4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
2C2HA 1JQJC 5B64A 1Q20A 4Z51A 2FG5A 1IN4A 3GFOA 4L9WA 2PT5A 3QIAA 4Q1CA 4EQ6A 1YR8A 4C0AC 1E96A 2CE2X 3KJEA 4NYMR 4BFSA 4MGYR 4F93B 4A2QA 5H8WA 5FOVA 3A1SA 4JLPA 5DSZA 3LW7A 4Q48A 4C2TA 1VHTA 3NC0C 3QXJA 1XEXA 3C15C 1SVMA 3HR8A 3QPVA 2Q21A 2VH5R 2WJHA 2O8CA 2IK8A 2ZSBA 5F2EA 5KHOC 3RS4A 3LVRE 1JPNA 4RCYA 3Q7QA 2ZJAA 1NVXQ 3FTQA 3AF0A 2QAGB 4KYIB 5C4GB 1XD8A 3C5CA 2OLKA 1P5ZB 3NXSA 5FI1B 1Z0IA 2QAGC 4YONB 2IWHA 1E94E 2P6NA 3GLGB 4MYTA 1TL7C 1GG2A 1RC8A 2IW3A 3OIYA 3Q5EA 2I3BA 3BH6A 4QJ4A 4ZPXA 4IDQA 3I62A 1EX6A 1OIVA 2F9MA 3B9QA 2WPDD 3C8UA 1AN0A 2V1XA 1AS2A 4B48A 1KDTA 1DAMA 1PLKA 2J41A 2LKDA 2ZITA 2JLWA 1CR0A 3ZD7A 2ZRPA 3JVVA 3C41J 3K9GA 1B0UA 2ZI4A 4KJZA 5FOTA 1Z0FA 1E1RD 3PUWA 4Z1MD 2ZYWX 1ZM2A 1MO6A 3TSWA 2VF8A 3BERA 3X1DA 4DB2A 2BIFA 3FKSD 1OFTA 4F92B 3BB3A 4TMZA 1RKBA 1F5NA 4AC9A 1SHZA 3X1WA 3QVUA 4EJSB 5KSOA 2VHCA 2O0JA 3R9IA 2FDCA 5DH9A 3D7MA 2H18A 2BKUA 3RLFA 1WQ1R 4Q7KA 2D2FA 2ORWA 4P4SA 4D4JA 4QBFA 3LXXA 5SZHB 3B13B 3VAAA 1G8HA 1IN7A 1E2PA 3VU9A 4Z54A 4GNKA 1HY3A 1G6OA 1CR2A 4XTRA 3W8NA 5JRJA 1II8A 1E2LA 3KKQA 4I1OA 3FOZA 4M1OA 1UEIA 2ZRLA 2PEZA 5E7JA 3QF4B 2GF9A 2QROA 4IDOA 2P6UA 1DG1G 3P27A 4I1SA 2XXAB 3K9LA 1N2CE 5DO9A 4KV9A 2FFBA 4PO9A 3ASZA 4O3MA 2NG1A 3V00A 3VNVA 4QM6A 4IDPA 2GXUA 4MYHA 4BFXA 3GJ0A 1ESMA 1JJVA 2J0UA 1NIPA 4NYMQ 1KI6B 1VCNA 1ZRHA 2WJYA 4A92A 3LLUA 3ADCA 5LD2C 1CXZA 1IBRA 1JI0A 2FGKA 2OAP1 3X1XA 4Z8YA 1S1CA 3TUZC 3EC1A 4B47A 2IYQA 1KZGB 4LGMA 3T12A 1LFDB 4OYHA 3RS5A 4DCTA 4A82A 3U6BA 2BEKA 4Q9JA 2KI5A 4RD0A 3RS7A 3HWSA 3NHAA 4ZDWA 3KQNA 5F3WB 4PSVA 4NL4H 1CJUC 5B2ZA 1T91A 4RY2A 3B7GA 4EJSC 4TMTA 5L3VA 2WM9B 3RS3A 3X1YA 5BN5A 1KI1A 4US2R 4Q19A 4C2UA 2G83A 4Q4LA 1U8YA 4UJ5A 4CYMA 2ZEJA 1WBBA 1RVDA 2W00A 3PUVA 4K46A 2EWWA 4LY6A 1Q1BA 2IUTA 2UZIR 2P65A 4C4PA 2UZ3A 4Q4AA 5C18A 1ZD8A 2OV2A 3RS2A 1VYTA 2C9OA 2JJ2D 2MSCB 4J0QA 1II8B 1T0JB 1MR3F 4Q47A 2PLRA 3WXMA 3LA6A 1P2TA 3AB3A 4FWTA 2HJVA 1OH5A 3I1FA 3RRZA 1MV5A 1I2MA 1OIXA 5G3ZA 3AUXA 2YC2C 2ZRNA 2P5SA 3OF5A 3NBZC 4GP6A 4UNQA 3NIBA 4EFLA 2DR3A 1E98A 5FH9A 2XGJA 5DIFA 2WPDA 4A0GA 5CB8A 4PPNA 5EQTA 1IJFA 4FD2A 3SC3A 1UKZA 2XZLA 3NTUA 4D26A 1GKIA 2ZE5A 3U5ZB 4TZ6A 5EUQB 2QSYA 2QZ4A 2ZYUX 4DIEA 2BMFA 4YDHB 2QP3A 3GLFA 3AVWA 4Q4JB 3W6OA 2IF2A 2DYKA 4Q4HB 1H8HA 2NO9A 1S1MA 2C95A 1JAIA 3NHBA 1XTQA 3D6TB 3CO5A 3BGWA 2REOA 2JLUA 3THYA 4BLOA 4CEHB 3UANA 4Q4HA 1LVGA 2ECKA 2JLSA 4F38A 1V43A 1KAOA 2Q3HA 1AQUA 2NPFA 4Q9IA 1FNNA 2D3WA 2PX0A 3QEJA 5KSZA 3HR7A 2A5GA 2ORVA 4D82A 1UKVY 1MO4A 4DCUA 2YWGA 3KJHA 5GVSA 2XAUA 5CM8B 1TX4B 3NVAA 2DWPA 1KO4A 4LPSA 4CRWB 1KMQA 3AH8A 2IUUA 2Z0MA 5DYIA 4DT1B 4TL9A 4B74A 1EX7A 3DO6A 1PV4A 3B1ZA 1Z83A 1E2NA 4MKGA 3R7WB 4MDEA 3WNDA 1FL9A 2R8RA 2IA5A 3TLXA 1L4UA 1G8GA 4BFWA 1NLZA 3CONA 1XPOA 3MWJA 1XX6A 4ZIRB 1QHYA 2RH5A 2GESA 1A82A 4WVFA 4B3CA 3OEED 1VG8A 1OHHA 3T1OA 4DXAA 5EXPA 4W9MC 1B23P 2AWNA 3CZQA 1Z47A 3VX4A 1E0AA 3UKDA 3IUYA 3U3OA 1QBKC 2LKCA 2A5FA 1KI4A 2ZUBA 2OBLA 3WRXC 1LB1B 4A9AA 1RRFA 4C0QC 1E9FA 1YRAA 2OEPA 3SYNA 2AK2A 2KSQA 4MUBA 3U4QB 2RKOA 2GETA 3IIKA 4LJ8A 3VHXA 1G21E 4CEJA 4IOLA 3FE2A 4HLUA 1CJKC 1N6NA 1NMXA 3KKPA 5G3YA 1Q1EA 2VHJA 5JECA 1KK2A 1XXHE 2GEUA 4ON9A 3LFUA 4CEIB 3TRFA 4JLDA 1DOAA 4IHQA 1Z0KA 1DAGA 3ZJYA 4NCHA 4CF7A 4PC7A 3I5YA 4WBSA 1U94A 2JGNA 1T3LA 1RIFA 3MRSA 3FMPB 3VHLB 1XZQA 1VDZA 4XJXA 4AYXA 4I1UA 1KJZA 1R5NA 1E2JA 1EGAA 4TMVA 1KI6A 1G1MA 2W6JD 4M4SA 2QPOA 1MH1A 1M2OB 2FSIA 2JJ1A 2VIIA 3TVTA 4DUGA 1XTRA 2GJ9A 5C2JB 1GNPA 2QP9X 5FBLB 4ARZA 4MRRA 3B6EA 4PR0A 4G5OA 4MGZR 4ZO4A 3PIRA 1WA5A 2CBZA 3QE0A 1G8FA 1YZLA 2FX3A 3EPHA 1X8LA 1T5IA 4YMWA 2NTYC 4TL8A 2WKQA 1S8FA 1IY1A 3KXLA 2QUZA 4C7OB 4JLJA 5FBQB 3CR8A 4HLUC 2P3SA 3S1AB 1N0VC 4IEEA 4WZBE 3DZDA 2BJVA 4UNSA 3MCAA 3MG9A 4NHOA 4JVMA 3BWDD 3RYTC 2A30A 2VLIA 4NE2A 3MWYW 3P32A 4GT1A 4H1UA 2VQSA 1TEXA 2FFHA 3SBDA 1S9HA 3C5HA 5FUWA 2ZJOA 2NO1A 3A4MA 3QG5A 2VTKA 4V0ME 2BOVA 1GAJA 4DLUA 3GJ8A 5CIWA 3BOSA 2XEXA 3BAFA 1ZC3A 5EXSA 2CHQA 1E99A 2O8BA 1XEWY 2AD1A 5J4LA 2RGNC 5BWMA 3TAHA 2DB3A 4AD8A 3WHLA 2JA1A 4NCKA 1T0HB 1D6JA 3AKYA 1ZD9A 4QKQA 3HU1A 2Z6VA 1U8AA 3GPLA 3I92A 3U7FB 2CLDX 2HLDA 1YZTA 4M1KA 3ZIAA 1GVNB 2GWHA 2FZLA 2WWIA 3BIFA 3H84A 3QBVA 4LHWA 4DBLC 2Q3FA 3MFYA 1OKKD 5A0FA 4ARZB 3SI7A 3Q7PA 3I8SA 4HB3A 2CCJA 3GJ4A 5E4FA 4WAUA 3PFIA 2GJSA 5D3MA 3GLGA 1JXOA 1LF0A 1OLOA 1RYHA 1UF9A 2EFHB 1V5WA 4WA7A 2QG6A 2OLJA 5DE3A 2E9SA 4F4IA 2R65A 1COWA 3TVDA 5EUMA 1KNXA 3R8CA 2DFTA 1Q22A 2X2FA 1AJEA 4JVSB 1PLLA 2R62A 2OUKA 2XJ9A 3CH5A 2AKYA 1P9WA 4PC1A 4GOKA 1NP6A 2OXRA 4MKFA 4B71A 4DDUA 4AYTA 1SKYE 4ITRC 1GM5A 5J4YA 3N70A 3PEYA 3PENA 1HUQA 1KIMA 3HDTA 5EZ6B 1TMKA 3NEYA 4PTLA 4OJQA 1P60A 2B21A 2ZRKA 3UXMA 1S3SA 4ZI2A 1GOTA 1SVOA 2JDID 3H2YA 4CDGA 3M4YA 1OFIA 3NBFA 1DPFA 2ANCA 4EPVA 5ANRB 2ONJA 1OE0A 3P4XA 1AS3A 3AUYA 4C0HA 2HCJB 2WICA 5DHFA 3KXKA 3RHFA 2QU8A 2ZS9A 2PMDA 1OF1A 3LW8A 4ASUD 5JLJA 4OJKA 1R10A 1RFLA 4L5BA 3OAAD 2HDNB 5FUYA 1LS6A 4D0GA 