4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
3WXMA 1W0KD 2ODEA 1CU1A 4IDOA 1SVSA 4G3XA 4ACBA 2QY9A 2W0MA 3B1VA 2RGNA 4YDSA 3GLGB 1N6IA 2NZ8A 3KKOA 4WZ6A 3ZQ6A 5EQTA 3MAAC 1F60A 1RJ9B 4N0EA 2ZSAA 3CPEA 3SHWA 3EZ6A 2F6RA 4LJYA 1CJKC 3G0HA 1KI3A 1DAGA 4ASUA 4FINA 3TSWA 2J3EA 4M1KA 2K5UA 4ERNA 4BLSA 3LLMA 4WW0A 1FZQA 1ZD8A 2OLJA 3QKRB 2GWHA 1VG1A 5JCPA 1AS2A 4BZQA 3QE0A 1U9IA 3SOPA 1DAFA 1TU3A 4LBWA 4TYQA 1HYQA 3NBFA 4NP6A 1E0KA 4PC3A 4C0LA 1W36B 1KI4A 1OFUX 3WMFA 5FH9A 4W7SA 4DCUA 1QRAA 2OT3B 4URZR 1OE0A 2ZE7A 3UATA 1EFTA 1OIVA 5BN4A 2JIZA 4A0RA 1KI7A 4KHZA 4H9GA 5FL7D 1OB5A 1W48A 2AXPA 3CM0A 5G41A 4Z54A 3IIMA 1E2EA 4QFMA 3PEYA 3W5IA 2G0NA 2XSZA 2O8FA 2GDJA 4TMZA 2IWHA 5L3SA 2ZUBA 3CF6R 4Q47A 1OF1A 821PA 2DFTA 2ZIAA 4PFSA 4RSGA 1KZ7B 4E07A 1S1CA 2RGGA 4M4SA 4AWXA 3AF2A 1FTNA 1EFCA 2KBFA 1SVMA 1XZPA 4M53A 2FE4A 5CLQA 4RD2A 4CZ2A 2IF0A 2WHXA 3TUZC 4X8OA 1XB2A 5KSPA 4RZUA 2JIZD 3AGQA 1DADA 3I4LA 1SVOA 5F98A 1IN4A 4BEBA 4CW7A 2BBTA 4Q9KA 2GNOA 4TZ0A 1LS1A 2XSZD 3I5YA 2W6JA 2WMOB 1XDBA 3I62A 1Q1EA 5TXGA 4QRHA 1NN3A 2Q9BA 4A15A 4C0JA 1RRCA 2OHFA 3BORA 4FD2A 3A1TA 3OAAA 1NG9A 3UPUA 1MV5A 1E2QA 2W2XA 2P0EA 4LHXA 1G5RA 1GZSA 4PAQA 2GJ9A 2J0SA 1D9XA 3C15C 5FUVA 3VU9A 1RC8A 4JMPA 2GILA 4N0DA 4M22A 2QN6A 2IC5A 1HY3A 3NEJA 4B71A 4HSEA 1J8MF 1J70A 5KDDA 3EX7C 4BFYA 1E1QD 3SBEA 2W6JD 3DEFA 1P2UA 1ZM7A 3SYLA 1G4UR 4B32A 4MGKR 2GZAA 2CJWB 1OHHA 2YYZA 4HDQB 4TQ9A 2RB4A 2D74A 3RWOA 5DH9A 3OAAD 3THXB 4XOIA 3ADBA 4HUQB 3QJYA 1II0A 5FOTA 1TF5A 1VECA 2IUSA 4ZCIA 3DOEA 1N0VC 2BMJA 2XXAB 2VA8A 3E1SA 2O52A 4B73A 4QJ4A 4PQFA 3HR8A 5G3ZA 2Z5FA 1L2TA 121PA 1HUQA 4PC1A 4EPYA 4TYWA 1X6VA 3IKJA 2GXUA 1KJWA 1W5SA 3BE4A 1J8YF 3MD0A 4GI7A 3L43A 3R8FA 2DHRA 1XU4A 1YR9A 1ZNYA 1ELOA 2P6NA 1KO5A 4FN5A 3I92A 1U2RA 4LC0A 3QKTA 3LLUA 4CT5A 1R0XA 3KJGA 4DUGD 1OHHD 2DWOA 4JJZA 4KLNA 5DGXA 2ZSFA 4U5XA 1GDDA 3P27A 4A0HA 5FPHA 1ZBDA 3GLIE 2O8DB 3IDQA 3SDZA 4CRWB 3KKMA 3OIVA 3RS2A 1YR7A 3RRNA 3A1UA 3SEAA 4NPHA 3T1QA 3KFXA 3NDBB 2QT0A 2V4ZA 3HPRA 1I2DA 2VP0A 3QVUA 3QY0A 2VP4A 5AJYA 1T8TA 2QQ0A 3MWKA 4A4DA 2BEKA 1W7AA 3AKDA 3OF5A 4ZCMA 5F3WB 2OFOA 3DDCA 4L9SA 3PR1A 4I1VA 3RVBA 3AP1A 1XD2A 1CIPA 2R6FA 4PSKA 1DPFA 3CX8A 1VMAA 2RKOA 3EZ9A 3EWSA 4I1UA 4HDCA 5EXTA 3ADCA 1UKZA 5IK2D 5DI3B 1V43A 2WBLC 5FOVA 1OJLA 3QVVA 5AK0A 1GILA 2OFWA 2CHVA 2Z4SA 5JEDA 1KK1A 2EFDB 4ESVA 5DYGA 4Q19A 3TVTA 2YOHA 4I99A 4B6EA 3UG7A 2R8RA 2GAOA 2ZYVX 3B1WA 4PANA 2R6GA 3KB1A 421PA 2O8BA 2F9LA 1HT1E 5J5CA 2DFNA 1D9ZA 2OG2A 2VSOA 2ZRKA 3O8DA 4WIAA 4B6FA 2CVFA 2V1XA 4Q4HA 2GXAA 1Z6XA 4NONA 1NNEA 3EPLA 1GSIA 1KJYA 1TADA 3IBGA 1KY2A 1DARA 1DAKA 1NN1A 4GSYA 4TZ6A 2O8FB 3KXKA 3W8RA 3V4RA 4PX9A 1XEXB 1DBSA 1F5NA 1T3LA 1NLYA 5L3RA 2Q3FA 1HE8B 3TSOA 1G41A 4Q4AB 4Z8YA 4EUNA 1KSFX 1A4RA 1IXSB 2PX0A 1Y3AA 2PCJA 4HUTA 4LYJA 4BLTA 1NP6A 1EXMA 4PAMA 4ZIRB 1FP7A 4CDGA 2QBYB 1RPZA 2YC4C 1TAGA 1ZU4A 1Z8FA 3VNUA 4QL3A 3IPXA 1II8B 3BK7A 4KBFA 2CHQA 2WAXA 2CHGA 4AYWA 1WB9A 3EC2A 4PHTA 1K5GA 2J46A 1XRJA 5EXSA 2WWXA 2FMXA 3LBNA 3R20A 2D7DA 1J2JA 1GKYA 2XOKA 2FPKA 2QMHA 2ZE8A 4IOMA 4JLAA 4Z1MA 5BYJA 3TGPA 2I4IA 1NVXQ 1BH2A 5JEEA 1FTSA 2FSIA 4B2LA 4DEYA 1L8QA 2WSMA 3N2EA 2UKDA 5TY0A 3BFXA 3L0PA 1Q57A 3O47A 1AS3A 2JJ2A 621PA 2O0JA 3GFTA 4D2IA 1XJCA 5K8TA 3A1VA 2FPMA 2CCKA 3CB4A 3M6AA 4BQSA 4DLYA 3UIEA 1QHSA 5FI0B 3QG1A 1H8HA 3VR2A 1R0WA 1YZNA 3UMRA 1Z6YA 3K9NA 2WWGA 5KNDA 4JZKA 2HDNB 3KQHA 2IBMA 2HXSA 1U98A 4Z1MD 2VYFA 3WNCA 1CR0A 1V5WA 4PZZA 5C1BA 4A82A 1S9HA 2DPXA 3F3YA 3FFAA 3I1FA 4JVNA 4XD7D 3PV0A 5JSZB 2IYUA 1G8YA 1N5LA 3C8UA 2GBLC 1DVRA 1ZNXA 3O8BA 2JJ2D 5J4YA 1RZ3A 2A5FA 5K8IA 4RZ3A 1M7HA 2OAP1 1G4AE 2PMKA 5JJIA 4LOAA 4IFEA 1LNZA 3CH5A 1KKMA 2BIFA 1AM4D 1SKYE 3AF4A 4NHOA 3T12A 5TMPA 2JLZA 5JJKA 5EP4A 2QPOA 1IJEA 4IDNA 1DG1G 4ILEA 3E70C 3MMPA 3FKSA 4LYAA 4RCYA 5KYKA 1R0ZA 3AF0A 5EZ6B 2BMFA 4BASA 4US2R 4W5WA 4XJXA 2VHUA 2XEXA 1RKBA 2CL7X 2IW3A 1ZM4A 2BCJQ 4DSOA 1XEFA 4ZDIA 4UXIA 5IDVA 3AVXA 4NH0A 4PC2A 4BLRA 1E2HA 4FCVA 4CGZA 4EQ6A 3VX3A 3CRRA 4HLCA 1DO2A 1RW4A 2OXRA 2H1LA 5FBWB 2GETA 4NDZA 1PV4A 2VSFA 1MKYA 1AK2A 1N6OA 2CMKA 2IS4A 3RSOA 2QMOA 4URUR 3R9XA 1UDXA 2F1JA 4IRUB 2GVZC 3GJ6A 2A3RA 3FKSD 4DHEA 3LW7A 4FMDB 1P4SA 3I73A 4D0GA 2XNSA 3K0FA 2NGRA 3B5JA 4JBWA 5EP1A 5JWRA 4R2HA 1Z6AA 1CS4C 1NVUQ 3AUXA 3QSYA 1ZMXA 2W58A 3D6TB 1L7VC 2WICA 2GXQA 1OYYA 3B7GA 4Q1FA 2C9OA 3IHLA 1R5NA 5KU1A 4JLKA 4TYPA 3W6PA 3QXXA 2JLXA 2PLFA 2QP9X 1JXOA 4GMDA 3SNHA 2EFGA 4DWJA 2ZR0A 3C16C 1P73A 5AR1A 3F5FA 4A1FA 1E6CA 1YRBA 2WOOA 1FQJA 3AQ4A 2XAUA 4LRWA 2ORIA 3SHFA 1C1YA 1E2MA 2ZEJA 3HU1A 1YZGA 2WJIA 3K9HA 2ZI5A 3GJ7A 2BMEA 2G0TA 4O0MA 2OCBA 2QG6A 1WDTA 1NMYA 2FN4A 4M0LA 4P4UA 4P4TA 3OZXA 3OIUA 4H1UA 1SHKA 2BDTA 1OV4A 3QKSB 1VG8A 5H70A 1S8FA 1XXHB 4LV6A 4UNNA 4TMXA 1P5ZB 3TNFA 1UBGA 2PEZA 5D3MB 1SXJB 4NL4H 5JRZA 2J0VA 1ZD9A 1Q3TA 2CVHA 5SZIA 4BPBA 1OSNA 4K81B 3O8CA 1E2PA 3SJAA 2FNAA 2HJGA 1KMQA 5JI3E 1TL7C 1VG9B 4B2IA 3SJZA 3QNUA 4W9MC 1KK0A 3THYA 1F2UA 1Z6GA 4IDPA 5DSZA 1Z06A 