4Q1EA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 10 {2-{[(1r/s)-1-{2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol 4-yl}ethyl]sulfanyl}pyrimidine-4,6-diamine}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
231
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 93
structure length 231
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1eA00
2QRNA 2J7PA 5BN3A 3R9IA 4PPFA 3OF5A 3T1TA 1G4AE 2QTVB 3THXB 1MH1A 1S1CA 3MLEA 3GEHA 3LBIA 4QJ3A 4Z8YA 5DHAA 2ZJAA 5L3RA 3I61A 3D31A 4R98A 3NBYC 4DLZA 3AKEA 2Q9CA 1XFAA 3GLIB 2YKGA 4YLGA 2CEAA 1J90A 5FL7D 2D2EA 2ZANA 3D3QA 4URVR 1OXSC 1W4AA 3DDCA 3GD7A 4POAA 4BEBA 1IM2A 2OHFA 3AF2A 4A0GA 4YQFA 2ZRLA 5H8WA 3FKSD 3BRWD 4PZLA 4RY2A 1N6PA 3I8XA 3GPLA 2GJKA 3CWQA 3VR4A 2ZXUA 3T61A 1HH4A 2G0NA 4B3CA 3MRSA 2GA8A 5KSOA 4E09A 3ZDQA 5CK5A 3Q5DA 1ZNZA 1IN8A 2O8EB 1OT3A 3T12A 5AUOB 1A2KC 3EAQA 1MOZA 1YRAA 4AYXA 3AUYA 1XWIA 3DMNA 4GOKA 1LS1A 3ZD7A 2FOLA 3EZ9A 4JMPA 3CH5A 3RVBA 4LPSA 5JJKA 3THWA 3DO6A 2X2FA 3H0KA 3EZ6A 4KYUA 1KI7A 2QG6A 1W36C 1E2EA 5SZKB 4F4JA 2QBYB 2BBTA 2O8BA 1KI2A 2H7VA 2TMKA 1ANKA 3BE4A 3PR1A 5C2JB 4AWXA 3LXRA 5G40A 3GP8A 1UF9A 2W0SA 1VG9B 4M53A 2QT0A 2ATVA 1GL7A 2YOGA 4ZDKA 3WRYC 3VX3A 4TMZA 3ADKA 4QKQA 2RGAA 1TADA 1WF3A 3FGNA 2KBFA 3EZ7A 2VBCA 4URXR 4TLAA 2ZRHA 1CKEA 1VMAA 2PL3A 2J9RA 2A5JA 3FMPB 3K1JA 4MGKR 5EUQB 2J46A 4KJZA 4UQOA 3ZS9A 4ZDJA 2ZRDA 5L3SB 4M1OA 2NIPA 1Z83A 3ECCA 1DAKA 2AK3A 4FMDB 4L9SA 1E9FA 3WMFA 3BFKA 2UZ3A 4Q9LA 1N2CE 4LHWA 1TQ2A 4XD7D 1FP6A 3CO5A 1ZU5A 3SEAA 3EW9A 3P27A 2XB2A 3BOSA 4IDNA 2CJWB 2RGNC 2V7QD 1J2JA 4L16A 1XBTA 4MGYR 3R9WA 1E0KA 1U94A 2XZOA 1R0XA 2LCFA 2OFOA 3QOFA 4TYWA 2G83A 4Q1EA 2W83A 4LPKA 4XTRA 3GJ0A 4P32A 4I1OA 1OKKD 4MKFA 2XGJA 1WDTA 3A1SA 1VYUA 3C5CA 2R2AA 4PHFA 4DIDA 3O8RA 3LW8A 1KO5A 3HPQA 4D0NA 3AP3A 4Z1MD 3K0FB 4QGAA 4HI0E 1JBKA 1E79D 3FWYA 4OJQA 