5IHPA 1DTSA 4TYPA 2ODNA 1UBCA 3A37A 5BYKA 3IEUA 2WWFA 3I5XA 1YZQA 2BV3A 1GILA 2YC4C 2ZRFA 4GI7A 3ADKA 4ACBA 3K70D 4P4SB 2CXXA 4Q1FA 1LF5A 4CIDA 3EPKA 4K81B 2EFEB 3WY9A 1OH7A 1W49A 2CE7A 3A36A 4L15A 4EUNA 3AVPA 1NN5A 3SZRA 2ZSFA 1DAEA 3B1YA 3DMDA 4HAWA 5J5CA 3EPJA 3MWKA 2PZEA 1US8B 3OIVA 3T15A 5FBVB 2BMDA 3LO5A 3NWJA 5FPHA 1CEEA 3RDPA 2JLXA 1GZSA 3IO3A 5EP3A 2YHSA 3QOFA 5J4HA 3LLMA 3RABA 3QXHA 4RFSA 3KL4A 3UWKA 4AKHA 1NN3A 5LB4A 4N0DA 4LBZA 2OHFA 3U7HB 1J90A 4HEJA 5DNYB 1NY5A 3GJ6A 4KSBA 1MRSA 3B1WA 5FOSA 2IL1A 3A6PC 4LJ4A 4M2LA 3CKLA 5CDFE 1JJ7A 1IJEA 4I81A 4NYJQ 4OQMA 1TF5A 3LDAA 5E7MA 1OXTA 1ZW6A 2H1LA 2WJVA 1AM4D 4DLZA 2ZRMA 3K0SA 2CK3A 5JJLA 1VIYA 1IOZA 4HAXA 3ASYA 1S0UA 4K8OA 3LQQA 3L2OB 1VCOA 1G19A 1T6NA 2V6JA 5DN6A 4PPGA 2QTHA 1XCMA 1G3IA 1Z22A 2BMEA 2GKSA 1GL9B 3LX8A 1FQKA 3RAPR 4L4UA 4OK6A 3KXIA 2A5JA 5EE1A 3TMKA 4RD6A 2ZJ5A 3K0CC 3GLGE 4DDVA 5H1YA 1W46A 3Q85A 5BN4A 1SVWA 4C3ZA 1Z8FA 2EW1A 2QGZA 4FN5A 2VA8A 4QGGA 5AJYA 3OFNA 2QM8A 2AX4A 1KI9A 1F2UA 3GD7A 2BHRA 4US1R 4QHYA 4BE7B 4BFZA 1YZKA 1IONA 2OBNA 3L8YA 4PPFA 3OEEA 4HDOB 3CWQA 2PZGA 3BRWD 3HYTA 5HE8A 1ZBDA 1Z0AA 4JLNA 4EQ6B 3LNCA 2KJQA 1MABA 3FB4A 1Z6XA 1KDRA 4D6PA 4B3BA 4LUCA 2NZJA 1KDOA 1P61B 2ZAMA 3KJGA 4BWYA 1XNJA 5DI3B 4DLSA 4M1YA 221PA 1UJ2A 3FMFA 3ZVRA 2Z83A 4ZCLA 3W5JA 3OZXA 1GTVA 2OXCA 3DZ8A 1EG7A 5DLQC 2CNWD 1W36D 2WSMA 4OI0A 4A2PA 2XSZA 1IHUA 1NL3A 3DM9B 3FKQA 1DADA 2A3RA 2G0NA 3K09A 4M1MA 4LYHA 5FTLA 4HUTA 1W4RA 2R6CA 4MGIR 1G3QA 3QVVA 4GZLA 1VCIA 3OIUA 5JS8A 1G3MA 1MT0A 2OBMA 4JL5A 1KMHA 5AWFC 1N5KA 3VX3A 3KQKA 4C0BA 4D0LB 3ZLJA 2G88A 1KNQA 1LTQA 2ZJ8A 2HV8A 3B78A 4OI1A 2ZE7A 3A1VA 3WBJA 1XD2A 5C1BA 1XRJA 1E1QD 2WWWA 4HDCA 3OE7D 4D0NA 4RZ3A 4C7OA 4ILEA 1T5LA 2WWGA 5FOUA 3GLIB 4BFTA 2UKDA 3MSXA 4WIAA 4NU0A 4IVRA 4TYQA 2XNDA 3AP1A 4LYJA 4A6XA 2D7DA 3RRYA 3ZVMA 4NZYA 1N6KA 2V9PA 1MKYA 1ZAKA 1XPRA 1J99A 1VECA 1E69A 3VKWA 2ZR7A 2V3CC 3MAAC 2KWIA 4TWZA 5DN6D 2AHOA 3GLHA 4RCZA 3CLVA 3CW2A 1L4YA 3EIQA 4GZMA 1KHTA 1W4CA 3DKPA 2P67A 4OHZA 6Q21A 4M0LA 1Z3IX 4PZZA 1AGRA 4F91B 2ZM5A 4DEYA 1ZCAA 4JIMA 3A1TA 2JJ2A 3CX8A 3FHOA 4RZUA 4HDQB 3ZYCA 1QVAA 4A0RA 3AQ4A 5KNCA 1K8RA 3KZ1E 3V4RA 4MRSA 1UDXA 3VR4A 4ZI3A 2ZSAA 1G8YA 4TYWA 2GRJA 5HE9A 3U3RA 3QXCA 1YU9A 1NJGA 3QBTA 4M1SA 4MRNA 1QHNA 4NCIA 2XB4A 2XZOA 1BH2A 5G41A 3IO5A 3GJ3A 3TJZA 4A8JA 2ZTSA 2CEAA 4EPRA 5L3SB 2F3RA 4G1UC 4V0OA 1DO0A 1Q12A 1NNEA 2OCBA 3B8HA 3FFBA 4NTZA 1PLJA 4EAQA 4YMVA 4Q7JB 2GAOA 4LBWA 4V0KA 1D8TA 2O8FB 5JWHA 2VEDA 5D3QA 2NQ2C 1SXJC 4OKSA 3PXGA 1DBSA 1AS0A 1GIAA 4FINA 2ZRGA 3P4YA 3QUSA 5IRCD 2QENA 2QT1A 1NF3A 4Q01A 1XTIA 2AWOA 4JS0A 4JZKA 1OIWA 3BC1A 1KGDA 4RZXA 3THYB 4CEHA 3DOEA 2CVFA 3MJRA 4BEJA 2PMKA 4KCGA 2GZDA 5CJ2A 2W0MA 2ZE6A 3SYKA 4NPHA 1NBME 2OILA 3T5GA 3TGPA 2OE2A 3ZVNA 2R2AA 4DKXA 4YMTA 1K6MA 3KQLA 2O8EB 4LJ9A 1IY2A 1TPZA 2J7KA 2HEIA 4R2HA 3EIHA 4I1VA 3R9WA 1GFIA 4E09A 2ORIA 3RRNA 2IYRA 1W0KA 2ZVQX 2EFCB 4TMWA 1FP7A 3CX7A 3TSOA 3F3YA 4WXRA 1U81A 3UG7A 1FW6A 2YINC 2JLVA 4BZQA 2YOFA 1R6BX 1ZP6A 4HAUA 1Z0DA 3GLIE 3IQXA 2ODWA 3SBEA 2ZE8A 3B1XA 1OH8A 2NOAA 2WOJA 2IYXA 2QT0A 3PEUA 4FMCF 1KOFA 5JCZA 1R5OA 3C14C 3THWB 2DFLA 5L8VA 1QHHA 4A0FA 4C30A 1YR9A 3QKRB 1I2DA 1D2MA 1D5CA 1Y63A 2A5YB 2IYTA 4QRHA 5DGXA 1RRPA 2A78A 1F3OA 2CLCX 4JVNA 3MGCA 3L0IB 2C5LA 2IS4A 4QG7A 3AM1A 1SZPA 4LHVA 1ZNWA 3FHTA 2PBRA 2G6BA 3IPXA 2EFDB 3GFTA 2W58A 1Z07A 4KLZA 1E79D 3LH5A 2IF0A 3VFDA 4U00A 3BK7A 1G5RA 2UVQA 4FCVA 4XOIA 1Z2CA 4B32A 3VKHA 1XEWX 4LV6A 1ANKA 1ELOA 4G5SA 4B34A 3GLFB 3CF2A 4BRUA 1D9XA 2A9KA 5P21A 4PQRA 4B6FA 1EFRA 2ZPTX 1ETUA 4RD1A 2BC9A 2MSDB 2J0QA 1KSJA 5EE0A 1FZQA 2ZU0C 4RVCA 2YKGA 4IFBA 2B92A 2F1HA 2DWQA 4MQBA 4GSYA 4Z8XA 4Q7MB 3GMTA 5HCNA 1J7KA 5KTYA 1C1YA 4NH0A 4MYUA 5BN3A 3EWSA 1GKYA 1S2MA 3ZDQA 3K9HA 5TDHA 4ESHA 3NG1A 3QPWA 2JEOA 1Z5ZA 2B6HA 2GK6A 2BMJA 2JIZA 4MH0R 3SJZA 5FTKA 4B3XA 3U6KA 4HI0E 1NJFA 1E9DA 2X8AA 1EWRA 3I3SR 4KXFB 4OHVA 3IDQA 5JS7A 3K70C 1C9KA 2AL7A 1TEVA 3DPUA 3K70B 5AJWA 3CPHA 1JALA 1OT3A 4DDWA 3WBKA 2FF7A 2IYSA 3HU2A 3KQUA 2BWJA 4YC7A 2ODBA 1RJ9B 2GBLA 3ND8A 1XCGB 4TYYA 3Q3JB 2P6RA 1S4QA 3RWOA 2XXAA 2Z43A 1KY3A 2WWHA 4H1VA 1UFQA 4JJKA 1TQ4A 3LBIA 4TYNA 3TE6A 2ZXUA 4FMCB 4Q03A 3F8TA 4PSKA 4P4TA 8OHMA 1ODFA 4MUAA 2B8WA 4B6EA 3ECCA 3RANA 5AUNB 2CVHA 2J0VA 1ZM3A 2R6AA 1NLFA 2FFAA 1VCMA 2IEYA 2IXEA 1Z06A 1NN1A 3JZMA 3MUFA 3HU3A 1RZ3A 2ZRBA 3U4QA 2ZAOA 1JEDA 4Q4JA 1UBGA 1IXZA 2BBWA 4E5UA 1P3JA 1E0KA 2R6GA 2RGAA 3EC2A 4LYFA 4Q66C 4QC2A 2BEJA 1KO8A 4LPKA 1QHIA 3JZAA 1YHNA 1OPXA 4P32A 5D3MB 5KSPA 1NMZA 1SQ5A 4A2WA 2QN6A 1EESA 1KDPA 2GJ8A 5KNDA 3W90A 4TQ9A 1DAIA 4JT2A 2DBYA 3MJHA 4OBEA 1OXVA 2B7CA 2NMVA 3MD0A 1HEIA 2FPKA 1F6BA 1AKEA 1JB1A 1W4AA 4V0NA 3SFZA 1N3BA 1OSNA 2WJJA 2F1RA 2VSOA 4IRUB 2AKAB 1T8UA 1VYUA 5CDFA 3SOPA 1P62B 2RHDA 2VHQA 2H8KA 4HSEA 3O47A 4LSGA 1CS4C 3AEZA 4EPYA 3AVYA 1LW7A 3BBPA 3I8XA 4TL6A 3AGPA 2FPMA 5JSZA 4ESVA 1ZD1A 1CKEA 2WKPA 3KX2A 3OFND 4F7WA 4TQAA 2XX3A 5BW8A 2QMUA 1SULA 3KTAA 4LDJA 2W83A 3H86A 3OE7A 