4Q1EA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 10 {2-{[(1r/s)-1-{2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol 4-yl}ethyl]sulfanyl}pyrimidine-4,6-diamine}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
231
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 231
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1eA00
3OFNA 4H1UA 2XAUA 4EQ6A 1UBGA 3EPHA 3D7MA 4D0GA 1II8A 2WJVA 3A58B 1T0JB 5DHAA 1NY6A 2IWHA 4PSVA 4EPTA 2QBYB 2GA8A 2QQ0A 4HB0A 3VX3A 3QKSA 5CITA 1KO7A 2PT7A 4GT1A 4L16A 1R2QA 5G3ZA 1FX0A 2FJUA 1JQLB 1KJWA 2FE4A 2YWEA 5AUOB 1E4YA 4QJ5A 4JT2A 4U00A 3A36A 1VCNA 4KV9A 1S1CA 2DFNA 3X1XA 2P67A 1S9DA 1GKYA 1XEFA 2YOHA 3AKYA 2OE2A 4LHYA 1XPUA 1TQ2A 4M9XA 1XXHB 1VYUA 2CEAA 3AGQA 2WV9A 4D25A 2PLFA 4QHSA 2JATA 521PA 1UEIA 1P62B 3FHCB 2GXUA 2OV2A 1VCMA 5H8WA 5JJKA 3MMPA 1YJ5A 2FWRA 4FMDF 3SEAA 1SGWA 4HZUB 1BS1A 1NMZA 4NCJA 2GKSA 2PCJA 3VR5A 2BCJQ 3V00A 4BUJA 4IJMA 3KKNA 2BWJA 4JLPA 5KSPA 2ZRGA 1RRGA 1RIFA 1RRCA 4TLAA 2QE7D 4YMWA 1N6NA 2WWHA 2BMFA 3FHOA 4DXAA 4ZPXA 2OXCA 4YONB 1L8QA 1KO1A 4PO1A 3J81k 2E87A 3P4YA 2ZQ5A 4E07A 3ASYA 1XRJA 4NTZA 5AJZA 1OH5A 3H86A 3RVBA 3B6EA 2ZRFA 4L15A 4B35A 3NBXX 3OFND 4ZDJA 4KHZA 2ZJYA 2QT0A 1U9IA 3NBFA 2VIIA 3WYFA 2OSBA 5IF9A 1JEEA 2ASEA 4PQYA 2GEVA 2GDJA 4KFRA 3AUYA 3CRMA 4MYUA 2IF0A 4CRWB 4CEJB 2QGNA 3WP1B 4UNNA 1E2KA 3IUYA 2W2XA 2OBLA 3H84A 3TJZA 2QPOA 1G7TA 4LJ6A 5IDVA 2CVHA 3KQKA 2YV5A 1IN5A 4JLOA 2ERYA 3GLIA 4LJ4A 2JLYA 2VP5A 4OHYA 4FD2A 2V55B 2OEPA 4M9QA 2G0NA 3SNHA 2GZAA 3C7KA 5DI9A 3V9PA 4IXNA 3SFVA 3LH5A 2QEQA 2QORA 1OB5A 4N1AA 5JFGA 3ZD6A 4OQNA 5EE5B 2OHFA 1Q21A 4FWIB 3P1JA 4M9ZA 4FXPA 2OCYC 3W3AA 1E4VA 1XMVA 1U0LA 3FB4A 2FV8A 1N6HA 3W9YA 4EFNA 5KPDA 5TXGA 4B3CA 1KDTA 4XWAA 4URZR 1W4RA 3GLFE 2VSXA 3BH7A 5FUVA 1AM4D 4G01B 4PC6A 2BV3A 2K5UA 1CULC 1QHHB 2C04A 5CYOA 5LDDC 4ITRC 2IUUA 4QRHA 5DIFA 3VKGA 4A9AA 4TT3A 3K0CC 3MWLA 1OJLA 1E9SA 2FSFA 4POAA 5DH9A 1Q1EA 4NYJQ 2H16A 3TIFA 3TQFA 3K70D 2ZTSA 2WWGA 2EYQA 1GRNA 5JECA 2B92A 2C9YA 4G5RA 2FSGA 4B71A 3Q8XB 2CE2X 4MGZR 3PUYA 4RD0A 2VEDA 4NKRA 1WBBA 2YKGA 1UJ2A 4W5JA 1DELA 3KDSE 3E1SA 1N6OA 1NSFA 3CH5A 1P2TA 1G41A 4F92B 2DYKA 2VTKA 4C2UA 5KPJA 2W0MA 4IOJA 1YZGA 3TW8B 4V0NA 2UZ3A 5EUMA 2AKAB 4HYYA 3REFA 4ABYA 4RCZA 4HB4A 4JSYA 1SXJA 1YR6A 2KWIA 4JT4A 4F91B 2GETA 3IIMA 4BECA 2CLSA 2NZ8A 2JDIA 2IK8A 3B1YA 5KDOA 1KI6B 5FOUA 1TNDA 3RNLA 1TQDA 4XVRA 4GRAA 4XWKA 2FG5A 1XMIA 4QM6A 4KBGA 1KI3A 4B75A 1E2MA 3LRPA 3THXA 2XB2A 4PSKA 4NYJR 2J3EA 4QFMA 2GXSA 2G0TA 1U0JA 3EC2A 1T3LA 2JLRA 4Y0VA 3PR1A 2WICA 4NPHA 3QNUA 4XH9B 3LNCA 2IYSA 5J5CA 4HLDA 2DB3A 2IS4A 1LW7A 2VO1A 3Q72A 3B82A 2O0KA 4HDOB 2HT1A 4Q4AB 4TL8A 4JKYA 1KI9A 4OHVA 4YC7A 4DCVA 1D9ZA 3IILA 3UANA 2ZU0C 2ZANA 5H68A 2OZEA 5EXPA 1RZ3A 4J0QA 1K6MA 4DSOA 4TT3D 3BGWA 3TUIC 3WYAA 4GP7A 3WHKA 4XJXA 1G5PA 1H65A 3LLMA 2C9CA 5E7MA 3RS2A 5K8IA 3T1TA 1TPZA 2X2FA 1DEKA 2GF0A 4Q66C 4P32A 4V0LA 3PJRA 2EFHB 5CJPA 1IJFA 2ZAMA 4WZAE 3H4MA 3QBVA 2AHOA 2XNDA 3SJBA 5FUWA 1JB1A 4U7DA 1XD8A 3NC0C 1EFUA 3B8HA 5HCNA 2IC5A 1W36B 1ZIPA 5KYKA 2IX3A 1MO4A 2CL0X 1ZD1A 5SZIA 5JWHA 5EUQB 3Q5DA 1NMXA 2PEYA 5CB8A 3CF6R 1RFLA 4WXRA 2Z5FA 1P2UA 1XWIA 3HDTA 4B43A 3SU8A 4ZCLA 1PLLA 5HE9A 4WIAA 3CPJB 1E2NA 1DPFA 1UADA 2A78A 4HDCA 3X1YA 2GEDA 1AQUA 3RAPR 5JS7A 3KTAB 1KO4A 1I4LD 2QMUA 2JDID 1UBCA 2A5GA 1J99A 1KI7A 2ZJ5A 4RD4A 3KKQA 1IXZA 1FL9A 4O25A 5AR1A 3ZVLA 3FDIA 1YR7A 1YR9A 2P5SA 5CM8B 5F9HA 3UMFA 2XB4A 2ATVA 4ARZA 4K8OA 2CE7A 5TDHA 3U4QA 3AH8A 4IXMA 4RD6A 4RKEA 4ZDIA 5LD2C 3A4LA 4LGMA 4Z51A 1R5NA 2O8CB 1LY1A 5EZ5A 4CVNA 3GEIA 3THWA 1GP2A 4OI0A 2BCGY 4RZ2A 2AFIE 4TQ9A 4W5WA 4B32A 3EIQA 2X8AA 3K9LA 1WE2A 1E9DA 4MKFA 1II0A 3PG5A 3K09C 1AK2A 1C9KA 3LBIA 4JIMA 4Q9IA 1GTVA 4I1SA 1JALA 1Z6GA 2OBMA 2RB4A 4PO8A 4E03A 3LXRA 5L3SB 1QHXA 2C8VA 2VP9A 2WHXA 2Q6TA 4LYFA 1H8EA 1DVRA 4FMBB 1UM8A 4Q4HA 2OFOA 2ZRHA 1FUUA 2ZRAA 3AKEA 3B85A 4URWR 3QE0A 2ODWA 1BMFA 3R7WB 3U7EB 3EA5A 4HAZA 4EKDA 1W5TA 3EXAA 1YZUA 1S9HA 2N46A 1T3SA 1E2QA 2FN4A 2FPLA 3DVLA 4D4MA 3RRNA 4JLKA 2XOKD 3K8YA 2WMOB 2XNDD 2IUSA 2Q9AA 3TK1A 1WF3A 4W5HA 1IBRA 3A8TA 2IS1A 4JLJA 5EE0A 4TMZA 1N0VC 5IHPA 5L8VA 1VHLA 1P6XA 1GVNB 3I92A 4DHEA 2JA1A 1D5CA 2TMKA 4S2EA 4TQUS 3U3KA 2VHCA 3GEEA 2J9RA 1HH4A 2IXFA 3Q7PA 1P5ZB 1MO5A 3I8XA 1N3BA 1SVKA 1QG4A 2CHVA 3TSWA 5M04A 1J90A 2V7QA 2ZRJA 2RKOA 2WKPA 2KI5A 4NP6A 4R2IA 3SYNA 1G8YA 1XCGB 2GCOB 3P26A 5JJLA 5CYPA 3TKLA 4TZ6A 2MSDB 2KSQA 3PVSA 2WJYA 2HYDA 3EPLA 3WXMA 4QGHA 3U7GA 1I4TD 4ZIRB 4PZZA 1UDXA 2AXPA 2Z6VA 3FMPB 5DN6A 4TYYA 4DDTA 4KXFB 2C96A 2WJHA 4PSAA 3JVVA 1LNZA 2J0VA 1CBUA 2YWHA 1KMHA 4Q4JB 3VU9A 2GAAA 3ZGXA 1E6CA 3AQ4A 3CZPA 3MD0A 4N0EA 4PX9A 4EPXA 4IOMA 4BLRA 3T61A 2HEIA 5JHHB 4LOAA 3K70C 4HUQA 4Q1FA 4IDHA 5AJXA 2GBLC 3LW7A 3LBNA 4OK5A 4ESVA 2QUZA 2R44A 1E69A 1H8ED 2OXRA 3T34A 4FCTA 2ANBA 1W48A 3KX2A 3CO5A 2CNWD 3HP1A 4A82A 3CPEA 1BMFD 4OHXA 1I4DD 5HPYB 2AKYA 1UAAA 1QBKC 4OQLA 1KGDA 1S2MA 1SZPA 1GNPA 2OESA 1JPJA 4IFBA 4M1MA 1NVVQ 3DMDA 4KU4A 4W9MC 3OAAA 4LHVA 4TLCA 4V0KA 3VX4A 