4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
1OJLA 4L9SA 4CVNA 4K81B 4QM6A 4C0QC 3LD9A 1Z47A 5JZVA 3SOPA 2EFDB 1NY6A 1XXHB 2QI9C 4BECA 2CK3A 3RHFA 3BAFA 1OYWA 1NVVQ 1P72A 1OFHA 4V0NA 3U3RA 1YZNA 3C5CA 5P21A 1PUJA 3T06B 4DIDA 1TPZA 4RD3A 5BYKA 4S35A 3LBHA 3WXMA 1XWIA 2H17A 4Y0VA 5DGXA 2F43B 4PAOA 2ONKA 3ZGXA 4LI0A 1C9KA 4OQMA 1VMAA 4Q1FA 4TMXA 3F0TA 5JECA 3OIWA 4UJ5A 4V0MA 1NLYA 3RRNA 3ZVLA 4E03A 4LUCA 1WXQA 3E70C 1FUUA 2FFBA 1TTTA 1NN0A 4WBSA 4A8JA 2AXPA 3RAPR 3GP8A 1E1QD 4PHFA 4GPTA 2IX3A 2H1LA 2ZI9A 2PJZA 1NMYA 3K70C 4KI0A 1P6XA 4PC1A 5E7JA 3B9QA 3HP1A 4TL6A 3B6EA 4Q4HA 2V6IA 1CJKC 1SGWA 3M6AA 1LS6A 1B23P 1DTSA 5GJWC 2WHXA 3HR7A 1TF7A 4WOPA 1Z6TA 3THWA 4TYQA 3ZYCA 1U90A 3WBJA 3IEVA 3SHWA 4DC9A 3GQBA 3SQXA 1GILA 1T9HA 1OLOA 5UKDA 1D2NA 1RYFA 1OHHD 1E2HA 1VIAA 3C14C 3F8TA 4Q7JB 1G4UR 2B8TA 1LVGA 2IXEA 2SHKA 1EX6A 3EZFA 3WP0A 4LWZA 2JJ1A 1DOAA 4A1FA 3LX5A 2DHRA 5HTKA 4XOIA 1F2UA 3GLHA 3GLGA 4ZV4A 5B30A 2VP0A 3KKQA 4PO1A 2BM1A 4DDWA 4WZ6A 2G0TA 221PA 2ECKA 2NIPA 1F48A 2ZTSA 3C4JA 3A1VA 1GKIA 3K9HA 3VFDA 3RS7A 4BRUA 1UM8A 1ZJ6A 4U7DA 4IDHA 2QQEA 4FXPA 2OZEA 4QGAA 4B3XA 4JZKA 3RRZA 1IM2A 4B71A 1ZC4A 3AKEA 5TV2A 1UKVY 1KDOA 2J0UB 5CB6A 3L43A 1XJ0A 2ZE8A 5JI3E 1GZSA 4FMCB 2C9YA 3NBFA 4OHVA 4TMTA 1G1MA 1B0UA 2IF2A 1YZQA 4NYMR 1FOEB 2R6FA 2OAP1 1OW3B 2YKGA 5FL7A 1P9NA 3W6PA 2FWRA 4F4JA 4QKQA 2FU5C 2PX3A 2HUPA 4XVRA 2IF0A 1WQ1R 3MGCA 3AVUA 2GTPA 3EIEA 5L3SB 4ZKEA 2ZEJA 2CVHA 1S3SA 2V54A 2OLKA 3TK1A 1Z0KA 3EARA 3C7KA 1US8B 2FSFA 3BB1A 4HDQB 2JIZD 1HY3A 4D4KA 1R4AA 2OBNA 1W36D 3DKVA 3QXXA 1IXSB 4MRNA 1D9ZA 1R5BA 2RAPA 2X2EA 4KU4A 2OFOA 1VPLA 4M21A 2G1KA 2O8FB 1GL9B 3N2EA 3CF6R 2PX0A 4YMUA 2CNWD 3ZZ0A 1YR6A 1LF5A 4PZYA 3TIFA 5D3MB 1W4BA 1G8GA 3FMPB 1NJGA 3GMTA 5C2JB 4LJAA 3H0KA 2VYFA 2R8RA 4Q9IA 3BFKA 2XSZD 2XZOA 4FINA 3QPWA 4JLNA 5H70A 4B47A 4P3YA 4GOXA 1MRNA 4LHWA 4BEJA 3LQRA 3UPUA 2GVDC 5EXTA 4PR0A 1W36B 3BIFA 4M2LA 2PEZA 4L9WA 2LKCA 2XXAA 2CXXA 1X86B 1XTSA 3U44B 3VU9B 1UKEA 4FCVA 4I1SA 2J46A 3U5ZB 1F3OA 5SZHB 3R9XA 3I72A 4JBYA 3I92A 5IF9A 1DO2A 4Z1MA 1SULA 1IONA 1VCIA 3SE0A 2HT1A 1KJZA 4GBMA 4O25A 3SJAA 4X8MA 2Z83A 4BQSA 1LY1A 4CEJA 2WJJA 2LKDA 2QROA 1OXTA 2WKQA 4WVFA 3WHKA 2HYIC 1WB9A 3DO6A 1KJWA 4F4IA 1LTQA 1X8LA 3U4QB 2CK3D 4PQRA 1G3MA 3QI2A 5K8IA 4B2IA 4BLRA 2QTHA 1RRFA 4JT2A 4B6FA 2ZS9A 3CX8A 2NPFA 3Q85A 4G5OA 4M9XA 3UMFA 3B60A 1Q3TA 5DYGA 1KJYA 3OIYA 2IYLD 4BLTA 4CEIB 2ZI6A 3CR7A 4M1WA 1HYQA 1IN6A 2P3SA 4MITA 2ZRGA 4B3GA 1R8SA 1E9EA 1UDXA 2RGAA 1UEJA 1TU4A 3K1JA 2FNAA 3JZAA 5CK4A 3MWJA 2W00A 4NCJA 3CNNA 3RC3A 4Q9JA 2ZS8A 4AIIA 2CLCX 2VP6A 4TL8A 1ZUIA 2CL7X 4CT5A 3DEFA 3ZIAA 1N6HA 1KMHA 2BMFA 5JJIA 4JSTA 2WKPA 2FV8A 2ZRNA 3OFNA 4DKXA 4DRZA 1E2EA 1W5SA 1X3SA 2AR7A 1KI1A 2GXSA 3B78A 5AWFC 2O8DB 2EVWX 3CONA 4XSGA 3U3MA 3NBXX 4ARZA 2WAYA 1E2MA 5AJZA 5EXXA 1UDWA 4TZ6A 2D62A 3PG5A 1YKSA 5FUXA 2OUKA 4MRVA 2QORA 4QBFA 4TYWA 4Q4HB 1JEDA 2EFCB 2JJ1D 2MMCA 3EPJA 5TDHA 4AG6A 2Z6VA 3THWB 1NMXA 4M1KA 1NI3A 2GA8A 1HE1C 1M2OB 3TH5A 3LXXA 1NF3A 4TLBA 1COWA 2DFKB 2IYTA 5FPTA 3IUYA 3QQ5A 4M1SA 3RDPA 5AK0A 3SJCA 4ILEA 4Q66C 3P26A 2PT5A 2Y8EA 4S2EA 3SEAA 4BFXA 3MJRA 2OFWA 4LHZA 4TT3A 5FPHA 3QBTA 3T1QA 4AK9A 1P73A 1P7CA 4KFUA 3SBDA 1SXJE 4DHEA 2RGBA 3IILA 3BJIC 4OI4A 2FE4A 2VHQA 3T1TA 1W7AA 2QENA 1TMKA 3SJZA 4RZXA 3I62A 3THYB 3GLGB 2O8BA 1Z28A 1E2FA 1D8TA 3BORA 4RD6A 3EA5A 3ASYA 3PEYA 1DAGA 4XTRA 3UXMA 5JS8A 2KI5A 1I4LD 2FFHA 2P6UA 5FI1B 5DLQC 3UANA 3GEIA 4D25A 2YOGA 3RLFA 1WA5A 3NVAA 5HKKA 1RPZA 1XDBA 4I1OA 2P67A 3SI7A 5IHPA 3AVYA 2QGNA 3E1SA 5HZHA 2ZR7A 1KK0A 1JNYA 4MRPA 1NL3A 2JJ2A 3K70B 1W0JA 2QTVB 1KSJA 2K5UA 4RFSB 3IPXA 4Z51A 3A58B 1D2EA 1YR7A 1JR6A 2O0KA 3AM1A 3CPJB 3QG1A 4ZKDA 5LD2C 1AQUA 4KFSA 1ZD1A 3DZ8A 4ZI3A 3P4YA 5IT5A 4N3NA 2WWXA 3AKDA 4A0RA 4JKIA 5BN5A 2W2VA 4US2R 2IXGA 2YYZA 2P65A 2N42A 4URZR 4C7OA 4IEIA 4PPQA 5L3RA 3LLUA 2ORIA 2X8AA 4P32A 4FI3C 4W5WA 2C99A 2EFEB 3CO5A 3VQTA 4ZDJA 3ICQB 4HEJA 5FTKA 4FD2A 1NN1A 4HZUA 4TYPA 1YE8A 3CZQA 3TR5A 3EPLA 3RANA 5FTMA 2GWHA 2PCJA 4Z1MD 1R2QA 3C16C 3CRVA 4ERNA 4PQFA 2QAGA 4HB4A 3X1ZA 1F2TB 2J59A 4N1AA 4R98A 4QRHA 3IIMA 4MGKR 1CRQA 1MKYA 2JLXA 2PMKA 4KVGA 2YVUA 2C78A 4IEEA 4Q01A 2XXAB 3VR6A 3MWYW 2VRWA 3KB1A 2WJYA 4F91B 2BWJA 3T15A 4QG7A 4W5HA 1U0JA 5FTLA 1SXJC 1BKDR 2WWYA 5B64A 1ZM2A 5BWMA 1U94A 3L8ZA 5FL3A 1UPTA 3DHWC 5FBVB 1R7RA 4JJZA 1T3SA 1QHSA 1XTQA 4I99A 2Q9BA 3ZVNA 1AK2A 4NKRA 1A2BA 1YU9A 4EJSC 5GVRA 3REGA 5F9FA 5CLQA 3KKOA 2HLDD 2V7QA 3V00A 4EPTA 4HATA 3SQWA 4CEJB 3THOA 1T4GA 2CL6X 3AVPA 1ZINA 2AWNA 1EX7A 5TB5A 1G6HA 2I1QA 1YZUA 2O0HA 2OBLA 1O3YA 2YC4C 4KITB 2IXFA 4QBIA 5FUVA 2UVQA 1JPNA 2GVZC 2WPDA 3IBGA 1X1SA 2ZR0A 3SNHA 3P1JA 5CK5A 3BOSA 4FN5A 1XD9A 5F2EA 1VIYA 4IFEA 3GLIA 3SHFA 2A78A 4KYUA 1M7HA 4YONB 1KK3A 1Q1BA 3GJXC 4TLEA 1DEKA 3NBZC 3OFND 4ACAA 2NG1A 4NCIA 3AF1A 5KPDA 2AXNA 2PT7A 3NDBB 1E9SA 5EE5B 5TARA 1U81A 4PPNA 4W5JA 621PA 2A2ZA 1IY2A 1CP2A 1G6OA 2CHGA 4IOLA 1XX6A 2CCKA 2V1XA 2ZPTX 4TYYA 5IRCD 3NTUA 4MKGA 