1N5JA 2QP4A 5JZVA 1TADA 2BVNA 4QGFA 5CIQA 2PJZA 4IOMA 1EFUA 1ZNXA 4WXPA 4PPQA 2J87A 1IXRC 1J2JA 2FE4A 2D74A 1AZSC 2JLYA 2VRWA 2QRZA 2IYYA 3B9PA 3ZS9A 2DHRA 4Q1AA 3A4NA 1W48A 2OCPA 5CLLA 3VR3A 3U60B 2QMHA 5AK0A 4P31A 2JASA 4GFDA 3WNBA 1GL7A 4G5QA 2ZRHA 3SFVA 2RHMA 4A36A 1P73A 2Q0HA 1KYIA 4IVPA 5TXGA 2ZUDA 2JJ1D 1ESNA 2FSGA 1XJ0A 1UBEA 3BE4A 2QSZA 3GJXC 3ZH9B 3CX6A 2OCYC 3OHMA 3PVSA 5LBIA 4EPWA 5HPYB 3FHCB 1MO5A 1GDDA 3I32A 3QF4A 3W9YA 4DSUA 3AF2A 4UQOA 1G41A 2ZU6A 2XNDD 3CRMA 3F0TA 3OEHD 1Z2AA 4LBYA 5FPKA 1UAAA 4JBXA 3KQHA 3K0FA 5FOWA 2G9NA 3WHKA 2OFWA 2KB0A 2VO1A 1YZNA 4GOJA 4N0EA 4A6PA 3QI2A 1E2EA 3RVBA 2OESA 4NYJR 1DAKA 1O3YA 3PUXA 1XFAA 1ZIPA 1HE1C 1TNDA 3EZ2A 2QA5A 5AUOB 2J9RA 4QFMA 1Q0UA 1AGPA 1AK2A 3N5CA 2QE7D 2GHIA 4R71A 4X8HA 2C99A 3PEWA 4LBVA 1DS6A 4URVR 4WW0A 5J4VA 1A2KC 2EQBA 2QMOA 3LD9A 3ICQB 3CUEF 3AF4A 4BEBA 1YKSA 3PUZA 4DLXA 1II0A 1N6PA 2IYLD 3VR6A 2R9VA 1UM8A 2KBFA 1MOZA 4Q9KA 3QXSA 3TUJC 1Z6TA 2HYDA 1PUIA 3HPRA 5HZKA 5JHHB 3K0AB 3W5IA 1BYIA 1M34E 3U7EB 3CB4A 1JR3A 2IWRA 2AXNA 2IBMA 2I1VB 4WOPA 1NVUQ 5FPTA 2D4HA 4QGHA 2ZVPX 4II7A 4JBWA 1G18A 4XWOA 5HCIA 2NO0A 1LNZA 3IILA 1QVRA 2GAAA 4LJYA 1R0YA 1AZTA 4HB0A 5HTKA 1OYWA 3W6PA 2GVZC 2J46A 1GUAA 1T4GA 1U8ZA 5B57C 1XXHA 1OB5A 3HJNA 3K0CA 1M7BA 4W5JA 5CLQA 4E03A 1EFCA 4HLCA 1S9DA 1VTKA 2F9LA 2KE5A 2WAYA 2HYIC 3PUYA 3GJ7A 1ZCBA 721PA 3Q9LA 4GDFA 4HLDA 1EXMA 3FWYA 2QPTA 1W5TA 4G5RA 1YE8A 1HQCA 1NBMD 2E1RA 4AI6A 1N6IA 4US0R 3VMFA 4LI0A 3BORA 3VR1A 4Q4AB 2AK3A 4IXMA 4PAOA 4BLTA 4FCWA 1D9ZA 3L0PA 3MWLA 3PCRB 4Y0AA 4QM7A 4OI4A 3DEFA 2QPAA 1I4TD 2OZEA 2C98A 4RFVA 2R6DA 3THOA 2V55B 2XTZA 4OK3A 2JCSA 2Z5FA 4OK5A 2O8DA 1XEFA 4M9ZA 4Z1MA 2B7BA 5TY0A 3LX5A 2Q3MA 4OHXA 1ZUHA 1QG4A 2BJWA 3VTKA 1AKYA 3SDZA 4A4DA 1E79A 1XCPA 1X86B 4HZUA 2OSBA 3AVOA 1Q57A 4EDHA 2QRNA 2VHUA 3RC8A 3AKDA 1KI7A 1GL6A 1ZM4A 1W36C 3SJAA 4TQUS 1TF7A 1KI3A 2MMGA 2OCAA 3T1VA 5KO2A 2VSFA 1OV4A 4BRWA 1NVWQ 1F48A 2WJIA 2IT1A 3AGQA 2O0KA 1GSIA 1HT2E 3WNCA 3PV0A 1VPLA 2ZSEA 1E9AA 3IHLA 4DLRA 4BGDA 4E07A 2CL7X 2YWFA 821PA 4JSYA 4QXAA 5TARA 4FW9A 2QTFA 4TLAA 3ZVLA 2QY9A 1R8SA 4GMDA 1NVVQ 2GCNA 4XVRA 4DHEA 4DJTA 3UPUA 2L0XA 3K09C 4A8JB 2X2EA 1IY0A 4TLEA 1TUEA 4U5XA 4NP6A 1QZXA 1I4LD 1EFRD 5KOYA 2HJGA 4B73A 3ZZ0A 4KAXA 4IDHA 1GRRA 1P9RA 4KITB 2J7PD 1XD2B 3WYFA 3V9PA 4QGAA 4P33A 3J81k 4IOJA 3L43A 4QL3A 2YZ2A 1HYQA 2F1IA 3CNOA 1FFHA 3O8RA 2DCUA 2CCKA 2VP9A 3N2EA 4NCJA 2EWVA 2WMNB 3SNHA 4AURA 4NBSA 2G1KA 1GITA 1G7CA 2VF7A 5CYOA 1CJVC 2REBA 3AF1A 4M53A 3BJIC 2RGBA 2IYZA 5DISB 1UKEA 1JBKA 1GRNA 3OESA 3AVTA 2IS2A 1ONBA 3U44B 1FMLA 2J5XA 3A4LA 2WWXA 2QM7A 5L3RA 2ZYVX 4OQXA 2GEDA 4KBGA 4BQSA 1P75A 3UK6A 1PVOA 4POAA 1UDWA 2FOLA 1NBMA 2FEMA 3KB2A 3U2QA 5C46F 1ZIOA 3QSYA 4UKDA 1E2FA 4TMKA 3WRYC 5KU1A 4JKYA 2JLZA 1S3GA 1G4AE 4V02A 2C77A 3RS0A 4M9SA 4DLTA 3T61A 1ZYUA 1R0XA 1KO1A 1G64A 1OXXK 2HT6A 2ZIAA 1W0KD 1KZ7B 1DVRA 5HR5A 1J70A 2EFGA 3EAQA 3OEHA 1Z28A 1N0UA 1NN0A 4NYIQ 4OQNA 3E5HA 2R6FA 5FPYA 2FU5C 4LJAA 1IN6A 3P26A 3EXAA 5JJKA 3WYAA 3EASA 3ZIAD 3IGFA 1IN8A 2W6JA 1WRBA 4DT1A 4GOXA 3SJBA 2HF9A 3HYRA 3IBGA 3BXZA 3TQCA 2ATXA 4X8LA 4JLOA 1MABB 1KMHB 1KTVA 3PITA 1HV8A 1ZU4A 4N1AA 1XTKA 1WE2A 1XF9A 1FOEB 2ZUCA 3FMIA 3QG1A 1CIPA 1OFHA 2K5UA 4RKFA 2TMKA 4KU4A 1EFHA 521PA 2XNSA 5JFGA 2PL3A 1W44A 4S35A 3SE0A 3U3JA 3W3ZB 4B35A 4OQLA 2QE7A 4O25A 4B44A 3TR0A 4W5WA 2ZROA 3PQCA 4UNNA 4DVGA 3KJIA 1M8PA 1EFTA 5EE5B 1Y3AA 1O87A 5FBRB 4KFTA 3LVQE 1JEEA 2LCFA 3WP0A 1G291 3LBNA 4BLRA 1Q3HA 5FL3A 2SHKA 3IHWA 2QBYA 3AVUA 1R5BA 2GXQA 2X77A 4OL0A 4WZAE 4C0JA 3U7GA 1A7JA 1YJ5A 2BBOA 1FP6A 2WJGA 3QKUA 4C9BA 1R7RA 1FUUA 3E1SA 2GXSA 2BBTA 1KSFX 3B85A 2O8EA 5IK2A 1G4UR 4LV5B 5SZIA 1W47A 2X19A 2CNWA 2N1BA 4YMUA 3QENA 3Q8XB 2GJKA 1X3SA 3KDSE 2X1VA 2GTPA 5EE3A 4B3DA 2BBSA 1S96A 4B2LA 3WMEA 4DZZA 1P4SA 2PJRA 2LWIA 2NGRA 2WBLC 4XVQA 5G53C 3THWA 2ZI6A 1HA3A 4CVNA 4A0HA 5AJVB 2F1JA 4CT4B 1P6XA 1W7AA 4LRWA 2GZHA 3QKTA 3RRMA 3KUCA 4HB4A 2ASEA 2XOKA 3SQXA 2ZS7A 5IK2D 2H16A 2QGNA 4LOAA 3AP2A 1G16A 1GWNA 4YXWD 2WSSD 3CRVA 3K0EA 2D62A 1JR3E 1E6CA 1VIAA 1U0JA 5FR1A 2C9YA 3UMFA 2CJWB 2Q6TA 4URUR 1IAQA 4RJLA 4DC9A 4M1WA 1G6HA 1TUIA 2IXFA 2O5VA 3DMNA 4IW3B 4ERNA 4Q18A 5L3QB 3SQWA 4JJZA 1ZU5A 1TF2A 1OHHD 4I99A 4CW7A 2IS1A 2YNMA 3AVQA 4HATA 3R9XA 1NSTA 1OH6A 3M0EA 1NKTA 1E9EA 3TBKA 1G17A 1UBFA 1CULC 4YDSA 5FTJA 2W0SA 3ND9A 4PZYA 4TLBA 4GL2A 5GADl 4Q1DA 1ZUNB 4TTQA 5KNBA 4MKHA 3AF3A 3KKOA 3TNFA 3WMFA 4QNRA 2J0UB 3IKJA 3ADBA 3KB1A 5E7IA 1W36B 3IEVA 3NBXX 4RZ2A 5FL7D 2V7QD 1XJCA 2C03A 3SU8A 2J7PA 1TTTA 2GCOA 4IXNA 3ADDA 4JVLA 1II9A 5JHGB 1TQ6A 4B3GA 3QY0A 2RAPA 1FMJA 3UATA 1JECA 2WZQA 2VHTA 1L2TA 1PZNA 1WDTA 4IVQA 4NCNA 4HAZA 4WZ6A 1U9IC 4CGZA 3GP8A 2CHVA 3SHFA 2IXGA 1KKMA 4DSOA 5FI0B 2VBCA 4FMDF 4D4KA 2VP0A 3LXRA 4HLQB 2MSEB 2CHGA 4IEIA 1Z08A 3O8DA 4DDTA 3THXB 1QF9A 3B2EA 1XP8A 1QG2A 4M9QA 2OFXA 2O8BB 4LC0A 2ZQ5A 1K5DA 2A2ZA 2J59A 5AR1A 1A1VA 4Q1BA 3LBHA 1QHSA 1CJTC 1N6LA 3SS8A 2VPPA 4I4LA 4XTCS 4G5GA 5FUVA 5DI9A 