1V5WA 4B3BA 2ZVPX 3K0SA 1EWQA 1CRPA 2ZR0A 1SKYB 2CLCX 1M7GA 2GXAA 4PC3A 2WIAA 4LCBA 2VP4A 3CRVA 3GFOA 4P4SB 3U7HB 4A0RA 2MMCA 3IIKA 3RHFA 3PUVA 2D2EA 1E99A 3ND9A 4HB3A 4D0NA 4FN5A 3ICQB 4HSEA 4FMCB 1O3YA 1PJRA 2O0JA 2V7QD 3GLFA 2IEYA 4DIDA 1YRAA 3EAQA 5FL3A 2IYQA 2P3SA 3IHLA 1NIJA 1RVDA 3CX8A 3OIVA 4XIGS 1R6BX 4DLTA 2J0QA 5FPKA 2RGBA 1QHGA 3ADBA 4L5BA 4UNQA 4C0JA 1E96A 4ZI3A 1XCPA 2REOA 1UKYA 1IY2A 1T9HA 2IYVA 4CEHB 5DN6D 4XVQA 4XSHA 4OQFA 3IQWA 1E2FA 1JI0A 2RGXA 3MLEA 1HE1C 2QAGA 2CXXA 1J7KA 5G40A 2W6IA 2I4IA 2H92A 4TMKA 1KI8A 3K9HA 1NVVR 4MITA 2WPDA 1SVLA 2ZE7A 1E9BA 2WWWA 2WSSD 2G77B 3KFXA 4BZPA 4WBSA 5EE3A 3JZMA 3U3OA 2Q3MA 4DIEA 1Z6YA 3EZ9A 3BE4A 1AS2A 1QVRA 1KMQA 2RGCA 2BHRA 4Q48A 1JXMA 1J70A 1S96A 4B47A 3B7GA 2XEXA 3OEED 4B34A 3KQNA 5KNBA 3Q7QA 4PTLA 1OIWA 5FUXA 1ZNYA 4UXIA 3RLFA 1ETUA 3C5CA 4MRSA 1NVUQ 4UNRA 1R0YA 2WAXA 4DJTA 1WXQA 4FW9A 4HAXA 2DFLA 2GESA 5KSYA 1R7RA 3OAAD 1US8B 2QG6A 5SZJA 1P7CA 3EA0A 3CR7A 2VP2A 3GPLA 1N5JA 4U5XA 1SXJC 3EG5A 1Z28A 1E1RA 1YU9A 4L9WA 2YC2C 621PA 1RPZA 2EU8A 1F2TB 3ZVRA 2PJRA 4BRUA 1ZM3A 4GZLA 3GCGA 1GUAA 5AUNB 4H9GA 1XZQA 3I4LA 2A5DA 3BB1A 5HTKA 2P6UA 4DSTA 1Z6AA 4GBMA 2FEMA 4KODA 3NIBA 4QBIA 4I81A 2R6FA 2O8EA 4C0HA 1EXMA 2B8TA 3FMOB 3Q5EA 1ZM4A 5C18A 2GAOA 1NMYA 4DT1B 2CL7X 3BS4A 1R5BA 4DZZA 1JBKA 1YZKA 3AVVA 4DLRA 3MGCA 4G1UC 4YXWA 1PUJA 2W6ID 5DI3A 2IHBA 3VKWA 1SVSA 5FOXA 3D6TB 3W6NA 2XXAA 3ZD7A 4ZDWA 3TR5A 2WPDD 2V9PA 3QG1A 4A15A 1A4RA 3AP2A 4EAQA 3AM1A 4GFDA 3QBTA 2JJ1A 2G3YA 2ZI6A 3ONWA 4BLSA 4D81A 3PFIA 4R98A 2X77A 2NTYC 1FNNA 1ZMXA 2FSHA 5AJVB 4PXAA 2AXNA 2HLDA 2KBFA 3SE0A 1MABB 5SZKB 3ZQ6A 1XX6A 1IHUA 3HPRA 2CHQA 1P61B 3O8DA 3EASA 3R20A 4B6FA 4NMMA 2YHSA 4ZCMA 1CKEA 3L0PA 2X19A 4DCNA 3C15C 3KB1A 4NCNA 4NHOA 4L9SA 1KIMA 5FBLB 1WCV1 2DPXA 2MSCB 4UXHA 2NO7A 4N3NA 4JBWA 1HY3A 1QF9A 3CNOA 4DLXA 4D2IA 5B64A 3CRQA 2OG2A 2DWPA 2B7CA 4O0MA 2ZPTX 4P33A 5LD2B 1DAMA 4JLBA 1II9A 3GFPA 3A6PC 1NLZA 3T1OA 3KJHA 3LW8A 1E1RD 4BFVA 2F3RA 3CB4A 3LWNA 1XFAA 1G3MA 3E70C 2AR7A 2HUPA 4OK6A 3QVVA 1G20E 2F43A 1OLOA 2ZUCA 1ZC3A 4QNMA 5K8TA 3WY9A 4Q19A 3B13B 3BB3A 3PITA 3QPWA 3UMRA 4HAVA 4BRWA 3ASZA 2ZI9A 1KSGA 3G0HA 3KL4A 5KO2A 2EFDB 3W5IA 2D62A 4EQ6B 721PA 1XMJA 3F8TA 5P21A 4B2PA 3DMNA 1II8B 1Z0IA 3QKTA 5HKKA 1V43A 5FL7A 2WTUA 1HT2E 4HEJA 2DFKB 5EE1A 3PEVA 2GZDA 1CU1A 4MDEA 1MH1A 4P4UA 4GZMA 3QKSB 1IONA 2FZLA 2VA8A 1FMLA 3BB4A 1SHKA 2WZQA 2FOLA 4LSGA 1AZTA 3VR1A 3DM9B 2C99A 4YXWD 3SQWA 3BC1A 1E3MA 1W49A 4FCWA 1OFUX 3CW2A 3OIYA 3BJIC 2F1RA 1RJ9B 2ORWA 3CH4B 1G3IA 2ATXA 4JLDA 4LX0A 5J4YA 5IRCD 4LHXA 1NJGA 2JJ1D 1H8HA 1EG7A 2BMDA 2ZRKA 2VHUA 3IEUA 4XVUA 1D8TA 1Q1QA 4HLQB 4ZCIA 5AJWA 1Z08A 4UJ3A 2W2VA 3QG5A 4EPRA 2HLDD 1E98A 4QG7A 1E9EA 3DM5A 4B76A 2L0XA 1JAIA 1G3RA 1OKKA 3CM0A 2GVZC 4WVFA 5J40A 2OAQ1 2UKDA 3B1ZA 1KK1A 2FU5C 3BFKA 3N2EA 4RD2A 4UQOA 3PXGA 3WNCA 1W0JA 2ONKA 1ZP6A 4D4JA 1YQTA 5GJVC 4DDWA 1DE0A 2DCUA 2ODEA 4IDNA 4LJ5A 1ZM7A 1UKEA 1ZM2A 1QZXA 1VYVA 2X1VA 4US2R 3TSOA 2ZE8A 3B9QA 4ZV4A 3I73A 4LUCA 4D4KA 4JMPA 4V0OA 3H1TA 2IYZA 4LYAA 1N0UA 3K70B 1U8YA 4DSUA 1AS3A 3BD9A 5EE9A 4S35A 1WA5A 1F2UA 4PO9A 3EWAA 1ZU5A 1KY3A 4U02A 1IY0A 3ZIAD 1BO6A 3W5JA 3EX7C 1TTTA 3O8CA 1U98A 4OQXA 3QPVA 1FP6A 2ZITA 4E22A 2I1VB 2CMKA 3U6KA 4MGIR 1ZIOA 3CBQA 1KDOA 2ZSFA 3AKDA 5AUPB 5HKKD 1NVXQ 5FL7D 3KB2A 4BLOA 1NKSA 3KXLA 3LX8A 3FYHA 4EPYA 4A0GA 3DL0A 3WBJA 4MYCA 2BBOA 4NDZA 2BEKA 5ELXA 2QMEA 3ICEA 3U2QA 1FQJA 1U8AA 5JSZA 2PLRA 1IN8A 2QMOA 2PMDA 3MJHA 1C1YA 4LBVA 4EUNA 3KJIA 2JLWA 4UNSA 5FPSA 1LB1B 3F5FA 2PX3A 1E9CA 1AJEA 3GLIB 3THYA 4Z8YA 5DYIA 5JS8A 2HJVA 4PPFA 4MUBA 1H8HD 3C5HA 4AKEA 4OKSA 5FBVB 4A36A 1DAIA 2VHTA 5CK5A 4NL4H 4TZ0A 2F1IA 4RZXA 2XITA 3ZVMA 2R6CA 3NDPA 1VG0B 4ZI2A 1GL9B 4E09A 1OKKD 4M22A 2IA5A 4CGZA 1RW4A 1W0JD 1YZLA 2CCKA 2GF9A 4KCGA 1ZD9A 1VIAA 3KQHA 4PHHA 4QNRA 3ZS8A 4HAUA 4XD7D 1E2HA 2FFAA 1VKJA 1XCMA 2NO0A 4LPKA 4F4CA 2C5LA 1N6KA 1ZBDA 3R9XA 3FTQA 5JHGB 3GP8A 2YZ2A 1T8UA 4AYXA 1Z0AA 4Z1MA 1A2KC 1Z6TA 2ANCA 5TVKA 3S1AA 3U5ZB 3RSLA 2GK7A 1LF0A 1MRNA 4LHZA 4FMDB 5FTMA 8OHMA 3JZAA 3I61A 2F9LA 4EJSA 2ZI7A 2ZRPA 4KYIB 4AG6A 2XTNA 1X8LA 2F55A 4OI1A 1YR8A 1BYIA 2LWIA 1N6IA 1XTIA 2QAGC 3DZDA 4ON9A 4C0AC 221PA 1IXRC 3LBHA 1T8TA 4X8MA 2PZFA 2O52A 3MWJA 4RY2A 1ONBA 2CBZA 4TL6A 1CJKC 1NKTA 1Z06A 1G19A 3F0TA 3KKPA 4A1FA 4B3FX 2X2EA 1CR4A 4BE7B 2QY9A 4R7ZA 1C4OA 3TUJC 2EVWX 1KK2A 2IUTA 4LV6A 2IWRA 1CJTC 3U3MA 1SXJB 2J46A 3BFVA 1TX4B 1Q44A 4HAWA 4Q9LA 1A82A 2WWIA 3GJ6A 2YWGA 5F9FA 3T5GA 4QXAA 3TVTA 4A2WA 2B7BA 3M1IA 1DARA 1LF5A 2XJ9A 5DNYB 1BH2A 1ZC4A 2H8KA 2YC4C 2FFHA 1NSTA 3QF4A 1DS6A 1IN6A 3THXB 3GLGE 4M4SA 4TYQA 2RGEA 2ZYTX 5CIQA 4HI0E 1JEDA 3O47A 4WOPA 1ZCAA 3OE7A 2A7QA 3UMSA 5JEEA 3EZ6A 1X3SA 1CR1A 3BRWD 1XDBA 2FZ4A 2JLZA 2EW1A 1T0HB 4NBSA 1AZSC 2BBTA 2ZJBA 4PPGA 1KAOA 1T6NA 1HE8B 1ZYUA 2QPTA 4B33A 3T5DA 5FOVA 2V6JA 4Z1MD 5UKDA 5K8LA 1E32A 1KZGB 2QM8A 1P60A 2HT6A 2QROA 3KZ1E 1M8PA 1LS6A 1HYQA 3GLHE 4RSGA 3A1VA 3CRW1 2VF8A 2PJZA 2O8DA 2H1LA 4O3MA 2V4ZA 2GRJA 2W83A 4XTCS 5HZHA 2MSEB 2OILA 