2Q21A 2XZLA 2DFNA 1ZIOA 1L8QA 1TQ6A 1GDDA 1M8PA 2J0SA 4Q5IA 4V0KA 1OFTA 2NO6A 1G291 3L0PA 1HE8B 1XEWX 3R8CA 2W2TA 3IBYA 3EZ6A 4XWOA 2NGRA 2H16A 2CL0X 3A4LA 2BCGY 1COWD 1EK0A 2QUZA 3KUDA 1QHIA 1Q1EA 4ARZB 1WMSA 1E99A 3Q9LA 1II0A 2YWEA 3LFUA 5CB8A 4AKEA 1A4RA 1G5RA 1KO4A 2ZI7A 1HQCA 3X2SA 4HI0E 4TT3D 4XVUA 5JBQA 2ZUBA 1P9WA 1HV8A 1OSNA 1FQJA 1J8YF 2OXCA 2FPMA 2WJIA 2UZIR 1LF0A 4YDSA 1IHUA 2F7SA 4R9UC 3V4FA 2WBLC 2ZETA 1E9CA 1G41A 1FMJA 3CNOA 2GBLC 1UBCA 2R6DA 3OEHA 1E94E 3OIUA 5DH9A 5HE9A 5JHHB 4MGYR 5J4VA 2GCOA 4C0BA 2IS2A 1G7CA 2DFLA 3SYNA 1GSIA 1W46A 1E1QA 2C77A 1HQYE 1PLJA 4C3ZA 4G3XA 4OBEA 3Q5DA 5HKKD 2UKDA 3B9PA 2R9VA 4PO8A 1CJTC 2JLRA 2JJ2D 1W0JD 4AYXA 4IOKA 3VNVA 1N0WA 4I4LA 1YZKA 1XCGB 4JKYA 1JQLB 3LA6A 1SVMA 1K5DA 4AWXA 1IN7A 2OCYC 3IIKA 4P4SB 3I1FA 1IXRC 5H1YA 1DS6A 4OYHA 4X8HA 4URXR 2FEOA 4PSVA 2ZRFA 5JWOA 1ZC3A 1JBKA 4OQNA 4QFMA 4CIDA 2D4HA 2EFGA 2QMEA 4QL3A 2GK6A 5CIWA 3RWOA 3CNLA 2HV8A 1GVNB 2IYQA 2WMNB 4QJ5A 4WXRA 1BO6A 5DSZA 4AG5A 4B3DA 1IQPA 4K8OA 2VPPA 1TQDA 2BBTA 2OESA 1DVRA 2QZ4A 5B2ZA 3GD7A 2QTFA 3JZMA 2HF9A 2Q3MA 4D4MA 4PHTA 1K8RA 1W49A 5EP4A 5CIQA 3RABA 1G3QA 5C4MA 3A1SA 3FHOA 2FPLA 5DNYB 1ZW6A 5L3SA 4UNSA 4BASA 5JJKA 1DAMA 2F3TA 3K0AA 4HB0A 2V1UA 1MO5A 2HJVA 1G19A 4IHQA 1ZCBA 2XNSA 2IT1A 2GZDA 2VHTA 4ZO4A 2W2XA 4UKDA 4JLPA 4KODA 3TR0A 1AQYA 1XJCA 4DBLC 4BFSA 1GNRA 3ZQ6A 4Q1CA 4RZUA 3LW8A 3JVVA 4ESVA 2O8FA 1R0YA 2R6GA 3R8FA 1NP6A 2O5VA 5LBIA 2R62A 2J41A 4JVMA 3SYKA 2WV9A 1UBFA 4MH0R 4IDOA 1X6VA 5AUOB 5FTJA 1R5NA 2ZXUA 5E95A 3RNLA 1BMFA 3U61B 2J7PA 2V7QD 1E4YA 1NVXQ 2AX4A 3TE6A 1KO7A 3W8RA 4DWJA 4CRWB 2OE2A 1PVOA 3U44A 1QDEA 3VU9A 3GJ8A 2BV3A 3HWSA 1W2GA 5EQTA 2GKSA 2ZSDA 2WPDD 4M1MA 2WMOB 1IJEA 1S3GA 4PX9A 3TVTA 4DDTA 4M4SA 3BRWD 3ZLJA 2RMKA 4QOSA 4FCWA 4TTQA 1E79A 2ZITA 5G3YA 1E6CA 1A1VA 5LD2B 2C2HA 3LQQA 2RGXA 5F98A 3FMOB 2CHVA 3U7HB 1WCV1 2R6AA 1N0UA 2QPOA 4ZDWA 1RRCA 4D2IA 1X1RA 3PXGA 1R8QA 1E2LA 3U4QA 2GJ9A 1JPJA 2ZRDA 4AKGA 4GT1A 4TLDA 3RSLA 2VF8A 1JQJC 1V43A 2XTNA 4P33A 5J4YA 5M04A 1Z0FA 3O8BA 5KOYA 2YOHA 4IJMA 4O2RA 5DN6D 4CEIA 4XVQA 2JCSA 4HDOB 3EIQA 4BFYA 1VHLA 1MH1A 1AS2A 4PZZA 1N0VC 3KQUA 2ZE5A 3ECCA 3LLMA 2O8CA 3W9YA 3W8NA 5CJPA 1T91A 3K09C 2MMGA 4WAUA 1U9IC 1IN4A 1FP7A 2QQ0A 5HCNA 1JJ7A 3HYRA 2HF8A 1OE0A 3HPQA 1T5IA 4DZZA 4D26A 2RHMA 3G0HA 1ZAKA 2IYUA 4KO8A 1RRGA 3FE2A 1TADA 2WSSA 3QF4A 3PENA 3QXHA 4N0EA 3B1XA 4AYWA 1XBTA 1GRRA 2ZJYA 3VR5A 2IW3A 1G16A 3B8HA 3LW7A 3AB3A 3OEHD 4C0JA 4EJSB 3KZ1E 2O8DA 3AQ4A 1VECA 1VHTA 2JASA 1PV4A 1LFDB 2NO1A 3GJ4A 1D9XA 1ELOA 3UG7A 3GJ0A 4W9MC 2KJQA 2E1RA 1X8KA 1HTWA 2ATXA 4PSAA 3V4RA 1G5PA 3TSWA 3T12A 3CF0A 3TUJC 3K0CA 1KAGA 3WP1B 3QXSA 4RD1A 3VMFA 1QBKC 1E1RD 3CH5A 2JLUA 1Z0AA 1RYHA 5E7IA 5G53C 4URYR 3VHXA 3O8CA 2GCOB 2WIBA 5E7MA 4DXAA 5CM8B 4ZCIA 1IY1A 1RRPA 4AD8A 2CCGA 3KX2A 3QNUA 1N6OA 4OI2A 1ZU5A 4V02A 4NCNA 2FJUA 4II7A 1KI8A 4Q7KA 4F38A 1WBBA 4WXPA 3W6OA 1E3MA 1XZPA 1M7GA 3FKQA 2IWHA 2RHDA 1GIAA 4DUGA 2OCAA 2IYXA 3BBPA 3QEJA 4MA4A 5EE9A 5TVKA 1IOZA 5J4LA 3SDZA 2REOA 3HDTA 4L4UA 3KQLA 3FGNA 4LJ9A 4QBGB 3W5IA 3BE4A 2ODWA 4GMXA 3L82B 3THYA 2OT3B 1N6KA 2ZJ5A 3CBQA 3MLEA 1P2VA 4QHSA 3SN6A 1E9FA 3QE0A 3K9LA 4NCHA 1J7KA 2GF9A 4FCTA 1Z0IA 3WMFA 1S9HA 1U8ZA 5IDVA 2FMXA 2H5EA 4DIEA 1IXZA 3I4LA 1AZSC 1NSFA 4Q1BA 3GEHA 3KJEA 2B6HA 3NEJA 1UBGA 3KL4A 3I73A 1NG1A 2WWWA 1G8PA 3MRSA 3TBKA 4Z8XA 2LCFA 2QN6A 3FB4A 4TMVA 4RFSA 2QSZA 5F9HA 2W58A 4LV5B 4FMBB 1DG1G 4NU0A 2EWWA 2AFHE 4B34A 1ZM9A 4IRUB 4A82A 4JLOA 2MSDB 3NG1A 1XU4A 3PVSA 5KU1A 4A2QA 5AR1A 5FI0B 1N5JA 1KMQA 1L4UA 1BMFD 1HUQA 3K0AB 3PUYA 2J7PD 3KJHA 4PSKA 3ADKA 5CM9C 4O2LA 1KSHA 3RYTC 3CLVA 2W0SA 3M0EA 3C8UA 2VP9A 1MO6A 4CW7A 2DWOA 1GL7A 3G5UA 2V3CC 4HDCA 2EYUA 3NBYC 4GRAA 1WE2A 4R2IA 2W0MA 2BEKA 4JS0A 1RVDA 1AN0A 4BEBA 1E2JA 1F2TA 1GNQA 3F5FA 2ZYVX 3VKWA 1E79D 1OFIA 3GJ5A 5BW8A 4AKIA 2VF7A 2R44A 2VL7A 3ZS9A 2C04A 4Q7LA 1JJVA 3OE7A 3B5JA 2QGZA 3BB3A 1ZUHA 4A36A 1JAHA 2ZSBA 4HYYA 1RJ9A 3ASZA 3S1AB 3WRXC 4DCSA 2VHUA 3K9NA 4B48A 3R7WB 1II8B 1DADA 2QBYA 2WICA 3AVQA 3NC0C 4QJ3A 4FMDF 4DLTA 2QT1A 1SHZA 3LV8A 1CF4A 3CPHA 2OBMA 1NBME 2L0XA 4TLAA 3H84A 1J70A 1OT3A 4PC6A 4O3MA 1DARA 1G3IA 4EFNA 4OK6A 1E9RA 5JEDA 1GKUB 1EFUA 2QP4A 1F6BA 4KXFB 5E3HA 3ZVMA 2QPTA 5CLLA 3WNBA 1Z83A 3B7GA 3EZ7A 1DAKA 2ZS7A 1Z22A 3IIJA 1KGDA 4PC7A 3U6KA 1XPOA 5FUYA 1KI3A 1G9XA 4QGGA 2ATVA 1M34E 2VSFA 1E98A 4N0DA 1DPFA 2A7QA 1Z6XA 4EPYA 4O0MA 4C2TA 3GJ6A 2WSSD 3EA0A 1KYIA 3EC2A 3A8TA 3PV0A 4KSBA 2NMVA 2HLDA 2OM2A 4GDFA 2JLZA 3KJGA 3NXSA 4JLKA 2ZU0C 3EAQA 2CE2X 4DLYA 5K8TA 2O8CB 3AGQA 2NO0A 2GRJA 4D0LB 3BS4A 2X1VA 2F9LA 2GEVA 3PFIA 2CDNA 1XMSA 4D81A 1HURA 3W34A 3WNDA 4DLXA 1OPXA 3BH6A 3ZQJA 2FGKA 2VHJA 4PTLA 3VHLB 2ZM5A 1OIWA 4R71A 3NH6A 2Q9AA 3NEYA 1TF5A 1GRNA 1QF9A 1MR3F 3EWAA 1KDTA 3QF4B 5AJYA 2NQ2C 1R10A 1GFIA 4EQ6A 2NPIA 2WKRA 5FR2A 4NZYA 2ZUCA 2CLSA 2QEQA 1SVLA 4DLRA 3KQKA 1Z0DA 3IO5A 3DPUA 4C0LA 5BN4A 4NBSA 4KV9A 1E0AA 1JR3E 2PZFA 2VP5A 1XB2A 3Q7PA 3KJIA 1UEIA 1E2NA 1ZBDA 4Q1DA 4OHYA 