3ZQ6A 1FTNA 1NI3A 2C9OA 4ZCLA 4BZXA 4X8LA 1ZM9A 2B92A 3PQCA 1SXJB 1Z6YA 2WZQA 2UVQA 4US1R 1U98A 3PCRB 3NDBB 3FTQA 3PUZA 1UADA 3T1OA 3WP0A 4NYIQ 4EPVA 2C77A 4UNNA 2AD5A 2SHKA 2V54A 4JBXA 4OYHA 1MO6A 2OE2A 4B2LA 2W58A 1G21E 4LK2A 1UBFA 4B75A 1G7RA 2GKSA 3LDAA 2GESA 1HQCA 4EKDA 3UANA 5KPDA 4IEEA 1ZM2A 4WAUA 1G291 1G5TA 4TWZA 1NG1A 2WSMA 4HLCA 4TQUS 5IK2D 2GXAA 3UG7A 4AKHA 4E07A 1TU3A 4Q4AA 1KI8A 2JDIA 4B2PA 1VCMA 2P67A 2GRJA 4GT1A 4TQAA 2RGDA 4TMTA 2F1HA 4C7OA 2PJZA 1XEWX 3IUYA 2ZAOA 1DEKA 5FL3A 1IBRA 5CM9C 1W2HA 2O8CA 2BC9A 4CZ2A 4LBVA 5DN6D 1JPJA 3KJGA 1I4DD 4ZIRB 4NL4H 3C8UA 2HYDA 3W6OA 2W6JD 2QORA 4LSGA 3U7FB 3CF0A 4PAQA 2ZQ5A 1PZNA 2OCYC 2JEOA 1ZUIA 5EXSA 1ZIPA 2OCBA 3KZ1E 4F93B 2JLSA 2XJ4A 2WWXA 4XIGS 5LB2A 2ERXA 1FUKA 1W44A 1KY2A 1XD9A 2D62A 1LTQA 1SVWA 2FA9A 4O2LA 1TEXA 4IOJA 1SXJC 1E9RA 1UM8A 2HJGA 4LWZA 4R9UC 3IBYA 4YMVA 5BN5A 1FQKA 5BQ5A 4LHXA 4YMTA 4XVUA 1ONBA 4KO8A 4OI2A 2FV8A 4IRUB 3IIJA 1S4QA 3S1AA 1A5TA 3NKVA 1SVKA 5FBVB 2BKUA 4OBEA 4XVQA 4DDVA 721PA 2Z4RA 5JHHB 2F43B 5FUWA 1BKDR 3GLFE 1D2EA 2EWVA 4RD4A 221PA 4O3MA 1G18A 1OLOA 1XDBA 4HUTA 1U8YA 4I81A 2GEUA 1CJKC 1E6CA 2OEPA 3LO5A 5FL7A 5TDHA 4B3GA 1TQDA 4M4SA 2DB3A 3T06B 3U3KA 1ZM4A 3IPXA 3K0CC 1QHYA 2QRZA 2G77B 3VHXA 1Z6GA 2CLCX 3X1XA 2GCOB 2WOOA 2GTPA 1P75A 3W5JA 4AG6A 3PEYA 2ZSAA 5AJWA 1RE0A 4QHYA 1KMHB 2WJVA 4Q21A 4QC2A 4PAOA 1VG0B 1CF4A 5DI9A 5C46F 1XXHE 2CL0X 3H86A 3AM1A 1T6NA 2ZIAA 1RC8A 3FHOA 2CK3D 1T8UA 4PQRA 3GLGA 3I72A 4HZUA 5CJ2A 3U7GA 2A78A 4DKXA 3TLXA 1Q57A 1EFRD 3AV0B 5D3MA 3ZVLA 3TVTA 3EC2A 4Y0VA 1KSJA 3TR0A 2E1RA 4QHSA 4QGHA 4Q4JB 121PA 1M7BA 2MSCB 5BWMA 4UNRA 5F2EA 2O8DB 2FX3A 3CZQA 1X86B 4PSVA 3E2IA 3RC8A 1YR7A 3IQXA 4D4KA 3U6BA 2HYIC 1AQUA 2ZITA 4BQSA 4C0LA 1OW3B 1ESNA 2GAAA 4BLTA 4B43A 4LYAA 2ZE5A 4HUQB 4Q7MB 2GF0A 2JLZA 1TF5A 2Z6VA 1FFHA 1FMLA 2F43A 2ZETA 3IO3A 3X1WA 3U7HB 