5JI2E 1G9XA 1UPTA 1Z0FA 3TLXA 4LC1A 3KQLA 4Q18A 1FOEB 3FMFA 5FPHA 4RCYA 4OBEA 5KDDA 3CF0A 3W34A 1G21E 3T1VA 4EIWA 1LV7A 1JQJC 3HJNA 4JVMA 4MH0R 1XEWY 5AK0A 5G41A 1ESNA 4M1TA 1Q3HA 1CRQA 3AGPA 2CCGA 4F4IA 3AP3A 4BLQA 3PUZA 1HT1E 3FFAA 1B23P 4Q1EA 1DO2A 3ETLA 2QT1A 3FVQA 3TQCA 5BN4A 2JCSA 3QUSA 2ZS7A 4RJLA 5DGXA 2XOKA 3B9PA 3DOFA 1IQPA 4DRZA 5C4MA 5JCZA 821PA 2Q9BA 1DG3A 2IT1A 3EWSA 3SQXA 3RS5A 1NIPA 1NG1A 1VHTA 3L0IB 5E3HA 1S4QA 2IYWA 1LVGA 2WJJA 3M4YA 2ZM5A 1XD2A 1NRJB 4A0FA 4ARZB 2ZEJA 5LBIA 1RC8A 1IJEA 3K9GA 3NH9A 4KYUA 1GFIA 3OESA 3U4QB 3HR7A 2R9VA 4Z8XA 3OE7D 2RGDA 3THWB 1E9RA 1AKYA 3M0EA 3LVQE 4EFMA 4V02A 3MRSA 4CDGA 1W44A 3Q85A 4PAMA 3DOEA 4KSCA 4BFYA 2ZJ8A 4RFSA 3AVWA 1GG2A 4I1VA 2ONJA 1EGAA 1G8FA 3CR8A 2IYTA 4O2LA 4I4LA 1OH6A 3L2OB 4GNKA 3LQRA 4GI7A 1MKYA 1OFTA 1LS1A 4Q4HB 5B2ZA 1BOFA 1QG2A 4DVGA 3QEOA 4D0LB 1NN1A 2ZSEA 4A0HA 3TAHA 1PLJA 4A6XA 4HLUC 3A1SA 4QHTA 4GL2A 3K53A 2WOOA 3MWKA 5JEDA 1T5LA 2GZHA 1M7BA 3B78A 1KI4A 1ZUHA 4OHWA 4Q9HA 2G6BA 3TW4A 4BWYA 4I1UA 2RAPA 4JSTA 3UG6A 4MUAA 2F6RA 2QTFA 4WAUA 2D2FA 1J2JA 1S3GA 2WVJA 3P4XA 4TSFA 1AKEA 2CNWA 4LJYA 4EFLA 2IYLD 1HV8A 1P2VA 5AUQA 2IEZA 3FE2A 4HLCA 2O8BA 1E2EA 4LYJA 4C7OA 4AKIA 4X8OA 4IDQA 5KUTA 4TYWA 5LPNA 3OZXA 3L8ZA 1XTQA 5JWOA 5DE3A 1XJQA 5KHOC 3QIAA 2Z83A 1S8FA 2G88A 2OFWA 2LKDA 3N5CA 3I8SA 4X8LA 3R9WA 1P4SA 3DHWC 3I32A 2QNRA 1XEXA 1HURA 4AK9A 3DEFA 2ZXUA 2VBCA 2VH5R 2YVUA 3X2SA 4DEXA 4KFTA 1YZNA 2B6HA 3QXJA 3VU9B 5J4HA 1KMHB 2OBNA 2NO1A 3CWZA 3SBEA 2R8RA 4YDHB 1VTKA 4RD3A 3IEVA 5FBWB 3D8BA 1CS4C 4LBYA 2DHRA 4HUQB 5BN3A 2IW3A 1KO8A 2BIFA 2REBA 2ZUDA 2B8WA 2W00A 3CLVA 1E79A 4C0SA 4PQRA 2IF2A 3GJ8A 1OB2A 4PC1A 3HR8A 5D3MA 3I62A 1TADA 2I1QA 1G6OA 3K1JA 3AUXA 4HATA 1N6PA 2BVNA 1JJ7A 3LVRE 3BOSA 1YHNA 4LY6A 4YMVA 2FPKA 2BOVA 2OCPA 1N25A 2WSSA 4JLMA 2JJ8A 3AB3A 2QA5A 3LX5A 4K81B 1VCIA 1W36D 2HF9A 2OM2A 1DAKA 1AQYA 1UBEA 4Q5IA 3RC8A 1U94A 2FA9A 2VHQA 1UKZA 1OIXA 4MGYR 1JJVA 1QRAA 3VR4A 1TF2A 2J59A 4TSFD 3OEEA 1IY1A 2H17A 3AF0A 2OO7A 1RRPA 5IK2D 3WRXC 2H57A 4IRUB 1DG1G 2JASA 2R2AA 2C9OA 2ZI3A 1U9IC 3BH0A 3PENA 4HUTA 3AF2A 3GLFB 1JR6A 1GZSA 1DAGA 3O8BA 5EQTA 4PC2A 2QPAA 1P73A 2Z4RA 3EZ7A 1W2HA 3PQCA 4C2TA 5CK4A 1OIVA 3CONA 2QP4A 2C03A 2DFTA 1W4CA 3QENA 4CF7A 4LC0A 1XTJA 1SQ5A 3MWYW 1Q0UA 5KU1A 5HZKA 3U6BA 4TTRA 2QAGB 1F48A 1W4BA 1XXHE 1TQ4A 4DLUA 4RD1A 1NBMD 3FGNA 1Z83A 1KK3A 3KXIA 2CK3A 4XOIA 3L43A 2ODBA 4LI0A 2XX3A 3E5HA 1XP8A 4PQFA 4ZO4A 4CEIA 4URVR 2ZSBA 5E7JA 1WQ1R 2VP6A 1E79D 1QHIA 1YZTA 4LPSA 1DAEA 4UKDA 1HTWA 3TBKA 3VAAA 1MOZA 3QOFA 3W6OA 4LBZA 3RC3A 1EK0A 2A9KA 3P32A 1A7JA 2NO9A 4DB2A 3K0AB 4BFSA 3RWMB 5CLLA 1WBDA 1R0ZA 2G1JA 2QU8A 5GJWC 2IHYA 2JAQA 4C0BA 1KTVA 5JLJA 4PPNA 5KDLA 5SZHB 1Q3TA 3IO5A 1GITA 4C0KA 2ZJ2A 1R5OA 2GEUA 3GLGA 2QMHA 3FHTA 5B30A 3AVYA 4MKGA 2PEZA 3THOA 5L3VA 4OI4A 2PT5A 1L4UA 4GOKA 1TMKA 4AY2A 3K0FA 1KHTA 2NOAA 2WMNB 3FMIA 4KFSA 2IYXA 3KJGA 1ZW6A 3RS3A 1IAQA 3VHXA 1VCOA 1AN0A 2AL7A 5J4KA 1CF4A 1N5KA 2OLKA 5FR2A 5TB5A 3PIRA 3K0CA 4QBGB 2RGNA 2XTZA 3SI7A 4MDFA 3NEYA 4C3ZA 2PCLA 5HE8A 4LV8B 4PPQA 3GJ0A 2O8EB 1XJ0A 3GLHA 4B2LA 4CZ2A 3K0EA 2VQSA 4DLZA 1R0WA 2ZRNA 4YMSA 2JLUA 2AN9A 2GXQA 4GMXA 5BWMA 5J4VA 3QXHA 1J8MF 1NLFA 2VYFA 3WMFA 2WJIA 2J0UA 1F3OA 3AVOA 4B3XA 3KFVA 1ZNZA 4EPVA 2RGAA 3GMTA 4NE2A 4KJZA 3SYLA 3GFTA 4OI2A 4YDSA 5DI3B 4Q7KA 2GHIA 2P2LA 4AG5A 2FGKA 3DPUA 2IXGA 2XXAB 1S3SA 2BEJA 4P3YA 3QVUA 2AFHE 4MGKR 4ASUA 2CK3D 3A4MA 1Z2CA 1XF9A 1YE8A 3DO6A 1QHYA 1VMAA 3TR0A 4JLAA 1Q20A 4WXPA 3LA6A 1ZUIA 5JBQA 1P72A 1Z0JA 4A8JA 2F3TA 1UBFA 2EYUA 4Q01A 4DKXA 4TMXA 5FH9A 3W8RA 4AURA 1XPRA 3SYKA 2V1XA 5AWFC 2DR3A 2BMEA 4NZYA 1K5DA 1DO0A 5DSZA 1SHZA 1E0AA 2C78A 3ADDA 2XNSA 2JIZA 2CJWA 3NBZC 4IOLA 2HF8A 3A1UA 2ZE5A 3BK7A 5EJEA 1GRQA 3U60B 1GIAA 1KAGA 1Z3IX 1ESMA 5CIWA 2NIPA 3EARA 1G1MA 3N70A 421PA 1KK0A 1U8ZA 3AVPA 4DBLC 2GWHA 1TAGA 4R71A 3U44B 1OXTA 2R62A 1DBSA 5CLQA 3KKOA 5DISB 4A2PA 1R10A 2F43B 1Z8FA 2A5YB 4II7A 5J47A 3SN6A 3PUXA 2GVDC 4LJ9A 5A0FA 4C9BA 3FOZA 1LTQA 1YVDA 4AD8A 1KY2A 1GL6A 4DUGD 4RVCA 3QKRA 1FW6A 3VNVA 1ZVQA 1CR2A 4PC7A 3UXMA 1Z6XA 3U61B 2GNOA 3C14C 1T3HA 4LYHA 4MQBA 3I72A 4EPWA 1FQKA 3QI2A 4HDQB 1SVIA 4D26A 2QRNA 4DCUA 3AVQA 4QL3A 1IM2A 2FGJA 2NPIA 1FZQA 1KO5A 3SZRA 1KNQA 4Q00A 2IS6A 1RRFA 3C16C 2KBEA 4G5SA 2GJAA 1ZU4A 1T4GA 4V0ME 5L3QA 2D3WA 2ZIAA 1R4AA 1YKSA 2WJGA 2FX3A 2BKUA 4LZZA 3RABA 3ZIAA 3I5YA 2CHGA 4GDFA 2Q21A 2W2TA 4ASUD 4KAXA 1U81A 3LLUA 3OIWA 3ZYCA 4B2IA 3RDPA 1YZQA 4CYMA 1RYFA 4AIIA 5KOYA 5KTYA 1FNMA 3I5XA 1GOTA 1XNJA 3SHFA 2ZRMA 2C95A 1BKDR 3IPYA 1XTSA 4M1OA 5JRJA 2AD1A 1U0HC 5KSOA 3CNLA 1G3UA 4M8NE 2D06A 1FX0B 2YOFA 1G8HA 3D31A 3L0OA 4WZ6A 1Q1BA 1MO3A 2ZI4A 1G18A 5K8UA 2XGJA 2AWNA 3QXCA 1W5SA 1OHHA 1L4YA 2RCNA 3VMFA 2JIZD 4O2RA 4LHWA 4PZLA 2ZAOA 1W7AA 4Q03A 3W3ZB 3EZ2A 3SC3A 3QKUA 4RKFA 1S1MA 3UPUA 5GADl 4DLWA 4GP6A 3ZQJA 1NNEA 4OYHA 1XB2A 4Z54A 1OPXA 2RHDA 1NN5A 1XU4A 3SR0A 2O8FA 4B3GA 1CR0A 1X1RA 1G7CA 1HUQA 1OW3B 3GJ5A 4JVNA 4AKHA 4US0R 2DY1A 1M7HA 4MRNA 4GOXA 1F2UB 1SVWA 3H2YA 3T35A 