4BFVA 1AKYA 2ZANA 2BC9A 4M1YA 1NJFA 2GNOA 4DUGD 5C46F 1P2TA 3THXB 2ZRAA 3SYLA 1I2MA 1MT0A 4PXAA 3ZDQA 4LHYA 1XD8A 2N1BA 2NOAA 1NN3A 4OJKA 2VEDA 5AUQA 4B74A 3C15C 4NYJQ 3LX8A 2ZE7A 3T1VA 4DEXA 3D7MA 5HZKA 3LBIA 5EP2A 4AC9A 4JSYA 4XWAA 4GOJA 3PUXA 5JI2E 4AKHA 1ZUNB 3CB4A 1OF1A 2KBEA 421PA 1GL6A 2VP2A 1RE0A 4I1VA 4U02A 1GITA 3B2EA 2D2EA 4OKSA 1FQKA 3EW9A 3LBNA 4H1VA 1M1YE 2C95A 4KBGA 4OK5A 2WSMA 4LV6A 3T5GA 4CEHB 3QJYA 3REFA 1UADA 1U2RA 3QKTA 1U8YA 3A6PC 3NHAA 5FPSA 5AUNB 1ANKA 2QNRA 4PQYA 4YDHB 4ITRC 2GETA 2R6CA 5KPJA 1W47A 1F60A 1P2UA 4RCYA 1KIMA 4U5XA 1YR9A 3L0SA 5LPNA 3K70D 5C1BA 4Z54A 1E32A 1TEXA 2ZREA 1NSTA 4EKDA 2VA8A 3PIRA 2W6IA 4QJ4A 2QMOA 4LX0A 4P4SA 1AIPA 3LNCA 1KY3A 3GFOA 3PQCA 1NVWQ 1MO3A 3NC1C 2H18A 2WZQA 4X8LA 4KBFA 1XPUA 3Q72A 1NNEA 1OFUX 1RKBA 4IDPA 3IHLA 4LBYA 1NG9A 4LV8B 4EPVA 4GZLA 4QHTA 2NTYC 1SVSA 1JECA 3OAAA 1AGRA 1P4SA 4A92A 4Q47A 2V9PA 5TY0A 2G9NA 5SZKB 2ZRKA 3VR2A 1NKTA 3SFZA 4BLSA 3BH7A 4URVR 3B1WA 1FUKA 4IXNA 4LHXA 4JVSB 1NKSA 1VG0B 2OLJA 3QENA 5JCPA 2R2AA 3U6BA 3RWMB 3KKNA 2BMDA 2Q3FA 3I61A 5FUWA 2PMDA 4AURA 2ZJOA 3N5CA 3LRPA 1YZLA 1QVAA 1AM4D 4M22A 3SFVA 3BERA 1EG7A 2FFAA 2HDNB 3ND8A 2W6JA 2J9RA 4LYHA 2BBSA 1GM5A 2XEXA 2ZYUX 4P31A 3OE7D 3QF7A 1E2QA 1RIFA 2D7CA 5FR1A 4GZMA 4YLGA 2DR3A 2IUTA 4K46A 2BBOA 5L8VA 4P4TA 2JLYA 4DSTA 3KXIA 1XD2A 3CZPA 2IYVA 4BFWA 1TQ4A 1OH8A 4V03A 2A5DA 1KTVA 4BLQA 4KHZA 5AJWA 1SVKA 1DG3A 4JT4A 2BKUA 4TMWA 1PUIA 1Q21A 1Q44A 5D3QA 4B73A 2XITA 2Z5FA 2CJWA 1N6IA 1RZ3A 2QG6A 1FW6A 1AZTA 1GTVA 5GVSA 4NTZA 1KY2A 1RJ9B 1N6NA 2GXQA 2HCBA 4P4UA 3A1UA 4NHOA 2B7CA 2G0NA 2VP4A 1HT1E 2QBYB 3O8DA 1CKEA 2PL3A 4RKEA 2FZLA 3RS2A 4LJYA 5FOXA 4WIAA 4BRWA 2AN9A 5A4JA 1PLLA 1OH6A 1T8UA 4DLWA 1ZNWA 3A1WA 4HSEA 1Q1QA 3QXCA 3VR3A 2OHFA 2VBCA 1G4AE 2RB4A 3ZJYA 2VHCA 2BVNA 3WBKA 4NYIQ 3I5XA 2F55A 4RKFA 1QHNA 1Z3IX 3CM0A 1NMZA 1VG8A 4OHXA 3ZD7A 1JR3A 4ZCMA 2YHSA 2MSCB 3HU1A 3MWKA 2RGNC 4PPFA 4F7WA 1XMJA 4EPXA 2IS6A 1CRPA 4Q4LA 4DCNA 2NO7A 2X2FA 3GFTA 3KFVA 2CCJA 3P27A 4JL5A 1ZU4A 3FTQA 1R0ZA 2Q3HA 3MG9A 3U3OA 5JWHA 3QXJA 2YC2C 2IYYA 2YWGA 3I32A 2JLQA 4KYIB 4E22A 5AUPB 1AGPA 3IHWA 3D6TB 3UKDA 1CJVC 1CR0A 5FFMA 3SZRA 1UJ2A 3CX7A 1CTQA 1ZP6A 4UXHA 1T6NA 2YOFA 2HJGA 1Q0UA 2OFXA 1Z0JA 5CDFE 4FWTA 1OYYA 2WJGA 5KNBA 1AKEA 3TLXA 1U0HC 1Z6YA 5EUQB 5F3WB 2ERXA 4RY2A 1SXJA 1DAEA 1M7BA 4Q7MB 4RD0A 2EW1A 4G5QA 4C2UA 2C5LA 1FNMA 1BH2A 1FNNA 2BM0A 3QBVA 1KHTA 4EQ6B 4PO9A 4BFZA 2F3RA 4YQFA 5FTNA 3PUZA 2QU8A 2BMJA 2G83A 2VSOA 1SHKA 1ZD8A 1T5LA 3W90A 2I3BA 2DBYA 4EJSA 3Q3JB 5JMTA 1SVIA 4DCUA 3MUFA 4GSYA 1W0KD 4JYBA 2GEDA 3B1ZA 3TRFA 2ZSFA 3NWJA 3QVVA 4C30A 1QG4A 1VYUA 3CW2A 4J0QA 1ZRHA 1UBEA 4M0LA 1WP9A 3TKLA 1G21E 4QGHA 4CYMA 5B57C 4OI1A 1KI6A 5JFGA 4GL2A 1E2GA 4PAMA 5BXQC 2GZHA 4LHVA 1E9AA 4MYCA 4CF7A 1E2PA 1K5GA 4Q48A 4IKEA 3O47A 4G5GA 4RFVA 3ONWA 4DDUA 2XAUA 2X77A 1XEFA 2W6ID 2Z43A 4DLVA 3AVTA 3FFBA 1XJQA 3VAAA 1G7SA 1P2SA 2NZJA 4NE2A 2JDIA 3B82A 4LRWA 4I81A 1CBUA 4RSGA 5SZIA 3GPLA 2P5TB 3OAAD 3T35A 1OXSC 4D4LA 2YWFA 1OB5A 1R0WA 3NKVA 1N5LA 3T5DA 3EPHA 4M1TA 4OQFA 3ZZUA 1E1RA 4TYNA 1FL9A 3CR8A 1QRAA 2ZROA 4CDGA 4OQLA 2AKYA 2AFIE 4JYCA 2ODEA 4ACBA 1UAAA 4B33A 1DELA 5KSZA 2C9CA 2PJRA 3FKSA 4D4JA 2GXUA 4Q4AA 2W6JD 2OO7A 2BCJQ 3EZ2A 1JB1A 2QSYA 1MOZA 1SZPA 3AEZA 3RS3A 1EXMA 3X1DA 2HXYA 2KBFA 3IEUA 3U3JA 5AJVB 1EFTA 1XNJA 2TMKA 3AF2A 3UWKA 2ZRJA 4V0ME 5KUTA 3TJZA 4Z8YA 1XZQA 4LOAA 3R9WA 4EFLA 3QY0A 4XIGS 4EAQA 2D7DA 4YMVA 1KSFX 2WM9B 1FZQA 3MCAA 4Q1EA 1VG1A 2QAJA 3ETLA 1W36C 5JSZB 2IUUA 2QL6A 2GBLA 1ZCAA 2WIAA 5HCIA 4MGZR 3GLFE 4AYTA 4OL0A 4PHHA 3K53A 1JAIA 3CRRA 2FGJA 1BOFA 1P75A 3IKJA 1FTNA 3B1VA 5EXSA 2FPKA 3AP3A 1OIXA 2ZAOA 1P61B 3QOFA 3CRW1 2P0EA 1J2JA 4HLUC 3ICEA 4B6EA 3C41J 4KAXA 1QVRA 5EP3A 2XNDA 3GFPA 1L2TA 4BZXA 1ZM7A 1NY5A 1XD2B 3FPAA 1YJ5A 2ONJA 2A5FA 4NL4H 1Y63A 4WA7A 3SJBA 2REXB 2MSEB 5DISB 2RGDA 4MKFA 1VCOA 4KFTA 2BDTA 3M1IA 5KDLA 2YINC 4M1OA 5KNDA 1TEVA 1ESNA 2CJWB 521PA 4ESHA 4UQOA 3BXZA 4Q4JA 3D3QA 3E2IA 4UNPA 5LDDC 2DPXA 2RCNA 1QHXA 1JR3D 3ADBA 4QBHA 3GLHE 3S1AA 3GLGE 2BMEA 5KSPA 3R7WA 2AWOA 1II8A 3WYAA 1IY0A 4NYJR 2REBA 4POAA 1YZGA 2HEIA 3TSOA 1A5TA 4G0NA 2GZAA 2JATA 2XX3A 4D0GA 4KJZA 3MMPA 2GCNA 1W1WA 2IEYA 3QEOA 2A3RA 4LDJA 1EESA 4ZDIA 3IDQA 1ZM3A 5C18A 3TUZC 2JEOA 1U99A 1A82A 5EE3A 1S1MA 1K6MA 4IOMA 2P6RA 5G40A 5G3ZA 2WOOA 3LH5A 1GWNA 1VDZA 1JXOA 1ONBA 2ZRLA 1S8FA 1KK1A 4DCTA 1N25A 2J0QA 1CR4A 4DVGA 3BD9A 3LDAA 1Z2CA 3T34A 2F6RA 2GEUA 2OG2A 1FX0A 1SXJD 2CLDX 2FEMA 2ZSEA 1HA3A 821PA 3U60B 1FP6A 4A8JC 4B75A 1KO8A 1XRJA 2DWPA 2QPAA 4LYJA 2HCJB 1YHNA 4RD2A 5BYJA 1S0UA 4TQ9A 4MQBA 4M9QA 1UF9A 4HAUA 1ETUA 2BIFA 4URUR 1BIFA 1HH4A 1EWRA 2AK2A 2LWIA 5JCZA 5JJLA 1LS1A 1P62B 2XJ9A 3R20A 3WNCA 2KE5A 2QE7A 3CKLA 3M4YA 4JMPA 3Q7QA 5LB4A 1KZGB 4Q1AA 1WF3A 1ZMXA 1SXJB 2J7KA 1Q12A 3SBEA 1R0XA 1NVUQ 2H7VA 2WJHA 4JL6A 4MDEA 2CEAA 3B1YA 1ZM4A 4C0KA 4MYUA 2YV5A 1H8EA 4E5UA 5H8WA 2RH5A 3BH0A 1IN8A 1E2KA 2QY9A 3GJ3A 3NH9A 2IYSA 2A30A 4TL9A 2F1RA 2VLIA 3AP2A 