4CEIA 1QG2A 3FB4A 1T3LA 4TL8A 1JXOA 2FFQA 3KX2A 4JLOA 2WHXA 4N3NA 1KZ7B 2IF2A 5DLQC 3HYRA 2OBNA 2B8TA 3IEVA 4A8JB 2JLVA 2C5LA 3LFUA 3RRZA 1K5DA 3QSYA 4D4LA 1OYYA 4JT4A 4DXAA 4CYMA 2Q9BA 1F3OA 3CONA 1TUIA 4YONB 1C1YA 3L0IB 4LYHA 2XX3A 2ZI9A 1L7VC 4LJ6A 3W8NA 2O5VA 1NN0A 5EE9A 4PO9A 1KO7A 1OIVA 2ZU0C 3AUXA 4KAXA 4BLQA 1WBBA 1E96A 2OZEA 4K81B 1DTSA 1GG2A 3B78A 1WP9A 5KSPA 1NJGA 5CJPA 1N6OA 4KFUA 1L2TA 3GJ3A 4DB2A 1KGDA 2BBSA 4UXJA 1SHZA 4JL5A 1OFTA 4PHHA 3JVVA 1G8HA 4LRWA 4M8NE 4KSBA 3LH5A 4NBSA 1K8RA 2BKEA 1XD2A 2VP6A 3TR5A 4LBZA 2ZJBA 2P5TB 3R20A 2ODBA 1F2UA 3GJ8A 2H18A 4JYBA 1QVAA 2ZVPX 3SE0A 1OHHA 1G3MA 2ZSBA 2F1IA 2ZJ2A 5TV2A 3QJYA 2NOAA 3CRW1 2ZPTX 4NPHA 2LKDA 3HPRA 1E2KA 4PAMA 3NHBA 3B9QA 4YC7A 1FNNA 2W2TA 4JL8A 1UAAA 4IXNA 1KTVA 5CB8A 3U4QB 4EPRA 3ASZA 1FNMA 4MITA 5UKDA 1A1VA 2OXCA 2KBEA 3BK7A 4XVRA 1XXHA 5FTMA 2I3BA 3WNCA 3BH0A 2IS6A 4B3FX 2IX3A 3NG1A 3KXKA 4H9GA 4Q03A 2CE2X 2R6AA 2GILA 2VF8A 1DARA 3U7EB 2G6BA 1R5OA 1SVMA 4OI0A 3K9LA 3KXIA 1TU4A 2A5DA 2CCJA 1BYIA 3NC1C 1CP2A 1FTSA 3EWAA 1Q0UA 4HLUA 2FGKA 4NDZA 2ZI6A 4JLMA 5F9HA 1UKEA 1R2QA 3EIQA 1P2VA 1KK0A 2QQEA 4DLVA 3SS8A 1RRFA 1WA5A 3GLHE 2ZRAA 5FPTA 2FZLA 2R44A 2FF7A 2ZYWX 5JJLA 1A4RA 3DKPA 3EA0A 1BO6A 5J5CA 3QBVA 3IHWA 4TT3D 3FKSA 3RWOA 2R6CA 5AUNB 2FMXA 2A9KA 3BD9A 5EJEA 4C2TA 4CIDA 2UKDA 3QXXA 2X77A 4E03A 3OE7A 3GJ4A 2IL1A 3FPAA 4IOKA 1GFIA 3QVUA 2IF0A 2Z4SA 1R5BA 5CITA 3I3SR 2OT3B 4LBYA 2DWPA 4C0AC 1G17A 4UKDA 2AFHE 4EPTA 3W8RA 3PUVA 3FOZA 3CH4B 4Q48A 4UXHA 5GADl 2J87A 3KFVA 4MUAA 1LVGA 1ESMA 2HT1A 3U4QA 1NN5A 2BVNA 1US8A 2QU8A 4Q1DA 3T5GA 3KQNA 1VKJA 3P20A 3TVDA 1E9EA 2RHMA 1XXHB 4A4DA 2GHIA 1VDZA 2VSFA 4O2RA 1VHTA 3OEED 1DAMA 3WY9A 3G82C 5ELXA 2F9MA 3OHMA 2IWHA 4C0SA 3U3RA 1TTTA 1JJ7A 1KI6A 3RANA 4C4PA 5DI3A 2QEQA 4EQ6B 2JATA 2YWHA 2A7QA 1NL3A 2DFKB 2ZRKA 4X8HA 2OM2A 1N0WA 5E7JA 4DLTA 3RS5A 3J81k 