4MYHA 3UKDA 2BMJA 2R65A 4LJAA 5HR5A 1NN0A 1JNYA 3HU2A 4JYCA 3P27A 3B1VA 4XD7A 1G4UR 1EX6A 1Y3AA 3AVXA 4BFZA 1KOFA 1LFDB 1PZNA 1TL7C 2WIBA 2VP0A 2ZSAA 1VDZA 2F7SA 4PANA 1TUEA 2O5VA 1PV4A 4JJZA 4HZIA 4BLTA 4JZKA 4QC2A 3MJRA 1E2PA 4QGAA 1TU4A 2W0SA 2G1KA 1E2IA 5JSZB 2PX0A 4L8GA 3CRRA 5FOWA 2HYIC 5JJIA 1RJ9A 1E1QD 3AV0B 3OEHA 2V8OA 3THYB 1ZD8A 1HEIA 1NBME 1FUKA 2Q3HA 3UK6A 1OXUA 4QOSA 2NG1A 1OV4A 2HJGA 1W4AA 1ZINA 3KJEA 4JL8A 4NH0A 2QBYA 1Z5ZA 1E2GA 4F38A 3DKVA 4OK3A 3UIEA 1OH8A 4UJ5A 3A1WA 3JVUA 3IO3A 3NVAA 3WNBA 3CX6A 3O8RA 2P0EA 4P4TA 2ZRBA 4WZBE 2EFCB 3WYGA 1G5TA 1OHHD 3MSXA 2GCPA 4V03A 3TGPA 1HQYE 5KNCA 5FOTA 4Q9JA 2QP3A 2OUKA 2HXSA 3EC1A 3MCAA 2QZ4A 4KLZA 3K9NA 3MG9A 2IL1A 1XXHA 3TVDA 3RYTC 3S1AB 3B1XA 4AWXA 5TY0A 2WSMA 2OCAA 3C41J 1W2GA 4BFTA 1M1YE 1OSNA 2GJKA 2FDCA 1VG9B 4EJSB 2VF7A 2UZIR 4M1KA 3KUCA 2BJWA 3Q9LA 2GBLA 3BAFA 2O0HA 2J7KA 4X8HA 1E9AA 4HZUA 4CIDA 1CJUC 2IYUA 4GPTA 3X1ZA 1XBTA 5CDFE 4DSNA 1XTKA 2BKEA 5EZ6B 1EFTA 2ZETA 1GWNA 2J5XA 2C98A 1TF5A 2IYRA 2CCJA 3QPUA 5EP1A 4ESHA 4KLNA 1X8JA 4A92A 1KSJA 4B3DA 2ZUBA 2FFBA 4BZXA 2KE5A 2JJ2A 3AEZA 4TQAA 3H0KA 5DYGA 1EFRA 2ORVA 3OF5A 4D82A 4LWZA 3L82B 4A2QA 3KXKA 4F7WA 4AKGA 3RS0A 4DDUA 1Q57A 1ZJ6A 4W7SA 1VYTA 4BFWA 2F1JA 4C0QC 1DOAA 2DBYA 3KKMA 4NONA 2JLSA 3OEHD 1XPOA 5H70A 1WP9A 4KVAA 1JR3E 3T12A 2AX4A 5JMTA 1BIFA 2YINC 2FEOA 3QF4B 1Z22A 2DWOA 5JCPA 4PAOA 3ZZUA 4CEJA 1W46A 4FI3C 3SJAA 1AIPA 4GSYA 6Q21A 1RYHA 2ZSDA 4IOKA 5DLQC 3IIJA 4I99A 4IFEA 1JAHA 5B57C 4I1OA 1N5IA 4PHGA 4AYTA 2Z0MA 1KYIA 2PZGA 3G82C 2HV8A 1EESA 4MKHA 5BQ5A 1E94E 1ANKA 1YRBA 1ZCBA 4M53A 5GVRA 1E9FA 4JS0A 2D7DA 3T15A 4G5OA 1X86B 1OH7A 1MRSA 2ZREA 2RGNC 4RZ3A 1Z2AA 1SKYE 3CPHA 4TLBA 4B6EA 1T91A 3C8UA 4MRRA 1SKQA 3WBKA 4IDOA 4RFVA 4IDPA 5FR1A 2ZVQX 2JEOA 2O8DB 2WWXA 1X8KA 3GJXC 3LV8A 4IVQA 3CX7A 1BYUA 3NH6A 4AC9A 3FPAA 2YJTD 3BFXA 4TL7A 4GMDA 4BEBA 5F2EA 5A5GA 4TLDA 1Y63A 4IVRA 1QHHA 2NZJA 5LB2A 4MYTA 3VFDA 2GJ9A 3GJ3A 2J1LA 3NC1C 4R9UC 2JJ2D 1QHSA 1KI1A 1EFRD 1W0KA 4DWJA 5BYJA 4OL0A 1AGRA 1JECA 1OXSC 1ZM9A 4ACBA 1OFHA 1IOZA 1NJFA 2GJ8A 2J87A 1GDDA 2ZYUX 3BBPA 4A8JC 1E2JA 4ZDKA 4B73A 3TH5A 4YMTA 1G3QA 2JLXA 2VPPA 1KJZA 4JL6A 4LJ8A 5KNDA 4FIDA 4KVGA 5BXQC 1GKUB 1XD2B 4FINA 3WRYC 4ZKEA 2PBRA 2ZE6A 2KB0A 2YWFA 4JL5A 1MT0A 1ZNWA 4P0TA 1O87A 1RE0A 2QQEA 3BIFA 5TARA 1GILA 3HU1A 5EP3A 3AF4A 3CZQA 2HXYA 2IBMA 3PEUA 5CB6A 4Q1DA 2WWYA 1Z0KA 4BFXA 2FMXA 2HDNB 3EPKA 1E2DA 3NBYC 4DLYA 4URUR 1KI6A 4GOJA 4RFSB 2P5TB 3TMKA 3W6PA 1NY5A 2V6IA 2VL7A 1G7SA 1OYWA 2ZYVX 5C46F 2R6GA 4C0LA 4V0MA 4D80A 2Z4SA 4IVPA 5CJ2A 1CEEA 2QM7A 4B74A 5C1BA 1Z29A 1T5IA 3FFBA 3QEJA 5F3WB 5FUYA 2QAJA 3QXXA 1F5NA 3C4JA 3RRZA 4BFUA 1P9NA 1S0UA 4JVSB 4XSGA 5FPYA 3ECCA 2JLVA 5JI3E 1A5TA 4Q4AA 1VPLA 4QJ4A 4M2LA 4M1YA 1NN3A 2IS2A 1WRBA 4A6PA 3HPQA 5B58C 1D2NA 4TTQA 3WNDA 3BWDD 3TE6A 2F9MA 5JWRA 4IKEA 3LXXA 1P3JA 3RWOA 3QJYA 3AVUA 4F4JA 1W0KD 4Q21A 2ZS9A 4PFSA 3PEYA 2R6AA 5DO9A 1SXJD 2GILA 2QRZA 2O8BB 3NG1A 4URXR 2D74A 2EQBA 4C7OB 4MKIA 2A3RA 5FTKA 4C30A 3LD9A 121PA 2C2HA 2KJQA 3LQQA 3MFYA 2GCNA 5TMPA 3SJZA 2RH5A 3EIEA 5EXXA 4G5GA 3NEJA 1OXVA 4LBWA 4DB4A 4EDHA 2WOJA 2AWOA 3BERA 4LDJA 2W6JA 1XEXB 2OT3B 3V4RA 1TF7A 3W90A 1KNXA 3NWJA 1COWA 4Q1CA 1NVWQ 3SJCA 2RGGA 4G0NA 4PR0A 5IK2A 3QSYA 1U2RA 3U3RA 3CKLA 3VTKA 1NP6A 1E0SA 1ODFA 4IHQA 1VG8A 3KTAA 3PEWA 1WMSA 2YYZA 1GNRA 1E2LA 1TUIA 2REXB 2V1UA 4ILEA 1G64A 1WB9A 1Q12A 1HQCA 1KZ7B 3SFZA 1CLUA 1Z0DA 2EWWA 3RSOA 2J45A 4Y0AA 1TEVA 1JPNA 3DKPA 3M6AA 2QTHA 5D3MB 3SHWA 3V4FA 1ZNXA 5FTNA 1G6HA 1OFIA 2BM1A 2O8CA 1U90A 1ZUNB 4BPBA 3HYRA 1E0JA 2N1BA 4IEIA 3ZVNA 1G4AE 1U99A 3EW9A 1NBMA 4MA4A 2WWFA 1D9XA 3A4NA 3IHWA 3NDBB 3UWOA 4YQFA 5FPTA 2Q0HA 2ZYWX 2J7PA 1N6RA 1K8RA 1CXZA 4Q1AA 5L3SA 2PL3A 1A2BA 1KSHA 4ACAA 1PUIA 2ZJAA 4CT5A 1K5GA 4M1WA 1NL3A 5FI0B 2ORIA 3R7WA 1KDRA 2V3CC 2AK3A 4LV5B 4NCKA 4KFUA 2C77A 4MRVA 1GAJA 1KI2A 4NYMQ 3NXSA 5FTJA 3R9IA 2ZR9A 2N42A 2PMKA 2WKRA 5A4JA 4TTPA 1FTSA 3P20A 2EFEB 4FMCF 3SDZA 4M1SA 4AYWA 4JVLA 4NCIA 2R6DA 3G5UA 5L3RA 3A37A 1PVOA 3IKJA 3ZJYA 1X6VA 2D7CA 2GJSA 3L8YA 5E7IA 5GVSA 4B44A 1OE0A 3LY5A 3IQXA 5G53C 4NU0A 3CF2A 2W6JD 2MMGA 1RKBA 3IBGA 3R8FA 5CDFA 1COWD 3ZH9B 1F60A 2GTPA 4TYNA 3AVTA 4OJKA 2VHJA 4LJ7A 2ECKA 3WMEA 2GCOA 5FBRB 2ODNA 2Q3FA 2VLIA 4KSBA 1TQ6A 4UNPA 2LCFA 4WW0A 4C4PA 1FMJA 2CLDX 3AF3A 4NYIQ 4OQMA 4P31A 1UEJA 2NGRA 3BH6A 3E2IA 4PHTA 5AJYA 5H1YA 2IXEA 3B60A 4CEIB 2WBLC 4R2HA 4D4LA 1AA9A 5BYKA 4UXJA 4ZIRA 1B0UA 3U3JA 2FSIA 2UVQA 2LKCA 1G17A 3BORA 3TSZA 2D4HA 3VHLB 1UKVY 4NYMR 2B21A 3PV0A 2A2ZA 4Q4JA 4RZUA 3LFUA 2RMKA 2NO6A 2QL6A 2XZOA 3ZS9A 1ZAKA 3MAAC 4H1VA 5C4GB 1JR3A 2H18A 5TV2A 1P2SA 2VRWA 1DAHA 1EFCA 4JJKA 5GJBA 4K46A 4FWTA 4JKIA 4QHYA 1N5LA 1R8QA 1G5RA 1MV5A 4TMVA 4EJSC 1M74A 3WHLA 3GLGB 2J7PD 1KSFX 1L7VC 3IPXA 2J0SA 4L4UA 2OLJA 2WKQA 1Q1ZA 4TN1A 3EPJA 3PUWA 2CL6X 4TLEA 3EZFA 2OAP1 3K0FB 1KDPA 1SVOA 1E0KA 4ZKDA 4OHZA 2RHMA 5D3QA 3TNFA 2CDNA 1PLKA 3LAWA 2JGNA 1F6BA 3CUEF 1D6JA 3EIHA 2ZI5A 3RS4A 3IBYA 5F98A 2OFXA 1P75A 1NG9A 1OYYA 2ZROA 4NYIR 1AS0A 