2DCUA 1TUEA 4DEYA 5GJBA 1NIJA 1KKMA 3BFXA 3KXLA 3UIEA 2JDID 1KK2A 4MKIA 3QKSB 4YMWA 1Z06A 1G8YA 3OEEA 3THXA 4DLUA 1KI6B 1XEXB 2N46A 4OI0A 3VKHA 1Z6GA 4DLZA 3AF0A 1KNQA 1S9DA 3PR1A 1J99A 1SKYE 2B21A 4NPHA 2AKAB 3TW4A 3PJRA 1G20E 3MWLA 1QHYA 3D8BA 4M9ZA 4LJ5A 3FYHA 4ASUA 2OEPA 1DAHA 1KO1A 2G77B 2VO1A 4JBXA 1BS1A 4F93B 1SVWA 4CEHA 2ZRIA 3UWOA 3IPYA 3FKSD 2IYRA 4W7SA 2DFTA 3GLFA 3CX6A 5KTYA 4E09A 2IL1A 3AV0B 1J8MF 4JL8A 1G8FA 2HT6A 2YJTD 1QHHB 3K09A 4GMDA 3T61A 2PH1A 5JS7A 3FOZA 2FDCA 1U9IA 4EUNA 3L0OA 3LVQE 4A4DA 4OK3A 2XTZA 1KNXA 2A5YB 2XZPA 3EWSA 5L3QB 2WAXA 4PC2A 2JLVA 4DB2A 2VQSA 4R7ZA 1IBRA 3DDCA 4TZ0A 1LB1B 4KLNA 2J5XA 2FOLA 4NYIR 4DSNA 3QUSA 4Q4AB 4C9BA 3Q8XB 2GCPA 4FW9A 4JLBA 4EPWA 2B92A 2RGGA 1TNDA 2OCBA 1DE0A 1FTSA 1Z2AA 4QXAA 2RGEA 4NCKA 1EFRA 2BJWA 3CUEF 4URWR 1CR2A 3AUYA 4PC3A 1Z8FA 1XP8A 2XNDD 3W5JA 3ZZTA 5JEEA 2RKOA 4FMDB 1HEIA 4DCVA 2WWGA 4Q9HA 3HYTA 4EFMA 5L3VA 2CBZA 2GF0A 2ODNA 3G82C 3UMRA 4M9SA 2O8EA 2BKEA 3FHTA 4LJ4A 3P20A 1YRAA 1EFCA 3L0IB 2ZI3A 3WMEA 2WTUA 3HJNA 2ANCA 3CH4B 4B3FX 4ZIRB 3OZXA 1L7VC 1M74A 3DM5A 1U0LA 4B2LA 1EGAA 1P60A 2F1IA 1F5NA 3BGWA 3FFAA 4HAVA 2ZI4A 4LCBA 4PHGA 1H8HA 1QZXA 3TAHA 3WYGA 4B44A 2V8OA 3U2QA 2IS1A 4JJKA 2BHRA 3TSZA 4NONA 2D06A 4TQAA 2G88A 1I4TD 2V4ZA 4BPBA 1G7RA 2QP3A 4LYFA 1GKYA 1W2HA 3QPUA 4TSFA 5DIFA 4DT1B 2JAQA 1E0JA 1AS3A 5HPYB 1FFHA 1ZYUA 2F1HA 4A6PA 3AVXA 1G3RA 4I1UA 5E4FA 1OV4A 5J5CA 1XCPA 4G5SA 1LNZA 4HUQA 4BZPA 4D82A 1ZVQA 2IEZA 3EG5A 4HLDA 5FOTA 4Q4JB 1OXXK 1T3HA 2E9SA 3CWZA 2DB3A 3IO3A 1AS0A 2OV2A 3QKRA 4TN1A 1J90A 3AKCA 4Q19A 2P6NA 4LBZA 4OHWA 2YNMA 4XH9B 3V9PA 4C4PA 2YWHA 1ODFA 1G5TA 2AHOA 4QNRA 5BN3A 6Q21A 2Z4SA 2HXSA 3K8YA 3LO5A 4B35A 4KSCA 3EC1A 3I8SA 4XSHA 2FN4A 2E87A 1EFHA 2QT0A 3KTAB 4X8OA 4MRRA 3W6NA 3FMFA 4G01B 4XTCS 4RD4A 1Z6AA 1MABB 4BGDA 1Q20A 2JJ8A 4H1UA 2IWRA 4BLPA 1JALA 2WVJA 3FMIA 3QG5A 2ZI5A 2GILA 4A0FA 3I3SR 4FMCF 5BQ5A 4Q00A 2GJ8A 3GJ7A 721PA 4YXWA 2XGJA 5KSYA 2QE7D 4KFRA 4OHZA 3W3ZB 4V0OA 2CHQA 1P5ZB 3K0FB 4GOKA 3UK6A 3WRYC 1CR1A 4GFDA 4TTRA 4QNMA 1FX0B 4Q9KA 2IHYA 3UG6A 4TLCA 4XD7A 1NLZA 2UZ3A 3K0EA 2IYWA 1OH5A 2C98A 5J4KA 1H8ED 4CZ2A 2ZRPA 4B32A 3EIHA 1DBSA 4GNKA 3TAUA 3JVUA 3P32A 3B13B 3FHCB 3OF5A 1WRBA 1KI9A 5EXPA 1G3UA 5SZJA 2WWHA 4DDVA 4JIMA 5KNCA 1S1CA 3LXRA 3P4XA 5FBQB 2IC5A 1Z07A 2ORVA 2P2LA 3OEED 4BFUA 3TGPA 1Z5ZA 3ZH9B 1KI4A 1ZNXA 1CU1A 3AUXA 5EE1A 1UFQA 1A2KC 3OHMA 2GESA 2ZAMA 1CEEA 3L8YA 1YZTA 1Q57A 1KI2A 2FZ4A 4TMZA 5J47A 2QM7A 2H8KA 1I2DA 1LV7A 1S4QA 4ASUD 5IK2A 5CYPA 5DE3A 3R9IA 1EWQA 1N3BA 1E96A 2FH5B 4C0SA 1TX4B 1KKLA 3AF3A 1C1YA 1YQTA 4ON9A 2ZYWX 1SVOA 1XF9A 2A5GA 1IJFA 3U7EB 3A37A 4TTPA 3NIBA 1T0JB 3AVWA 1ESMA 2O0JA 1PJRA 1R5OA 4BUJA 2DYKA 4UNRA 1T0HB 2FA9A 2NO9A 1CLUA 3CRMA 2ZRBA 3GEEA 2KWIA 5GADl 4G5RA 1GAJA 4L8GA 3ADCA 2GJKA 4A8JB 1W5TA 4LPKA 3VKGA 2OXRA 2JGNA 2B7BA 2IYZA 1W0KA 3F3YA 1YR8A 4JVLA 4C0AC 1NRJB 4MYHA 5JWRA 3GLFB 4F92B 2FSIA 1OXUA 3IQWA 2Z0MA 2IBMA 5A5GA 3GLIE 3UATA 4L15A 4E07A 3DM9B 1JI0A 2J45A 4OJQA 1EFRD 4PANA 5FBWB 3RRYA 1KDRA 3AH8A 5FOWA 1CJMA 4R2HA 4B76A 5KHOC 3RVBA 4LBVA 2VTKA 1XTJA 1G18A 3DMNA 4UXJA 5DI3A 3EPKA 4RJLA 1CJUC 1TUIA 3LY5A 1XXHE 2H92A 2ZRCA 2ZYTX 3KQHA 5CYOA 1XFAA 3LVRE 2ZJBA 3KUCA 3W3AA 2AL7A 2GHIA 4US1R 4OQXA 2P5SA 2V55B 2IS4A 4FWIB 2PEYA 3SU8A 3TQCA 2QAGC 2J0VA 1NLFA 1F2UB 3GLHB 5FL7D 2R65A 4YMSA 1H8HD 3RC8A 1CS4C 3BB4A 2JA1A 1G7TA 2EFHB 3PUVA 3PCRB 2DWQA 1N6RA 4Q21A 3X1WA 4DB4A 2O8EB 1R6BX 1TL7C 1D5CA 3HPRA 1G8HA 3LAWA 3AP1A 2ASEA 4HAYA 1NBMA 2ZSAA 2ANBA 4HLQB 4M53A 4TSFD 5JSZA 2FX3A 3QKUA 2F9MA 4ZDKA 2OCPA 4PAQA 4TL7A 3RSOA 1FPMA 4LJ8A 3SR0A 3CRQA 1NN5A 4PZLA 3AVOA 2VIIA 2XTMA 4UJ3A 3ZS8A 4WW0A 1Z63A 2ZVQX 2CMKA 4HAZA 5AJXA 1AJEA 3ADDA 3KFXA 3U7FB 3HU2A 4L5BA 1RFLA 1XTKA 2KB0A 1S2MA 4ABYA 4M8NE 2G6BA 2F1JA 3C5HA 4BE7B 4Q03A 4HUQB 3DVLA 5CITA 4EIWA 4QGFA 1Y3AA 2ZRHA 1NVVR 2WOJA 3QKRB 2PLFA 1W4AA 4Q18A 2OAQ1 4IVQA 2ZVPX 4NP6A 3NDPA 4B2PA 3DKPA 3MAAC 3AGPA 1N2CE 4IXMA 4WZAE 4YXWD 5J4HA 2ZR9A 2RGCA 4G1UC 4BFTA 2Q6TA 2I4IA 3I5YA 3X1YA 4HAWA 4HUTA 4EPRA 1PLKA 4XD7D 5EUMA 1TQ2A 1GRQA 4GI7A 5JRJA 4B3CA 4JVNA 1BYIA 4QC2A 2CE7A 1O87A 5EZ6B 5KSOA 1A7JA 1ZNZA 2ZJZA 3DOFA 2XB2A 2BJVA 1XMVA 4KCGA 2FSGA 3CPEA 4KLZA 3T1OA 4YMTA 2J3EA 2I1VB 4QM7A 1E4VA 4EDHA 2ZRMA 2ZUDA 1KZ7B 4LSGA 1VKJA 1VYTA 4B43A 3WYFA 3ZD6A 3MSXA 3PEUA 3BC1A 2AD5A 3GCGA 5EZ5A 1KAOA 2ZU6A 4BWYA 1MO4A 2ZQ5A 4DSUA 3MFYA 4LGMA 2FF7A 1W4CA 2J1LA 4JBWA 1D6JA 1SKYB 2WJVA 3EASA 3D31A 4HAXA 3A36A 1T8TA 2GDJA 1ZNYA 2YZ2A 1P9RA 1GG2A 1ZD9A 3L2OB 1GOTA 5K8UA 1E0SA 5K8LA 2XOKA 5IK2D 1E2DA 1W4RA 4GP6A 3WMGA 5JHGB 1TF2A 1U98A 3VNUA 2FSHA 2GAAA 2B8WA 2PBRA 4CGZA 4NYMQ 4MUBA 4JLMA 3A4NA 3KKPA 3ZIAD 1OXVA 4HB2A 2EWVA 1TU3A 4NDZA 4XWKA 4AY2A 2ZJ8A 3EX7C 3UMSA 5DHAA 4B3BA 4L16A 3QPVA 2HYDA 2GXAA 1L4YA 1YRBA 2EU8A 1OKKA 4UNNA 1VG9B 4QHYA 2G1JA 5FPYA 1SKQA 1XPRA 1XXHA 4A0HA 4RZ3A 3KXKA 2WWFA 4LK2A 3VR1A 1RC8A 1KOFA 4ZI2A 1E69A 3RRMA 1T3LA 4BLOA 1UKYA 2AK3A 1WDTA 3PUWA 3QIAA 4A15A 3QKSA 4HB3A 