1BYUA 3WMGA 2JLQA 4DEXA 3CPJB 2J3EA 4MA4A 1BKDR 1P7CA 1R2QA 1D2NA 1TQDA 3SEAA 3AVXA 4C0SA 4B75A 1T3SA 1U0LA 1CTQA 1U2RA 3ICEA 4XSGA 4UXHA 4H9GA 1MO3A 4GRAA 1KJWA 1Q3TA 3FDIA 3PR1A 4GPTA 4PHFA 3C7KA 3TK1A 5GJCA 5LB2A 5H68A 5CYPA 3IIJA 4LWZA 3HPQA 3ZD6A 3EIEA 1MRNA 3CNLA 2V8OA 3QNUA 3H4MA 3AVVA 3FPAA 1DEKA 3I72A 2WIAA 3EWAA 3LRPA 4D80A 1SXJA 2J0SA 3VNUA 1U98A 1EK0A 1YRBA 4AK9A 2J45A 1E2DA 3FVQA 4LJ5A 1XB2A 3FMOB 2GCOB 4O2LA 1PJRA 3GJ5A 1YR6A 2V4ZA 4AWXA 2RMKA 2HUPA 2ZETA 4TN1A 3O8BA 2IHYA 3LV8A 5TV2A 1NIJA 4A8JC 3LY5A 4URXR 3B60A 3TQFA 1SKYB 2ZI7A 4DLWA 1E2QA 1X8JA 2B8TA 4PQFA 4EPXA 1X1RA 1Z6GA 3C4JA 3AV0B 3RNLA 2DFKB 4BZXA 1HTWA 3L0OA 1W0JD 3T06B 1QRAA 1F60A 4LV8B 4HZUB 4URYR 2Q9BA 3CBQA 4B2IA 3BFXA 4PC3A 2VP6A 4TMXA 2GF0A 1OKKA 5FTNA 1G7SA 1E3MA 1VG0B 3UG6A 3W34A 4JLKA 3EX7C 4DCNA 3DKVA 1PUJA 5IDVA 4DWJA 5BXQC 3TSZA 1DG3A 4IKEA 2NIPA 1A4RA 4HAVA 2HLDD 2ZR9A 1DARA 3E70C 3DHWC 3P20A 1N6HA 4DLVA 4EFNA 1ZVQA 1G5PA 1GNQA 1CJMA 3S1AA 1XBTA 5JEEA 1WB9A 3EPLA 4IDNA 2AR7A 2IS6A 5JCPA 1J8YF 4R98A 1DO2A 2XZPA 1T8TA 4MITA 2IHBA 2OM2A 2ZRDA 1N6OA 2O8CB 4ABYA 4MYCA 1E2IA 4BPBA 5E3HA 2FA9A 4CEJB 3L0SA 1ZC4A 3DL0A 3KFXA 5B58C 2H57A 5F98A 1US8A 3B82A 1RJ9A 5TB5A 2OO7A 1JPJA 4M1TA 2YOGA 3OIWA 5FPSA 1XJQA 1UEJA 2AD5A 3N2IA 1JR6A 1NKSA 4RSGA 1IN5A 4KVAA 5BQ5A 2DPXA 2WKRA 1E1RA 4OHWA 5CM9C 1GRQA 621PA 3K8YA 4OQFA 4MRVA 5BYJA 4L8GA 1W1WA 5JWOA 1NG9A 4JYBA 5JRZA 2W2XA 1LV7A 1NI3A 1N6RA 2HF8A 4QHSA 4XWAA 2GBLC 5B30A 3A1UA 4C0LA 2BCGY 4RD4A 3AKEA 1E32A 3F5FA 1JQLB 4PHHA 2G3YA 3RSLA 4AIIA 5F9FA 4TTPA 2ZRAA 5EP1A 5IF9A 3L8ZA 2W2VA 2VP2A 3QPUA 2V1UA 1JR3D 4YMSA 5A4JA 4HAYA 1Q21A 1G9XA 1BS1A 1IM2A 4TTRA 2FPLA 4HUQB 4B2PA 4B43A 1KO5A 2DWOA 2C78A 3MMPA 4URWR 2F43B 3QQ5A 3T1QA 2D7CA 4B3FX 1E0JA 4PX9A 4YLGA 2WAXA 3Q5DA 4G01B 1DELA 4AY2A 2QQEA 4KFSA 2IYUA 4N3NA 2QBYB 3W8RA 1ZM9A 3VKGA 4DIDA 3E2IA 2ZANA 2PX3A 3O8CA 1J8MF 3EG5A 4XH9B 5FBWB 4PO1A 1SVSA 4Q9LA 2Y8EA 3U3KA 1E4YA 1X8KA 5EJEA 2JLRA 4BUJA 4F4JA 1OB2A 4O2RA 2QI9C 5GJBA 2Z4SA 2D2EA 4JYCA 5EP2A 5FOXA 1W2GA 1RW4A 4ZDJA 1IQPA 1R4AA 1KSGA 4JT4A 1W2HA 1KSHA 5EP4A 1P9NA 1SVKA 421PA 2RGEA 5AJZA 1SKQA 5M04A 1L8QA 2ERYA 4JMPA 3TKLA 4Q9HA 4JLVA 1XTJA 5LDDC 4PQYA 2F55A 2RGXA 1GNRA 2V6IA 2V7QA 3DVLA 2CLSA 3EZ9A 4MRPA 5AJXA 1ZNYA 4KI0A 3BD9A 2VL7A 3BFVA 1HE8B 4QNMA 1C4OA 1N5LA 2CL6X 4KLNA 5EZ5A 1XZPA 1F2TB 1U90A 4V03A 1XMJA 2ATVA 2NZ8A 2ZRIA 1W5SA 5JBQA 4LCBA 3VQTA 5K8LA 4XWKA 2A7QA 1XWIA 2OFOA 2C9CA 5DHAA 5CJPA 4B33A 1Q1ZA 1NVVR 1I4DD 2HT1A 2ZI9A 121PA 1FQJA 1KK0A 1WMSA 4TLCA 3V4FA 3BH7A 2D06A 2I1QA 3LWNA 4MKIA 1DAHA 4D4LA 1TU3A 2PCJA 2WVJA 2ZJ2A 4X8MA 4PAMA 4LJ7A 4LHYA 1D2EA 1OJLA 3I61A 2HXYA 2Z4RA 2RGDA 4R7ZA 3BB1A 2WSSA 2XB2A 1CR4A 2YWHA 4XIGS 4JL8A 3VU9B 3Q72A 1XPUA 2QEQA 3IQWA 2W2TA 2VP4A 3TIFA 3CM0A 5GJVC 3VR5A 4CT5A 4EFMA 2QTVB 2BKEA 4EKDA 2IC5A 2G77B 3AKCA 3G82C 1H8EA 1G20E 2AXPA 3GQBA 4HZIA 2N42A 4KHZA 4PANA 4LZZA 1L7VC 4M8NE 3SJCA 2YYZA 1GP2A 3EW9A 2FFQA 4C0KA 3HP1A 1P2SA 4FMBB 1IXSB 2QORA 3LQRA 3T1TA 2QL6A 2XTMA 2GCPA 3GCGA 4ZV4A 1SVLA 2JIZD 4KBFA 2E87A 4LHXA 4QJ5A 1KI8A 3EA0A 2ZRJA 4KYUA 4UNPA 4S2EA 1UKYA 2RGNA 3PEVA 5DI3A 3X2SA 4CZ2A 1R8QA 5UKDA 2YJTD 3T5DA 2PLFA 4KSCA 1H8HD 4OHYA 2VSXA 1K5GA 2GVDC 1E9RA 1N25A 2GXAA 1YR7A 1HURA 4Q00A 5FR2A 4PHTA 1F2UB 4FWIB 1KK3A 3GEHA 4BFUA 2OT3B 2YV5A 1FTNA 3NEJA 1ZINA 1YZUA 3KFVA 4BFYA 2BM1A 5GVRA 4R9UC 5FTMA 2RB4A 5J40A 4TT3D 3UWOA 5HZHA 2QNRA 5CK4A 1HH4A 4Y0VA 3R7WA 4UXIA 4EPTA 2FZ4A 3CWZA 5KUTA 1HT1E 2FGJA 1E4VA 1QDEA 2H7VA 3DOFA 3LAWA 4PFSA 2HCBA 1NY6A 4W7SA 1QHGA 1ZMXA 3AP3A 1KKLA 2WOOA 3B5JA 2JATA 3M1IA 4L9SA 3FYHA 4KFUA 1ZNZA 3W6NA 1DAFA 2IYVA 1A2BA 1G8PA 3BH0A 5CB6A 5KSYA 3UIEA 5C4MA 3CRRA 1XDBA 1JNYA 4BZPA 2BDTA 1P72A 2GNOA 3I4LA 1LS1A 3BB4A 3QKRA 3A58B 4KO8A 5HKKD 1SGWA 2ONKA 3TAUA 2QAJA 4QJ3A 1YVDA 2GZAA 3T34A 4U7DA 5KPJA 3PG5A 4DCSA 1RRCA 5AUQA 1ZM7A 2N46A 5H70A 5J4KA 4Q02A 5JI2E 4B76A 3K0AA 4LYAA 4NMMA 2CDNA 2G0TA 1OFUX 3GLHE 4LJ6A 1UADA 2DY1A 1VKJA 2ZS8A 5CK5A 3JVUA 1DE0A 1Z6AA 2GILA 4XVUA 4HYYA 4JSTA 2C96A 2ODEA 4NDZA 1CR1A 2AFIE 2OAQ1 2H92A 4JLBA 5JSZB 4RD2A 4V0LA 5KDOA 5G40A 1XMIA 1XU4A 2VYFA 3CPEA 3X1ZA 4D2IA 2ZR0A 2ZREA 3CNNA 4M22A 3ZQJA 2VP5A 4UJ3A 3ZZTA 5A5GA 1T3HA 2IYWA 4ZCMA 1BMFA 3ZS8A 1Z29A 4Q1EA 4UXJA 1R0ZA 3D8BA 4RD3A 4BLQA 1VHLA 4AG5A 2NO6A 2ZJYA 4ZDIA 5EXTA 1GKUB 1ZUIA 3GEEA 1N0WA 4CEIA 4DB4A 5F9HA 3M6AA 1XEXB 2AN9A 1VMAA 2EVWX 4NONA 1X6VA 5GJWC 2FH5B 3DDCA 2H5EA 3EARA 2EYQA 4ACAA 4HB2A 3RSOA 2FWRA 1XXHB 5JI3E 4HUQA 2O8FA 2ZI3A 2OG2A 1E2HA 5IT5A 3KUDA 2ZJZA 1E2KA 2MMCA 3CRW1 3T35A 4M9XA 3WP1B 4ZDKA 1H65A 2CCGA 3EA5A 4LX0A 4JL6A 3CH4B 1KY2A 2XTNA 4GP7A 4F4CA 4MGKR 1TAGA 3GLHB 1FPMA 1ZJ6A 2RCNA 3D3QA 4KVGA 4PO8A 3CF6R 3TH5A 2JJ8A 2RGGA 3GEIA 1X1SA 1E0SA 1VYVA 3I73A 2PH1A 2FSFA 4JLAA 4PAQA 3U44A 1CRPA 3VR2A 5FUXA 4UNRA 2NO7A 4DSNA 2IUSA 5HKKA 3TR5A 2C8VA 2REXB 1E2GA 2AFHE 3FKSA 4FMDB 3EZ7A 1SXJD 3W3AA 2F7SA 3GLFE 3TW8B 2FV8A 3OAAA 2FEOA 1KI2A 3H1TA 1WXQA 1KJYA 5FL7A 1OYYA 2W6IA 