1S3SA 3DKVA 5JMTA 4Q02A 3KQUA 1S9DA 3EIEA 1KYIA 2BC9A 1KMHB 3GFOA 1M2OB 3TVDA 1NG1A 3Q85A 3DMDA 3GPLA 1PLLA 2G77B 2PH1A 4EIWA 2ECKA 2VSXA 1W2GA 4S35A 5DLQC 4A92A 3U7EB 4XTRA 5C4MA 2Z83A 5FL3A 4MKHA 2OUKA 4GOKA 2IYQA 4MYHA 4DC9A 5KO2A 1X8LA 2QRNA 4JSTA 4A0GA 2FDCA 2YKGA 1CXZA 4JYBA 4C7OB 2VHCA 2JLWA 1B0UA 1M1YE 4NCHA 4NCNA 4MDEA 4L4UA 4EPWA 1PZNA 4KYUA 4LBZA 2JASA 2A30A 4JLBA 4TLEA 2QORA 4BECA 1DAIA 2AR7A 3QPWA 3BD9A 2FSGA 4Q1CA 2FPLA 2I3BA 4HAUA 3ZLJA 1R2QA 5FOUA 4RVCA 3MWJA 4GP7A 1JR6A 2VBCA 3GFPA 3NC0C 4S2EA 3R7WA 1W0JA 3NH6A 4Q1DA 2V7QA 3NHAA 3EASA 2YOFA 2QRZA 4DZZA 3E2IA 1JBKA 5BQ5A 2IXFA 1W46A 4MRPA 4OJKA 3ZZTA 4B47A 4TSFD 5DO9A 2O0KA 2ZYUX 4IKEA 3TKLA 4Q4JA 4PHFA 3N2IA 4G0NA 5AJZA 2YOGA 2B8WA 1Z83A 2VP2A 3B82A 3ECCA 3EZ2A 1C4OA 3IILA 4ACAA 4LI0A 3WNDA 1T3SA 4GDFA 2XZLA 3GJ4A 4B3XA 3FHOA 1E79A 2ZROA 5GJWC 2B21A 5IHPA 4HB3A 5JHHB 2BKEA 3THWA 4LSGA 2ODBA 2KE5A 5JZVA 3RC8A 2V7QD 2CE7A 1N5KA 1CR1A 4AKHA 3P32A 1ANKA 4XVQA 2GEUA 5AJVB 5B64A 1AA9A 1KO1A 3NXSA 3D8BA 1YR6A 3SC3A 4M9ZA 1OKKA 1IY2A 1M8PA 3EWAA 4Q5IA 1DG3A 1BOFA 4FI3C 2BM1A 2AK3A 2LCFA 2BOVA 4XVRA 1TUEA 1E79D 1E9RA 3VKHA 5EUQB 1LV7A 3PUYA 1KK3A 4ON9A 4LJAA 3RHFA 3HDTA 1XMJA 2HXYA 3U7HB 5FTKA 3T1OA 1IN5A 2BBWA 5FPYA 3G5UA 3KB2A 4HAYA 1G3IA 4Q9IA 2WJGA 2ZQ5A 3OIYA 3TAUA 1NN5A 5BN5A 2WJHA 4OQMA 3X1DA 5FBQB 3IEUA 2QAGA 4C0SA 3IO5A 4RY2A 1OKKD 3B13B 3I32A 4PPGA 4TLCA 1KI1A 1KI9A 2JCSA 3SJCA 2ZETA 3K0CC 4Z51A 2O5VA 2QSZA 2CK3D 3WP0A 1G7RA 2ATVA 5CIQA 4DRZA 4KFRA 4PO8A 2KSQA 1T0HB 2X77A 2NMVA 1W47A 5BW8A 5HR5A 2ODWA 2W83A 1CEEA 3QG5A 2GHIA 4QG7A 2ZE6A 5JCZA 4XIGS 3U4QB 2CBZA 5UKDA 1HQYE 3OE7A 4GZMA 1VCOA 2V8OA 2JDIA 1U99A 2ZYWX 3ZZUA 1D2NA 3GLFE 2HEIA 1OFIA 5G53C 3U3OA 4A8JA 1NKSA 5JHGB 1ZP6A 4JLVA 4CEHA 3ZVMA 1LF5A 4FMCF 4U7DA 1ZUHA 3L8ZA 4Q01A 3LX8A 2AL7A 2G6BA 2Q3MA 3VMFA 4WOPA 1E4VA 1PVOA 3RS3A 4YXWD 4LBYA 2JJ8A 3DO6A 2GZDA 2IYSA 5KSYA 3EPHA 1CRQA 3BB3A 2J41A 3U60B 1OIXA 4RFSA 1LFDB 3JVUA 3GLFA 2AWOA 4G5QA 1LVGA 1QVAA 3OE7D 3B1XA 3TK1A 3FOZA 1JQLB 3I8XA 2FWRA 1CLUA 3AF1A 4OQXA 1UBEA 3K70C 4N3NA 5EUMA 4E03A 1XEWY 4GPTA 4HAWA 3QEJA 1W4CA 2H16A 4HZUA 1Z2AA 3B85A 2G1JA 4XSHA 2XTNA 4C4PA 2IYTA 3B1YA 4AYXA 2GJKA 2MMGA 3CZPA 4FIDA 1QG4A 1US8A 1W4AA 2J7PA 521PA 4C0HA 5CDFE 1AQYA 1XF9A 5JFGA 3U61B 1TNDA 2YWHA 4LJ8A 1ZCBA 2FFQA 1DE0A 4PO1A 4Q00A 1XCPA 1UAAA 1N25A 4F4CA 5KNCA 2NZJA 1NJFA 4YMVA 3IQXA 3I8SA 3GJ3A 3M4YA 1M7BA 1KGDA 4QXAA 2F43A 4LGMA 4KJZA 3PXGA 5L3QA 4HZIA 3LQQA 4A36A 2CDNA 2O8EA 5HKKA 4YONB 4R9UC 2J7PD 3RLFA 3ZH9B 2FF7A 4TMKA 1P60A 2REXB 3AVYA 1SXJC 2EYQA 2WPDA 4HYYA 4HLDA 4BLOA 2EFEB 2DWPA 4JKYA 3TLXA 3ONWA 1MABA 1XD2B 2C9CA 5FL7A 4R71A 1EFUA 3N70A 2AWNA 3PCRB 1U0LA 4QBHA 4PZYA 4JT4A 3SI7A 4D4LA 1GRQA 1AIPA 5FBLB 3AKYA 1YZQA 3GP8A 3AVUA 5HKKD 3ZS9A 2IYVA 1TTTA 1VYUA 4TN1A 1S1MA 1HE1C 4LV8B 1KDPA 1GP2A 2IYWA 2VPPA 4KSBA 3TR5A 2LKCA 2O8BB 2WPDD 2RMKA 2ZJ8A 1ZW6A 1KI6B 3W3ZB 4FWTA 4DIDA 1M6NA 1W1WA 3KJIA 4BGDA 4DLVA 1XP8A 4OK5A 1X3SA 3MGCA 3GJ0A 3IBYA 5C2JB 1NSFA 1N5JA 1P75A 4UXJA 2ZJYA 3O8RA 3LY5A 1A5TA 5G3YA 2R65A 1JQJC 3RAPR 4TMWA 3P26A 5KDLA 4C9BA 5B57C 1TU4A 2R6CA 3U44A 3ZJYA 2OESA 1NVVQ 2N1BA 4Q9LA 1NSTA 2ZPTX 4W5JA 2B7BA 2PCLA 2JA1A 3CO5A 1ZRHA 3TSZA 3UMSA 2WWYA 2RGNC 4ZI2A 5AJXA 3FMOB 3ZD6A 3OESA 2ONKA 4Q18A 3THOA 5JWHA 5ELXA 3GJXC 4HDOB 1E3MA 4RZXA 3IUYA 2A78A 2G88A 4OQNA 6Q21A 2ERYA 1Z08A 3H2YA 2OEPA 1R8QA 4WXPA 1W4BA 1E1QA 1KDOA 1VCNA 3A4LA 3SE0A 3FYHA 2B8TA 3Q3JB 4MITA 4RD6A 4K46A 3GLHE 1N6KA 2BBOA 4JBYA 1UBCA 3QF7A 1Q0UA 3UMFA 3BIFA 1N3BA 3UANA 2EWVA 1UKVY 3QKUA 2PBRA 2GCOA 5C4GB 2VHJA 3EXAA 2P6RA 2ORWA 1Q1QA 2VLIA 2O8CB 4UNRA 2OO7A 4TL8A 4U00A 2ZJOA 4MGIR 1KY3A 2FJUA 2NO6A 3FHCB 3PENA 4XVUA 4QM6A 3MUFA 1BMFA 3PFIA 1K8RA 2YWFA 3Q72A 4ARZB 2DY1A 2PL3A 2FFBA 1WMSA 2Z43A 2ZRAA 4LJ5A 1WE2A 2ANBA 1GL7A 3GLHA 4UQOA 2H18A 4D25A 4MGYR 3RC3A 3TW4A 4F38A 2DCUA 4MRRA 2REOA 1E2DA 5EE1A 1MO5A 4TL9A 3LAWA 4DUGA 5JJLA 2FFHA 4PSVA 5LBIA 1SVKA 5JS8A 3BFKA 4K8OA 4PPFA 4OHXA 4Z8XA 1IY0A 2P65A 3T35A 1G3UA 3LW8A 3NWJA 3WNBA 4DSNA 1GOTA 3DZDA 4A2WA 1JXMA 1UBFA 2PX3A 3NBYC 1QHHA 1BMFD 1WP9A 3G82C 5FUYA 3ASZA 3FMPB 2IX3A 1GAJA 4CVNA 1XEWX 3GEHA 4KYIB 3VKWA 1JNYA 1IN8A 4V02A 1P9WA 2H57A 1ZVQA 5F2EA 1QG2A 2JLUA 1MH1A 3PVSA 4M1WA 1OFHA 3UXMA 1W44A 1YE8A 1QF9A 1W4RA 4M1SA 3WHKA 3Q7PA 2RGCA 4Q1EA 5BXQC 5IK2A 2IF2A 1ZIOA 4NBSA 1E2LA 3ZS8A 1O87A 3VTKA 2WJVA 4EQ6B 1SKYB 2FV8A 3CNLA 3PIRA 4KFSA 4NYIR 1WBBA 1OXXK 3GLGE 5EP2A 2ORVA 1G1MA 2R6DA 5EXXA 3VHXA 5J4KA 3SQWA 721PA 4DLTA 4ESHA 1G19A 2WVJA 5EE5B 4CIDA 1LY1A 2IYLD 4F91B 4QBFA 3KQNA 3GLIA 1JR3E 3K0FB 2QMEA 1Z2CA 4BRWA 4C2TA 2ZS7A 3VAAA 2ZREA 3REFA 3BAFA 1Z3IX 5BN3A 2W2TA 1Q12A 2BV3A 3CZQA 4L16A 1XD9A 4NYMR 4QKQA 4Q21A 3GLGA 2RH5A 3JZAA 3U3RA 2HT1A 2IS6A 1E94E 2OE2A 4I1OA 5FI1B 1SVIA 3ZVNA 3IGFA 4KFUA 4TMTA 4V0NA 2EFHB 3RS7A 8OHMA 5L3VA 4QHYA 3FKQA 5LB4A 1EK0A 1CRPA 1G8FA 2NPIA 4TTRA 3TR0A 1JJVA 1AN0A 1JR3A 2XJ4A 1SGWA 2XTZA 1MOZA 4M21A 3QF4A 2Q3HA 4MUAA 1DTSA 5A4JA 1Z29A 2UZIR 