1JEEA 1KMHB 4JLDA 1CIPA 4LBWA 3RS5A 3K0SA 1LW7A 1DO0A 2IUSA 5B58C 2F43A 2RGNA 3VR4A 3PEVA 1XEXA 3I8XA 1P3JA 5A0FA 3TW8B 3BWDD 3TUIC 2W83A 4A6XA 3N70A 4DSOA 2WWIA 4LPSA 1XCMA 3EZ9A 3DL0A 4Y0AA 2V6JA 4A2WA 1E0KA 1MV5A 3TNFA 4U00A 1CXZA 2EYQA 4Q02A 2QRZA 1JXMA 1KI7A 3EXAA 3AVVA 4IVPA 5ANRB 3KQNA 4TMKA 4D0NA 5DN6A 5TXGA 2J87A 4C0HA 4JLAA 1D2MA 2XB4A 1QG2A 3VX4A 2IHBA 1QHHA 3CIOA 4DJTA 3TVDA 1N6LA 2PZEA 3KKMA 1KO5A 4HZIA 5HR5A 3AKYA 2X19A 4MUAA 1M6NA 4TQUS 1Z08A 4NH0A 4PPGA 2C03A 5DI3B 5C4GB 4XJXA 5FH9A 4RZ2A 3KDSE 4ZCLA 8OHMA 5L3QA 4LY6A 2QMHA 3PITA 4D6PA 3IGFA 3O8RA 1VYVA 2GJAA 4F4CA 5JRZA 1NBMD 4IFBA 2GJSA 2PZGA 4FIDA 1IN5A 3IQXA 2QP9X 5H68A 4Q9LA 2A5JA 2IK8A 4LZZA 1Q22A 2EQBA 2Z4RA 4MGIR 5FBRB 2O8BB 3U7GA 4NMMA 4IOJA 5ELXA 1VCNA 1VTKA 5EJEA 3H4MA 5FOSA 5JLJA 2GK7A 4RCZA 1OB2A 1XMIA 3SS8A 1SQ5A 5CJ2A 3Q5EA 3SC3A 1GUAA 1OHHA 4A0GA 2OILA 1RW4A 3K9GA 2PCLA 3B85A 2ZE6A 1FMLA 1GNPA 2D3WA 2IA5A 2QA5A 2C96A 4ZIRA 2J0UA 4HLCA 5KO2A 3ND9A 2ERYA 5GJVC 3U3KA 2FFQA 4IVRA 2ZJ2A 4GP7A 1NIPA 5DYIA 1U8AA 3FWYA 4JLVA 3WHLA 4AI6A 4IW3B 1KDPA 3QVUA 4US0R 4RVCA 1OH7A 3OIVA 4MDFA 1OIVA 2NZ8A 3H86A 3DMDA 1QHGA 4DT1A 2BOVA 5DO9A 2D2FA 1W48A 5HE8A 1US8A 1XEWY 3CWQA 3NHBA 4P0TA 1G17A 1N5KA 1XTRA 2ZIAA 5EE0A 5FPKA 4ZPXA 3J81k 1ZIPA 5DI9A 3ZVRA 4C7OB 3DZDA 1IAQA 1CULC 1X8JA 5FBLB 4A9AA 5EP1A 3VTKA 3MD0A 2D74A 2G3YA 121PA 2H57A 4HZUB 3TMKA 5KDDA 4MYTA 2AD1A 4JLJA 4MRSA 5CDFA 3QSYA 4KVAA 1N5IA 1DAFA 2QAGB 3VX3A 2VSXA 4PFSA 2JLSA 2XJ4A 3H2YA 5D3MA 2JLWA 4CT4B 3AF4A 2QRNA 1BYUA 3HR8A 5FOUA 1GP2A 1C4OA 1I4DD 4UNQA 3KTAA 5DHFA 5TMPA 2C9OA 1Z29A 2JIZA 4YC7A 5LB2A 1MABA 3MJHA 3A1TA 1KSGA 1S96A 3RS4A 1VCMA 2XOKD 3BFVA 4V0LA 1W44A 1AA9A 2VH5R 4UXIA 5FOVA 3LWNA 1G64A 2QM8A 3DOEA 1II9A 3A4MA 2CNWA 1E9BA 1XTIA 1E2IA 1DAIA 1V5WA 1MRSA 4IDQA 2BEJA 1TAGA 1E9DA 2ZJAA 3TQFA 4BZQA 2C8VA 3K0FA 4HLUA 2FG5A 2XSZA 3H1TA 1UKZA 3KB2A 2ODBA 4MKHA 1PZNA 2ORWA 4DLSA 2BBWA 5GJCA 1N6PA 4H9GA 2KSQA 4D80A 5KDOA 4TWZA 1OKKD 4LC0A 1Q1ZA 2A9KA 3HU3A 4LJ6A 2Q9CA 2O52A 2PLRA 4LC1A 3X1XA 3RS0A 2Q0HA 1Q3HA 4IDNA 4A2PA 3K0CC 2GAOA 1WBDA 3WY9A 3OESA 1YVDA 3FVQA 1HT2E 3N2IA 2QMUA 3GLIB 5G41A 4LYAA 3BK7A 2DY1A 5J40A 3CF2A 3E5HA 3FDIA 3PEWA 5KYKA 1H65A 2OSBA 2CVFA 4LJ7A 4WZBE
chains in the Genus database with same CATH superfamily
2P27A 4F71A 4CKZA 3PQEA 4CUKA 4DG5A 1HDYA 1SK9A 3IP8A 4Z6KA 5KMGA 3ANMA 2Q1SA 2RD2A 1IBCA 1XXHB 4LVCA 2QI9C 3MJTA 3CJTA 4YDRA 1Z56C 4JXJA 4DAOA 4OO3A 4BMDA 2CK3A 5FFNA 4HS9A 4G4SP 3MTBA 2IXBA 3WK9A 4F1KA 5LLTA 3H5TA 2OZPA 4RXMA 5KJEA 5JD4A 1N33B 4S35A 1JW9B 1KVSA 3WXMA 2V5VA 4FDAA 2QN3A 1GLVA 5JY1A 3DXZA 1PCXA 4HGYA 2F17A 2PKYX 3BL5A 3C48A 1U7WA 4OQMA 5BMVA 4XPZA 2YTZA 4DMFA 2EW2A 1JX6A 3DVSX 4LOIA 1NLYA 1B74A 4V0MA 3VSCA 1LWOA 5ALFA 4E03A 1WXQA 3VPSA 3H6HA 2J5RA 2FFBA 4RIHA 1J2YA 4W8OA 3ZPXA 4A8JA 1XYGA 2CMGA 2NACA 1V6SA 2AXPA 2WJWA 4FPXA 4QTUB 5HDBB 3RUFA 3V3KA 1DQPA 1EYZA 4HT3B 5A7GA 1E58A 2ZWMA 5GTDA 2R751 2PJZA 4RH1A 3RG8A 3K70C 4Q3AA 3I2FA 5DM70 5HFJA 4R8MA 1MF7A 4PC1A 4FI3F 1IWPB 1F8XA 4TZTA 4XW2A 3R3SA 4ZZ2A 5IVIA 1X7YA 3GLKA 3M33A 2V6IA 4Q4HA 3AB7A 4YAKA 3CEPB 1LW6E 2B1QA 5A4KA 1QGYA 3S81A 1LS6A 4Z2YA 2O07A 5GJWC 3BUSA 2XLCA 1TF7A 4WOPA 5FBZA 4UREA 2IEBA 2BMWA 4Y2TA 1VMEA 1X1EA 2VYND 1FU4A 4H3HB 3WBJA 4F2PA 1RQ7A 1CZNA 1VE9A 1M10A 4DC9A 3PHGA 5HQTA 4TTSA 3EHEA 4LISA 5G1OA 1GILA 2EJWA 3IT2A 4MCAA 1D2NA 3ET4A 2G72A 1P4GA 2GSWA 4K87A 4Q39A 4Z4QA 2SBTA 4HH4A 4UHJA 2BEVA 4Q7JB 4MRAA 3PHLA 3VYTB 1CNMA 4GGOA 1LPAB 3E48A 5DCLA 1UOPA 2V97A 2WHRA 3HEBA 4L5JA 9ATCA 3GK3A 5JXIA 1EX6A 4YECA 2DUNA 4MARA 2PKQO 4LWZA 2VJYA 3N3BC 3RIEA 5D6OA 3C45A 2VZEA 5KYYB 1F8FA 5HTKA 1MNAA 1TMOA 1KY5A 2XE6A 3PL5A 4XOIA 5IBQA 1BD3A 3GLHA 4ZV4A 5B30A 4QX6A 4F9TA 3V8VA 4ZHSA 2NQ8A 2B98A 4DDWA 1KVRA 1USKA 1BG6A 2ECKA 1FP4A 2NIPA 3T0GA 2AOTB 1Q83A 1Z25A 1P31A 2MSKA 4IUYA 2ZGVA 5GQSA 3DMHA 5J5VA 4O63O 1LGYA 2QQEA 2PDAA 2OZEA 3BKWA 2ZLBA 4JZKA 4X7BA 1IM2A 5BWBA 5FRDA 1ZC4A 1UKVY 1HI9A 1KDOA 4RDHA 4F9FA 3RSFA 5CB6A 1RI4A 1XJ0A 1HDGO 1AQJA 1W88B 1GZSA 1PFGA 4FMCB 3BFPA 4UUBA 3UMBA 4YJGA 1B0UA 4Y2VA 1CDEA 4B3IA 1PG0A 2IF2A 4QYTA 1QTQA 2R6FA 1OW3B 2ZXEA 4ALLA 4DIBA 4MEJA 3NRBA 4QSMA 4QKQA 1W9HA 4IR7A 4P3PA 2FU5C 4QREA 4UBKA 2I22A 3KVRA 4GECA 3WKBA 3DE4X 2C84A 2AJBA 3EIEA 4EY6A 3W2FA 2WYIA 4MTLA 1TYZA 1UBUS 4ZKEA 6NULA 5AKZA 1OGYA 2V54A 2OLKA 3R6LA 4ZO9A 3EXFB 1WG8A 4QASA 4TYMA 3DAFA 4FE4A 3P7MA 3BB1A 3PGXA 1VJ0A 4RVHA 2JHCA 1UZUA 2JIZD 5LUBA 3RVQA 1HY3A 4AF8A 3FSJX 4S0ZA 2PNJA 1GQQA 4Z7NB 4NY1A 3U37A 2J31A 1GPDG 1D9ZA 3KOYA 4I8XA 1JKIA 3PICA 4M21A 4ITVA 2C4VA 2JFNA 2WPNA 3N2EA 4Y6OA 1RJEA 3ZZ0A 3PBKA 2WYHA 4HUJA 4WN9A 3HFGA 3TIFA 4XQEA 2FK7A 1G8GA 4XGIA 3QVJA 3SPXA 2J9XB 2I2WA 4RIGA 4FXOA 1YS6A 4LJAA 2NZWA 3H0KA 5IH7A 4TTAA 4Q9IA 5DTIA 2G1PA 3OA0A 4C5BA 1GCGA 3JYQA 2XSZD 1K98A 1QH9A 4WZBA 4FINA 5FO1A 4DMUB 3F4LA 1MRNA 2VK8A 3LQRA 5EXTA 1TEHA 4PR0A 2PU5A 3UZUA 2A94A 5TGDA 1KDVA 3CRNA 2PEZA 3V8RA 1W36B 2CXXA 5YASA 4D8XA 2B4AA 2C20A 1GTZA 3VU9B 4GVLA 