1QHXA 1M1YE 2CMKA 2ZRCA 5LD2B 1BMFD 3NBYC 3GFPA 1R0WA 1CP2A 1UPTA 4TL7A 2IX3A 3BFKA 4URZR 2WIBA 4D4MA 2BCJQ 2QQ0A 1TQ2A 2GDJA 4D81A 4G3XA 4JBYA 3RWMB 4PXAA 1SXJB 2JDIA 2Q9CA 3B1VA 2GJAA 1QHHB 1FNMA 4Q7LA 1N5IA 1U99A 2ZI5A 4TZ0A 1FTSA 3QEOA 4EIWA 2PT7A 1U9IA 1OXUA 3CF0A 5JEDA 4JLMA 1E1QA 2ERXA 1FX0A 2O52A 1VG1A 3UMRA 3K53A 4IJMA 1W0JA 3QJYA 4FIDA 5L3QA 1E9CA 3IIMA 4E22A 2FSHA 3KKMA 4JKIA 3UMSA 3G0HA 2F3TA 3K9NA 3R8FA 4DRZA 3KTAB 1Z63A 4QOSA 4FI3C 1KO7A 1WF3A 1WBDA 2F6RA 1AA9A 1COWD 1XTSA 2CJWA 3EZ6A 1SVIA 2YVUA 3MLEA 1RYFA 3NDBB 1JXMA 4AG6A 5ELXA 1KK1A 4YXWA 4QBIA 4M21A 5SZKB 3FGNA 4PHGA 1RE0A 4TSFA 1E9SA 4Q21A 3TW4A 1M74A 3DM5A 1G7TA 4DLYA 1G5TA 3K1JA 2XOKD 1XMVA 3KKNA 4GBMA 2DFNA 2QAGA 1JAHA 4BASA 2R44A 2NPIA 3QKSB 1RPZA 3REFA 1YZGA 2CL0X 1Z0JA 3C16C 1CRQA 1Z6YA 3P1JA 4IFEA 1SHKA 3ONWA 4KFRA 4GMXA 3A8TA 4TT3A 5TVKA 5E95A 3IBYA 4BFVA 5KYKA 1H8ED 1XMSA 2XITA 2WV9A 4X8OA 1WCV1 1CLUA 3QF7A 2O0HA 3NH9A 2XJ4A 5EE9A 4XD7D 2O8DB 5DYGA 3NKVA 1Q1QA 3PJRA 1NG1A 3SN6A 1CU1A 2FMXA 3FFAA 3A1WA 3H0KA 4EJSA 1NRJB 5AUPB 4PC2A 5K8UA 1G7RA 1LY1A 2P5TB 4NYIR 4RKEA 2JAQA 1AQYA 1TU4A 5CITA 2GA8A 4BLSA 3REGA 4AKEA 5LPNA 1M7GA 2EYUA 4Q5IA 4DCVA 3CIOA 5SZJA 3SHWA 3EZFA 3THXA 5FFMA 2QMEA 4PZLA 4ZCIA 4QBGB 1FX0B 1BOFA 3QKSA 1T9HA 2A5DA 3CZPA 2P2LA 4TLDA 1BO6A 2H17A 2WWYA 4D25A 3NC1C 4QHTA 2G1JA 4OI2A 4A1FA 2V54A 3ZZUA 3NDPA 1FUKA 3QXXA 1YQTA 2BM0A 2J1LA 3CRQA 4A15A 3BS4A 4AYWA 1AIPA 2WHXA 1M6NA 2ZYTX 1A5TA 1HQYE 2CK3D 2ZSDA 4P3YA 1NMYA 1XD9A 2EU8A 4DUGD 4LHZA 4R2IA 4YQFA 3RC3A 4ZKEA 4G0NA 2ZJBA 1BIFA 4IOKA 1NSFA 3CR7A 1OXSC 4LK2A 4BLPA 2GK7A 3L82B 1G3RA 1OW3B 1WP9A 4KODA 2FJUA 3SYLA 2ANBA 3G5UA 4TSFD 3NH6A 5EXXA 3SR0A 1RRGA 2WMOB 1W4BA 2IEZA 2YWEA 1E2MA 1G3UA 2C04A 4RFSB 4DSTA 3GLIA 5K8TA 4MDFA 4QBHA 5TMPA 1P2VA 1E9BA 4U02A 4P0TA 2Q9AA 4P4UA 4O0MA 2F43A 1M7HA 1CF4A 4PSAA 1EWQA 2PCLA 1CBUA 4FCTA 2PZFA 5KDLA 3ZGXA 5JWRA 1U0HC 2FNAA 5J47A 5L3SA 2PEYA 5KPDA 3K0FB 2WTUA 3ETLA 2RGCA 4W5HA 4BECA 1F2TA 4V0MA 2YOHA 3R20A 1Q44A 4FXPA 3IPYA 4ZIRA 4ZKDA 2HXSA 2GEVA 2P0EA 3U3MA 2XSZD 4AKGA 1SXJE 2KBEA 4LC1A 4XSHA 4NKRA 1VG9B 4XD7A 3U61B 3D31A 2FN4A 5K8IA 4ASUA 5KDDA 5JMTA 2W6ID 5JJIA 2I4IA 1NLYA 4L16A 3WYGA 1P2UA 1KAGA 3ZQ6A 4PC6A 3TUIC 4AKIA
chains in the Genus database with same CATH superfamily
4IRXA 4MVJM 1O95A 2HN9A 2FG5A 2QMYA 1JHUA 2PT5A 4NIMA 5AK6A 1YR8A 4C0AC 1E96A 1NX6A 3L9XA 5JJ5A 4I0WB 2CE2X 3ZQUA 4AUMA 3IPLA 3KELA 3K2QA 1YZYA 4W1PA 4BFSA 4MGYR 4HTFA 2OHGA 3CLTD 3GJYA 4P2GA 3PA6A 3A1SA 4K3UA 2DUNA 1JTFA 4Q48A 5AYVA 3NC0C 4QGBA 4ZQHA 1E5VA 2A92A 4S3MA 2O54A 4XEUA 3S29A 4E5SA 3C7AA 4HH4A 5EJ9A 3EQ2A 4RK6A 5ALDA 3R3XA 2QAGB 4KYIB 5C4GB 1XD8A 3C5CA 3NHWA 4YUVA 1TAQA 5FI1B 2ZZKA 1Z0IA 4MWEA 4EHIA 4CKCB 4OSPA 4YONB 5IKMA 1E94E 3J7TA 2EF0A 2J32A 3SOZA 4ZARA 1KBZA 1Q84A 3DMYA 4I4CA 4F85A 4MYTA 3VISA 4NBLA 1RC8A 3IB6A 3I58A 2IW3A 4IJUA 3OIYA 3LT1A 2F1OA 1OX4A 3QTLA 3W2IA 5B2FA 1SELA 1YZVA 1RAEA 5KVQA 1OIVA 4DGSA 3I62A 2D59A 2LP4Y 1WSAA 4NSNA 2WPDD 3IV6A 5A1TA 5IUJC 3RHTA 1AN0A 1AQLA 5JJCA 3E3LA 4WJZA 3FPEA 4ZXFA 4KL8S 1AKUA 5B5SA 1T43A 4B48A 4DV3B 2W8BA 5CAEA 2LGJA 1KDTA 2XUDA 3LO8A 1L5ZA 2BZ0A 1P8JA 4QDJA 3JVVA 4PTZA 4ZZ3A 2O6HA 3G85A 3GRZA 4RCVA 3NAMA 2ZJ1A 3C6YA 1KPIA 3DGEC 2Z1NA 1AURA 1A1SA 2D5BA 1Z0FA 4UFPA 5E9QA 2QN7A 2Q6KA 2ZYWX 3ZK8A 1MVOA 1MO6A 3TSWA 2VF8A 1C9MA 3X1DA 1ECBA 3ONEA 3FKSD 1J25A 1T8PA 2IX9A 3T7AA 1F5NA 2BGKA 3BF7A 1RHMA 1S7CA 3X1WA 1I6KA 4BO6A 4Y7DA 3QVUA 5REQB 2P2GA 1MD9A 3R9IA 3UMJA 1O8BA 4Q4DA 1FJ2A 3RLFA 4K8RB 2FQ1A 2D2FA 2Z8ZA 2QYOA 5DULA 3DLPX 2WYWA 3U3XA 2O3RA 2ORWA 3UTCA 3WYBA 4ZAZA 4AXBA 3ZU5A 2A59A 4EY5A 1JWLA 3IEKA 4OUDB 3VAAA 1G8HA 4WNAB 1E2PA 1B14A 1TM2A 3ZWWA 3HJGA 4BNHA 3KWJA 3U0BA 3OC6A 3PJDA 1MEEA 3VYRB 5AQEA 3W8NA 1QIFA 1U6KA 1E2LA 1KJQA 2ZAIA 2AMLA 4M7RA 4M1OA 5J1SB 1UEIA 4CUZA 2AI2A 1J8VA 1HDRA 2GCGA 1OTXA 1F38A 5AI9A 3P27A 4I1SA 4JDPA 4KUGA 3E9RA 3HP7A 3X1MA 1T9KA 1U28A 1N2CE 4X85A 5DO9A 2FFBA 3UJHA 3FPGA 5FWNA 4O3MA 3V00A 1RJEA 1Y98A 1GG8A 5GWXA 3HADA 5A4MS 1UK9A 3ACCA 1D07A 1KMMA 2XVXA 4CM3A 3ZTYA 2FG6C 4C2AA 1VCNA 4JEHA 3JAWA 2FGKA 3UVEA 2AOUB 2QW0X 1DEAA 2V6GA 3MF4A 4Z8YA 3X1XA 4Y2XA 2JPDA 3EC1A 3G88A 5EERA 4B47A 3NTOA 1OCEA 2BUBA 4WLVA 3T12A 3V46A 3ZNOA 4BRZA 5L7WA 5E6SB 4ENUA 1PR9A 1LI4A 4A82A 1P18A 3ECAA 3GA0A 2WI8A 3U6BA 4YQYA 2CUTA 5TF4A 2VZEA 3PX7A 4RD0A 3QA9A 1LWOA 1TM5E 2ZB7A 4QFCA 2PQMA 2JRLA 1EFPA 3RS7A 4C4ZA 3HWSA 2NZXA 3NHAA 3SDBA 4A5OA 3WWYA 1K68A 2QOEA 4NL4H 1T4MA 4YYEA 4KXQA 4R7GA 4ZODA 3RD5A 1T91A 2MCFA 1C2TA 1C3XA 4NCXA 3RS3A 2WFLA 3F4LA 2WUVA 2OB2A 4MQLA 3AY3A 4LMPA 2ZTLA 4JBGA 5PNTA 1KS9A 3DD1A 2ZEJA 1JSRA 2KM1A 2WU1A 4QTYA 4W7HA 1WBBA 4CIXA 2VAVA 2EWWA 1C7IA 2RDMA 2UZIR 4TN5A 3HCBA 4WGFA 2UZ3A 2O7NA 3AW9A 2AI3A 4H6WA 1ZD8A 3DUWA 1GRCA 1JMYA 2RJNA 1WB4A 2BE7A 1KQ3A 2C9OA 5I9SA 3RS2A 5LUAA 3RYCA 4E5NA 2QRKA 1HZJA 5JPIA 4Q47A 3HS3A 2GKGA 1N3YA 3KT6A 3LA6A 3AB3A 4JJEA 4KQ9A 4RSMA 4CCAA 4GMHA 2OPHA 3I1FA 3RRZA 1C5KA 1TIBA 4I9NA 1O2DA 1YDEA 4ZO6A 