1SVMA 5FI1B 4DLSA 2NMVA 1DAFA 5FOSA 4TWZA 3U7FB 3VNUA 4BASA 3REGA 2E9SA 2NQ2C 1VECA 1GSIA 3B2EA 1KKLA 3GLHB 2J41A 2FPMA 4JBXA 4LRWA 4BEJA 2A5JA 4BQSA 1M34E 2H5EA 4JLNA 4TMWA 3ZDQA 3TUZC 1DTSA 1WDTA 1Q22A 4QJ3A 3GLIE 4P4SA 4BZQA 1UDWA 4IEEA 4KITB 4FCVA 4Q7LA 2QGZA 2J0UB 3VR2A 3B5JA 2ZJOA 4TL9A 3BXZA 3RS7A 4QKQA 1G8GA 1SULA 1FPMA 3I1FA 1J8YF 3GD7A 4G5QA 5EP4A 4DCSA 4DUGA 2XJ4A 2DWQA 2XZLA 2G83A 3DZ8A 3HU3A 4NCHA 4LK2A 1GL7A 5G3YA 4CT4B 3ZLJA 2AK2A 1UFQA 1XZPA 5E4FA 2XZPA 3ADKA 3VR3A 4QGFA 3T06B 1G8PA 2JLQA 3KUDA 3NKVA 1GNQA 4QGGA 4OJQA 4CEHA 4A8JB 3SBDA 3AP1A 2QENA 4DEYA 3ADCA 1R8SA 4HB2A 1P9RA 4AI6A 1KJYA 2EFGA 3GJ7A 4URYR 5BW8A 1ZRHA 3K0AA 1I2DA 4Q7JB 1FTNA 1GRRA 2QN6A 4Q02A 1Z07A 1JR3D 4Q1BA 1CTQA 2E1RA 1VIYA 2CJWB 1FP7A 1XEWX 4TMTA 3GJ4A 3TRFA 3FKSA 2I3BA 3OHMA 2H7VA 3MUFA 4DDVA 4F93B 2W58A 2ZRCA 3NHAA 4M21A 1XTRA 4BLPA 5IT5A 1G291 4DLVA 5E95A 1MO6A 2ZS8A 3ND8A 3RRYA 1QDEA 4BGDA 1R0XA 5EXSA 1W47A 2VSOA 3T1QA 3QF7A 3I3SR 3TAUA 3D3QA 1CJVC 3GEHA 4JBYA 4YLGA 4WA7A 1US8A 3F3YA 3QKRB 4PHFA 1TEXA 3UWKA 3L0SA 2G9NA 5KSZA 1SXJE 4XWOA 3X1DA 4XTRA 1D2EA 2BM0A 2ZRDA 2PZEA 1Z63A 1EWRA 3Q3JB 4G3XA 3OIUA 5EXTA 3X1WA 1QHNA 4Q47A 2VSFA 1AGPA 1F2TA 4MRPA 2ZRIA 1CP2A 2ERXA 3IDQA 4HAYA 3VR6A 4IW3B 3UATA 1D2MA 4D6PA 4JYBA 5L3QB 1IXSB 2XSZA 3IGFA 2QP9X 1UF9A 2WAYA 2AD5A 2QTVB 1P9WA 2ZR7A 3FWYA 1OXXK 1JXOA 2HCBA 4PZYA 4Q9KA 3HWSA 1IN7A 2SHKA 4Q7MB 2CVFA 4E5UA 1KKMA 2OCBA 4DT1A 5GJCA 1EFHA 1M2OB 2EWVA 2V54A 3R8CA 3RRMA 3FKQA 2ZRLA 5FTLA 3VQTA 4ERNA 1NLYA 2P6RA 3NHBA 3LDAA 1N0WA 4CW7A 3SS8A 1XD9A 5FBQB 1QVAA 2Q9CA 4YMUA 3DDCA 3CNNA 1XJCA 3AF1A 4M9SA 1NF3A 3A1TA 3CIOA 5ANRB 1G7RA 1E1QA 2YNMA 2BJVA 3FKSD 3RANA 1OF1A 1G16A 1MR3F 2NPFA 3VKHA 1OT3A 2Z43A 1M6NA 5CM9C 1N2CE 4PAQA 3U44A 1CJMA 1MABA 1XMSA 1Z47A 1HA3A 2YOGA 2O8FB 1W1WA 2IYYA 2GK6A 1CIPA 4Q4LA 1X1SA 2HCJB 5HCIA 4DCTA 2PH1A 1W36C 5LB4A 5J4LA 1TU3A 4QBHA 3LO5A 2QSZA 2A30A 3KQUA 4KO8A 5DHFA 2ZU6A 1DADA 4M0LA 5JZVA 4QM7A 2ZJZA 3PCRB 3ZZ0A 2FFQA 4KI0A 3B1WA 5EP2A 2Y8EA 4JLVA 1L2TA 1A1VA 2QI9C 2BC9A 2A5FA 3AKCA 3CWQA 3QXSA 4HLUA 2XTMA 5JRZA 3ZZTA 5BN5A 3UG7A 1N6LA 3QY0A 3NTUA 4US1R 2WM9B 1EX7A 3W8NA 3HYTA 4B48A 2BDTA 2QE7A 5FFMA 4QBFA 2BBSA 4N0DA 2P6NA 1GM5A 2FNAA 1FFHA 1VG1A 4TYPA 3K09A 1I2MA 4A4DA 2F1HA 2BBWA 2P65A 2FF7A 5C2JB 2FH5B 3QQ5A 3WP0A 2QSYA 2XSZD 3N2IA 1ELOA 4DC9A 1NI3A 1IN4A 4KBFA 3WMGA 3SOPA 1GKIA 3GQBA
chains in the Genus database with same CATH superfamily
3N86A 4EQ6A 1B74A 3ESZA 3M6LA 1K5HA 4IVNA 5TPZD 2F64A 3EPHA 5HXAA 2C7OA 4PSVA 4TVKA 3IIIA 3CEJA 3D5TA 2H52A 3QKSA 2OQ2A 3HNOA 3AG6A 4GT1A 4D9BA 3I0MA 5DOZA 5G3ZA 1FX0A 3TOZA 5AKJA 3ZU3A 1JSZA 2BMVA 1G42A 4BPRA 1QP0A 1JQLB 1KJWA 1KZ4A 3WE7A 1N8NA 5K5EA 1QQ7A 1SB9A 5C35A 5ESDA 3L3BA 3E9ZA 1K06A 2GEJA 1DRVA 2JAOA 3L6RA 4JT2A 4ND6A 5F3DA 4RTSA 1DC7A 2O3UA 3DD5A 1YCGA 1S1CA 2PXHA 4JV5B 1Z74A 2P67A 2IP2A 4PSDA 1GKYA 2YOHA 4RKWA 1ABBA 3F4LA 1X7DA 4DV1B 2LBPA 3EQ2A 4LHYA 1OBVA 4G0MA 3CCCA 4M9XA 5E9QA 4ER7A 3SS9X 2W71A 2VATA 3E35A 4FHZA 5FFNA 5YASA 4OMFG 4D25A 1Z62A 1U6IA 1P62B 2PBLA 1CDOA 2Q2WA 4K7JA 1MAAA 2IUEA 2WSLA 1X7HA 1K66A 2OM6A 4D9HA 3JQ7A 4R1MA 3BICA 2VYVD 3MMPA 3OTHA 4FMDF 2I03A 3NC4A 4RVOA 3SEAA 4GBGA 4TWBA 4F5DA 4ARUA 3TTUA 3OOHA 4AS2A 4NCJA 4P3OA 3HFJA 1JNXX 4O2BB 4EJFA 5LP1A 2HF7A 4JLPA 2GN1A 3U0BA 5KSPA 1EEXB 5JAUA 1SUCA 4W7HA 4O4IA 4X00A 2B1RA 5CXSA 5K0GA 3D64A 2EBUA 3FNQA 4XCQA 1RRCA 4QU5A 3EA4A 3DE7X 7REQB 1Q83A 1PT9A 3GEMA 1BH6A 4QELA 2H9YA 3DPSA 3JXEA 2PX2A 3C2QA 4YONB 1AUPA 4DXAA 1YACA 1EFVA 1NMSA 2PFSA 1OWMA 5C0OE 3ENQA 2C3UA 4ENPA 2DBZA 4W1PA 5KIAA 3NEPX 2E87A 2GAJA 3J81k 1T8YA 4RDHA 2WTMA 2EGHA 2BM9A 4GX2A 3VOTA 1OH5A 1T6BY 2I7CA 2XZDA 3HGQA 1X38A 3UKJA 1E62A 1F2VA 1MQSA 4RC9A 3UV3A 2Q6IA 3DDHA 2VDMB 3JARA 2AF4C 4OXNA 3UPDA 2FDRA 3OPQA 4FEAA 4ZAZA 1QRSA 4BXOB 1DXYA 1ULTA 2CYCA 2PT9A 3K1ZA 3L9WA 5C51B 3TD2A 2LW7A 3HXPA 5TLSA 2WVHA 2V9CA 4DV4B 1JEEA 2ASEA 4PQYA 4QICA 5HNKA 1Z4IA 3EUFA 3P9IA 1SCJA 2O57A 4UNNA 3K0KA 2LRHA 4REQA 1E2KA 1F6WA 1OYOA 3DLCA 2OBLA 2NTNA 4JI0B 3TZKA 5CDGA 2C1ZA 3DFZA 3G6WA 1DT3A 1Z7YA 3SF0A 1C80A 4TV9A 4Y1EA 3O9VA 1MB4A 4J0JA 4TMYA 1E6EA 1M34A 5TS2A 4KR9A 4AJ9A 2P8JA 2YV5A 1IN5A 1ZOOA 4LJ4A 5FWYA 3DBIA 1QM5A 4NJOA 5TNXA 4G1CA 4M9QA 3SNHA 1Z5GA 5K20A 3C7KA 5DI9A 2DT8A 3VNQA 3WLAA 3V9PA 1RS0A 2AI1A 3H65A 4IXNA 3SFVA 3FOFC 4MR7A 2X22A 3UOWA 3KLBA 2OCDA 2VK1A 2Z2KA 3BWVA 4N1AA 3UT5A 3ZD6A 4OQNA 1WSDA 5EE5B 2CN1A 2CNKA 4OGLA 3UGJA 3P19A 1Y5RA 2ZIXB 4FXPA 5HCUA 1UINA 2Q6KA 4P84A 2OCYC 1A0OA 4I55A 1A5SB 1XMVA 3QH4A 3IT1A 4QQNA 4BKPA 3W9YA 1N6HA 2C2GA 1AT1A 2PA3A 5KPDA 5CCBA 4GO1A 1KDTA 4HEHA 3VR5D 2VJKA 4URZR 3TG2A 1PWHA 2BGIA 5B55A 4C7MA 5D5HA 2Z5LA 1QHHB 1JIQA 1LBEA 1SJ9A 2IUUA 5DIFA 3B53X 4E70A 5HWSA 1Q6YA 4TT3A 3K0CC 1OJLA 2RI0A 1E9SA 1KPGA 2FSFA 3QUCA 1Q1EA 1U3TA 3NB0A 4GUAA 4UCWA 1S2IA 3TIFA 3TQFA 3SBXA 1MIOA 2C9YA 4FZ3A 4KFCA 2D1FA 1Q91A 1XL0A 4UEQA 5HUHA 4EYEA 2JFZA 3Q8XB 2CE2X 5HBRA 3N7AA 4MGZR 1IEXA 3PUYA 3CR3C 5AI4A 3IQDB 3AJ9A 3I37X 1UJ2A 1CD5A 4IL5A 4ZZIA 4IG9A 