5K0LA 1LZKA 3PD1A 5B4TA 1XKQA 1L4GA 2H08A 2PLWA 2VPYA 1RHKA 5SZHB 3DO8A 3ROXA 3I92A 4YYEA 1DO2A 1IOWA 4BYMA 5KOJB 1Z4PX 4CNQA 1IONA 1ND5A 3PYMA 2Z2JA 1AC5A 3L41A 4ND4A 4ENRA 5FLYA 1UFKA 1XZIA 4L4ZA 4X8MA 3OOJA 4IWXA 2SECE 4COOA 1KC3A 3NFYA 1VE6A 3R5HA 4TWJA 4QFCA 3PK0A 1IEXA 1O4WA 1MA3A 3P2KA 4BQSA 2LKDA 2QROA 3QU9A 2HYIC 1C9EA 4GLFA 4EQZA 4RPGA 4XIIA 5FAXA 3V1UA 1SXQA 1GPAA 3FPFA 4MQ6A 1IY9A 4EHKA 1JG1A 1YU6A 2D1SA 3TTSA 2CK3D 1ADJA 4PQRA 1G3MA 1GCAA 1XUOA 3O0DA 3QNMA 5DZSA 3WL4A 2NYAA 4O4LB 1JFVA 4JT2A 1QC5B 1Z62A 3FUUA 3WOHA 2K4MA 2FPXA 3JWPA 3R5SA 4M9XA 3UMFA 3W9BA 2RC6A 2HSWA 3B60A 3KIPA 2I2DA 4GR9A 4BCDA 1Q3TA 3U3DA 3PR3A 4F6CA 2IYLD 5LOVF 1UC9A 1JPUA 2WMDA 2Q4RA 4M0KA 1LK0A 3H83A 4M1WA 2MDTA 3ETHA 3UW1A 5F2OA 3F96A 3UT5A 3MYYA 1A98A 4MITA 1R8SA 4CWAA 4B3GA 3RV3A 3T1HB 1UDXA 2H3EA 2RGAA 3LI2A 4G1CA 4OHOA 3ON5A 3R7DA 3VX3A 1ODCA 5CK4A 4QOHA 3MWJA 3QMWA 2W00A 1EQ2A 3MMXA 3ODGA 4NCJA 5J9FA 4UFPA 1CE8A 3WNZA 3W4IA 1RXEA 5BUSA 4TL8A 4FFRA 1ZUIA 3G02A 5DSXA 1LLUA 4G86A 2CL7X 3DEFA 4YRAA 1N6HA 3UMCA 4J7UA 1A96A 2BMFA 2D6FA 3KC2A 1CQZA 2KLBA 3VI4B 1BA3A 4HGOA 2WRZA 4H4CA 1CDDA 4WZZA 5G0TA 2CLHB 1JTFA 1E2EA 4DRZA 1YAHA 1UZAA 2WU3A 4MA5A 3WL3A 5AM5A 5KNDH 3SXUA 2EVWX 3GA7A 4O02B 1KE1A 3GA5A 4B82A 3TBHA 4XSGA 3V80A 1Y6RA 5BT8A 3EEOA 1Z0ZA 1HLPA 2C29D 2WAYA 5AI8A 1CNEA 4G65A 5EXXA 1K4YA 1UDWA 2C2KA 3EG9A 2D62A 1ADCA 3T4EA 1CZHA 1YKSA 5FUXA 3BE8A 2GPYA 3NIDB 4ZQCB 2GRAA 5EKDA 4CQLB 1IFXA 5I6DA 2BFFB 4BU1A 3FYDA 4IH9A 4TYWA 3GJTA 2FTKE 1HFWA 1HG0A 4D3DA 2EFCB 1X39A 5AM4A 1O95C 1H0SA 1WMEA 2WF5A 4HXFB 1AUQA 5TDHA 3RI3A 4BP1A 3AZQA 3AR6A 2Z6VA 2EV9A 3G1TA 1NPYA 4RH0A 4UBOA 3EOAI 1QGAA 1SUCA 2JZOA 1HE1C 1M2OB 3LXXA 4PEVA 3V97A 1NF3A 2GK3A 5HIMA 4KDCA 3IUYA 4XUEA 2VUTA 2YMLA 4GM0A 5JSHA 5C1OA 4L85A 2WM8A 2QLFA 5GOZA 4JT8A 3MJRA 1WUTA 3WDMA 4MV9A 1Y6FA 1MJ5A 1CJSA 1E63A 1EFDN 3H8VA 4JJAA 4JD5A 4TT3A 3TGWA 4UTOA 4BATA 3NWOA 4NICA 2I4TA 1MP0A 2QWXA 4U9IS 4DLBA 4DHEA 3H2BA 3UCFA 3N6RA 2VHQA 2PN1A 3O2QB 3PGA1 3LK6A 4NOLA 2WV7A 3P0IA 4BAZA 3VI3B 1VB3A 3CLRD 3I62A 5DLEA 3LHDA 1Z28A 3TZHA 2PT6A 1D8TA 3LNTA 4FYYA 4QTYA 5EIFA 4ZJZA 3EDQA 4CMJA 3P19A 1K8YB 1KS2A 1VL1A 3JZFA 4XTRA 1E1DA 2ZSHA 4FD3A 3UXMA 5AQEA 1I4LD 5EVJA 4BO3A 4WNAA 3PNMA 4YVFA 3F6RA 3V8BA 1NVKA 1NATA 1UQUA 3K32A 5K4AA 1UXGA 3SSMA 3W78A 3M89A 5CFQA 4LRTB 5FDFA 2J9GA 4LC9A 4LMRA 2QY6A 5E4JA 5IXJA 3KQWA 3WWDA 2Q2QA 4D25A 2FRDC 2OGTA 2WJZB 5HKKA 1RPZA 1XDBA 5KYWA 2RHTA 1B8UA 1V8FA 2W6QA 5HZHA 2X3FA 1NL3A 1VB5A 2JJ2A 1K7FB 1HT3A 2HCRA 2WSLA 3FFXA 3GDFA 4K9PA 5EJ4A 1D2EA 4GOOD 4OOFA 4DJEC 1JR6A 1IWBB 3TSCA 1VFNA 4N5IX 1FMTA 3GC6A 3D0QA 3TTWA 2PFSA 1TW3A 3P0JA 1WHTA 4YB8A 4ZKDA 2IHNA 3R7LA 1Q0TA 2A92A 4MR7B 4UFOA 3P4YA 1GTMA 1J42A 3KZVA 5LMUB 4OQPA 4UM7A 3VISA 3HB1A 1U1GA 4BFCA 2YYZA 4EW2A 1VKRA 2QI9F 1AH2A 2QRHA 5L3RA 3H2HA 2ORIA 3LLUA 4P32A 1MZPA 4NJMA 4BWVA 3VQTA 1FS4A 1E7MA 2WLSA 1Y8CA 2QRUA 4OGWA 4XDGA 5C81A 1N8NA 1ULTA 4FD2A 4JC0A 1TZBA 1KJ9A 2GASA 4UMFA 1P29A 3BHIA 3TR5A 1BDJA 1ZJJA 2BSQA 2XMQA 4MW2A 2PA0A 3TW0A 4D8VA 3HDHA 4TKMA 2YQZA 5B2EA 4L0DA 1R2QA 5A6VA 3IVCA 3L18A 3CZ4A 4KNVA 2QAGA 1PZHA 1VLHA 4QUDA 3IBTA 4N1AA 4R98A 2EWMA 4IIHA 3IIMA 4IDCA 5BPFA 2QXUA 2P5UA 1CRQA 1PGNA 1EEXB 2YL2A 5BVGA 5LDGA 4CDMA 3OTGA 1G5QA 1NQVA 2C78A 3OO0A 3ZDAA 4UUQA 2VRWA 2G36A 4YMIA 1QQBA 1RSZA 3AUFA 2XWQA 4GKAA 4AMVA 5KTMA 4WQMA 5B64A 2YJ6A 4H1WA 5BWMA 1NDUA 3EK2A 3AJ8A 1U94A 3H2GA 4NAUA 1EWYA 1YQEA 4P4GA 1PJ4A 5AOVA 1YQXA 3V8PA 1XTQA 2DFVA 4E0BA 5CLIA 4AX8A 1SRQA 3ZVNA 4HFNA 2LZ0A 1GJRA 5AVQA 4ZGWA 4E3ZA 4EAAA 1VSVA 2V7QA 3V00A 3G9XA 4W63A 5BNWA 2QPLA 3SQWA 5C31A 5LMCA 4L7QA 2QW1A 1QAQA 5HF5A 2OPBA 1J07A 1T0UA 3HA5A 2VK4A 3JQ9C 5EQDA 3AVPA 3IDZA 3UAVA 4H6WA 1QVVA 3JQPA 4KXMA 3ELUA 3PF8A 4WRRA 2AEJA 2ZBQA 5CPBA 1HC7A 3DZGA 3QLVA 2UVQA 1LPBB 2QQGA 2WC1A 2WPDA 5ALHA 1Q3KA 1X1SA 2GYYA 3KQVA 4JI6B 4FEAA 4DA7A 3RJTA 5AW5A 3AHGA 4NIMA 3P1JA 3T9CA 4DR7B 1SCBA 3C3WA 3EDRA 3FF4A 3IP5A 3HKEA 2IITA 4GEKA 1VIYA 1LD3A 5F2EA 1HR0B 2D13A 3GH1A 3H05A 3AZOA 2X2PA 1N5MA 1POWA 1AZWA 2AZ4A 3FVRA 4EZIA 5BUZA 1K5HA 1RLIA 1U9YA 1JIQA 1N2EA 1ZHHA 3AIOA 1ESDA 3FZGA 2NG1A 4KNWA 4HH3C 1T36A 3HCBA 2C7PA 1BFKA 1MG5A 2H59A 1IB0A 2CZCA 3TEJA 2A2ZA 5E3IA 3C7CB 1G6OA 3R40A 1GA1A 5BWLA 2ZBVA 1RZVA 5IRCD 1GGNA 3F8WA 5COBA 2Q21A 1PJ8A 1RFGE 2DFNA 1OC4A 1ZIOA 3OQVA 3SR4A 5EPOA 1S8NA 4LMAA 3P52A 4Q15A 3T9EA 2J0SA 1SWVA 2ZIXB 3HJRA 4I3FA 4RLSA 3R7NA 3D43A 5HZGA 4MQFA 2A9OA 1MB9A 5AIAA 2RIPA 4MQLA 3I76A 3AOEA 4I55B 1CY2A 1NX9A 2HRBA 3I52A 4XWOA 4WKOA 1HOTA 1EJ2A 2HK6A 4Q9DA 1EK0A 2QUZA 2HMUA 4WKGA 3F4BA 1KBOA 1Q74A 4DS3A 2Y0PA 1KXJA 3LFUA 4XWTA 3FHLA 4LXHA 4M99A 4AKEA 2X0IA 1KO4A 5IKMA 1T3TA 4L6IA 4MTCA 4MV4A 3TB6A 3UFXA 1TZJA 4OKNA 4TT3D 3OT1B 4KW7A 1Z15A 4QYXA 5JBQA 2H7YA 3U56A 4AZWA 1P9WA 5KVVA 1HV8A 4QXRA 1TCVA 4NV1A 4F96A 1O8BA 1INLA 1JU9A 3CLUC 1DUVG 3BWXA 4Y1FA 1QQ6A 2O3JA 2NUAB 3TE7A 4HNAA 1IHUA 2OB2A 3T95A 3H04A 2PBLA 5I01A 4FS8A 1E9CA 3NATA 1G41A 4WY2A 3QEKA 4BZZA 