1PVVA 2YC2C 2P5SA 4AJOA 5E4TA 4WOKA 3N1UA 2JFHA 5SICE 3NBZC 7GPBA 2QTLA 3TEMA 4EA8A 4F5DA 2P0AA 3NIBA 2PUHA 1NVKA 5EMMA 1LEHA 3BYZA 5DIFA 4X97A 2UUBB 4Y6SA 4CBVA 1LA2A 5EQTA 2AFIB 5KQGA 1HMPA 1B7GO 4D26A 2C9ZA 3ETNA 5LP6A 2BGRA 4IIJB 3EH2A 4MYDA 1ZESA 2WFAA 3ZGLA 3VPSA 5GONF 4MMYB 2WB2A 3OQMA 1YZ3A 4Q4JB 1JLRA 3GT7A 3RUEA 2XRFA 4Q4HB 1LDBA 4O4JA 5BN1A 3OZGA 4YR9A 2IP4A 4EG5A 4KMOA 4QYIA 5A3RA 4D3SA 1O96B 1CZNA 4PX3A 1SIBE 3MPUA 4N54A 2J85A 1FUIA 4HXYA 4INOA 4MQUA 1UBJS 2JLSA 1MPTA 3WLRA 4HDRA 1GSOA 1DV2A 2Q3HA 4AX4A 1MHPA 1HTBA 4D9NA 3P2KA 4Q9IA 3TCKA 1P39A 2D3WA 1FRVA 4TTJA 4F4UA 2WHQA 1PE0A 1U2PA 3HR7A 3IEPA 5C3MA 4I3FA 1MO4A 1FFWA 4BVKA 2JGAA 1O9HA 1H2FA 4IAOA 1YL5A 3VH1A 1KO4A 4FJ1A 3TLCA 3I5MA 4PNPA 4E30A 4GR4A 1CVRA 3WFZA 1Y8RB 2IYEA 2GZ1A 2O1XA 4TL9A 4B74A 4O4HB 2FUKA 4PZ9A 5TSDA 3TI7A 3UQZA 2E2WA 5LMUB 2GNPA 3GR6A 5FWXA 1FFXA 3GZ4A 1Z83A 3AEKA 2PKRA 4I5IA 3C3KA 4MKGA 3T4UA 5JZBA 1ADGA 4RGQA 2RK6A 3HUEA 1DUVG 1L4UA 1TVKB 2YHIB 3CONA 3K94A 2G72A 3MWJA 3THSA 5KVCA 1AA6A 3RYCB 3AG5A 4ZYTA 2UV8A 4K6MA 4YRKA 1ZR4A 1O5OA 3F3MA 1GD1O 2FMKA 3H9QA 3OEED 4B3CA 1U9YA 1L5QA 3AHGA 4FOPA 2V45A 3OLQA 3T1OA 5AVYA 4KO4S 5EXPA 4P7GA 3OURA 1D4OA 2XE7A 4J75A 2XADA 5CH5A 4MAAA 4ZJZA 4IS3A 4K1LA 3PNOA 3VOSA 2JA2A 3W2HA 5H4HA 4OHUA 2H3HA 1VLMA 3IURA 2WP0A 4MQEB 2L42A 3RSCA 2LKCA 1DKNA 3S0JA 4WBNB 3D0QA 4K03A 1LB1B 4NBRA 1JYFA 4NVRA 5BV1A 3TPCA 3NATA 4H7DA 5TQ2B 1GTL1 2R1TB 4JP2A 2OEPA 1HYEA 4YV0A 1W5EA 4MUBA 1KC1A 3U4QB 1EXNA 1WJGA 3G2NA 4L50A 5TS2A 3T9BA 2ODPA 1EDZA 3DBRA 2WG2A 3Q9UA 4FBGA 3AX6A 2LIVA 2RI1A 4YBRA 3FYUA 1TW3A 3PDHA 4LVUA 1A9ZA 4TKVA 4Z49A 2PUBA 1SUPA 3MB5A 2Z56A 3QEBZ 4CEIB 4TVBA 1O5TA 3MBIA 2XNHA 5AW9A 1XZJA 4QTUB 2BE9A 1M8KA 1OX6A 3DEHA 1BN7A 2BTQB 3FCAA 4FLFA 2QXYA 4GM4A 4WBSA 5JDCC 3I5YA 3C5VA 1T3LA 4GECA 3FMPB 3PE3A 3VHLB 4CLRA 4G8CA 2MWMA 3A3KA 1H23A 5FAKA 4XJXA 4AYXA 4CWAA 4JOQA 1EGAA 2H85A 1RWOA 3L6UA 1ODLA 1LLFA 4RLFA 2W6JD 1NRXA 1MH1A 3TVTA 4II2A 2VIIA 3LI2A 4BWFB 5EIAA 1QHFA 1XTRA 3PCTA 1ZOPA 1Z6ZA 4NR0A 6GPBA 3ZLTA 3CLRC 3ELYA 3BHJA 4A6DA 3M1YA 4LJSA 1MGOA 1GCIA 2GPTA 4PXYA 4X6UA 4PR0A 4ZO4A 1NHWA 4BQNA 4CI0B 1P6UA 1YB5A 1Y6RA 2XLCA 1YZLA 3EQ6A 6CHYA 3EPHA 1CR6A 1G8JA 1F20A 3ZU3A 2Z6AA 1TKCA 4LTMA 1FXUA 3OLWA 1DQZA 3KM0A 3EB9A 1ZS9A 2EIHA 3MINA 2E5FA 1E3SA 3MCAA 4NHOA 3O73A 4Z9FA 1RBMA 3X2EA 1WQ3A 1E7MA 3RYTC 2A30A 4LKOA 4H4CA 3USES 4Q37A 2AG5A 1Q0SA 4EG3A 3SBDA 5IJWA 1S9HA 1ABEA 4CMGA 1ETHA 1ONNA 4BGVA 2I91A 5AVSA 2VDNB 2BOVA 2DHQA 4TROA 3BOSA 5GV7A 3SBOA 2MOKA 1U7HA 1W88B 5EXSA 5EHGA 1GGJA 2CHQA 3D3NA 2C7OA 2O8BA 2IXBA 1XEWY 4WSOA 3UA4A 1X8XA 2HLHA 3EXEA 3T41A 5J4LA 4AD8A 2OECA 3JWIA 4DMHA 4NCKA 1D6JA 4MV6A 1GZVA 1RQLA 1U8AA 1T24A 2AMJA 3BTOA 3UOWA 3UWMA 2VYQA 4I46A 3U7FB 2CLDX 2HLDA 3BE8A 3ZIAA 2IGBA 3AEUB 1VCHA 3D1LA 1QZ3A 4GOOD 2B1RA 1NQTA 2XUPA 2WWIA 3E22A 3LSYA 3CTPA 3H84A 4XEHA 4LHWA 4II3A 3MFYA 1K4YA 5KYWA 1OKKD 1RVV1 5A0FA 3Q98A 3T3OA 5DM1A 3SI7A 3SVZA 4R0MA 5JATA 5E4FA 3RCBA 4EB3A 5D3MA 3RSQA 5CT9A 3HCWA 2L17A 4WA7A 4GX2A 1JDBC 2Y0BA 5DM4A 3RRFA 2VSNA 2ZYRA 3AFMA 4F4IA 1COWA 1EWVA 5AKYA 1KNXA 4MYSA 2IH2A 3EFEA 2WA1A 1SQGA 4BFCA 1Y48E 2OUKA 1EMDA 5JAMA 2HWKA 4RPJA 1AE1A 4OAPA 2PN1A 4GOKA 1NKVA 2VJKA 3LCUA 3QVGA 4WRRA 5EGNA 3V7UA 4DDUA 2Q3JA 1GM5A 4N18A 3KAPA 3PEYA 4ED9A 3DE4X 3RARA 3V8QA 5C53B 4C87A 3HDTA 1IWOA 4RIGA 5KJFA 3UXMA 2P3LA 2GO1A 2H5JA 4HNQA 2JDID 3FX2A 4NK5A 4R2WA 1DJQA 3NBFA 4CDGA 4EPVA 2AS0A 3VZRA 5JQWA 1KMIY 1I4WA 1L5HB 3LPLA 2ONJA 5IG2A 3QU5A 1OE0A 2P41A 2NP7A 3P4XA 1K7CA 1ZMOA 1AGNA 3HZZA 2NTEA 1JKMA 2FXIA 3KXKA 1L5KA 2HCRA 2W6ZA 1T0UA 4OUKX 4NDAA 1Z17A 1FTWA 4GBGA 3IQZA 2C54A 3CE9A 3IERA 5JLJA 2FW6A 1QR2A 4OJKA 4CM9A 3SX0A 5DKFA 3OAAD 2HV9A 2NYUA 5DK4A 4UZEA 3HDYA 2WZCA 3AI7A 4QE3A 2X22A 3EVFA 2GTHA 3DSRA 5FUYA 4D0GA 2FRVA 3IYLW 3JD2A 1VP3A 5IHPA 5LQJA 2CMHA 4U6NA 2OR3A 1SBZA 1NF8A 2WWFA 4J7AA 2GH1A 4MULA 3WFJA 4DTIA 1TD1A 1AKMA 2QWXA 3ADKA 2WB4A 1AG9A 4ACBA 4DN6A 1F1BA 3P5BA 4KG7A 1ZH6A 4P4SB 5AK5A 4IQ0A 2CXXA 5FIUA 5FAXA 1CNMA 4CIDA 3EH1A 1BH6A 1QYXA 3EPKA 1KEPA 4G4SP 1LKZA 3IJEB 1WTCA 1W49A 4UREA 2V97A 4EUNA 3AVPA 5CVTA 2GDZA 3S70A 2X76A 3DMDA 4HAWA 1EGVB 1XFDA 5J5CA 3EPJA 4BB9A 2JD2A 3OIVA 4L8WB 5FORA 4LMRA 3EF0A 5EKTA 2BMDA 3LO5A 3EZXA 2XDWA 1GZSA 2DGDA 3MZ0A 2V6FA 4YJHA 3OE5A 3LLMA 3QXHA 2RHCA 5EIBD 4RFSA 1NN3A 2BFAA 4X71A 1P1RA 4XLLA 4ZFNA 5K2MA 4HEJA 4C76A 3RJTA 4QYMA 4ESEA 4X1IB 2YHAA 3KZMA 9LDBA 3IA7A 4NECA 4I81A 5A4FS 1UT8A 4EVRA 2YJNA 2Y1GA 4KN9S 4RHFA 4OQMA 5KYTA 3SJ7A 1PHPA 2H1LA 2WJVA 4X3OA 3O7WA 4EARA 5H0IA 2C4MA 4DLZA 5JJLA 1GY8A 4LFAB 4XJTA 2PS9A 3D7RA 5T3YA 1DFIA 1U7XA 1U7OA 2AG6A 4HAXA 3LZDA 3L2OB 5DTMA 5AVTA 2Z04A 2AKEA 5DN6A 5SYMA 3VR5D 2QTHA 4IXTA 2ZTVA 4QDKA 4CHGA 4Y2GA 3DHNA 4RTKA 4NY1A 1DSSG 1TOAA 2WLSA 4FS3A 2WD7B 2MSWA 1N1GA 2VUUA 1M0WA 4FYVA 1XZKA 3DTYA 2PGLA 2RJ3A 3A6JA 3V33A 4H7PA 1P2FA 4QTZA 5BN4A 2CHFA 4R6WA 2QGZA 2CUKA 3HHEA 4D5EA 3ANMA 3RLIA 1H9BA 4G0WA 1U31A 2QM8A 2AX4A 4RE6A 2WABA 3ADBA 