4EJSA 4OI0A 4ZI3A 3TRFA 4DLZA 1YU9A 4HB0A 3EIHA 2C98A 4IEEA 3H84A 4KVAA 3K1JA 4FW9A 4WA7A 1VDZA 2VTKA 3L0OA 3SZRA 2A5DA 4U02A 3VNVA 1FMJA 3QKRA 4O2RA 3BJIC 1HH4A 4GOJA 4UJ3A 2GJAA 2GESA 4ZKDA 4KV9A 2ZYTX 4UXHA 2OZEA 3WMGA 3ZD7A 3WYAA 4G5GA 4JS0A 2JLVA 2IK8A 1KI2A 2FH5B 2TMKA 1GNPA 1D2MA 1UKYA 1JR3D 1SZPA 1KIMA 3QBTA 4KXFB 4NYJQ 2QAJA 4JLNA 2GAAA 3C4JA 4V03A 3PUVA 3K09A 3PEVA 1TEVA 5C46F 3BC1A 1XTIA 3KXIA 1TX4B 3U3KA 3HU2A 4TLAA 1QVRA 1RIFA 5EJEA 4LJ7A 1G8HA 2ZJBA 1DS6A 1U8AA 3TW8B 4AD8A 4NKRA 1RRFA 5JECA 4B3GA 1F2UB 4DBLC 2ZM5A 2CNWA 3BXZA 2GBLA 1FOEB 4BE7B 3GJ5A 4B75A 4G1UC 3SYNA 2G1KA 1I4LD 2QGNA 2RGXA 1Z0KA 1Z28A 2RGDA 2ZRNA 1RYHA 4MUBA 2ZUDA 2ZI4A 1NKTA 3MCAA 2G83A 3H0KA 4L15A 1W36D 3NEYA 4XD7A 4CEJB 3SBDA 4DVGA 4G5OA 1E32A 3NBXX 2FFAA 2GJSA 3OEED 4C0BA 1N6HA 5AJWA 1VCIA 4MH0R 4BRUA 1AS0A 2CNWD 2QP4A 1VTKA 2Y8EA 1NVWQ 3BS4A 4Y0VA 4CT4B 3LNCA 2C95A 1WXQA 1KNQA 2BVNA 3VQTA 3L2OB 1ZC4A 4QBGB 5LDDC 4DLXA 2J0QA 3KUDA 1N5IA 1KAOA 1XPUA 1YQTA 1JAHA 4B3DA 2QSYA 3KKQA 3X1ZA 3R7WB 5CITA 2KJQA 2C04A 1R4AA 3QPVA 3U5ZB 2FZLA 1KO4A 5B2ZA 1KTVA 5EP3A 1CJVC 4B34A 3QXSA 2RAPA 2WJYA 2IA5A 1XMVA 3CW2A 5CLLA 3C5HA 3EZ7A 3ZYCA 4BFUA 3LO5A 3AUYA 3X1XA 2ZS9A 4Q4JB 3ZIAA 1R0YA 1MR3F 4LK2A 4V0ME 5CJPA 1X86B 4DLRA 1XCGB 4XWOA 4TTQA 4WXRA 1OYWA 4LHVA 4II7A 4AC9A 2HF9A 4LPKA 4PC6A 1VHLA 2GA8A 2JLRA 3AVOA 1U0JA 4PTLA 4M1TA 1EG7A 1E2KA 2IYXA 1OH8A 3THWB 4HUQA 1F2TB 2EW1A 1G8PA 2JAQA 2YVUA 3VX4A 1D8TA 2OLKA 4PHHA 2XXAA 2VH5R 2L0XA 4OI2A 1KI8A 2F1HA 4RJLA 1F48A 3B8HA 3W90A 1VHTA 4RD4A 1KO7A 1RRGA 3A4NA 3WBKA 4D82A 3NG1A 1NLZA 4PXAA 4V0MA 2HCJB 3ZIAD 1E98A 4P31A 2WWWA 1DEKA 4WBSA 1FPMA 3KJHA 2WZQA 2RGBA 2NO9A 1P2SA 3K70B 2QM8A 1X8JA 2O8DA 3TH5A 3ETLA 4DT1B 4JKIA 4TWZA 3UK6A 4C0QC 1XX6A 5LPNA 5J4HA 2DYKA 3RDPA 1CJTC 1JAIA 4XH9B 2OAQ1 5FTJA 4CEIB 4DSTA 4Q7LA 4PPNA 4US0R 3AP3A 3IIKA 1T4GA 1E2FA 3GEIA 1J7KA 4PC7A 3CRVA 1FX0B 3RNLA 3FHTA 2Z4RA 2DFKB 3RYTC 3TBKA 3ADDA 1TQDA 1YZLA 3K9LA 4ZPXA 5E7IA 3SFZA 2JLQA 4D0NA 1G7SA 4QJ3A 5GJBA 1E9FA 1P61B 1ZNWA 2W0SA 3KTAB 1WQ1R 5AUQA 5GVSA 3B6EA 3U3MA 4Y0AA 1R6BX 3U2QA 2ZSEA 4L8GA 5HZKA 1S3GA 3ZGXA 2I1QA 3CPHA 4URVR 3FWYA 1DELA 4M8NE 1WCV1 3QI2A 5IF9A 2SHKA 1DO0A 4B48A 1JB1A 1T9HA 4CEHB 1COWA 1A2KC 3UKDA 1X1RA 1G6HA 3AH8A 3PQCA 3MFYA 4BFSA 3ASYA 4GT1A 4HAVA 4P4SB 1R5OA 1G5PA 2N46A 2WIAA 2ZI6A 1OPXA 1ZIPA 2XGJA 2H7VA 3AGPA 4M9XA 2V3CC 1S4QA 2Z6VA 2VP9A 4OHYA 2J0UA 2F3TA 2IWRA 4NCJA 2J5XA 4P33A 4RFSB 1P9NA 3Q7QA 1VPLA 2B7CA 2X2EA 1XEXA 2B92A 2NO7A 4FMCB 1EFRD 4JIMA 4UNQA 3NKVA 4Q4AA 3LBHA 1KOFA 3NC1C 3AB3A 2ZJZA 3K53A 2J59A 3BRWD 5B58C 4C2UA 2J45A 1COWD 2H8KA 2D4HA 1N6RA 3NIBA 4HZUB 4DCNA 3M0EA 4B44A 4AKIA 3AVQA 1G3QA 1QHYA 5SZKB 4WVFA 4ZIRA 1N6LA 1WF3A 5HPYB 2QBYA 3EAQA 1XJ0A 1FFHA 2RHMA 4JVMA 3CKLA 3LX5A 4PAOA 4AK9A 1II8A 1Q20A 1US8B 2LWIA 2H5EA 4OHVA 1GVNB 4AG6A 3QXCA 1HV8A 4R2IA 4AG5A 3TUIC 4TSFA 2VQSA 2HLDD 4X8LA 1G18A 3GEEA 1GTVA 5GJVC 1NY5A 1CBUA 3LRPA 5FTLA 4X8MA 1JEEA 2D06A 4KO8A 4LX0A 5KPJA 1P6XA 1YKSA 4J0QA 4LPSA 1JEDA 1NIJA 2HJVA 4TLBA 3FGNA 3CONA 5FOWA 2WV9A 1K5DA 4HAXA 4URXR 2O8EB 2CL0X 4MYTA 1D2EA 2Q21A 1EFHA 2V6JA 1P9RA 4JLPA 4BLPA 4Q1AA 1R8SA 4DSUA 3ZVRA 2A5JA 3SU8A 1XTKA 3T15A 4IOJA 1VIAA 3IPYA 5FPSA 3OIWA 1MO3A 2IS2A 4MYCA 1GL9B 4B3BA 4IJMA 2ZU0C 2ZI9A 2GJ8A 3W34A 4ZDKA 4IEIA 5C18A 3U7FB 2VIIA 3RS5A 3WP1B 4AIIA 3VR1A 4TL7A 4E22A 3CPJB 2GKSA 1ETUA 1Q22A 1BYIA 1Q44A 4FXPA 1KJZA 1LW7A 2GVDC 3DKPA 3GMTA 2UVQA 3RABA 3V9PA 1FNNA 5TARA 2E1RA 3PUXA 2DB3A 4NE2A 1IOZA 2C03A 1D6JA 1WBDA 4RZ2A 3KX2A 4EFNA 4MKGA 4Q66C 2CK3A 2ZRGA 2ZAOA 3X1YA 1XD8A 2IUUA 5DNYB 3QXJA 1UPTA 5ANRB 3CUEF 1QHXA 4OQFA 5LD2B 2OFXA 3C14C 3F8TA 4KVGA 4PPQA 3BFVA 3H4MA 3KL4A 5L3SB 2R9VA 1CF4A 2ZJ5A 1RFLA 5KNBA 2WTUA 1QDEA 1I4DD 4EFLA 3U44B 3EG5A 3VR4A 2AHOA 4IVQA 1DAHA 2H92A 5FOSA 2BCGY 2RCNA 2VL7A 4AURA 3T1VA 1Z0JA 1T8UA 3L8YA 4NYIQ 4PQRA 1KHTA 1KSGA 2J1LA 2YC2C 2IS1A 1NN0A 5HE8A 2AXNA 4QC2A 4YXWA 5KHOC 1YHNA 1Z0DA 2CE2X 3CR8A 2YINC 3CX6A 2WWIA 4DJTA 4NCKA 2RGEA 4M1MA 4LJ4A 2QTVB 4US1R 1KNXA 3BH7A 4KU4A 3AVVA 5E3HA 1HTWA 2AX4A 4QNMA 2BHRA 2X2FA 1JI0A 5TVKA 3DPUA 2NTYC 5KSOA 3FMIA 1E4YA 2IL1A 1XXHE 4ZKEA 4MKIA 1OXSC 5KOYA 3EPJA 2QNRA 1SXJE 4QGHA 3QXHA 2F1IA 5FTNA 5FTMA 5FFMA 3MWYW 3VU9B 1OH6A 4RD0A 4HLUC 5CB6A 4LBVA 3X1WA 1IJFA 3GLHB 3I3SR 4TTPA 3Q5DA 4PO9A 4ZO4A 5FBVB 2ZS8A 4JL5A 2QU8A 1JJ7A 1WA5A 1IONA 5CM9C 3T1TA 3CNNA 5DE3A 3KQKA 2MSCB 4YMUA 1ZUIA 3EA0A 1XXHA 3P4XA 2XITA 1UDWA 3TMKA 1XTQA 3UWKA 1BIFA 1SXJA 1Z0AA 3CIOA 3X2SA 5EE0A 4QOSA 4O2LA 2GEDA 4AKEA 1XMIA 4HLQB 3RRZA 1QHNA 1ZYUA 4JJKA 3VHLB 2OM2A 1QHHB 1PJRA 3HWSA 3DVLA 2YNMA 4MGZR 5JBQA 2XNDA 2ZVQX 5CJ2A 2F9MA 4WAUA 2JGNA 3V00A 3M1IA 3IQWA 3B9QA 3QEOA 4FMBB 1GKUB 3DZ8A 2QQEA 5J47A 3ICQB 5IRCD 4ZDWA 2KB0A 3D3QA 4P3YA 2EVWX 1SXJD 1Q1ZA 2IYYA 1HQCA 2PEYA 4FCWA 4TL6A 5EXPA 3GQBA 5HCNA 4BFWA 1RVDA 1ZINA 2QM7A 3QIAA 5CDFA 2QUZA 2ZI7A 2WM9B 4EAQA 2OSBA 1NJGA 1XFAA 3BH0A 4C7OA 1IN7A 1UEJA 2ZRFA 2XNDD 2ZRIA 3NDPA 2BM0A 2DFLA 2ZTSA 