4K9SA 3E1SA 1N6OA 4JUIA 3EVTA 2UXCB 1DKUA 5ENVA 1EI9A 1P2TA 2C5AA 2LDXA 2VTKA 4MVJF 5KWIA 2OFPA 4M60A 4MHTA 1RFGE 2X9QA 3O7WA 3P8ZA 5DYWA 3HYCA 4NOLA 2QZZA 1AOXA 3TIXB 3P5SA 2NZWA 5G0WA 5LQKA 2AKAB 4Q4DA 4ABYA 2GYVA 3AWIA 4KO1S 2DUUA 4RCZA 5JXWA 3WC4A 4JSYA 4JELA 3IMCA 4P5PA 4UHFA 4JT4A 3SM9A 3FOAA 1R12A 4N39A 4U6QA 1THMA 1LDBA 2BSAA 1ZQ9A 3W0LB 2J85A 2IK8A 2O2YA 2HHLA 3K71B 3B1YA 4QDOA 1WBJB 1XJ5A 5KDOA 5DNUA 2B5WA 1DX4A 2QI9F 1FQOA 3ZC3A 1X9HA 4NJEB 1R4NB 1B4DA 4U0KA 1I6KA 3THXA 3K4PA 3S8YA 2IYFA 3DTNA 3P0IA 3NWPA 1BNCA 2J3EA 4HQNA 5KBYA 3H2BA 3EC2A 3JRWA 1QIFA 4UVGA 3KQPA 4OOFA 4Q0MA 4FFRA 1R8YA 5IW8A 4YDQA 1WEHA 4UUPA 3V1YA 2GM4A 4HLDA 4XDGA 3SS7X 3UUFA 3UJBA 2O0KA 4KKXB 5HSGA 5EI5A 2IHTA 1KTIA 2P40A 2W2MA 1Z8DA 3DVAB 1DINA 1GO2A 3DUFB 4Q4AB 5A3VA 4HS9A 4YC7A 2PUEA 3IILA 4DR1B 3UANA 2ZU0C 3EDMA 3U44B 3E5RA 2ZANA 3MT7A 4PYMA 4AMVA 3WK8A 3RU9A 4ZN6A 1GR0A 4CBVA 4J0QA 5E1BA 1K6MA 2AG1A 5DEIA 3KJNA 5JAIA 2Q4OA 3V2IA 2WD9A 3CEMA 5KYVA 3OMXA 3RF6A 2JHCA 1DFGA 1JG3A 5IDWA 3DDOA 1P0FA 3O4FA 4R2KA 4RVDA 5TQ2A 1H65A 2O1SA 2C9CA 3RS2A 1K7XB 1CJSA 1LPAB 3KZNA 1TPZA 3QX8A 4IS3A 4X54A 5E2IA 3P2MA 2EG9A 2YDXA 3GUZA 4PXYA 2MINA 4YJHA 3AFOA 3KOXA 4J0EA 2XEDA 3RBVA 1IHPA 3BULA 4L76A 4BIIA 2J3QA 2AHOA 4RVNA 2OOKA 1FLVA 1KHHA 2ARKA 2I6UA 5FB3A 4U7DA 3L0ZA 3CHYA 2ACEA 3CLTD 3G2IA 3ICCA 4R05A 1OYVA 5KYKA 4C4TA 2IX3A 1OZAA 3EXFA 1W96A 3Q5DA 2DH5A 1C7EA 1RZRA 2PEYA 3GELA 2ZB8A 1YI8A 3PGMA 1H0SA 3VO1A 1XWIA 1V11B 2DPLA 5H0IA 4YR7A 2FW0A 2C88A 3PWSA 5HE9A 4PRKA 3JQCA 5I7VA 1WMFA 1ZUD1 3CPJB 5BNTA 2W90A 3R1IA 5ICEA 1EHYA 1KAHA 2A78A 3BSSA 2GEDA 3KTAB 3WRVA 2H63A 4ZHQA 3MIIA 4IP0A 1UBCA 3IDSA 1J99A 4WNCA 2BI7A 1KDYA 2FQYA 4RD4A 3W2GA 2OO5A 3ZVLA 4O25A 2R1VA 5AR1A 4OLAA 4MW4A 1FFGA 4PN7A 1PJ3A 5A9TA 5F9HA 1PDOA 5EA2A 4K6FA 3H2GA 3KB8A 3MJDA 4ZDIA 3IS3A 2EJWA 4H31A 2AW5A 5LD2C 1QTQA 3WBFA 2I0FA 4GRDA 2O8CB 5D3ZA 5EZ5A 3FUTA 3H83A 5EQDA 3G79A 3BGVA 1GP2A 4OI0A 4Z3KA 4DR7B 3CSDA 1BHJA 1KJ8A 2GA9A 4B32A 5JS6A 3A1DA 4ZVVA 1U2PA 5BSUA 4EGAA 2H9IA 1B6TA 1WE2A 3MGBA 3PG5A 3TLZA 4A0SA 1KEEB 1Z3CA 2ZB2A 5IVDA 3AB7A 4CLEA 4YMHA 3U49A 1JU3A 3O2JA 1QHXA 2VP9A 4AMYA 2WHXA 3V7WA 2Q6TA 4NU5A 3SX0A 2XCSB 3EEFA 4QUIA 1UM8A 4Q4HA 3DFMA 4GBJA 1OBCA 3AKEA 4YHHB 3AILA 4URWR 2ODWA 1BMFA 1TYDE 2C2BA 2PIAA 4J7AA 3ZHQA 1DLJA 4GLJA 1YZUA 3FWZA 1O89A 1YQGA 5AXDA 1T3SA 3DVLA 1VRWA 1J25A 1P80A 3D7KA 4GYKA 1QOQB 1OGIA 4MIOA 2WFMA 2DY0A 2PGNA 2XOKD 3DE4X 3BSYA 2WMOB 3R6LA 2FEPA 1HMYA 3PRKE 4MI6A 3NP7A 1GCOA 2R47A 1GRCA 1I7PA 1WF3A 3PBKA 4XXHA 3UHAA 5AKXA 3A8TA 2IS1A 4FQ5A 3PFFA 1JSRA 2BFDA 3SQLA 2HKIA 4CGYA 3WL5A 3I92A 1B16A 1GUDA 2JA1A 3PJDA 2TMKA 4S2EA 5JNSA 2QX8A 3U3KA 4JXXA 2Y99A 2J9RA 1HH4A 1WMEA 2M1ZA 2FVYA 3QHQA 4MQEA 2PD4A 3AFNA 4KXQA 3I8XA 3F98A 3PRJA 3R4VA 2CHVA 5AVKA 5GGXA 3RG8A 5DW3A 1GFSA 2A0FA 5JJLA 4RA6A 1ATZA 3TKLA 1WZNA 1LW6E 3H7AA 3OLQA 5KX5F 4LCJA 5I7UA 4K88A 5CAEB 3QM1A 3KSRA 4XZ3A 4M83A 3WXMA 5DV9A 4CL8A 2J31A 2H4WA 1N1EA 2GS9A 4LY9A 4ZIRB 3FOEC 3OZVA 5DN6A 4NDAA 4GI2A 4B0PA 5ALZA 4C7VA 2PSHA 1T34A 1OFGA 1YC2A 2QZPA 2VK2A 3VBEA 2GAAA 4W5RA 2W6NA 1KMIY 3OZWA 1TTHA 1UZLA 1P1CA 1PJ4A 2QTMA 5MDHA 1ABFA 2BGMA 5JHHB 4LOAA 3IPCA 3CUKA 3ZD8A 1CUDA 3K70C 1R74A 2A1UA 4HUQA 4OP1A 4RETA 4ZGWA 1LK5A 1FFXA 1FE8A 5I5EA 1SUDA 2CLMB 1GQFA 1UKBA 5B7QA 4WGFA 3EVNA 5F78A 1RCUA 4OYYA 4BNJA 5MN5A 1E69A 4JJAA 2M6KA 3CN9A 2ANBA 4UE2A 3KSDO 4A82A 4OHXA 4X85A 1JIVA 2VCHA 5HPYB 1QP4A 1UAAA 2M9MA 1S2MA 4C06A 2IZ6A 2OESA 4CIBA 1WEKA 2TSYB 5ALTA 4W9MC 1Z68A 3OC6A 2IXTA 4MYDA 4BO2A 4EOGA 4CN8A 3KL2A 1V5WA 1PVVA 4ATNA 3JQGA 2X1MA 4P36A 1QMGA 1SKYB 2CLCX 4N5DA 5THQA 2CMGA 4PGFA 1CRPA 2WABA 1F0KA 5BSFA 2HIAA 3VZPA 3ULKA 3B1KA 2B2XA 4X6LA 3LUHA 4WSOA 3TSCA 3RFXA 1I13A 2BFBB 3UF0A 4FN5A 3TQHA 5KX5B 5LL6P 4RMIA 5IBQA 1DIHA 1LGYA 2AQHA 2JL1A 2O0JA 2YWDA 4QUGA 5E9WA 3HCWA 1KYYA 2FXVA 2IYQA 3CKYA 3IHLA 1NIJA 3CX8A 3CVWA 3OIVA 1EH5A 4INZA 4XIGS 4CLOA 4DLTA 2J0QA 3B9RA 2RGBA 2WF9A 1JEYB 1I2CA 2BGJA 5BQOA 1MFZA 1K68A 1PFWA 3F3KA 3HV0A 3U1VA 5C5EA 4C0JA 3IUEA 2CDCA 4KDCA 4OB7A 4EL0A 1GA4A 1F8UA 1UKYA 5B3JA 3HTXA 4UZFA 2IYVA 5ALYA 3I83A 4D92A 3VTAA 3QE2A 4XSHA 4TRMA 2HLNA 3MLEA 1HE1C 2QAGA 1AH2A 1J7KA 2CXTA 4FHFA 5F1KA 5LYJB 1KDZA 4G9GA 5LU8A 3FY4A 2YHIB 5BW6B 4R2WA 2Z2IA 2VNIA 3OO1A 3TTYA 4JASB 5BSWA 1FSSA 1RWVA 1SVLA 1U7OA 4RJ2A 5AW4A 1MEEA 3S2FA 2G77B 1C0IA 3KFXA 5T57A 3CEHA 1AF4A 4BZPA 4Z6KA 5KTPA 5EE3A 3U3OA 4DIEA 3IOYA 1R0KA 3ZE0B 3EVFA 2ISQA 5CX1B 3T5PA 4WY5A 1V6SA 1NBAA 4AMGA 5KNBH 1ZR4A 2RGCA 1BN6A 1T2VA 4MMXB 1S96A 2CWWA 1YKGA 3ZKWB 2ECPA 3YASA 2DWUA 3C3YA 2IIPA 3IR6A 4S0XA 2PD6A 4Z9YA 4BGVA 4U3JB 3OWOA 1LRJA 2KYRA 2D5IA 3B3QA 4GM4A 4JT9A 3RLFA 1Y4DE 1GEEA 3C5CA 4FLFA 1R0YA 3SY8A 4PTZA 2HHHB 1XA0A 2BE9A 4ODIA 2X1LA 4MYRA 2QLNA 4HAXA 2HFJA 2GESA 3KT8A 2EKLA 3FWNA 3JQ8B 1US8B 5JD3A 1NVGA 3Q88A 2QG6A 5SZJA 1MX3A 4J91A 4MQFB 5BW5A 5JCXA 1L5VA 1QFSA 1RRVA 1D2HA 1W9MA 1SOMA 4Q6WA 4Y1FA 3N3AC 1Z28A 2H5IA 2X15A 1E1RA 5IANA 4JCOA 4TX1A 3UCEA 3DQQA 3WQRA 1FXWF 3F78A 1I6WA 2FZVA 3HVJA 