1F2UA 4MV4A 2J4DA 3MTBA 4I6EA 1U8UA 5DHTA 3UMYA 3A4TA 1IONA 2H2HA 5KBYA 4YAFA 4PPFA 1MU0A 2A4MA 5FA8A 3O5AA 5K8VA 5HE8A 4NJOA 2QN2A 4NNJA 4KFCA 2GZMA 2X6RA 4QUKA 3ENZA 3QX3A 3FB4A 1Z6XA 5C31A 3V8EA 4B3BA 2NZJA 1H2WA 1KDOA 2QYHA 5DCYA 2ZAMA 1XNJA 1BE8A 1QAQA 4DLSA 2AYYA 1ATZA 2HIMA 4RE5A 1JIVA 1YAJA 4U2DA 1LWNA 5EWMB 2R8ZA 3LC1O 3ZVRA 4ECEA 5DZSA 4DNXA 3F9CA 4FFLA 2PD6A 3C8DA 2PE5A 3GT0A 1K6EA 4NICA 2QGFA 4FX2A 1NP3A 3N59A 3QX9A 3NOXA 4RPCA 2WSMA 1IHPA 5LA6B 4A2PA 3C3XA 2TSYB 1A7KA 3FKQA 1MDBA 3K09A 3F7MA 4TGLA 1JU4A 1WUIS 3HMKA 1EJ0A 5KYNA 2H2AA 3RUPA 1W4RA 4MGIR 5THKA 3QVVA 2W2LA 5BQPA 1ISSA 4AICA 3QE9Y 2FFJA 2ZTMA 1N5KA 4OXKA 5AJTA 1X7XB 3SMQA 4BHTA 3MUNA 4CDMA 3KQKA 1LDYA 3P2OA 3TLJA 4D0LB 4YVFA 4DV7B 1LTQA 1E7QA 2ZJ8A 1O89A 5DBIA 1Q11A 2G9RA 1M2EA 1CZHA 1K92A 1BAPA 1BX3A 1Y1LA 3WBJA 3N2KB 1UMCB 2HO4A 3Q0EA 1Q0QA 1Y4SA 2OBYA 1GZ4A 1Y1QA 2I99A 3L6BA 2XODA 5FOUA 5EQFA 1XRLA 3WBFA 5BQXA 3MBKA 4HFNA 2V65A 1S7GA 1FIUA 5JXJA 5AVZA 4HS9A 2VJPA 3NJ4A 4PIVA 3IDAA 4NU0A 2M6RA 1RLJA 2VZ0A 4PG7A 1XZMA 5LZ2A 1RWPA 2IH5A 4QU5A 4RLSA 1TZKA 2ADFA 3DBLA 4KQIA 2D7DA 3C1AA 3ZH2A 3CU5A 1S5PA 1TM1E 4RETA 2V9PA 5A6SB 2YVLA 1ZAKA 1XPRA 5FNVB 1E69A 1MTZA 5J59A 3VKWA 1AUXA 3MAAC 1OWMA 1P5FA 1WLYA 4KDFA 1Q0HA 4LMBA 2PTHA 3NEAA 3WIUA 4ZD6A 3CLVA 3HV2A 1ULBA 3O8CA 2BM9A 3EIQA 4MKRA 2Q27A 2X8WA 4EA6A 4OHZA 5FLKA 2JFGA 4PN7A 1KQFA 4KB5A 1E4OA 2XRYA 1A8UA 1U6JA 4O1IA 1PR0A 3T9AA 3TXAA 3FHOA 3CX8A 5LLDA 4WKPA 4EATA 1ZICA 4HDQB 3E9YA 1QVAA 3AC0A 4HNHA 3CX4A 1K8RA 4WL0A 4M46A 4KKXB 1HDOA 3FZGA 2GRUA 3D8RA 3VPHA 5CNKA 4ZYLA 3V4RA 5LDHA 1QG6A 4MS1A 5CMLA 2XUOA 1XZCA 3H9JA 4JJGA 4OHCA 4WDRA 2SNIE 1R16A 1MQSA 3H8VA 4RUKA 1YU9A 1M2VA 4ZALA 3DVAB 3KQMA 3QBTA 2VAMA 2DLCX 2JZOA 3DHEA 4NCIA 1CZKA 2HMAA 4OUDA 1JFFA 5COAA 3BT7A 3TJZA 4IL5A 2CEAA 4IO0A 5TPZA 5ELLA 1E5TA 4HGNA 4V0OA 3ETDA 5JLAA 3OIGA 1Q12A 3QYFA 3TPZA 4OD0A 3AHFA 3B8HA 3UAZA 1BWRA 1X7DA 1PJZA 4R81A 5FBZA 2QM0A 4EAQA 1XTPA 4YMVA 4JC5A 3WIEA 1RAGA 5IBRA 4CL2A 2ZDQA 1H0RA 3ED1A 5D3QA 5C7OO 4G86A 5EPEA 2NN3C 1AS0A 2CWDA 3FTPA 3IEXA 1GIAA 4L0MA 4Q3DA 4Q3BA 2YH2A 1JN0A 3NVDA 1BU8A 3HKEB 1XTIA 4JS0A 4JZKA 4U7HA 4PLPA 4F11A 1OIWA 1W1IA 2ZWVA 3U1BA 3V1MA 2PKCA 3DOEA 4YPOA 3GBSA 2PMKA 1G9TA 5CJ2A 1V25A 2HA3A 3V80A 3AIIA 3PDUA 2ZTHA 2HRQA 2FEAA 4LSWA 3LCRA 2OKCA 2NXWA 3RASA 3RJZA 3BMQA 1QJCA 4RM3A 2XY4A 3V48A 4CCSA 5JAQA 1XNQB 3HCCA 2OE2A 3ZVNA 2W70A 4WTOA 4BAUA 1N8SA 3TZCA 4QXMA 3F7OA 1TLFA 4ZVOA 3WADA 2O8EB 1JDSA 3K31A 2ZUEA 3BE6A 4AJ4A 5JALA 2IITA 3W3AD 3B3FA 3OOYA 1Y1SA 5J63A 4BCBA 1WXEA 2GRAA 1GFIA 3OZ7A 4CUKA 4E09A 2ORIA 4M1QA 3HHPA 2OBXA 1YMQA 2ZVQX 2IDZA 2EFCB 4V1CA 2JW5A 3RIGA 5U4QA 1WNFA 5H02A 4JB8A 1RDFA 3OCCA 1ZN8A 3LECA 3E3MA 5H7XA 4DIMA 3RTDA 2QVYX 1GTMA 2HSWA 2RGYA 3T6KA 2JLVA 4BZQA 3OIDA 1J06A 1ZP6A 2GEFA 1DKPA 4IDDA 4L4XA 4PZPA 4YX9A 1ZOIA 3QVTA 2ZE8A 3SXUB 5BUZA 3PEUA 2HJWA 3R7DA 1HE2A 2JFVA 2JS7A 1AV6A 3A7DA 1R5OA 1YJXA 2P3QA 1WW3A 1TIPA 3B3GA 2PSHA 4MVJA 5L8VA 1IBKB 3UYKA 3UJAA 4A0FA 1NDHA 4MVYA 2JD1A 3AESA 3HJTA 2HB6A 5ETJA 1M1XB 1D2MA 1Y63A 2A5YB 3IUBA 1K3TA 1N9KA 2UYQA 4QRHA 3HBMA 2XZDA 4IPTA 3VZPA 2H2GA 3ZWQA 3PK0A 4N7MA 1HETA 4I4TF 3L0IB 1QRTA 4NZPA 1VL8A 2C5LA 4BNGA 4INAA 3T9EA 2GLXA 4EJ0A 4X65B 2IS4A 4OQQA 1SZPA 3A1EA 3OU6A 4WFKA 5EJ4A 1ZNWA 2H3EA 3KWFA 1PU2A 3FHTA 5LYJA 3IPXA 4GZ5A 2EFDB 4X54A 1KZHA 4EHHA 1R66A 1Z07A 4CV3A 1PGJA 1O95C 1Z4NA 3AR4A 3AXSA 5ELMA 3X1KA 5HWSA 2IF0A 1QUEA 3PLNA 3R44A 3BK7A 1G5RA 4U00A 4XQCA 1P1IA 4XOIA 4YS6A 5AW0A 3C5EA 2QTNA 3VKHA 1JAZA 4JUBA 3PPXA 2WHPA 2O2YA 5KWJA 5JZ9A 3AINA 4B34A 1CETA 2VDUE 3ZUPA 4WCFC 5ESRA 1PJLA 1X1TA 1QQBA 4F92B 4AM8A 1EE1A 5ES4B 4F3RA 4ARAA 4IIEA 4P82A 2MSDB 5BV7A 2J3JA 1KSJA 2FJ0A 3DKRA 1EGHA 3QU7A 4B4DA 5A04A 1JSCA 1XVLA 4IFBA 1ZA2A 5F7XA 1PWEA 1E60A 2BSXA 5ALYA 2DWQA 4Z8XA 3SR4A 3KIPA 3CYFA 4J9UE 4Q7MB 5BSUA 4X6XA 5D5QA 5KTYA 2CYCA 4B87A 4MYUA 5BN3A 3GDOA 3VSDA 4GKJB 1GKYA 3H5VA 4BWGA 2Q49A 3FOCA 4RHCA 4E08A 5DXFA 3HM9A 2R79A 4K0KB 5TDHA 4ESHA 1FK8A 3QPWA 4NAUA 2JEOA 3R24A 4IWXA 4ZOLB 5F35A 1HX7A 3DHYA 4LE2A 3FPSA 4U4AA 3OZFA 3SJZA 4B3XA 5T4EA 3SS9X 2V5UA 2W6NA 1V1RB 4K9OA 3WLHA 4G37A 5FWXB 1P19A 2A35A 5C32A 1ZEMA 1JLKA 2DKNA 1IC6A 2W43A 3PYMA 5EUBA 3X43A 1BE6A 8LDHA 3L0BA 2PHZA 1DUSA 1VMKA 2IPXA 3G68A 3SR3A 3HB1A 2COKA 4DDWA 2H8GA 2IYSA 1FS6A 2XIQA 4UTOA 1WD5A 1BMQA 2GBLA 4TYYA 5J2UF 1WMDA 1K7XB 4DG9A 3OI7A 1IBLB 1U0TA 2AN1A 3GN1A 5DRTA 1UFQA 2PQ6A 3NW9A 4JJKA 4G0YA 1TQ4A 2WM3A 3R0JA 1WM1A 2NU7A 2HMVA 4N5HX 4WY8A 3M3DA 2QZSA 3UKJA 5LZ7A 3F8TA 4BS9A 2V3WA 1ODFA 1EGMB 3GRPA 1GAWA 3EQ8A 2J0VA 3CKMA 3GJZA 3OTGA 2R6AA 1NLFA 2FFAA 2BFFA 4ZOLA 3H19A 4LWOA 1XMOB 3KQSA 4OLFA 1W35A 1XRMA 3HU3A 1PJ4A 2ZRBA 3U4QA 2OD2A 5EG5A 2ZAOA 1JEDA 1NBWB 3VBCA 4JGGA 4DS3A 3RFFA 2FF5A 2RGAA 3EC2A 1HLFA 3D4PA 3UB4A 5CJJA 3VDQA 3ZXYA 4YCSA 3EIXA 3JAWB 3ETHA 3LUJA 1TK3A 4FFVA 2PSEA 1YHNA 1EESA 4P32A 2C0QA 3PXEA 4WASA 5K3DA 1GUBA 4W1RA 2JFPA 1LNSA 3FDJA 1RC0A 3MT7A 1H0SA 4IH1A 2F8TA 1ZD3A 2FEWB 