4KLZA 4R98A 5J4VA 5KPDA 3SQXA 4L9WA 3BB4A 2CLSA 2OXCA 3GLIB 1LTQA 2ANCA 1EESA 5JS7A 2QPAA 1S0UA 2KBEA 2PT5A 5H8WA 4HATA 1UFQA 3S1AA 5HE9A 1I4TD 1W2HA 4QNRA 1E9CA 1G6OA 1RRPA 3A8TA 1XNJA 4UNPA 1HEIA 3CLVA 3C7KA 5FOXA 3TJZA 4RCZA 2OV2A 4QGGA 3SJBA 2XJ9A 4BFVA 3PEWA 3CBQA 1AKYA 4GBMA 1NMXA 3EPKA 5B30A 4KCGA 3I72A 4URWR 2HT6A 4EPTA 3NTUA 3SS8A 1NF3A 4P0TA 1XPRA 1N0UA 3QF4B 3NBZC 1T0JB 1E9EA 4JSYA 1CR4A 3WHLA 4EJSB 2A2ZA 3CRMA 1FQKA 4Q4HB 4WZAE 1FW6A 4DKXA 1E2JA 2AKAB 4PQYA 3P4YA 2BJVA 1IQPA 3B78A 2WAYA 3EA5A 2DBYA 4D26A 2Q9CA 3CRW1 5HCIA 2OCPA 1WRBA 2NOAA 4ZDJA 3AF3A 3HR7A 2H17A 5CIWA 5HZHA 3HU3A 4Q03A 3DL0A 1SULA 4MRVA 1VG0B 1ZM3A 5KTYA 4QHTA 2OILA 3UG6A 3L0SA 3LDAA 3NVAA 1Z47A 1E0SA 4HEJA 1E2NA 2C78A 5CK4A 3SYKA 4ASUD 1NLFA 5E95A 1W49A 1XTRA 3AKEA 4TYNA 1ODFA 2ATXA 2GCPA 4IW3B 4F7WA 1XCMA 2PJZA 4TLDA 2GRJA 3K0AA 2P5SA 3AP2A 2QI9C 4LHYA 1CULC 2WKPA 3ND8A 4ZV4A 3SFVA 1SVLA 2C77A 1TUIA 1T6NA 3KXLA 1N6PA 2OBNA 2XTMA 4BUJA 2JLSA 1TF2A 1SQ5A 2MSEB 1JPJA 1HA3A 1E96A 1E69A 5CK5A 5BYKA 3NH9A 4TMVA 4UJ5A 1U9IC 1G291 4AI6A 1S2MA 4RKEA 3V4FA 5AUNB 1W5TA 2NQ2C 4Q4LA 3U4QA 1DAMA 2LKDA 1N2CE 4D4JA 4IOKA 2ZRCA 3C5CA 3PUZA 4IDHA 4LCBA 3W9YA 2ZRHA 2ZRBA 1NY6A 1PUJA 1FL9A 2A5YB 4XWKA 3RWMB 5LD2C 2REBA 5FPTA 3WRXC 4D4KA 1Q21A 1DAEA 4IOLA 5L8VA 5DYIA 2ZANA 3CF2A 4Q7JB 1E2GA 4E09A 4B76A 1T3HA 4DDVA 1YR8A 4D0LB 4G01B 2BMDA 2F3RA 1P72A 1NMZA 2ZUCA 1QHIA 2F1RA 2GF9A 3K0EA 3LVRE 1KK2A 2GZHA 1AKEA 1LS6A 5EE9A 1BKDR 3TUJC 2R62A 4KFTA 2ZRPA 3OFNA 3B9PA 3CX7A 1MO4A 4I4LA 1IY1A 2MSDB 3A37A 1G3RA 2WIBA 5FUXA 3WYGA 1R7RA 2GCNA 4NMMA 4OK6A 2AK2A 4CYMA 3BOSA 3GD7A 3VFDA 3KZ1E 1GNRA 2QPTA 1ZD1A 3IIJA 1XJQA 2IHBA 2KI5A 3DM9B 2AKYA 1E9BA 2R6AA 4DLWA 1ONBA 1Z22A 1EWQA 2UZ3A 1LB1B 5G40A 1ESMA 1GRNA 3OFND 4GRAA 4FWIB 1E9SA 4KODA 4LYFA 4DB2A 4NTZA 4IXMA 4TQAA 2BJWA 2QTHA 4W5HA 3R8CA 1ZC3A 2P5TB 2C99A 1NBME 1QZXA 5AWFC 1GNQA 1H8EA 1IXRC 1SHZA 1ZM9A 3PEUA 4JVLA 2VHTA 3D7MA 2RHDA 4O25A 2PZGA 4ITRC 2X19A 5GJCA 1UEIA 2VP6A 1CR2A 2RGAA 4MKFA 1RJ9A 3I61A 1G8GA 3ND9A 1KKLA 1NI3A 2ZRLA 2QROA 2V54A 4N1AA 3E5HA 4HB2A 4BEJA 3U3JA 4XWAA 3A1SA 4RFVA 4KI0A 4GFDA 2NIPA 4GP6A 1NBMA 3PJRA 1B23P 2FA9A 2ZJ2A 4M9QA 1TQ6A 2IT1A 2OCYC 3QOFA 2Z0MA 5KSZA 2HUPA 3ADKA 4TQUS 4C0AC 2A7QA 5FR2A 4TT3A 1H8ED 5K8UA 1CKEA 2JEOA 2FGJA 4G5RA 4DIEA 4OYHA 1U8YA 1JECA 3HJNA 1AGRA 1KI6A 2B6HA 2ZJAA 2W2VA 1ZAKA 1CP2A 2C5LA 3R9WA 1G64A 4Q7KA 2J0UB 1P2TA 3FFBA 1TF7A 2AD1A 1NBMD 2WOJA 3ICEA 2IXEA 2V55B 3OEEA 1M34E 3AKCA 3THYB 2GXSA 2BKUA 2PZEA 3CRQA 1SVWA 4PZLA 2HF8A 4IHQA 4DDTA 1TPZA 5JLJA 4TYYA 4TT3D 4B33A 3TQCA 1ZCAA 3AM1A 2IXGA 2X8AA 3QUSA 2G9NA 4LJ9A 5M04A 3A1WA 1EGAA 4B3FX 2J9RA 1KSJA 1VCMA 2AFIE 2HYIC 3FB4A 4JYCA 2V9PA 3Q5EA 3PG5A 1R10A 2VF8A 2IEZA 3EARA 4JLJA 4EFMA 3HP1A 5DIFA 1ZJ6A 4NU0A 2A9KA 3EW9A 3J81k 2PT7A 1T5IA 3TQFA 2W00A 4A6PA 3U6BA 1NL3A 5DI9A 1KDRA 2D7CA 4EJSC 2R44A 2CCGA 2J87A 4R7ZA 1A1VA 2FG5A 1Z5ZA 1ZUNB 1MT0A 2ZXUA 1G16A 3FDIA 1YRAA 1RYFA 2O8CA 2E87A 2YHSA 4YQFA 1XWIA 1G21E 3H86A 2FZ4A 2MMCA 1H65A 3IEVA 2P6UA 2VF7A 4M9SA 4P32A 3WRYC 2ZR7A 4ARZA 3ZVLA 2FEMA 4LV5B 5JWOA 1W36C 4B35A 2CLDX 4DLSA 1SKQA 2XOKD 3L82B 5JI2E 3CNOA 2WWHA 3K09C 3AEZA 1G3MA 4BFZA 1XZQA 1PUIA 1ZU5A 2AFHE 4ZCLA 5TV2A 1YZTA 4I1SA 1OH5A 2CJWA 1T5LA 2QZ4A 4KAXA 1N6NA 2OBMA 2YJTD 1AQUA 2VO1A 4E5UA 4G5SA 3THXA 2D3WA 221PA 4F4IA 3WMEA 5HTKA 3QBVA 4NZYA 4GL2A 1UF9A 4OK3A 2WJJA 5KUTA 1GWNA 3UWOA 3K0SA 4X8HA 2BEJA 1II9A 2FGKA 1H8HD 2QGZA 3IO3A 4B3CA 4BFTA 4AY2A 5F9FA 1GKIA 2VRWA 4QJ5A 3N5CA 2GEVA 2IUTA 2VEDA 3DM5A 1IXZA 4KBGA 4D6PA 3MLEA 1YVDA 1KZGB 2CL6X 1UM8A 4JT2A 5CYOA 1Z0FA 1IM2A 1IBRA 4BLQA 1EWRA 2OCAA 5K8LA 2XX3A 5EZ5A 4JL8A 2N42A 3IHWA 5A0FA 3BB1A 3W5JA 1J90A 2OBLA 3TE6A 4LHWA 1NVVR 4LJ6A 4IXNA 2NPFA 1G20E 5CM8B 1Y63A 3L0IB 5AUPB 3EC1A 4OI4A 4V0OA 3QQ5A 3A58B 4YDHB 1AZSC 2CEAA 1F3OA 3VR6A 3T34A 3W6NA 3BWDD 2A5GA 3K9GA 3KQLA 1FUKA 1N0WA 2QAGB 3A36A 3FMFA 3C41J 4MA4A 4YMTA 2XZOA 1GG2A 2ASEA 1FUUA 3LFUA 1XMSA 3JZMA 4V0LA 3BBPA 4AKGA 3CWQA 1P2VA 1BO6A 4OHZA 2IYZA 3WY9A 3HYTA 2IHYA 1ZNZA 4DCSA 3W3AA 4OI1A 2DWQA 1PLKA 4A6XA 1AZTA 3CR7A 2FSFA 3W6OA 3W8NA 2CCJA 5DI3A 3BH6A 1OIWA 1GIAA 1IN6A 3MSXA 1EFRA 1S96A 4JLDA 4B74A 1OH7A 4A8JB 3LQRA 2EFCB 4EPVA 3AVWA 3ZZ0A 3HPQA 4B2PA 4DDWA 4V0KA 2QE7A 5FPKA 4URYR 2FX3A 2I1VB 2HCBA 1X8KA 4FCTA 1VYTA 4LC1A 1JPNA 2P3SA 1UADA 1E0JA 2HYDA 2PZFA 2F55A 1CJMA 2NO1A 2PJRA 4Q9JA 2VHQA 2J7KA 4OJQA 4I81A 2D62A 4JLMA 1OLOA 1U94A 1TQ2A 3A4MA 1JALA 2P2LA 3DHWC 1FNMA 1U81A 2HLDA 4LY6A 1QHGA 3GLFB 3Q9LA 5JRJA 3DOFA 3RRMA 5KDOA 5TDHA 3RSLA 1M7GA 3K8YA 1E1RA 1XBTA 5F9HA 2XZPA 2QE7D 5E7JA 3WBJA 1KDTA 1MRSA 1XTJA 4LWZA 5A5GA 1PLJA 4IVPA 4M1OA 1TQ4A 3CH4B 2FSHA 4F92B 3Q8XB 1Z0IA 3AV0B 3T5GA 3LXRA 4H1VA 3RANA 3SN6A 1BS1A 2EWWA 2WWFA 4Q7MB 4QGFA 3VR3A 4JBXA 3KJEA 3LWNA 2NO0A 3F0TA 3SR0A 3A6PC 2YZ2A 3FVQA 4D81A 4DXAA 1Q1BA 3MWLA 3RRYA 4CF7A 2X1VA 1FMLA 4GZLA 2D2EA 2QENA 1E1RD 4M1YA 1MO6A 5DHAA 2F43B 1OFTA 4YC7A 1Z63A 1OT3A 5L3QB 2C9YA 4C30A 3KKNA 3MG9A 