3PDIA 1JA9A 4NFSA 2QTLA 4K9QA 5A3SA 3CX4A 1ZM3A 4K6CA 4PSCA 4GZLA 4QXQA 1LX7A 5EIAA 1NX6A 1IBMB 4XB2A 5KTOA 2GCIA 4JC0A 2YZMA 4FVTA 1Z6AA 4GBMA 3LZDA 2QMYA 4QFDA 2FEMA 4X45A 4L51A 5FKJA 3ZHVA 2BGGA 1EM8B 4IDAA 1WSAA 3FF4A 5DEOA 2FG7C 1N77A 4Z53A 3L02A 4AY6A 3FMOB 5AO9A 2NTVA 5TMBA 1NMYA 1XQ9A 2FP4A 3M3PA 2ZJ7A 2CL7X 1NF9A 3ROKA 4DT1B 1QQ5A 3UOAB 1QC5A 3LUGA 3S4YA 4DLRA 4X20A 4U2BA 1GPNA 3ZE8A 1PUJA 2XUDA 2ATIA 1NXSA 2W6ID 2IHBA 5DI3A 2AMYA 2JHFA 2F9FA 1BJRE 2AH5A 3W6NA 5AKZA 4MDYA 2XXAA 4B3HA 4ZDWA 3T99A 3TR5A 1V7QA 2WPDD 2HJHA 3U3ZA 3HCPA 1A4RA 1F8FA 2VXBA 2Q41A 1JWLA 3QBTA 3L6DA 3TRIA 4KK4A 3SC6A 5JU6A 1TKCA 1ZVMA 3HN2A 4RHYA 2ONZA 2YHAA 2RJNA 3DWGA 3JYLA 4P80A 3U19A 4V39A 1QG0A 1FNNA 3DQZA 3TCXB 1G6KA 2FSHA 3RC9A 1LFAA 4ALJA 3ZQ6A 3SE0A 1S3FA 3R0VA 4R68A 3CIFA 2XUFA 3HV2A 3R20A 3HPRA 4QUBA 4B6FA 3EODA 1CWUA 4YS6A 4WTOA 1A7AA 5I7WA 2EKPA 2PBZA 3NASA 3SQNA 3CH6A 3UHFA 5EKTA 4DCNA 1VXRA 1KP2A 4M7PA 1VLLA 4EO9A 1OBFO 2J3KA 5KYYB 3U3DA 1WCV1 4KO2S 2PKXA 3QU7A 4N3NA 4P7BA 4WK6A 1QF9A 4GZMA 3ZH2A 2OG2A 4WN3A 1ENPA 1VL2A 4JKOA 2FN3A 4P83A 3RUFA 5CLFA 1K7YA 5GPBA 4Q3NA 5AT1A 1EE1A 4KPEC 1QP8A 1SZCA 3INNA 4M0KA 2JFVA 1UPCA 1NLZA 4MB2A 5MN6A 2CEKA 5BN5B 5F1OA 3CB4A 1WDLA 5C5CA 3NT4A 4YX9A 1GNVA 1PO7A 2WJZB 4V0SA 1G20E 2I6FA 2F43A 3IP8A 1OLOA 1CVIA 2ZUCA 3OA0A 1JYSA 2FUKA 2F3UA 4Q19A 2H4JA 3LGSA 5IVHA 1JHZA 3CO0S 6ABPA 1FK8A 4CV2A 2BY4A 3FJ1A 2H11A 3H5WA 4EJMA 1I7DA 3F47A 2SNIE 3GQBB 3SC4A 1VIVA 3ASZA 2HR1A 1WPQA 1W6UA 1FXWA 1SU6A 3OZ7A 1PQ4A 2D62A 3PSHA 3UAYA 4BNHA 1FTYA 3F8TA 4Q3EA 3RK4A 3GO4A 3ZHOA 2G72A 3CMMA 3Q7SA 2WTUA 1HT2E 5CR9A 3GP3A 4JXKA 1IQRA 1XZMA 2WU0A 1L4MA 5THXA 4EABA 3CF4G 1W85A 2A88A 5DTIA 1XMPA 2VA8A 3BB4A 2IP1A 4YALA 4MYSA 1ZWLA 2C99A 3JQFA 4DSAA 4ENRA 2Q46A 5IAGA 4FCWA 2R1TB 1DBIA 3W5VA 1JDSA 1OFUX 1ZHHA 3CW2A 3OSZA 4BNVA 3CH4B 4HWRA 1MG5A 2ORWA 5AI0A 4F1JA 3GL9A 4JLDA 5J4YA 3ITNA 4K6KA 4LHXA 3OVMA 2B8EA 1H8HA 3L0YA 1LK7A 4LHSA 1BA2A 3DZHA 3QMMA 3K2IA 1Q1QA 1Y4AE 1N7GA 2POCA 4HLQB 1R9NA 4ZCIA 5LMUB 4EPRA 3LY9A 2QD2A 2XDWA 3LC0A 1CY2A 3QYJA 5EIOA 4DVJA 2QJFA 3OG9A 2CFSA 3W2FA 3JTMA 4YI5A 4ZAVA 3CM0A 4LXIA 2GVZC 4Y2HA 2OAQ1 2FU5C 3BFKA 4C4RA 1W581 2I2CA 2W98A 3QSGA 4D4JA 1YQTA 1MN6A 1CRWG 4U1RA 5EC8A 1D1PA 4REOA 4EVIA 3IQEA 1U9YA 4X1KB 2ODEA 4HNHA 1O6ZA 3TB6A 4HDMB 5ED4A 4RJJA 1YF3A 1KJNA 2VPZA 1F17A 2X1VA 4U7HA 3TSOA 3HY4A 2ZE8A 3RIXA 2HQOA 3MUNA 4G1MB 4V0OA 4O5AA 2VQDA 5IKXA 1V5GA 4QE3A 5LFAA 4DSUA 4S35A 3K1YA 1UL1X 1WA5A 1FJGB 9MHTA 2ZYRA 2OPBA 1KY3A 3HS3A 1IY0A 3F90A 3PD7A 3ZIAD 4B85A 1SXIA 4CNBA 1WKCA 2WUEA 5BNWA 1ZCFA 3B9BA 3AEUB 3ZIDA 5C4IA 1FP6A 3EOBI 1WZCA 3LUPA 4BTVA 5TIIA 4KQXA 1ZIOA 4KUHA 1A8IA 4MW9A 5ARBA 1KDOA 4TXNA 4UHHA 3KXPA 3KZVA 5J9FA 1V3QE 3AKDA 1Y9AA 1ZIYA 2ZBRA 3STHA 4X65B 2ILVA 1WUJS 3CJTA 3M9LA 4GD3Q 3WBJA 3DNMA 1IOVA 2BBOA 4NDZA 3LBFA 5EMMA 3SZMA 4EG3A 1JEQB 3U2QA 1F5SA 4XWWA 3NHUA 3PX7A 2NO4A 3KKKA 5JSZA 2ZSUA 3OUTA 1IN8A 4KO4S 3JD1A 1T6YA 2AZDA 2REQA 1M2JA 3QVWA 3K0BA 2PX3A 1E9CA 3HU5A 4LMBA 3ZCUA 1AJEA 4QPPA 3BMCA 3T7EA 3GLIB 3L7NA 4Z8YA 5M2QA 4WLEA 3RVJA 4DA8A 3PNPA 1NONA 4AKEA 1KS9A 2UYYA 1LJUA 1R37A 1H2WA 1QGDA 2F2TA 1K2VN 2XUOA 2HBZA 1R27A 3GAMA 5FJIA 4BO6A 4DDHA 4DLKA 1ITZA 3O3MB 4ZVLA 3JQQA 2FXIA 3TTXA 1GL9B 5K3EA 2RH8A 1HR0B 1N9KA 5BMVB 5KCMA 4KCGA 3WSVA 5WRFA 1EUDA 3IE2A 3PXCX 2FN8A 4JUFA 3ET5A 4ZEVA 1HFEL 4HAUA 3CWCA 3WOVA 2G5PA 5A62A 1E2HA 4ZTBA 4N03A 3UGTA 1N6KA 2BFEB 2O05A 4NRDA 2FFJA 1E64A 5IJXA 3WLKX 3GP8A 5A0TA 2ORED 2YZ2A 3A6EA 4Z1MA 3U5ZB 1BVRA 1CQJA 1FNCA 4UU7A 4WOKA 3UUGA 5FTMA 3GRAA 3PDHA 4DW8A 1L9XA 4B46A 1VL5A 5JNVA 4KYIB 4KV7A 2ZBGA 1RXCA 4RENA 3L7OA 1XWWA 5C34B 2WHEA 3M34A 4N5HX 1AKVA 1U0NA 3ISVA 3V8NA 3WKEA 1Z12A 4IFIA 1BQ4A 3N74A 3WRWA 2IYOA 4OI1A 1C0EA 2PK3A 3NHKA 3R41A 4BE4A 3ZQUA 1CIJA 2VHXA 1N6IA 2FQWA 1NVMB 4IZ6A 1XTIA 4ON9A 4X9XA 3OZRA 4CTOA 3TKAA 3L8FA 1RM3A 2NZUG 3LBHA 4C0AC 2Q99A 4MX8A 5LQCA 3LHKA 2QM0A 4RY2A 2O52A 4QYWA 5CNKA 1LSOA 1PE0A 2Y1OA 4UC0A 4ZREA 1CJKC 1EINA 4XI9A 3GG2A 3ONEA 1Z06A 3AV3A 3D02A 1G38A 1JHYA 3F0TA 1J2YA 2NUAA 1QANA 2D3TA 2X2EA 1N2GA 2QY9A 4R7ZA 2O4UX 2EVWX 1NJ1A 3HO8A 4K9RA 1DXQA 2IWRA 2KHZA 2GHRA 2Y76A 2JCVA 4H1TA 3RCBA 1RLUA 2CFIA 1GQYA 2E7ZA 2FZWA 2QN8A 5ALIA 5FWAA 4BBPA 1M2VB 1VP3A 2AOVA 2BFPA 2C94A 4FONA 3T5GA 3SJ7A 1EFAA 1SG0A 1ZDMA 3I6BA 5T67A 3PHLA 3TVTA 3LG2A 1OJ7A 5LP6C 5TEWA 3M1IA 2XJ9A 1LF5A 2JCGA 4AF7A 1BH2A 5DNYB 4L9RA 1L8XA 2AIRA 1AY0A 5K6AC 1Z34A 3AFGA 3QF4A 3NTVA 1AN9A 1Z5WA 4BL5A 3QNMA 4HBZA 4HS4A 2HU2A 4M0CA 4DMMA 1CSEE 1GGKA 1GZUA 3ZJVA 1NPYA 2K87A 1SBHA 5CIQA 1XXLA 1PZXA 2JVIA 4HI0E 3UMYA 1T5OA 4MPTA 2A7QA 5BYBA 1PT7A 3AR7A 1WB5A 4J1QA 2O14A 3CB2A 2J3MA 3EZ6A 1X3SA 3C7AA 1JJIA 2FZ4A 2VPTA 4V0QA 4ZCPA 3I3OA 2BBTA 1RAEA 2W2LA 2QTRA 2QT9A 4D8YA 2QPTA 4XDZA 3KAPA 1Z75A 2QZ9A 4XQCA 2V6JA 2HA5A 3IT0A 2NU6A 4KI7A 3ASUA 4BE9A 3D3KA 1XKXA 3KOUA 4UUAA 2QM8A 2UZ1B 1ZH2A 3ZCRA 3CRW1 5P21A 1ORDA 3NIWA 2ZJ6A 1QYDA 5GONA 2JHGA 2VJBA 1RHRA 3FDXA 4AMZA 5IFLA 1TYAE 1L1QA 3OE5A 4U4AA 3LK6A 2V4ZA 2GRJA 