5LKRA 1NV9A 1L4HA 3BMOA 2WTMA 4HBGA 2BF4A 4A0SA 4YGXB 3OQIA 5ALJA 4DA4A 1TTPB 4MW1A 5IARA 1E1DA 2ST1A 4BO5A 4FNAA 8ATCA 4A2CA 1OXVA 1XZEA 2NMVA 4BNLA 3MD0A 1UKCA 4Z4HA 2Y4NA 5BRJA 3O03A 2BLNA 1S8AA 3QMVA 1EVZA 2NU6B 3C3DA 3H1BA 1Q2UA 3A4YA 1N3BA 4EBFA 3TLGB 1RZRD 1L4MA 2GBFA 1ZW1A 2WJJA 2WU4A 1L4KA 1SB9A 2F1RA 4Q39A 4PXSA 5CGZA 3S2EA 5FEUA 3H1FA 4OG2A 5LMCA 4BMDA 1DZ3A 1T8UA 4IHAA 2PZ8A 1VZ3A 4BXOB 1T1IA 1R74A 4HSEA 4UCFA 5IP5A 2P9YA 1CS4C 2PMEA 5JSHA 4Y30A 3BBPA 3P45A 3DDSA 3ICOA 4TL6A 3UUEA 2DFPA 4FEEA 1MA3A 3RUFA 1P80A 1CK4A 1ZD1A 2CDRA 2WKPA 1G5HA 4RKRA 1SKAA 3FETA 2XX3A 1VOTA 3G5TA 3IMFA 2QMUA 1SULA 4TXJA 3KTAA 4LDJA 2NVUB 4G09A 4BN4A 3WISA 1VE5A 4X64B 2QP4A 5DHUA 4CFZA 5BN4B 3K0HA 1VL0A 4UDYX 5IU6A 4IOMA 1ISMA 1EFUA 3KJZA 4NMHA 3T0FA 4BO2A 5A9RA 3WQSB 4JHXA 4TKVB 3JX9A 1NMEA 2EX4A 1IXRC 2ATEA 2V9CA 4EZBA 1ZI8A 2JLYA 2AXEA 1XP5A 1P77A 3A6DA 3IDSA 1LPNA 1YJQA 1KA9H 3DJYA 3KLMX 1HDGO 3ZS9A 4K5QA 1N3LA 3HWRA 2LNDA 4U2FA 1K63A 2QSJA 1W48A 2C4VA 2AUNA 2GBIA 3WGHA 3OZAA 1VLQA 2JASA 3ND6A 3O93A 4P31A 2CDBA 4XM2A 3ZG6A 3SFVA 1T5HX 2PGOA 4A36A 4M8LA 5HBRA 1KYIA 4IVPA 5LP6F 1AB6A 4YXFA 3WMRA 1F8GA 5HHTA 1O77A 2ECFA 2IU3A 1XJ0A 4JFRA 1UBEA 4TLLB 5JJBA 2JARA 2QLMA 3OHMA 4EY7A 2CMDA 4EPWA 3UOGA 2CBXA 3I32A 2H48A 3B2QA 3AF2A 3AEQA 4PF1A 2J3IA 3BE5A 2AOVA 3B3JA 1L5SA 3HJCA 5SYAA 3CRMA 2FK7A 5BPHA 4EYGA 2QF7A 2CJXA 2VXCA 1WW8A 1X1CA 1P91A 3KC2A 3BEOA 1ORTA 4MQFB 3AB7A 2VO1A 4GLLA 1EBFA 1WW2A 3JZFA 1SK9A 5DPMA 1DAKA 1MQAA 3PUXA 5KYXB 4JEMA 2HBQA 4YLYA 1NE7A 1U7TA 3S5JA 4GPEA 3EZ2A 3OWHA 3HJAA 4DC0A 2NXJA 1AGPA 2QE7D 2C99A 2NP6A 1O9GA 1FRQA 1PGQA 1IG3A 2XNKA 1SU4A 4P93A 4OXRA 1A2KC 1TJYA 1USIA 3MXTA 5KYUA 3HY3A 4R69A 4J0IA 3ICQB 3U48A 4BEBA 4QOFA 1BDIA 1YKSA 1IEWA 1QR6A 1TZ2A 3PUZA 4PW0A 1N6PA 2RG1A 4HWTA 3VR6A 5DK6A 4Y9RA 5F12A 4K9KA 2H0AA 2QD4A 3KJNA 1H4SA 3CUYA 2X6TA 2XWPA 3TLBA 1B15A 3GHHA 1K8YB 2JFFA 4Q0MA 5J58A 1PUIA 5JHHB 1QO9A 3LKZA 5FV7A 3MA0A 4X62B 3JQFA 3SAJA 3T3HA 1EVYA 2IBMA 1HE4A 2I1VB 3WYEA 1THZA 1V96A 3KJXA 5F73A 4JSRA 1OA0A 3PDJA 5K6AC 2ZVPX 5F33A 5K03A 2OO5A 3B1JA 3JQAD 4XWOA 3QI7A 5JSUA 2NO0A 3BCUA 1GKKA 1XHLA 3M6WA 4MQEA 4PGGA 3HL4A 1M1NB 4XWYA 3LKDA 4GI5A 2QR3A 4O1MA 1OYWA 2AZTA 4RIFA 3L8CA 5G0UA 2EG9A 1A2OA 2SBTA 1U3VA 2J46A 1GUAA 3PDWA 1T4GA 3UAOA 1XXHA 1OB5A 2LD4A 4Y7CA 4W5JA 3KE9A 5DXAA 4BY9E 4LY9A 1QFSA 3TPFA 3AUAA 1M54A 3VMMA 4JI0B 2VTVA 1ZCBA 3CVWA 2F00A 1EXMA 2CF6A 5JMWA 4LOKA 1N0HA 1LW6E 4G5RA 3QH4A 1HQCA 2WZBA 4P0QB 4AI6A 3PUKA 3DF7A 4KK4A 2ASVA 4A5SA 3BMCA 2WC1A 3L7LA 4US0R 2C5SA 3VMFA 5T67A 3VR1A 4Q4AB 1Y8RA 2AK3A 1UXHA 4IXMA 4FUQA 5BOSB 5KQSA 2LVBA 9MHTA 4Y0AA 1B41A 3OJWA 4L9AA 3PIIA 1V7QA 2YDYA 4RFVA 4KH1A 3THOA 1L5HA 5AD1A 3RVJA 3FRHA 4NBKA 1XLWA 2WIFA 3AU9A 4OK5A 4OHOA 1OWPA 1QNFA 4M9ZA 4Z1MA 3WGYA 3IA2A 6PFKA 4N48A 1A4XA 2Q3MA 3H42B 3JWEA 3W9BA 3ZZMA 4GVPA 4A4DA 1E79A 2FPXA 1HLPA 1U2TA 2WIGA 3GXBA 4F8JA 5DNAA 3AVOA 3V8VA 2QTRA 1H85A 2Q8NA 2YL2A 2INGX 2X3YA 4MP8A 4PBSA 4CMBA 4A26A 1HGXA 3R5XA 3AHDA 4UVGA 1AHNA 4UHBA 3WB2A 3C97A 3QHAA 1TF7A 2MMGA 1Z4IA 3L92A 5BOVA 4QASA 5JS1A 2VSFA 2ZW9A 2VR1A 4BRWA 2Z6UA 4D9CA 5JXWA 2O0KA 3OHPA 2VZ8A 3UV7A 2JGJA 4WXYB 3PV0A 4RPLA 2JK0A 4E07A 4P81A 2GN6A 4WFQA 5GMOA 4HDMB 5LWHA 2TMDA 5IZ4A 1W6RA 4LXQA 2RH8A 3JCZA 4UCWA 4DYDA 4C29A 3OQ1A 2QTFA 2DT5A 4TLAA 2QY9A 4M8SA 5ALZA 5BURA 4GMDA 4UCQA 1NVVQ 5KAPA 4NPCA 4DHEA 2IUEA 4DJTA 2A1TR 3L8MA 1ZX1A 4KYTA 2C9DA 2FP4A 3G89A 4ZHQA 3DBLB 2X2EA 3W5HA 1HL3A 3PWKA 2FEPA 3GGCA 3KQTA 4OB8A 1YFZA 1M67A 3DCIA 3HVRA 2H4WA 3L49A 1YUBA 1EFRD 3NJRA 3ODGA 3OPMA 2K2WA 3R23A 3BGDA 4WY2A 5ECGC 4EG8A 4IIHA 1EQAA 3G9XA 2RARA 3O8OB 4KK3A 1MXHA 1P9RA 5LQMA 4PG6A 3L7BA 2V9ZA 4DANA 2YIJA 4HQFA 2AHRA 2GOYA 2HHCA 2VSYA 5A5VA 4WNCA 2DECA 1P44A 3L43A 2YZ2A 3EG9B 3OMLA 1QE3A 2F1IA 3CNOA 4IYJA 2GNAA 2CCKA 2NT3A 2PX2A 3JPYA 5DCUA 1UZAA 3N2EA 2EWVA 3VO2A 4QEZA 2O3QA 4YT8A 4C43A 5ALMA 4E7PA 5HBGA 4EYKA 3NB0A 4F9FA 2G1KA 1IMOA 1DWUA 3EN0A 3CLUD 1K27A 3MRXA 1G7CA 1UUFA 1V71A 3GCXA 4UHHA 3RF6A 3FTDA 4M53A 1QWSA 1KBQA 3GRUA 1JBKA 3IL2A 3KD3A 4DFDA 4L8FA 5I4KA 1K9SA 2ABWA 1FMLA 1NUPA 3A4LA 3A2MA 1ZN2A 5L3RA 4GF5A 4HQRA 4KWCA 1TLLA 3KYBA 4BQSA 1QS0A 3DL4A 3VRHA 1I0IA 4DM3A 1OLSB 1CB0A 3KYCA 3P0RA 1BD4A 4V39A 4CF4A 1NBMA 2FPOA 4LN1A 4YYZA 5C46F 5J23A 2JKZA 2XE6A 1N1EA 4CCYB 1C80A 4TMKA 5HNKA 2C4NA 4YJ2A 1JLHA 1T8WA 2K2QB 3EXG1 4DLTA 1PTJC 2XE8A 4N01A 3WLTA 1P29A 3T61A 1TA4A 1ZYUA 1R0XA 4Z86A 4YAKA 1KO1A 4CKCA 4WH0A 1R0KA 1DVRA 2CKDA 2AEMA 4AN1A 4GPAA 1ZG3A 3ZHCA 4CQMD 2EFGA 1L7DA 1CUCA 4OQNA 1NN0A 2F8MA 1FQWA 2OORA 1XV5A 4XUGB 4C6SA 4CG1A 1YE5A 1IAVA 1IE3A 4L27A 3FJ1A 3MQ4A 1ZZGA 4INJA 4FZ5A 4EEZA 3EXAA 3KDAA 1RU3A 3EASA 3IRUA 4F46A 5JJKA 3DUFA 2X8LA 4R3NA 1WRBA 4EDFA 3GOHA 1E2UA 5EJ2A 2X9GA 2YVKA 3Q7IA 3C3AA 4GOXA 4MS4B 3S55A 3ANXA 3BL6A 3SJBA 3H87A 1CEXA 1CFZA 1M6VB 3C0KA 3E58A 3LF2A 3H1GA 3HYRA 3OJEA 4LEIA 5EZSA 1BVRA 4JLOA 1MABB 3DULA 3EZLA 1KTVA 1J00A 1ZU4A 2Z2YA 4U3JA 1MTOA 3FPKA 1ZHOA 1M8JA 2WVAA 3QG1A