5DN6A 1G9XA 5P21A 4CEJA 2E9SA 4UNSA 5AUOB 5GADl 1DOAA 1E2IA 2JATA 1NRJB 3QENA 4BWYA 2ZRJA 1Z07A 3MJRA 5E4FA 1XPOA 2FEOA 5BWMA 3RS4A 4PR0A 2PMDA 3MJHA 4XTCS 3GCGA 2YWGA 5LB2A 1A2BA 1GUAA 3HYRA 1OXTA 1YZUA 2NG1A 1MABB 3LBIA 4DLUA 3EZFA 3S1AB 1BYUA 2CXXA 3CWZA 2ONJA 4Q1BA 5FR1A 5J40A 1XTSA 5JSZA 2AD5A 2ZRDA 2QL6A 2JJ1A 3K0CA 1OXUA 3NHBA 5DN6D 4LYHA 4DB4A 2ZSDA 1VKJA 3KFVA 2Q6TA 4OL0A 3AVTA 1J99A 2EU8A 4EKDA 1TMKA 3WYFA 4M2LA 3D31A 1LF0A 2W6IA 4MRSA 3LXXA 3U6KA 3OEHA 2BBSA 2QT1A 4NCIA 5H1YA 2GK6A 1P62B 1E99A 4MDFA 4JL6A 1IHUA 3LVQE 1GITA 2C96A 3EIQA 1A82A 1KSHA 4XSGA 1ZM2A 1NIPA 2WKRA 4GMXA 1F2TA 5J4LA 1W0JD 2QP3A 4FMDF 4EPRA 4KITB 2JJ1D 2QA5A 3P20A 4NYJR 4PHGA 3FPAA 4JLOA 3ZQJA 2V1UA 4HLUA 1I2MA 5CYPA 4PSAA 3REGA 1RE0A 2G3YA 2YV5A 4BZXA 3KUCA 4MYUA 4MRNA 2W6ID 4RKFA 4KSCA 4YLGA 1U90A 3R9IA 3T06B 3T61A 3KKPA 2XB2A 1VIYA 1CJUC 3OEHD 2BWJA 4HAZA 2Q0HA 4LDJA 4LHZA 2ZI3A 2JLYA 4O3MA 4B43A 3T5DA 3U7GA 1AGPA 1O3YA 2F7SA 4BZPA 4WZBE 5EE3A 4Q48A 4RD3A 3K0AB 4OQLA 4DT1A 4YMSA 1E9AA 3BGWA 5TB5A 1CTQA 4F4JA 1KO8A 3LV8A 4A0FA 4CEIA 2ZVPX 3KDSE 2GCOB 2D2FA 4NYMQ 1AJEA 2ZE5A 1U8ZA 3VKGA 1FX0A 3CF0A 2WMNB 3I5XA 1GFIA 1D5CA 2EYUA 3B1ZA 4IVRA 4MQBA 1A7JA 1R5BA 3TAHA 3K70D 5DHFA 4EPXA 4BFXA 2FOLA 3PUWA 1KAGA 3DMNA 3KTAA 1ESNA 2YWEA 2ZU6A 2IYRA 1UJ2A 1UKEA 2P67A 2QMUA 1EX7A 2WSSA 3FTQA 2Q9AA 5GVRA 3MRSA 1G17A 3LD9A 2XB4A 4Q9HA 4YMWA 2EQBA 1HT2E 3LA6A 4A2QA 2ERXA 4LUCA 4QBIA 2R2AA 2ZAMA 3GJ8A 4C0KA 1YZKA 4AYTA 1GL6A 2GF0A 3BERA 2ZRMA 3QKSA 4A9AA 4F93B 4QGAA 4UKDA 4C3ZA 1GRRA 4QM7A 3AVPA 5D3MA 1E0AA 4P4SA 1IAQA 1C9KA 1L4YA 2GK7A 3P1JA 4EDHA 4QHSA 2C8VA 4L5BA 1G7CA 4ABYA 2VP5A 5CB8A 5H68A 2WKQA 2V6IA 2DR3A 4DEXA 2AN9A 2QAGC 3LH5A 1Q3HA 1OB2A 3JVVA 3RS0A 1VYVA 1Z6TA 2PLRA 2WSSD 5D3QA 4HB4A 2KWIA 3QPUA 1P3JA 4RD1A 5SZJA 2JDID 2ZITA 4OKSA 1G5TA 2QEQA 2ZSBA 4DCVA 2ZR9A 2O0HA 5IT5A 4DCTA 5FBRB 4DDUA 3FE2A 1TEXA 3ZDQA 1KMHA 1QBKC 4IFBA 4D80A 4D4MA 2HV8A 5SZHB 1F6BA 2CLCX 4POAA 3VR5A 1W0KA 4OHWA 1OXVA 2C2HA 1FP6A 1G7TA 2GTPA 1T91A 3PITA 1EX6A 1YJ5A 1M74A 5DISB 2QTFA 4LZZA 4A8JC 4HI0E 4A2PA 1HURA 3TIFA 4IDQA 5E7MA 1L4UA 4OBEA 2ODNA 3OHMA 4GOXA 2IEYA 1K6MA 3B2EA 3H1TA 4JVSB 3B60A 1X1SA 1P7CA 1OW3B 1U0HC 5FUWA 4GNKA 1GM5A 1MRNA 1E9DA 2FU5C
chains in the Genus database with same CATH superfamily
4NLLA 5HSGA 4JB3A 3IPAA 1CUSA 5HIMA 4WEOA 2WJPA 3SIRA 3IP3A 3OJOA 4UM9D 3PIDA 1N6IA 3CUVA 3LHIA 3AC0A 5ERXA 4NENB 1L4FA 3W5BA 3G9TA 2AS0A 3JASA 1XKLA 2FLWA 4HL6A 5EQTA 1F60A 5L51A 2CWDA 1HR0B 2A4KA 2QN8A 1IEWA 3CPEA 2GPYA 1QB7A 1FU4A 5F1YA 2AKEA 1PFGA 1UDAA 3DGFC 3DTNA 3EWNA 3I83A 1DRWA 1DAGA 4FINA 5JAUA 3UH0A 2A94A 2A57A 4TV8B 2QRGA 4QUAA 1U2QA 1X7XB 2GFQA 5LZ5A 1P0MA 4RSRA 1TXGA 4ZQHA 3RSHA 4D9EA 1ZD8A 2G5CA 4K0RA 5F3RA 2FETA 3T5CA 1AV7A 1VG1A 4MROA 1NR5A 4U7FA 4H3VA 3O2QB 2YQ5A 1U9IA 3JATB 5FADA 1DAFA 4ZHSA 4S1VA 1TU3A 5JAOA 4DV6B 4ZANA 4IG9A 3INGA 1VI6A 4UVIA 4DJFC 1K7CA 1MIOB 1P9OA 2FCAA 5AW9A 5B2EA 1W36B 4LDRA 1OFUX 1Q1GA 3OM9A 3WMFA 4B4DA 4ZZ3A 1ZSNA 4I36A 4URZR 4B1FA 4EMBA 4YAIA 3D8NA 1EFTA 1OIVA 3GWZA 2JIZA 1KI7A 1KKUA 2JGJA 4ZICA 2HNAA 5FL7D 2I3AA 1W48A 4NVRA 1OB5A 5FF9A 4M7OA 3IIMA 1E2EA 3JWHA 4QFMA 3HLTA 4RMNA 1J0DA 4GRDA 2XSZA 4H3KB 3VKUA 2GDJA 4HXGA 4TMZA 1BXGA 3EGDB 5L3SA 2PSDA 3PNMA 1B6RA 1CUGA 1GNTA 1ICEA 1MFZA 1OF1A 3L7KA 4HOYA 1KP9A 3SMQA 1S1CA 1EFCA 3HUFA 3NHZA 1V1MB 2H2FA 3Q3HA 5T7BA 4ZRDA 2RK6A 4BMSA 4LSWA 1Y9ZA 3ESQA 2IOFA 2JH9A 1ZSVA 2VATA 1UPBA 3PD7A 3V8QA 4CLEA 4DA0A 2Q9UA 4JI7B 3ONEA 4BNVA 1T9DA 1Q1NA 3B6JA 5LWHA 2I54A 1H2WA 1EWVA 2YJ3A 4I6GA 3WOVA 1SVOA 1N92A 3X1JA 3K2QA 3JD0A 4BEBA 4I5FA 3EK2A 4XX0B 1D7OA 3CEAA 1PDWA 1QUFA 1LS1A 2IZZA 2TMGA 3QUQA 5HDQA 4K9DA 2G08A 1ZMTA 3E3AA 1RBQA 3KKKA 1XDBA 3ROXA 4QRHA 2Q9BA 3BCHA 3QW4B 4LY0A 1JSCA 4WKOA 4C0JA 5JNLA 1K06A 2PZ8A 1PFKA 1XQWA 3F97A 4I2NA 1RKXA 3ELUA 1QPZA 1AGYA 2R1TA 3ZHUA 3ABQB 1LBSA 3QU7A 1C3LA 1E2QA 4JP8A 4RK5A 4FHFA 1QIGA 1UZMA 4YMHA 2A0XA 5D87A 3WIUA 1YHZA 2PX5A 5FUVA 3IB3A 3AB8A 1HY3A 4G37A 4U63A 1PJLA 5C81A 1J8MF 1J70A 2DG2A 2GBCA 5F33A 4JJ6A 3Q8MA 5IFKA 1N2CA 3SBEA 3DEFA 1T3GA 3AJ9A 3OX3A 5DNEA 3ZCQA 2BPOA 4BJ6A 1J20A 1IBSA 1KQOA 3AIOA 3SVLA 1MB4A 1G4UR 2F3UA 4NOJA 4B32A 2PIAA 2CJWB 4TQ9A 4QYIB 4EKNB 4QZVA 1CIVA 2C54A 1J1UA 5CTAA 3OAAD 2CY0A 4O4LF 3ADBA 1ADJA 3EF0A 1G0NA 4JP3A 1II0A 5G1PA 1Z37A 5FOTA 4ZCIA 1WD5A 3ETNA 2VZ9A 5NULA 2QX6A 3PE3A 2A84A 3HR8A 4BVGA 2QBYB 1NW6A 1YC2A 1UJBA 2DLCX 1HUQA 4Z3DA 2UYOA 4UUAA 5ECGC 3CISA 5KMGA 4G9GA 2FMTA 4I8DA 3HVRA 2HGZA 4UU7A 1JV2B 4O4LA 1R15A 3PTAA 2P6NA 4UQLA 4DBLE 1OHHD 1TO1E 4ZQGA 1TGYA 4KLNA 2IZ1A 2AF3C 3O95A 3ILHA 4MXDA 1TYBE 2WM2A 1ZBDA 2V5VA 1V7PC 1X7HA 1SOVA 2WHPB 3EODA 3IDQA 5FPHA 5TGTA 3SDSA 2QJFA 2G36A 4G8DA 1F8XA 4CRWB 1ZHFA 4JOSA 2GYVA 1FQOA 1TT5B 1CQIB 1LBHA 4K9LA 1LVUA 4MOWA 4R31A 3RS2A 1KVQA 1YR7A 3VGJA 4C20A 2X13A 1MX9A 4EATA 1EP9A 3ORQA 1FB5A 2C83A 2B1QA 5THXA 2H5IA 4ZRMA 4ZCRA 3FHLA 1YJBA 2IU3A 5H83A 2VP4A 1Y5NA 1C7RA 4TRNA 2DKFA 1BMDA 3AEXA 3MWKA 5IF3A 5KWSA 2OVBA 3H5RA 