZN9A 3Q85A 1GNVA 4MKFA 1YNSA 4MRVA 3C3BA 4BAUA 4MW1A 1IZ9A 2ZSUA 1QGZA 3IERA 5HEKA 4YUWA 1E6CA 4LX0A 4OHYA 1OBVA 2WUVA 3EMDA 2A1TR 4YLGA 3RUEA 3IODA 4KQHA 1QYRA 3TXAA 2QL6A 2YICA 4DJAA 3J81A 3K2EA 2OQVA 3LBAA 2OV4A 4TMKA 4Z4HA 4ZN6A 1H2RS 1C4XA 2LDXA 2QM7A 1T34A 3RWOA 3TIVA 3MCAA 2C4MA 3H2GA 3PU6A 4Q4DA 5AJTA 4P93A 1QHGA 5IJ9A 4N0PA 2XNDA 3DEYX 1GEEA 1N32B 5JR3A 3ZDBA 2Z09A 3RYIA 4JXXA 1GGEA 2EP8A 1SH7A 3I37X 5FFMA 1GP2A 1Q3KA 3PXAA 1M1NA 1TJNA 2WWVD 3TXXA 1R64A 4HWSA 5JS6A 3N0TA 2VHYA 1ONSA 1ZYUA 5FBHA 2VBFA 3VFDA 3OFSA 3OSUA 4DSTA 5ED4A 1WQ3A 2AYXA 3JQ8A 4B4WA 5AFSA 1ZUWA 3R0XA 1FDIA 3DR5A 4MOWA 2HCBA 5ALTA 3U44A 1EB9A 3RCBA 2H2GA 1V1JA 4ZV7A 4BKQA 1ZUNB 2W2LD 4TMXA 2J6BA 3LX5A 4HWKA 4KPYA 1LPPA 1QJCA 2BBOA 1DEXA 3QSGA 3IRVA 5AH0A 3ILXA 2J07A 2D8AA 5IBPA 2WYUA 1OZFA 1KMQA 3CUKA 1OT3A 4AMBA 5INTA 4WPGA 1IBSA 1TYZA 3JQGA 3DLBA 2WILA 4EQZA 2XRMA 4JP3A 4Z7JA 1XSEA 1Z0KA 2D00A 4AJ4A 4U7FA 1TD9A 2E5FA 3C7TA 3HL0A 3MWJA 2M32A 1RJDA 3O8OA 4U7GA 2O59A 5DCWA 1H4TA 4UJ3A 2VYND 2Q8PA 1EFUA 4YNBA 3QEBZ 1GG5A 1T13A 3OX2A 2CL6X 4LV6A 4TV9A 4EKGA 4CKWA 3K71B 5TVGA 4AQ7A 1ZGHA 4QYIA 3JYNA 4MQLA 1ODJA 5B3JA 3FYUA 1IU9A 4F5WA 2G63A 3GROA 1I5RA 1DUSA 2RG1A 4YLEA 4AY3A 1BCRB 2CFIA 1ZN7A 2WM9B 3ZZ1A 4BE9A 1EQUA 3D4BA 4OYHA 2AFIE 1L1FA 4YRCA 2QQ5A 4KE6A 1PZXA 4MVXA 4RHTA 1MB3A 4I4CA 1QAQA 4Y9RA 3ESXA 3NKVA 3WYEA 4YPFA 2SCUB 5ALIA 1W44A 4OHMA 3KT6A 4WGGA 2QJTA 4I1UA 4Y7CA 4HPXB 4IXTA 4MWTA 4ZAGA 1IMOA 1XRNA 3LHIA 3PNPA 3AOGA 3RRYA 4HX9A 4I50F 2O2EA 1K7EB 3LUPA 3AZPA 4ASUA 3GCDA 1XD9A 4OXKA 2A9VA 1XTUA 3BXGA 4TWAA 4ZREA 3BWVA 1M6HA 1I2BA 3K9QO 3LDFA 3QA9A 4JJ7A 4EHIA 3O7MA 1L6RA 2AG0A 4QSHA 3GGGA 1Q92A 2GUGA 2FMTA 5LU9A 1XWFA 4NU8X 5KAMA 4M87A 1N78A 1DDOA 2DR3A 2Q7OE 1A9PA 1NQUA 3O91A 2AEEA 4P34A 2FLWA 4D9CA 2IS1A 1Z83A 1RE0A 2A88A 1N4AA 1ES9A 2O4CA 2VF4X 1ISGA 2ZR9A 3UMMA 1HT1E 3AJ9A 2EVWX 1M0SA 2VQ3A 4F8YA 1D0IA 2G08A 1G41A 3PR1A 3AR6A 1SNYA 1AB5A 4YDSA 1RMYA 2BV3A 1E9VA 1Z4JA 4MVJE 3ASUA 4BEJA 1KVUA 2FSVC 2VDQB 4XM2A 5CIQA 4DCSA 4YIKA 1XZLA 1VCIA 1GTZA 1Q0PA 4RU1A 3WLHA 2M1ZA 3HMKA 5BW4A 5K8VA 5L3SB 3IBSA 2NZ2A 5EHGA 1PKEA 5DASA 3KL4A 3PCXA 1HC7A 5KPJA 3I5YA 1WHSA 1YTLA 3AZOA 2HSZA 3VQTA 1NW4A 2QD1A 2P2ZA 3G0DA 2GS9A 2VJYA 3QPWA 2OXIA 1GIAA 2NXCA 3AHIA 5L51A 3TAHA 3X44A 3ZE1B 3D4NA 5C80A 3WLJA 1OYVA 1JG2A 3KZXA 1P4RA 3NV7A 4PLPA 4CMGA 3L6UA 1FLDA 3NT2A 5C1PA 4EB3A 3NHKA 3FNHA 2FR0A 5CR9A 2FUNB 4MRRA 3U6BA 3BMOA 3M89A 1UC8A 1TO6A 4RY0A 3CUSA 4EI9A 3SBXA 4RMHA 4P6VF 1B7GO 3D6UA 3EIUA 3OX1A 4PG7A 2FUG6 5EKDA 1OW3B 2QMHA 1VSTA 4AF7A 1YDWA 1Z5PA