5JHHB 1NPDA 3A9TA 2HLHA 1E94E 4CUJA 5BOSB 5FB3A 1U0GA 3D8RA 1NUPA 5EIOA 2IS2A 2DFLA 1NBEA 1GSIA 1JSLA 2YWJA 2PANA 5A03A 4H35A 4UEQA 3AFHA 2NZ2A 5GP1A 3WG9A 3AEYA 1P0PA 4G3XA 3OQJA 2P30A 1CPYA 1EQAA 1MV8A 1NW6A 2R7LA 3KXPA 5HKKD 2UKDA 4R9SA 4KE8A 2Q9UA 3QOYA 2FZGA 5CDHA 2R9VA 5FTWA 3TNLA 5KTSA 5LQAA 3AO0B 5J1SB 3PC8C 3HBLA 3U49A 2JJ2D 1I13A 3DEHA 2RHHA 1NQUA 2JIBA 4D9BA 2HQ1A 1ZK1A 3GHHA 3W7BA 1YZKA 1EVLA 4IGAA 1XCGB 3G7NA 1NAIA 4XAQA 4RLHA 2VSYA 2XUFA 3AK4A 1L7XA 2AN5A 2B6NA 3I5AA 1IXRC 4EFDA 2YJNA 3H1EA 2ZRFA 3B1JA 4NBWA 4RTOA 1GTRA 1YV9A 4DCJA 3UQYS 4MUHA 4RESA 2BFNA 1DQZA 5ALNA 1LJUA 4OQNA 3DV0B 4QFMA 5F12A 3ZDQA 3A9CA 1G55A 4ZVPA 1MX9A 4J4HA 1V7PC 3NV9A 5KNCH 2QDXA 1PGPA 2H2GA 3A4TA 1LTKA 1X87A 4WXRA 4Y2UA 1GVNB 2WMNB 1T4BA 2INGX 2W6OA 1QIFA 1IQPA 1U0NA 1ZLYA 2VPPA 3O3NB 4HN2A 4YJFB 2OESA 4WD3A 1DVRA 3T54A 1I7SB 1EEHA 1BU5A 1SELA 3KR0A 4CPDA 1RXCA 2B34A 1WO8A 3H9JA 2JKVA 3WNVA 5BQ3A 4OXIA 1W49A 3RABA 5CIQA 1G3QA 4RJ2A 1ST3A 4RNCA 5C8YB 1Q7GA 1ZW6A 2VRBA 3A32A 3B89A 4HWRA 3P0FA 3ENZA 5TC4A 5C5DA 3TZLA 2VWPA 4CDNA 2H0RA 4CMCA 3K0AA 4HB0A 4HDRB 1WUHS 2V1UA 5IKPA 4HGNA 3E61A 5AW1A 2XNSA 2XEDA 1QJ4A 3TZ6A 3ENQA 4JLPA 4KODA 4I6JA 3TR0A 1AQYA 3UHFA 1RPTA 4FGZA 1AKWA 4PZDA 4K2AA 1UJ4A 4BFSA 3IR6A 5EKUA 2PL5A 4RZUA 3OT4A 5F76A 4BZWA 4U0KA 1A4UA 2R6GA 2VNKA 2O5VA 1XNRB 2R62A 4JR2A 4URHA 3UBMA 3WLOA 2FEPA 1X0XA 2NSDA 4YUWA 2O9JA 5LOVA 3AUUA 5FTJA 2ZXUA 5E95A 3UN1A 2V7QD 3IUPA 2LW7A 1QG0A 2XW6A 3LA8A 5DDIP 5EMKA 1HE3A 3RIMA 4UM9B 2E21A 3KSAC 3T1YB 4KQEA 1QK5A 3WE7A 3JATA 1V8PA 4X0EA 4I50F 5TF4A 4Q4DA 2PPVA 2WUWE 4QQNA 5G1PA 5K3FB 2AX4A 1V1RB 1GAWA 3PJFA 5EGSA 2A88A 3A1NA 3IEKA 4RS3A 3U44A 1PVOA 1UBLS 2G80A 3E8XA 5EQTA 1W2GA 2Q27A 3NM5A 5I5EA 2WPDD 2RB5A 4M1MA 4YP7A 2VJLA 2B5WA 3ETEA 3GDWA 4OH1A 1JG6A 2GPAA 4P86A 4UBMA 1SBQA 1XHLA 4PX9A 1B42A 1M6WA 3LBFA 4M4SA 4YP6A 5K2OA 2PSFA 1EJ6A 2O5EA 4CCWA 5FI3A 3I0NA 3WDLA 3RW9A 4ESOA 4MP3A 2CFSA 3OJWA 2ZITA 5EJAA 3CF4A 4MO9A 4G1VA 2QD5A 3K8ZA 2IDJA 4RGVA 4ZREA 1ZZEA 1ZPDA 4PF1A 2C5SA 4GUAA 1WCV1 5CH5A 4CBVA 4RPLA 1N9KA 2IEDA 2QPOA 1IZ8A 1CY8A 3P9XA 5EESA 5CDUA 3LKVA 4JP3A 1R8QA 1Q1AA 3IODA 5DW3A 2ZRDA 3KAQA 3IDFA 4AKGA 5G2OA 3EE6A 4ME6A 4YREA 3RSLA 1DJNA 2Q5LA 1V3VA 1X15A 3DMTC 1A8SA 1V43A 4PINA 3TLKA 2FEXA 3E9DA 1I2AA 1LZLA 3PRKE 4P33A 5TT1A 5F7OA 1DRJA 4LVNA 3ENNA 4O2RA 5JASA 3KQYA 1EGMB 5KYXA 3CJQA 1QMPA 4R01A 4CEIA 3LHFA 4QPJC 1CB0A 3QBDA 3KLBA 3LQ2A 4BFYA 1MH1A 3RUPA 1N0VC 7REQA 1H4SA 1U8TA 4RLFA 2O8CA 1EXWA 1OLXA 3G2PA 2LBPA 4ES6A 4J0JA 2ZUEA 3URMA 4C01A 4W4TA 3K09C 2WNHA 2MMGA 4WAUA 1U9IC 2JCBA 2QQ0A 3PDCA 1F14A 4ZAVA 4GP9A 3HYRA 3FNHA 4WXMA 1YMUA 3SCZA 5CBPB 2JLCA 4Y6LA 4D26A 3ZU5A 2RHMA 2P9CA 1WWKA 5IN5A 5K3EA 1LDEA 3FE2A 3CLHA 4O8CA 3HVRA 1JU4A 3PENA 3O90A 3B1XA 2VDMB 4AYWA 3JYOA 1VL8A 2I54A 1PFYA 2PE5A 1G16A 3B8HA 2R8PA 5U4QA 4N18A 4DUYB 4M7PA 5JNWA 4Q3OA 2LPMA 3W0LB 4FBMA 2WI8A 1LFDB 3DKIA 2NO1A 1ZG3A 3OBIA 3S5UA 2VQEB 3NLLA 1ELOA 2X22A 2YWCA 1EZ1A 3F7TA 3GJ0A 1GQRA 1SZCA 3BHJA 4PW0A 1SUPA 1BNCA 2IU6A 3BXEA 1AMNA 4W9MC 2E1RA 3HCPA 2BTEA 2JGRA 3DLBA 3V1LA 2I5PO 2PH3A 3D8UA 1D1QA 4PSAA 1KH2A 3LP6A 1G5PA 4AJEA 1R6TA 2AZMA 1KZYC 1OAOC 3HNOA 4HGZA 1XRQA 4LQLA 3T12A 3VMFA 1E1RD 3F2IA 5GAJA 5FEMA 1RCTE 2R84A 1RYHA 1PK8A 3QTTA 2BCEA 2GCOB 5E7MA 3RVKA 5CM8B 1IY1A 1JV2B 3SQLA 4LMBA 5AO9A 2R1TA 4MW5A 3LOQA 1F8UA 1D07A 1NW7A 1ZU5A 1V8DA 4AJ4A 3PC3A 1KI8A 2P8SA 4Y67A 4BOYA 3W6OA 1EHIA 4IY1A 5HBRA 1M7GA 5A4FS 2QUAA 4K9NA 5HKAA 1OX6A 3NHWA 3NONA 3PCTA 4GO1A 1T4CA 4MA4A 5TVKA 1IOZA 1XN1A 1ZUWA 2D5BA 1B14A 3UM9A 3KSBC 4L4UA 3KQLA 5M34A 3IP9A 3W5IA 3V4PB 3BE4A 4BIIA 1JEYB 1PAUA 1UOQA 3FNQA 4TXLA 4DYHA 1ODJA 3L82B 3THYA 2OT3B 5CXSA 1N6KA 3REOA 4L8WB 4FOOA 1UOOA 4I2NA 2O7VA 3TL3A 1HE2A 1Y4UA 3QBJA 1TQ8A 4PTYA 2A0UA 4KMSA 1O4VA 2JS7A 1DMRA 3R1IA 2GF9A 4CMHA 1DWOA 2FMXA 5B2FA 3OIDA 4ISBA 2REQA 3PFWO 2XVXA 3H3FA 5IDYA 4LJLA 5AW0A 1N36B 3GEHA 4ZVUA 4ZRNA 4G4JA 4OQDA 2X4DA 4QDJA 1ZK3A 4OLBA 3S28A 2WWWA 5HKBA 4MMYB 2J6BA 1MAVA 1TYEB 2Z2KA 1PT9A 4Z8XA 1Z7WA 1X7XB 2QTVA 3FB4A 4TMVA 1LKZA 3LKZA 5PNTA 4D6YA 4G23A 4XASA 5JZSA 1XTBA 3D4IA 3WHIA 3NM6B 3F5DA 4HGPA 1SU4A 4NU0A 4CM4A 3O8QB 2EHJA 1FZTA 2DQ4A 3NHKA 2CXUA 3IX7A 4KOEC 1XRNA 4OHRA 1XU4A 5KU1A 2JD1A 1KMQA 1HUQA 3FTCA 2D1YA 2OCLA 1MIOA 3BWCA 4QO8A 3KJHA 2VJMA 1W85B 4PSKA 3VNAA 3WFZA 2L69A 2QLMA 5FWNA 4Z3DA 4AJ9A 1XPJA 3A2LA 3HACA 4K9MA 3JQAA 2VP9A 3VR4H 1GQFA 2HV9A 4COKA 4M9UA 1NPTO 4JT9A 3ZD9A 1W29A 3NJRA 4QDKA 3T7SA 1GL7A 3TDKA 2A14A 1CUWA 1JF8A 4HDCA 2EYUA 2FPUA 3MW8A 4A8HA 5CA1B 2V3CC 1GKKA 2X5XA 3AXTA 1IQ0A 3FYTA 3HYNA 4JS0A 4D5EA 3CEHA 1AN0A 3TX2A 3V6MA 3MUEA 4BEBA 2F90A 3O4VA 5KJCA 3EIWA 1TMGE 1FNDA 1SUDA 2G5PA 3FCEA 5JPCA 2ZYDA 4Q7LA 1HM5A 3AX6A 4EA6A 4AQDA 1L4FA 4ZJPA 3B5JA 3EDYA 1FTGA 1PFWA 1U1FA 1Z13A 4AULA 4RTSA 1I0LA 1JAHA 1XYVA 2XZTA 2ZSBA 3G8BA 4D9IA 3CQ9A 4EO4A 2VJPA 2EAUA 3K9NA 3N0WA 3HP7A 1M8KA 4GBGA 1II8B 1DADA 1LPPA 3C87A 3G0DA 3NC0C 4LDNA 1LU9A 4FZ5A 3DE6X 4D57A 1B93A 1S2DA 