2WQ6A 2EKBA 3AKDA 2J48A 3M5WA 4ZCMA 4G4SO 2O5CA 2HIMA 3PR1A 4I1VA 5KTMA 1XTZA 1ZCJA 4GUDA 5AM3A 2XR1A 3PC7A 4LNUB 1DPFA 3CX8A 1VMAA 2P4EA 3FJOA 4CG1A 1G60A 4OLFA 1GPWB 4AY3A 3S4YA 4QTYA 3JAKB 4MICA 3CLRC 3IV9A 2ZCVA 4MYRA 3ZWQA 3A1CA 1OAOA 1RYMA 2OFWA 1IWBB 3KLPX 5T8KA 3TRHA 5I48A 2EFDB 2IHUA 5B1HA 2X8BA 4DNFA 3CN9A 2YOHA 1GGVA 1A8HA 4I99A 4O1IA 1CE8B 4OMFG 3COVA 3B1WA 1G9TA 2XVMA 4TRMA 1Q0HA 4HRAA 4C4OA 5JT1A 1HT1E 3WAGA 1UDBA 4V1CB 3D2LA 5TF0A 2ZRKA 1NR1A 1MX3A 3LIIA 3LO8A 1Z2EA 3KOUA 1EE2A 4AKTA 2HA4A 3EPLA 2IX9A 3M89A 3N2GA 3AY6A 4NFSA 3C3KA 3IUNA 1TADA 4K8RB 4J0DA 1TCCA 5JDCA 4S04A 1DARA 1FP4B 2J9FB 2NSHA 4RTJA 2OVFA 2R48A 3KKZA 3CC8A 3T7EA 3V4RA 4PX9A 3SVZA 4F5WA 4RYDA 4Q9DA 5L3RA 3RVKA 5HF9A 5IAKA 1G41A 4Z8YA 4AXXA 4XUDA 4C14A 1ZOLA 4BMXA 5BNWA 1RPNA 3OJEA 2BFEB 2PX0A 1EM6A 2W4IA 3UMGA 1KXJA 4LYJA 4BLTA 3ZI7A 4J9UE 2F8TA 1Z33A 1ZESA 3C2QA 2COUA 4E5PA 2V6MA 4ZIRB 2OZKA 1T36B 1U63A 4EF4A 3P9NA 1I7DA 2JGAA 3CU5A 3GLSA 4C1BA 1FFAA 1GLNA 4KIWA 3HI4A 1JQKA 1USWA 4DR2B 1XQ1A 2WAXA 1E2BA 3EC2A 4BP1A 3F7MA 2H1HA 5LQNA 5EXSA 2R7MA 2OBFA 2OLEA 2FMXA 2BUCA 3R20A 4BGEA 3OP1A 4HYEA 4FOOA 2QMHA 4QUKA 1GZ3A 1YB1A 4D9MA 4IOMA 5DW3A 2RKBA 3AR6A 4Q7EA 2HPAA 1XMPA 3CVYA 4NABA 2WD7B 2I4IA 2XA2A 1NVXQ 1V39A 3HBFA 1BH2A 4FR5A 2A0WA 3B8EA 2FSIA 3CHYA 4J29A 1GR1A 4HEQA 4B2LA 1L8QA 2WSMA 4D3FA 3QFTA 1HEYA 3BFXA 1OX4A 4GSLA 4CMIB 3ZV5A 1PFQA 3OU7A 1FLDA 3FF1A 3KU1A 4KZPA 4HXYA 2CCKA 4O8ZA 1W25A 5E8JA 4EHKA 1IXYA 4DLYA 4JASB 4WLVA 2C31A 2GYYA 1KJIA 5FI0B 1AXEA 2GHTA 4D9NA 1IEXA 2P69A 5DW0A 4CHGA 2E21A 5KNDA 3NHFA 3HZOA 2DAPA 4GOND 1YUBA 5ECDA 2YWCA 3KQHA 1U0NA 3W3AH 3P52A 3WNCA 1N7IA 4DMUB 3EOZA 3LT4A 5BOSB 3LZCA 3ET5A 3V55A 1NBOA 4IIJA 4IWNA 4F45A 2XF8A 4RC9A 4HWKA 1ZHHA 3K9BA 2QTMA 3PV0A 1WNFA 5AM5A 3C8UA 2GBLC 3IP8A 3O8BA 3DBVO 2HJSA 3FG9A 1EUQA 2DHQA 3PZRA 3L5OA 4HQNA 3UK2A 3P94A 4DA4A 5AKKA 1M2KA 1M7HA 2IPXA 1JIVA 4IFEA 1AXGA 1LNZA 4B3SB 1C2YA 2RBKA 1SKYE 3EGVA 3T12A 1E6UA 1FCJA 3O31A 1NQUA 1Z5GA 4RQTA 4CTMA 2J9YB 1YVRA 3MMPA 2FWIA 2IOHA 5C7YA 4RCYA 3H42B 2G1PA 4HMQA 4F6LA 1FQWA 4KO1S 4QVGA 1FYXA 1R0ZA 2CL5A 3K0KA 1U8XX 3GT3A 4BASA 4LF5B 3NATA 2QDXA 3DZBA 2TMYA 1KL7A 1I2CA 2CW5A 2IW3A 3PRHA 4RTSA 3BQ9A 2BCJQ 1JKIA 1K88A 1UC9A 2CB9A 2HDHA 3AOEC 4NJEB 4ZDIA 4EUEA 5L7WA 1R9NA 1ZJYA 4MGHA 5A62A 1E2HA 3JQQA 4LZLA 4CGZA 4AJHA 4CMGA 1Q77A 1VMKA 4CM1A 5K6TA 2OXRA 4K7JA 4MJ7A 4PHCA 1LBTA 2VSFA 3TXAA 1MKYA 4GYWA 4O2AA 2CMKA 3E61A 4KXQA 4F06A 3RSOA 2QMOA 2X0NA 3DPIA 4IDAA 2X5NA 1V37A 4S05A 3FKSD 4JXJA 5KTTA 4ID3A 1U11A 3MMXA 3R3SA 2NU9B 4RMHA 4Q24A 8AT1A 1JJFA 5CA1F 2XNSA 4JJEA 2NGRA 3B9RA 5HA5A 2MIIA 2FDXA 3B5JA 3I9LA 1E4EA 3II6X 5EP1A 4EHLA 1SVNA 4LE2A 3VA7A 1ONSA 1HFJA 1Z62A 1PHPA 1T6BY 2C82A 3GDHA 3V48A 2DQKA 2PUEA 2PD6A 1KFEB 1ZMXA 3AV3A 3UFBA 3OCCA 4WKNA 1V48A 1J2RA 3MB8A 3CY6A 1HG1A 4YP0A 3WWOA 3LPAA 1XJ5A 4QVIA 2FOIA 2WICA 2GXQA 1OYYA 4EB0A 3ODGA 2H29A 5IULC 1KQFA 3B7GA 4KRXA 2ORYA 3K6SB 1ILEA 3E1GA 3IBCA 3MEQA 4WFIA 4JLKA 5CA1A 1PJ3A 3N5KA 1NF8A 4TYPA 3E2PA 1D04A 4PGHA 4A2CA 4BNGA 3HYNA 4H7IA 3NGXA 3HCDA 4NOMA 2ZUEA 1NVEA 4KIGA 5BXYA 5BW5A 5LR6A 2ZR0A 1U0RA 1I36A 4KR3A 3O94A 3UJAA 2WOOA 1DLJA 1YRBA 3HV0A 4E1AA 2XAUA 5K3CA 2HA7A 2XVXA 5I7SA 3KYJB 3WJ7A 4GC5A 4GLJA 3HU1A 1YZGA 2QZZA 3K9HA 2BMEA 4ARVA 1HYBA 3WGHA 5KHAA 5HUHA 1NMYA 5F5LA 1FSFA 3M1YA 2Q5OA 4P4UA 3OZXA 4ZP1A 1P1RA 5JIBA 1DRUA 2IEIA 2ZB7A 1FNDA 2R5WA 1OV4A 2ENUA 1VG8A 2FW9A 4UCFA 4Y2TA 1S8FA 5H70A 2NT4A 2YMQA 4TMXA 3S1LA 1P5ZB 2HAEA 4DJAA 4KNYA 2C7VA 1SG9A 1IM5A 2HSWA 4G5FA 4JB0A 1Z5OA 1Q3TA 2CVHA 4Y2HA 3E1KA 3VPSA 3GOQA 5BWLA 2Z5LA 1ZOPA 1XL0A 2H7YA 3OPYA 5CX1B 3TX6A 3LHKA 4TKUB 4A5SA 2Q6KA 5JI3E 3GU3A 4B2IA 5HTOA 5EY5B 4K6HA 2EW2A 4HNAA 1IZ8A 1VMEA 1KK0A 3KOWA 2INGX 3OD1A 4H60A 3LZ6A 1F2UA 4MW0A 4X1YB 3TOSA 2COEA 3ESXA 4YUVA 1W5AA 4RIFA 3IOYA 1NHWA 3FSGD 4Q02A 1TYZA 3OOEA 4MWCA 3U26A 3KQUA 1PEDA 4D3XA 1MQ8B 4HWOA 4QO8A 2AI1A 2PH1A 1V4VA 1WL8A 2FQQA 1QQBA 3DL4A 4A92A 3TQOA 2ZWOA 1H2RS 4HKTA 4KPYA 3DBLB 4MKHA 2OUKA 1X8LA 3PXAA 1NRXA 1FNCA 2DQSA 1CXZA 5CD9A 1BEZA 2DTDA 3GA7A 4BJHB 3IRUA 3TL2A 5FNVF 4MDEA 2DP4E 3FDJA 1DV2A 2JJQA 2R1VB 3N7UA 4L4UA 5DVZA 4EPWA 4PNPA 4TLEA 4JLBA 3WBFA 1XO1A 2E3JA 2PXHA 3ORHA 3QLVA 2ZWIA 3QPWA 2ZUFA 3H8WA 4QPDA 4TXJA 2FPLA 3Q2IA 4FYMA 5DM0A 4MV7A 4ZXFA 4BBPA 2IQIA 1YS2X 4GP7A 3S5JA 1JR6A 3KVNA 3INRA 4GS5A 1I13A 1XZCA 3FUXA 3NH6A 4RKRA 5GMOA 4EG7A 3E2IA 4Z86A 3HVJA 2PKYX 1W46A 1WEKA 3GCDA 4HJRA 4OJKA 4BKOA 3ZZTA 2GHQA 2X0JA 3EY4A 3OU6A 4PCUA 1BOOA 2AHRA 5DO9A 1Q92A 3LOPA 2B37A 3QQPA 1O08A 1PVVA 3N2IA 1QIFA 2FPGB 3FI9A 3H6GA 4ZZIA 2R47A 4JJ7A 2B8WA 1E61A 4LSMA 3P5SA 1I1HA 4ACAA 3ZWCA 4CM4A 3FSJX 2DX7A 2OCXA 1T3SA 4TMYA 5DLDA 3SSNA 2EJWA 5K20A 4MR7A 1YMVA 2EOAA 3FHOA 1E79A 3DLIA 4FGWA 1J42A 2ZROA 2FP4A 3MIZA 5LOVF 4PGMA 6ADHA 4B0OA 3SWWA 1YCFA 5JHHB 3THWA 4OMUA 4PPYA 2BKEA 2NP6A 1PQPA 3RK1A 2VHWA 1K08A 1RYYA 1T10A 2V7QD 2CE7A 4AKHA 1PT7A 2GEBA 5D51S 2AUTA 2OC4A 1W34A 3KLOA 5AJVB 4EG6A 2GEUA 1DBRA 