4C2BA 3Q0EA 4JAVC 4N3GA 4XTCS 4ZCTA 3LC2O 3GT4A 5CEFA 1MX9A 4I4CA 4XLLA 4LC1A 1N2CB 1PZHA 3IV6A 4ND5A 3ZWBA 4E5PA 3O4IA 4RCYA 2N75A 3RC7A 4FNAA 3GCWA 3X2EA 2Y0DA 1JH8A 1UBHS 1G21E 2IHUA 4NF2A 4QVGA 4YTEA 2HBRA 5A4KA 5JPCA 1AF7A 3DBVO 3HJNA 5TJHA 2IV2X 1UOQA 5AK0A 1WSBA 3RG2A 3ZHSA 1NBHA 1GUBA 13PKA 1ESNA 1NJ5A 3R7SA 1OWOA 3AGPA 1KQNA 2HMWA 2FPXA 3D2CA 3PUZA 5A2GA 3M5WA 3FFAA 3OJEA 5DBHX 2EOAA 5BWCA 5BSTA 5IM4F 3FVQA 4F21A 5ALJA 4CR6A 1L7PA 3D43A 3B2QA 4PICA 3SKXA 5DGXA 3ZLBA 4BN0A 3NOQA 2XOKA 1IZYA 2IPNA 2JW5A 4I9HA 2CXUA 3NRBA 3RS5A 3ZLVA 4YR9A 2R4UA 3ILSA 5KMGB 4G41A 4MUHA 5E3HA 1G20A 4J2OA 2I4TA 2WJJA 2JLAA 2VNKA 2WI8A 3AR2A 1XD2A 3FNGA 3QWHA 3SZGA 1GPKA 1CCWA 1IIBA 5EJ6A 1A71A 2G9UA 4ARZB 2XR1A 2ZEJA 4QTZA 3BZBA 3K9GA 1N2IA 3NH9A 1GFIA 3Q8WA 3M49A 4MKXA 1JVNA 2QNBA 3Q7EA 4I66A 1V0JA 1MQ9A 1HYEA 3CXRA 1DWQA 4IIJF 4IIHA 3VZQA 2GWRA 5BWNA 3EVEA 2VAPA 4I6EA 1T1IA 3M0EA 4Z0TA 1I7SB 1TLLA 5SV2A 1UQTA 1U0OC 4IS2A 4MV7A 4NG5A 5IZCA 3DOEA 1EP2B 2E89A 3FUCA 3HBMA 3WKBA 2JHPA 4RTLA 4QTYA 3AVWA 1GG2A 3NWEA 3B89A 1CEXA 1FBNA 3CISA 1W8DA 2QV7A 2IYTA 4O2LA 2ONJA 5EIHA 1ONSA 2L69A 2DLCX 1OTHA 1HF3A 1MKYA 5FCDA 4WERA 3N05A 1OFTA 4KGDA 3M82A 1WHTA 2BMAA 2RHTA 3N0XA 4WACA 5B2ZA 5IH7A 4ESOA 1O58A 1HOXA 4DVGA 3QEOA 4G5YA 4V38A 4JBHA 1KY5A 1M5TA 4HLUC 4QHTA 3C85A 4FFBB 4HL6A 2YWCA 3EPRA 3ILVA 4RQAA 3TDNA 5C8VA 1T5LA 4ZXPA 5JNUA 1NTOA 3FUUA 4JGGA 3RTBA 4XEUA 4ETMA 3ZDEA 5AM0A 5C1OA 3N75A 5KWSA 1BQ3A 2XADA 5FBHA 1N9GA 3TW4A 1R16A 2RAPA 4JSTA 3RSHA 1ADBA 2F6RA 4CLRB 3N58A 4DCOA 2CVZA 2B98A 5B4UA 2GJ4A 2JEZA 1C81A 1RAAA 4FWBA 2CLFB 3BRQA 4NY1A 1AKEA 2CYAA 1R0RE 3RVRA 7MDHA 1P39A 3R0ZA 4QUKA 4E5NA 4I3GA 4NV0A 1I6LA 1XYYA 3KJZA 2IEZA 3IULA 4FYWA 3M4ZA 3GPIA 1M8FA 2HNAA 4L2IB 2BFCA 3PQDA 4LSWA 4DOMA 3E81A 1CPYA 4WJLA 2FUEA 5LPNA 1LVUA 4S0ZA 1S8OA 1XTQA 4M3NA 3SM3A 3Q9SA 4BMSA 4H59A 5MGNA 5KHOC 2BF7A 3OTOB 5IZ4A 3KQQA 1V8ZA 3N5CA 2G88A 2OFWA 3R9WA 3ZU6A 1P4SA 4IIJB 4AK9A 3K6JA 2LIVA 3B6JA 2IHJA 3L49A 5TQVA 4LWOA 5ILOA 2GLXA 3JQPA 5B4TA 2B6HA 3SLKA 2ACKA 4OQPA 5J4HA 1KMHB 2OBNA 4UM8B 5M3BA 3CWZA 4YRQA 1Y42X 2WG2A 1ODSA 1VJTA 3G13A 1XZFA 1R0BA 1VTKA 4UHJA 1WY7A 1S8AA 3GDFA 2C8KA 2IEBA 3AHDA 3FRHA 2IW3A 4NVRA 2PFKA 4YBRA 5BN3A 3E1KA 5AW3A 1Y6QA 3PHGA 3RODA 2RD2A 1CERA 5DGDA 2W00A 3CLVA 4NULA 2PMCA 1E79A 1UCFA 3CCFA 3R5HA 5EUCA 4KUEA 5FUMA 4CKEA 1N34B 5ICCA 1OZGA 2EXXA 5DMXA 4PC1A 4NR0A 2D5LA 4G63A 2JJQA 3D7LA 2CUNA 4LDAA 5B6JA 3O1JC 1ZA2A 4JXZA 4D7AA 1JE1A 5I9LA 4CIYA 3BOSA 3KEQA 4GHWA 3FD8A 4YMVA 5CPBA 3VTFA 1A88A 3O21A 2V0GA 1AXGA 1AKQA 3LX5A 1VCIA 4KC0A 1W36D 3RR2A 3NOXA 2WB2A 3M2TA 3V5NA 1GYPA 1GEGA 1UKZA 1OIXA 4MA0A 1JJVA 5ECGC 4HWPA 4XR9A 2C5GA 4TSFD 4RF5A 3AF0A 2VQ3A 3I5MA 4MICA 1RRPA 4GWLA 4IRUB 3O8QB 5GM1A 2JASA 4CPDA 4NAVA 4BZZA 3EVGA 3BH0A 5J43A 2HWWA 3PENA 3GLFB 1TO6A 3O8BA 5EQTA 5M5BA 1HDYA 1XSEA 4WNAB 2Z4RA 3EZ7A 1UJMA 2G07A 3SSAA 1KL7A 4IF6A 4BNZA 3A4YA 1L5ZA 3O1LA 3ZV3A 2QP4A 4DR5B 2C03A 4OXYA 1ZS9A 1H1LA 2DFTA 3RUAA 3QENA 2P11A 3ETNA 4A6EA 1WVMA 2JZOA 4CF7A 5LN1A 5I51A 2QIPA 2BE7A 4EKIA 4U7WA 3W06A 1K97A 3DBRA 4L3OA 1EVQA 4DLAA 4ZYYA 1UXIA 2LVBA 4BV8A 4PV7A 3ZW7A 4D6XA 2PXCA 1JUDA 1W4BA 2IYAA 4W1SA 1XXHE 4J2TA 1TQ4A 3MN1A 1NUTA 2C97A 4P7FA 2EF1A 2C3YA 4YREA 1R6DA 1T25A 4AVYA 4JR2A 1AU9A 2FW7A 3QOWA 4MJXA 1YFZA 1P5HA 3VOAA 4KMRA 2CK3A 4LI0A 4TM7A 3NVMB 3E5HA 4M1EA 1GTSA 3LUFA 1C30A 3P9XA 3I62A 4H6XA 3NHPA 4W9NA 5E7JA 5ICSA 1H9CA 1HEUA 2P69A 1J56A 5HK8A 4Q3OA 2QTZA 2GAFA 3VUEA 3VAAA 5C7LO 2X7HA 1MX1A 3QOFA 3W6OA 2PM8A 3RAEC 1EK0A 3P32A 4MMZB 4KGZA 3NQ41 1A7JA 2NO9A 3PC8A 3T7RA 4Y2XA 2EP5A 4BFSA 2P2DA 4F45A 1GT6A 1M5UA 4NBNA 4LXQA 2XNJA 3DMTC 2JAQA 3DZJA 1KTVA 4NJMA 2VS1A 5KDLA 1RPTA 4MP8A 2Y1KA 4JQCA 1GITA 4UOEA 2ZJ2A 2PMWB 2XRYA 3NHWA 5EJIA 5JG7A 4MKGA 2PEZA 1EBFA 3DHYA 3THOA 4AJ2A 2EL9A 3I6QA 4PPYA 2H06A 2VUHB 3OQ6A 2B2NA 4OF4A 4OSOA 1PSDA 3TIVA 1IVSA 3EDRA 4JYPA 2DECA 3VR4D 4AY2A 5IULC 4MUNA 1DJLA 5K03A 1M0EA 2NM0A 2XAAA 3SD7A 3FIUA 1ZW6A 4J49A 1WQ4A 2BGUA 3VHXA 4Y6LA 5LLSA 1OT5A 2AL7A 1TLTA 2EGUA 2HJWA 4YCCA 3K35A 3VU1A 5J4KA 1CF4A 1N5KA 1Z7WA 2WHPB 3G2HA 1O94C 4HH0A 5TB5A 3PIRA 4R5HA 3SI7A 2XTZA 1Y3CE 2BR3A 3HL4A 2PCLA 3Q3CA 4ZI7F 2ZKLA 2FPIA 3DFKA 3D5EA 1AV7A 3VPAA 4G2NA 4CXMA 1AURA 1K2WA 1TCAA 1VE3A 1XJ0A 5K3FB 1QAOA 4CZ2A 3JASA 3ZXIA 3NTXA 1BXGB 4YMSA 2VNSA 4ZYZA 5BWMA 3QLUA 4UTXA 1NLFA 2IODA 4WZAB 2GPWA 3UK0A 3L84A 2HQSA 4EPVA 2RGAA 4NE2A 4AY3A 2H59A 4KJZA 5CPFA 3SYLA 2Y6UA 1JKMA 1JQKA 3FUWA 3GFTA 3K73O 4KMOA 2OY0A 3S2IA 3WG9A 4AG5A 4WFQA 1MAVA 2A35A 4BCBA 4B80A 1G21A 2QD4A 1N7IA 2AOUB 2BM8A 2QVBA 1SZDA 3AINA 5EIEA 2QPLA 4ZOLA 3PQ6A 2Z4TA 1Z2CA 1X7XA 1XF9A 1ISRA 1YE8A 2HA3A 1YHYA 1L7XA 2ZIFA 3CZ9A 3LUBA 4YUZA 3TR0A 1D6SA 3LA6A 1ZUIA 5JBQA 3H9QA 4Q3AA 1UBFA 2C7GA 2FMUA 3LHIA 4C3UA 3L40A 3H11B 3OTQA 4CIVA 1D8AA 3BF8A 4R8KA 5FH9A 1GUFA 3S8EA 1V6AA 1IK4A 2V1XA 5IAKA 1XPRA 2HV9A 4NZYA 2WFZA 3D6JA 1SHZA 5U1PA 2AG8A 4BMXA 3FNFA 2FSVC 2C78A 3ADDA 3GEPA 3KOZA 3GLRA 3DXZA 2HF8A 3A1UA 3BK7A 1SKAA 3JD0A 4MQ4A 4DXHA 5IT4A