2BE7A 4QU5A 5IZCC 2WU4A 2QSUA 3IV7A 3LV8A 3HEAA 2ZKLA 3NOVA 4ZOCA 2FCRA 3CPHA 3PU6A 5K99A 3CBGA 2ZWOA 3F5MA 1Q15A 5EMLA 4I0WB 1UJMA 3HCOA 4FW8A 3H4TA 4OMUA 1KDZA 1OT3A 1TKAA 2X14A 4DMCA 1NNLA 3ROEA 1ZJYA 3WI7A 5GZ1A 1TZCA 3GRCA 3NOOA 1NXQA 4NBVA 2FSSA 5BXYA 5JXWA 3B9RA 2QP4A 4KXFB 3UGKA 3WJ1A 4J49A 3B7GA 2XHZA 3H8WA 1DAKA 4G84A 4NZMA 4YRSA 4GR5A 3SM9A 3C85A 3CE6A 3MWEB 4A03A 2HU5A 4AF7A 1XPOA 3SG0A 2MIIA 3PDIB 2B5OA 5F1YA 1Z35A 4EUKA 1NC1A 2GTIA 3GCZA 3ZQ4A 1E98A 5AIBA 3BTVA 4N0DA 1DPFA 1Z6XA 2JW5A 2X41A 4O0MA 5T4HA 3EA0A 3ZWMA 1RHUA 4PHCA 3RK4A 4AUKA 1WF6A 3S1SA 2HLDA 5AVXA 3N8KA 4DAEA 3NXSA 2RI0A 3LCCA 1CF2O 1KU0A 3GRRA 4DLYA 1ESZA 1YB1A 3K9CA 3HYCA 4OB7A 3MTIA 3FVVA 1DG9A 2Y77A 3MILA 1DBVO 1EA7A 4PCVA 4UM8B 5CNJA 1HURA 4ANFA 3QXGA 2J3DA 1RCFA 1YDWA 4CM3A 2AJDA 4EY3A 4BX9A 4R71A 3R7FA 4MUYA 4R1TA 2XA2A 3EUEA 1K6EA 1SMKA 1WMDA 3VDNB 1UMKA 4CU2A 4P7KA 2Z2IA 5C4IA 3QF4B 5FWYA 5CVTA 5BNFA 5IMBA 4GRDA 4PIVA 2HQRA 4EQ6A 2WKRA 3E82A 4RSRA 2CDCA 5JQWA 1AMOA 1R74A 4B7UA 4DLNA 2DZDA 4DKJA 2ZUCA 1O96A 2CLSA 1R9JA 3OE5A 3LC2O 4NWIA 1Z0DA 4ARSA 2ZXFA 1LSSA 3KQKA 1TK3A 4JHXA 1U28C 4BV2A 3V7WA 1XB2A 1V2HE 1ZI9A 1UEIA 5H02A 3MEQA 1K6IA 1LC0A 1LWNA 1E7RA 1YSCA 2PO5A 2PTGA 3KPVA 4H1TA 2SKEA 4BFVA 4OHYA 2GNOA 1TPYA 2GJ4A 2I8CA 3IQIX 4REOA 4XE5A 1IHYA 2ON6A 3LQFA 1XD8A 2G4LA 3JVIA 3N2ZB 4KWTA 5AUQA 1KBQA 4EF6A 3FX2A 4XX0B 1L8LA 2CXNA 4D6XA 4JSYA 4RF2A 2PGIA 2KBEA 4NFSA 5HOEA 2VP2A 1RE0A 3QM1A 4U02A 5INTA 4OKSA 3ZLUA 2VQFB 5ERGB 2Q6IA 3BULA 5FADA 3EAGA 4KBGA 4M0FA 1L5GB 4LV6A 3CKYA 4KH0A 1RRVA 4NPCA 3VO1A 4O08A 3CNEA 2H5JA 2WJPA 5FD8A 1OLSB 2G17A 5DNCA 3G8YA 3NHAA 5FPSA 2YVAA 1ANKA 2J9FA 3HM2A 3AUTA 4QTZA 1IJBA 4YDHB 1KKUA 4QVIA 2GETA 2R6CA 1A8PA 2RCYA 3RVSA 4JBLA 4W5RA 5EWMB 2HOQA 4RCYA 5CDGA 4QUGA 1JNXX 3VYRB 3FNIA 4IJQA 4LA4A 5LPNA 3K70D 2Z8ZA 4Z54A 1E32A 5DGIA 5EQFA 5J2TB 2ZREA 2BFDB 1NSTA 3IQDB 3PHBE 2Z3WA 2J6HA 3MCZA 3JWIA 2VK2A 2FW6A 2VA8A 3JQCA 2I67A 2P1DA 4L0MA 4QJ4A 5ALLA 3WLIA 4LX0A 4LDAA 3U1VA 2GM5A 1IBKB 3TQCA 3QU2A 4X8LA 2GD2A 2F8SA 1MO3A 2WZQA 2PQMA 3M9WA 4KBFA 4U7JA 2C0QA 3IMGA 3Q72A 4R8SA 4TTJA 1HNZB 4RDCA 4C06A 3EGXA 4LN1A 5KX5F 1BVHA 1QGED 1YBAA 4E5KA 4FOTA 2A1TS 1YJBA 2YVKA 3GEPA 1SVSA 2X4IA 1AGRA 1HDIA 1PT7A 1QZUA 2ZATA 4Q47A 1F7UA 1BGXT 2CXHA 2FLVA 4UCWA 3JQAD 3HRIA 2YXBA 1DBQA 2XE7A 4H7KA 4X94A 3RVNA 3FLEA 4F72A 1NVMB 1SURA 2Z57A 2OLJA 3RRXA 1PFQA 4WKNA 1FSPA 1O95A 1YJCA 2ZTMA 3KKNA 3NBMA 5JDCC 2I76A 2DM6A 2PMDA 3BWEA 3N5CA 2D5CA 1QVAA 3UAXA 3KKLA 4M22A 3VJMA 1SQSA 3FCOA 1I9GA 4XYMA 5B3KA 1JEQA 3M34A 1XQ1A 2I29A 3T9BA 2XEXA 4K9KA 5DEIA 4P31A 1NUUA 3NHLA 3T3DA 3WZLA 3DLTA 5IUKC 2OFFA 4CFZA 5CT4A 1P1KA 1NV8A 3PF9A 4GZMA 4EHLA 4QLAA 4RKQA 5T8KA 3SEZA 4IPTA 2CNOA 1E8MA 1SNYA 2RG1A 4F56A 4BFWA 2HK7A 1M34A 3U7IA 1TQ4A 3UJBA 1ZGZA 4P4NA 3ZXYA 4W7HA 1GL3A 3UHOA 1RIIA 1ISMA 2WABA 3DOUA 5CX1B 4V03A 3O1HB 1TRHA 5ILGA 4NCBA 4U39A 2X5NA 4UC0A 2HNBA 4EMBA 4JT4A 4EHFA 3MQFA 1KFJB 3SX0A 3G9QA 1Q21A 3CY6A 4WNIA 1IEWA 4MCIA 4BO5A 2Z5FA 4DIUA 1X2EA 2R1VA 1FW6A 3M4JA 1GTVA 5GVSA 2OBYA 3TLGB 1KY2A 5AICA 5KJFA 1WQ4A 2JBWA 3EOZA 3I2IA 3INYA 4P4UA 3ORFA 3MERA 3FMGA 4JUDX 2FRDA 3EIUA 1N2XA 2B7CA 2GS9A 2VP4A 1M2KA 2RHGB 1CKEA 2PL3A 4RKEA 4XLTA 1C81A 2MYUA 2F64A 3FNBA 2GN2A 2OORA 4D45A 3VHRA 4WIAA 2WU0A 1PLLA 3PPVA 1V9SA 3DEYX 5KNLA 1PJTA 1E77A 1G2IA 4QT4A 1BWQA 2FZKA 3FJ1A 3ZWKA 5AHRA 5E6SB 5ETJA 2YY7A 3SMVA 4HJRA 1IK6A 3WBKA 3RVJA 4B5LA 5TSDA 2F55A 4G5YA 4I5GA 1Y9DA 2DEUA 2BZSA 4TS9A 4EABA 2XAAA 3FMVA 1BU8A 3P2IA 4EVRA 1KFCB 1RKQA 1TKCA 5DNAA 4ZYUA 1L1RA 3B36A 1PS8A 1KH3A 1YRHA 5JC1A 1I3MA 4EPXA 3PYLA 1CRPA 1YB5A 3IXLA 4D5GA 3KFVA 1YUBA 4JL5A 2H1OA 1UMDB 4WACA 1ZU4A 3SDBA 2GPTA 1CY7A 2ZBDA 3A1EA 3OCVA 1S01A 1JL3A 2MYPA 2ZTUA 3MG9A 1K89A 2GNAA 2ZBEA 1X0VA 3N2GA 2OO3A 3GDOA 4HYTA 1V39A 5AUPB 2VQ3A 1SIUA 2J5KA 4YUXA 2FX5A 1CJVC 4QWWA 3WTCA 1F8YA 5F2NA 3NVKI 4HWPA 1YFKA 5FFMA 3GNLA 3Q7RA 1ZP6A 3ZHTA 1QZZA 3QFSA 2IJGX 4AJIA 5K3AA 3ZOKA 2UUPA 2X2OA 3C8DA 3ONEA 1Q0UA 4L5CA 4DV4B 1E7QA 4N01A 4FWTA 2WJGA 5KNBA 2FWNA 1S2OA 1Z6YA 2ERXA 1TM4E 2D1RA 4RY2A 5D5PA 5PGMA 1M7BA 4FDTA 3V4LA 4RIIA 3KZXA 5EJFA 4X20B 4C22A 4EEXA 2BM0A 1FNNA 3L4EA 4Q16A 3KSDO 5AK5A 2Q5HA 4NXMB 4YQFA 3WKDA 1K97A 3H2JA 4X60A 3UJ8A 3BF8A 4EKIA 3WGLA 2IE0A 2QU8A 1K7YA 4RX1A 4WK0B 3Q0EA 5FA6A 2JL1A 4AM8A 5EXEA 1SHKA 2WHQA 4RHCA 3W90A 4CKYA 4RZ3A 1N9GB 3V6LA 5JMTA 4E88A 2V7GA 3MUFA 1SCUB 3C3DA 1SPXA 1VIMA 1CQPA 3NRJA 4JYBA 2GEDA 3UAGA 1X80B 1JQAA 1E1CA 2VH1A 4EUEA 3MINB 3GGCA 3JD3A 3HBNA 3QVVA 1VYUA 2L17A 4J0QA 4K0RA 1PSWA 4O4IF 3SIXA 1WPRA 3CN7A 4M0LA 1WXHA 3PLAE 1FYFA 3TKLA 1CDOA 2NXEA 3NIWA 2WJAA 3LL4A 4QGHA 4CYMA 5K8CA 2PUDA 1BVRA 2AG0A 2E37A 2EW8A 2NX2A 2GZHA 1C3OA 1E9AA 3ANNA 1Z45A 2NUPA 2D1QA 2FPPA 4GI5A 1YCHA 2WVGA 1J56A 4EO9A 4EKYA 3ONWA 1S89A 4JFRA 3DBLB 1JFFB 1DC4A 2C2XA 2QTTA 5JANA 1KYWA 2RK4A 5JAZA 2WDZA 3B20A 4ZEWA 4EARA 1P2SA 1N3YA 4MHSA 4TKUB 2NZJA 4V1CI 1T2UA 1B76A 2JDIA 1I1OA 3NTLA 4LHEA 4LRWA 3BTUA 4KPFC 1DTWB 4E30A