1LLCA 4MV5A 1SRQA 2MSNA 3ZHSA 5TQ2B 1I3OA 3DHEA 3B1FA 1P3DA 2K7ZA 3H9CA 4OFXA 3TKYA 4HYTA 1CPYA 4WZAB 5G2OA 4JR2A 5BSEA 5BN4B 2VNJA 1F38A 4FI3C 1ECJA 2QNIA 4RV9A 1NC3A 5D5HA 2AK3A 2OWEA 2RSLA 5ICMA 4ENVA 5T3UA 4NG5A 2ZCUA 4WX2B 5B53A 4FDMA 3B52X 4K3UA 4LOLA 1T2FA 4FNGA 5CW2A 3FZEA 3PCTA 4EHIA 4ON9A 1I3KA 4EUFA 5EMLA 4LWOA 4YP9A 2I62A 2BFDA 3RVBA 2X22A 3FOCA 3G0IA 1K4YA 4MZDA 3JRWA 1IN5A 3U7HB 5FPYA 4HDSA 2IEAA 4HAYA 4YT4A 3NOOA 3WI7A 3AERB 3CSDA 3OIYA 2FSVC 1PEYA 3NPMA 3QTTA 5IXYA 4J75A 3C6MA 5FBQB 4Y18A 4PTZA 4LSZA 4D9JA 3WGGA 4NECA 5AVOA 3SAJA 4AMBA 1GHTA 4DCPA 4CTOA 1G2IA 3ZY3A 3I32A 3AVTA 1KI1A 4XZ3A 3SJCA 1CY1A 2ZETA 4FEEA 2CK3D 3L0DA 1G7RA 2HU5A 1CQJA 1VSVA 2VJCA 3EYWA 4PO8A 1U8UA 2X77A 3ENQA 3LBFA 1W47A 4TKVB 5BW8A 5C8DA 4B3RB 3ZLVA 3I6QA 3RRJA 2Z04A 2NUBA 1KYYA 1I3LA 3BZWA 4LX8A 3FCOA 4BO1A 3F5MA 4EYGA 2ZJ6A 5LKRA 5TX7A 2XCSB 4Y30A 3RYHB 3D5QA 1DKMA 1VCOA 1R9GA 2PRSA 2WVAA 1QH8A 1U99A 3QVGB 4IX9A 1D2NA 4MSUA 3WS7A 4MS3A 3DAFA 2JKYA 1VIDA 3DFMA 5CLJA 5G53C 1ZG3A 2OL4A 3FPBA 2I7TA 5IDYA 4JLVA 3DR5A 5JQGB 2OO5C 3PPWA 4OHFA 1RAAA 4UEWA 3MHTA 2HJWA 3LX8A 2YIDA 4PRKA 2I7DA 1EBBA 3L4SO 1WSDA 4XIIA 4OU5A 3T4PA 5JW6A 3VMFA 2IS6A 3NKLA 4MCHA 1PVOA 5DGIA 1KWGA 2UUBB 2DERA 2JJ8A 3DO6A 2GZDA 5D6NA 3N8KA 3UWPA 1CRQA 4ALKA 3BB3A 4R9NA 1OBVA 2AOUB 1FX1A 3JVUA 4MV1A 4QUIA 1QVAA 2WT8A 3MRVA 4KE8A 1U9ZA 3FOZA 1JQLB 3N1UA 2YXPX 2FWRA 3I8XA 3TI7A 5J43A 4G36A 3N39C 3DMRA 5KVSA 5A7GA 1D6NA 2VAWA 4M8SA 1W4CA 1AURA 4W7IA 5KSWB 1IH8A 3OQIB 2OCIA 1STOA 3B85A 1U4SA 3TZKA 2XBLA 3EQ9A 1E62A 4R54A 3N0TA 3BQNB 5GM2A 3OQ1A 3I5MA 4MAAA 5DPMA 1P0QA 3IH5A 2PRZA 4REQA 2IYTA 4AYXA 3L46A 4B6JA 1E6WA 2MMGA 1QG4A 1UJNA 1W4AA 3IULA 4FE7A 521PA 3ST7A 5CDFE 2P4HX 5JNUA 4MCJA 4HDMB 3QZUA 2OECA 1EJ2A 1TVKB 3EDYA 5J9FA 3UPTA 2H07A 1AQNA 1ZCBA 3KV3O 2FFQA 1X9IA 4BNFA 3KR2A 1CRWG 4PO1A 3UMJA 4FT2A 1IWOA 2XKKA 1N25A 2QE6A 1JHUA 1Y81A 3PUKA 1B26A 4FC6A 3TOVA 4DIOA 2IKQA 5J59A 3DBIA 4GGOA 2OBBA 3P0JA 5AOCA 5FPQA 5KJEA 3LWDA 5A9TA 4P58A 3R76A 4AY6A 2H48A 3K4HA 5WRFA 4GWGA 4HZIA 2Q1YA 4FFBB 3E7DA 2CDNA 4WGGA 3FM9A 2WJ4A 2PUFA 4Q9NA 4A36A 2QB5A 5GGXA 1G5FA 4PCAA 3RLFA 4E21A 1DEHA 3EGOA 5LKAA 4M36A 4TMKA 2GR9A 3UCXA 1C29B 1SO8A 1TFRA 1F1BA 2IE0A 1HE5A 2X2OA 3F3KA 2B1RA 3L7YA 4HYYA 3UICA 4OFWA 4ZYYA 5KX5B 1L1RA 1TM5E 2DWPA 3TLXA 3ONWA 1L4GA 1WR8A 1MABA 2QJOA 3JSXA 1Y9DA 1VBMA 3JRNA 3R5JA 1P6UA 4E51A 1KAEA 4YWHA 3UAXA 3ZJUA 3HDHA 3PCRB 4TVKA 1GXSB 4EGJA 4PZYA 3I6MA 3N53A 3F6CA 2BLLA 3R3UA 4RMGA 1BNCA 1RABA 3AKYA 2VXCA 1MU0A 4CGYA 3W1EA 1WZUA 2QL9A 3HYSA 5HKKD 3GP8A 3DO8A 4B7AA 1LDEA 1JQAA 1VYUA 2QTNA 1F8FA 2WVHA 1ZL0A 3G0CA 1U6IA 4TN1A 4PLPA 1W581 5M34A 2V6BA 2R79A 1HE1C 1XROA 1BH6A 5T4EA 4BCCA 1ENYA 1SU7A 3TR5A 2FZCA 1NV8A 2H4ZA 2LKCA 5KCMA 1UOQA 1T24A 4P7GA 4CDMA 2ZJ8A 5K0TA 1KI6B 4EHDA 1JFRA 2FWAA 4IDDA 5IM5A 3GNQA 1CC1S 1W1WA 4KTTE 1PF7E 3OKPA 2EKDA 2HOQA 2J30A 1Z7BA 2W2LA 3DLAA 4D96A 4BGDA 1XP8A 4OK5A 3I2KA 4G0YA 4NHEA 2B3TA 3HM2A 3IBYA 2V98A 3DF9A 4UXJA 5E7QA 1O94A 4OQEA 2Y9PB 1WQ3A 4WJKB 1T4CA 1A5TA 5G3YA 2NO4A 1YZ3A 3CCBA 1YB2A 5KDLA 3VISA 5B57C 1CFZA 1Y4UA 4HWTA 2R6CA 3U44A 4MRMA 4FPXA 4FQ7A 1UMBB 2ZTMA 5EINA 3H8VA 4LXGA 1NMSA 4IJQA 3TI9A 4JJ8A 2NZ2A 4Q9LA 3QFSA 5H4HA 2B7BA 3FA2A 2JA1A 4HMOA 4QOIA 2NU6B 3SR3A 4C5CA 4TWAA 1C9NA 2RGNC 3WHPA 5AJXA 2R0QC 4B8ZA 1SZDA 1PEKE 2ONKA 2ZIFA 5JWHA 1ZUWA 4HDOB 3THOA 3IUYA 1M34B 1QGUA 3AZQA 1NBWB 2G88A 4MINA 1FNBA 4UE2A 3SZGA 3KK0A 4LY3A 4YBZA 2R5NA 2YHAA 2VKTA 1KDOA 1E1QA 1PZMA 1W4BA 2CVQA 3A4LA 3GO4A 3SE0A 2YVKA 3FYHA 5AKJA 3Q3JB 1DJQA 2DQYA 1N6KA 4IM7A 1QFYA 2AYZA 1PFVA 2BTQA 1IEQA 1Q0UA 3R5XA 1VGQA 4GGPA 2JHCA 3MFQA 1UKVY 3QKUA 4PZPA 3FZGA 3ANLA 3F78A 3SZOA 2VHJA 3DVRX 1Q5PA 2I4NA 2AA3A 2NSLA 2P6RA 2ORWA 1ADGA 1C0EA 1RWMA 3IVGA 4IS3A 4DV0B 2OO7A 5A3SA 3O8OA 2M2IA 2ZJOA 1ZPDA 4XVUA 3JQFC 3OMLA 2C1ZA 2QUHA 1BMFA 1I80A 3D8TA 3IELA 5CDHA 5C35A 3ECSA 2DY1A 1U5BA 2FFBA 2PL3A 2Z43A 2VK2A 1VJ1A 3EUEA 1WE2A 4JJAA 1B16A 2I4RA 3ZY4A 1BCRA 3RTEA 5EUBA 3VHRA 3RB8A 3KBBA 4PYMA 4WNIA 4N49A 4D25A 2FN9A 1U3GA 3GIDA 2DCUA 2NTJA 2REOA 5TMBA 5JU6A 1SMKA 4TL9A 4DUGA 4WOKA 2FFHA 3HCAA 1B74A 1M67A 1PYOA 5JS8A 2HHCA 1QFMA 5KZMB 4OHXA 1PN3A 4BO2A 4M8IA 1G21B 4ZAYA 2P65A 1O9GA 5ALEA 3BVPA 1GOTA 2W5UA 3IX7A 1NQXA 5JZSA 3O73A 1LGYA 5IWCA 3OZAA 4E7PA 7REQA 5FUYA 4DMMA 1R50A 1TKCA 2NU7B 3MTGA 4R2KA 2IX3A 1GAJA 1VB3A 4CVNA 3IJPA 3OBIA 1EFVB 1GQSA 1H0KA 5P8WA 3VKWA 3HFGA 3QOXA 4YJ2B 2WSBA 4JLUA 4DDKA 2AFHB 4OXYA 5IT4A 4MQEA 2P9TA 2CZCA 1VKZA 4D9GA 1UM9A 2H57A 2WLTA 3TVYA 2JLUA 3AEYA 2WG1A 3PVSA 3R09A 4O59O 4JP2A 1OFHA 4HLNA 2YHIA 4LWPA 1YE8A 4LJKA 2FPPA 3DJFA 3GR6A 1DBPA 1JDZA 1YOVB 3EOBI 3HZZA 3U7RA 1V35A 2NNLD 3WIVA 3ZS8A 5GIPE 3HP7A 3CLUD 3W2TA 1A9PA 2Y0BA 4ZV7A 4INZA 3TLBA 5LYJF 1EUZA 4CDRA 5EC8A 3S7TA 1G1MA 2R6DA 2WYHA 3MWDB 4XARA 5J4KA 4KHPB 4HBGA 1FDIA 1P77A 5K2OA 3O93A 3MNFA 3TDNA 3ZDCA 1Z16A 5B3LA 4ESHA 5EZYB 3LYLA 2WVJA 4HMPA 1CETA 1LY1A 3JYPA 1HSOA 3L1KA 3N6VA 4QBFA 4ENRA 4F91B 5KYXB 3KQNA 3GLIA 1NATA 1UP7A 5LMCA 2C2WA 4BRWA 1FYFA 4ED9A 5H3HA 3EGCA 5IKXA 1G20B 5CNKA 5LYJA 4AWAA 2D5CA 2C4KA 3O1HB 4ZT2A 5KOIA 3U09A 2V7BA 1L5ZA 1GQYA 3OT1B 4FJ1A 4QRIA 2GD6A 1YKGA 4YAOA 5AKEA 4EY4A 1E94E 3EUWA 4I4NA 3ETDA 4DUYB 4I1OA 4Q6WA 4DKJA 4NENA 1SVIA 1WPRA 3OOWA 2GTIA 3ZVNA 4TMTA 5DBIA 2EFHB 5L3VA 4OGGA 2FW7A 1KOGA 2ZTLA 5LB4A 3E8MA 4CM3A 1MT3A 1G8FA 5HG0A 1XA4A 2AE1A 2XVZA 4XPIA 1MZVA 5HYVA 4LVNA 4YAKA 2N3ZA 2SICE 3L8DA 1MOZA 1Y5IA 3MHPA 3G23A 4EO4A 2OD2A 3GJQA 5AXAA 2P8JA 2Y67A 3KETA 3JQGB 4ND2A 1Z29A 2QLTA 5I9NA 4GKKB 1XN4A 4P3PA 3CZ5A 2GGSA 5JCOC 2IGTA 4TV8A 2W6CX 4W7HA 4Y67A 4HB0A 4IEEA 2C98A 5KNDH 4KVAA 4FW9A 1M0EA 4BZZA 3I9JA 1PR9A 5EHNA 4OX9Y 3GVIA 1U2EA 3VNVA 4BQFA 3G13A 2R00C 3W05A 4TN5A 3U0BA 3DE1X 3VZBA 3I2JA 4GOJA 3IR7A 3JATA 4N3GA 4KVZA 4QODA 4UXHA 3WRYA 1JWBB 1MIOA 4G5GA 1XTBA 3WYAA 1G9SA 2ZKLA 1RLTA 2IK8A 2NUTB 1JLLA 3BKWA 1VRWA 4MVWA 5DCLA 2PUAA 4K0KB 1HTTA 4NYJQ 6REQB 3QBTA 1N7GA 1U02A 1Y42X 2QAJA 4V03A 4BNXA 3PUVA 4ZYLA 4R81A 1XTIA 1LWOA 1W52X 1PQUA 1TX4B 2VCYA 3GDOA 4QQNA 2AG0A 2X14A 1QVRA 1RIFA 2OZPA 3LC2O 1BQEA 1DS6A 1U8AA 1PWZA 5C1OA 4R0MA 5J2UB 1M73E 4WKBA 4LN1A 3BXZA 2GBLA 5AI4A 3EGDA 1P2DA 1XZLA 3ZWWA 1UQUA 4B75A 2NPOA 5ILOA 5BOVA 2OBYA 4MUBA 2ZRNA 5IN5A 3ADOA 3D3EA 4FFPA 1LTHR 1V1MA 4RLQA 4FXOA 3EZXA 3OM1A 3FCCA 1JNXX 5HILA 3EUFA 3S2ZA 1ZIXA 2PMFA 3GZTB 3C3DA 3M83A 3WNVA 4KIJA 4CJXA 3DEKA 5FB3A 5JPIA 2BMWA 2VPWA 4DVGA 4G5OA 1E32A 1VA5A 4QTZA 4X1KB 3NBXX 5EHIA 3RBVA 4C0BA 1XLVA 3N8GA 5JAIA 3AOEA 1DT3A 1DCKA 4GDMA 3QFHA 4BRUA 1AS0A 1PDOA 2BH2A 2QP4A 4QDUA 2WTMA 3HN7A 4LDAA 2JG3A 3W2GA 1KNQA 3VQTA 4IIHA 3PNYA 4BGVA 1M6VB 3MZ0A 4NU8X 4DLXA 4LXYA 1N5IA 3H3XA 3QI7A 4PR3A 4BVLA 4MO2A 3VBCA 5JRDS 1XPUA 1LBQA 2PZKA 5CRIA 1C3XA 2FUKA 4QXRA 5CLFA 4BP9A 3Q2KA 4ISBA 1RACA 4D9KA 4RLFA 4OHOA 1VJGA 1YBMA 3K5HA 1EFLA 1L5RA 3MCVA 4LCJA 3UTCA 3NYRA 4YREA 1KO4A 3C8HA 4C1NA 2ZK7A 1CJVC 3PNOA 3ORYA 5EPUA 3R41A 3LDUA 1YVEI 3I6IA 3R7BA 3VSBA 4B34A 4B0PA 3Q7EA 2RHTA 3CW2A 5CLLA 3DOOA 4P80A 1GCIA 3AUYA 2XA1A 3ZIAA 1LSUA 3EVEA 1ZDMA 1J9EA 3JPWA 2RCYA 3AR2A 1XCGB 3HCPA 1KJNA 4LNHA 4HFMA 3ZK7A 4TTQA 4XWOA 4WXRA 3UAZA 2PPVA 3ESDA 4IPTA 4II7A 1CUIA 4KQ1A 5MHTA 4LPKA 3BHIA 1DQRA 1VHLA 3KG2A 1RPTA 4L4SA 3FOAA 1EG7A 4OP2A 1OH8A 3WB0A 1BDBA 5T4FA 1F2TB 2YVUA 1WEHA 3MPUA 4M76B 1YR2A 4F5DA 1ZMOA 4G86A 2A59A 4PLHA 2PGDA 4P7FA 2PL5A 1GZ4A 5GWXA 4FGUA 4DNXA 3BTOA 2WVGA 1NWHA 2EC5A 1NJSA 3A4NA 2L69A 4RD4A 1I7NA 4D82A 3T3GA 5M2QA 3NG1A 1M2FA 3D43A 3GA0A 4C0XA 2XMQA 4CCWA 1JZQA 2YH2A 3W4JA 4DIMA 3H9UA 1C5KA 2C20A 4J0JA 3K30A 3DVAB 3GJYA 4RPLA 5EHQA 2CF6A 2WZQA 1S3IA 4LRTB 4A8HA 3GAAA 2RGBA 4EG5A 1PSWA 1GLVA 1P2SA 3TIGA 4BBAA 1CZHA 1ZH8A 3FAZA 2QM8A 5K0NA 1IVSA 1TRKA 3BSSA 5BSVA 1S2OA 5KTNA 2O8DA 3H75A 2WHPA 4X00A 3L3BA 2SCUB 1XZGA 4BEVA 2VHYA 1I1QB 1JHRA 4C0QC 1TT5A 1EVYA 4MUFA 3RDPA 1HX7A 2OAQ1 1FPQA 3FGZA 5EZQA 3E58A 3D2BA 3E82A 4NU6A 5JAQA 3FTDA 3WLAA 2D59A 3AP3A 3N86A 3IIKA 3PJGA 3R4VA 1MJHA 3NJRA 1E2FA 1J7KA 4PC7A 5DXFA 3CRVA 3ZHRA 1YJCA 8GPBA 4BAGA 4IR7A 3ADDA 1YZLA 1YSCA 3K9LA 4TXMA 3SFZA 2P90A 6NULA 3Q8KA 4YAWA 3ZJ4A 4LNUA 3BD6A 1WQ1R 1H6DA 1R74A 1WKVA 5AUQA 1RZRD 2LDXA 3GDWA 3BD8A 3USCS 3Q5GA 1R6BX 3JAKA 2ZSEA 3PL5A 3DEJA 3FJYA 4L8GA 2H9IA 4YRNA 1JHYA 3ZGXA 1A7KA 3NYQA 5HZKA 1YWGO 3FWYA 2PLAA 2Q49A 4CIBA 2EL7A 2SHKA 3I01M 4IVNA 2WB2A 2FPWA 4JWTA 1CE8A 3BRWA 1A2KC 1I10A 3UQZA 1X1RA 4QQKA 1G6HA 3SHVA 3MFYA 1TYDE 1H2BA 1OC2A 1XF1A 3HDGA 4V1CA 2ZI6A 4QFDA 3IAEA 4MJLA 2GAJA 3Q7IA 1QLJA 1E7RA 3I9V1 1S4QA 2Z6VA 1ZUD1 1SKAA 3FPJA 4NV1A 4ID9A 2J0UA 3M6VA 3SC4A 3KTFA 1XQVA 1TZ2A 4LWQA 1IHYA 1H94A 2Q1XA 2F3SA 4P33A 1P9NA 1FP4A 2QRVB 1VPLA 3Q7QA 1ZW1A 1Y6ZA 2Q8QA 2I4LA 2RFLA 4IIDA 4N47A 1P33A 5I01A 2B7CA 2V7XA 2X2EA 4BVJA 1U8EA 3N0WA 4U7HA 4YUWA 1QYWA 2NO7A 4ZTBA 3FYTA 1XZMA 4JIMA 1QK4A 4FEYA 4E30A 3DDNA 4BMOB 3LBHA 3P4UA 1ZOSA 2ZJZA 3AB3A 3OQVA 3RSQA 3WFZA 2BFEA 1COWD 2C5AA 3B1KA 3K1TA 1FS6A 4MK4A 4BRZA 1GTMA 3M0EA 3AHHA 4AZ3B 2QN7A 2DVMA 1Q6ZA 3AVQA 3PVCA 2GN6A 4ZIRA 1T36A 1WF3A 1VBFA 3JQ8B 1RFGE 3H1AA 3UY4A 4P36A 3V7YA 1PGQA 2OTCA 1Q11A 1US8B 1DKQA 2DUUA 2H5EA 2LWIA 3O4RA 4OHVA 2XAAA 2GS9A 3MQFA 3QXCA 5DNAA 4AG6A 2ZJ4A 4YN3A 1FSPA 3ETJA 4AG5A 5IUJC 3FFXA 3LQ2A 4MRAA 1C4WA 1I2BA 3RD5A 3C5EA 1G18A 1SN7A 2VDNB 4AX4A 1CBUA 1CD5A 4CL0A 4X8MA 4YAJA 2XYVA 1R0SA 1YUNA 1Z73A 2D06A 2XA9A 4YECA 2CMGA 3R3WA 2WD7A 3TNYA 5E6SB 1U2GC 4LPSA 3VUFA 4J8PA 4EG4A 4OB8A 4YCDA 5DWDA 4XQGA 3FGNA 1ZICA 3VHQA 1SR8A 2WV9A 2DBQA 3AO0B 3QNWA 4KUEA 1Z6PA 2X3UA 4URXR 1Y8CA 4BNTA 3TCXB 2CL0X 1RWXA 4QDJA 4QYSA 1P9RA 1QPGA 4O2BB 2JIMA 4CMIA 1MH9A 4DSUA 4L08A 3G0OA 3ZVRA 3EAFA 3TG2A 2AN4A 3T15A 2ZZKA 3DP9A 3F6RA 1VIAA 2DPMA 3WNQA 4AZTA 3NHKA 3Q1LA 5LIRA 1JHXA 3G2JA 1UJ4A 2D0OB 1AUPA 5KWEA 3OIWA 2VXYA 1GL9B 3RFFA 4X63A 3KYBA 2ZU0C 1ZGZA 3E2MA 2XMGA 1I6KA 3E9MA 3W34A 2FSVA 1B3BA 4ZDKA 5BOSA 5FWXB 2ZR8A 2C4HA 3SQDA 4IEIA 5ES3A 3VJKA 1YJAA 3F71A 5FBZA 3GBVA 4EB8A 4IKPA 3O1JC 4H1WA 3PGLA 3UXEA 5AHRA 2OMEA 3NHYA 4XJTA