1E2QA 1W4BA 3NEYA 4AI6A 4V0MA 2NG1A 2GK7A 1SULA 2ZRFA 2WSSD 5GJVC 3JZMA 3KKPA 4P33A 1W47A 1O3YA 1P9NA 3FHCB 5DO9A 2J1LA 3MWKA 2WMNB 5EP1A 1M7GA 1OF1A 1GILA 3AF0A 1XTRA 4QFMA 3FKQA 3IKJA 3LY5A 4AG5A 3B1WA 1DAIA 3GLFB 4N1AA 2ASEA 4OHZA 1AQYA 4FINA 4IVQA 4DWJA 2IEZA 3DHWC 4W7SA 1QZXA 4DSOA 3I62A 2Z83A 2WWFA 1ZRHA 1RVDA 1PLLA 3BGWA 3ZVNA 4PSAA 4ESHA 2ZRIA 1F5NA 3CNLA 4PFSA 2XXAB 3RS3A 2EFGA 1NIPA 1U2RA 2BJVA 4QNRA 1LB1B 3MJRA 4Q1CA 1QDEA 2A30A 5L3QA 4CT4B 3D8BA 3GFPA 4YMWA 2F7SA 5HKKD 3QF4A 3AF1A 4Q7KA 5AK0A 1C9KA 1TAGA 3P32A 1XPOA 3X2SA 4Q19A 1P2SA 1E2NA 1AKEA 2J0UA 2PCLA 5FOXA 1N5IA 3VR5A 3AGPA 1GUAA 1GSIA 2ZRGA 3UWOA 3QF7A 2AL7A 1VG1A 2J7PD 4MYCA 1RJ9A 1NMXA 3ZIAD 2B21A 1E1RA 1FUUA 4D6PA 1HYQA 4DHEA 1IY2A 2PX3A 4HDCA 3UMRA 3V4RA 2GJAA 1KSHA 4M9ZA 3TRFA 3KQLA 1SHKA 1TL7C 2BOVA 3TUIC 3UG6A 2VPPA 3FVQA 1QHXA 2FPKA 3PXGA 1OXXK 2GZHA 1G41A 1KDRA 2C03A 1Q1EA 4PANA 1PLJA 4IHQA 1Z0DA 1YZUA 1AS0A 2ZM5A 2QAGC 2VA8A 4EJSB 1R6BX 1MO4A 4EIWA 5FOSA 2GBLC 4AKEA 5KNCA 2IYZA 2IUTA 4DLSA 2QZ4A 1WBDA 4C2UA 2OXRA 2CCGA 2QAGA 3HDTA 1H8EA 4D2IA 2V8OA 3AH8A 2P2LA 3Q5EA 3SZRA 3KJHA 1ZD1A 1QHSA 3A8TA 1U0HC 4FCVA 3CX8A 5JBQA 1SVLA 4G1UC 4B3DA 5CLLA 3Q3JB 1S2MA 3B2EA 4WZ6A 1OH5A 5L3QB 3P4YA 2CVFA 2P6NA 1FZQA 2VO1A 1B23P 3OEEA 3K09C 1GKIA 1P62B 2ZR7A 4KITB 3GFOA 3QF4B 3EARA 4U00A 5A4JA 3AEZA 1OPXA 4TL7A 421PA 4LJ8A 2J0SA 1AS2A 1E2MA 621PA 4F92B 1TF7A 4BLRA 4PX9A 2FN4A 4KODA 1ZCBA 1IHUA 3IHLA 2ZU6A 3BWDD 1Q1ZA 5FBLB 1Q44A 2O0KA 2QNRA 2KB0A 4MRSA 3ONWA 5DIFA 2QT1A 1E9BA 3NH6A 4PPQA 2PEYA 2XAUA 2GWHA 1VIAA 4U7DA 4FIDA 2FPMA 3BXZA 4IW3B 2PT5A 4CEHA 2BMJA 4EJSA 1AM4D 3OFND 5AJZA 2ZI5A 2ZUBA 1MR3F 3DZ8A 3EZ2A 4MRNA 4QBGB 5HE8A 3THWB 2Q21A 3UATA 1E79A 1EG7A 1CR2A 2A2ZA 4JJZA 4RZXA 2HF9A 1WMSA 3I1FA 4DDUA 4OHYA 2PH1A 4JIMA 2ONJA 4EAQA 4QNMA 4BLSA 2CK3A 2ZAMA 3WP1B 1F2TA 2RKOA 4M9SA 4US2R 3VHLB 4UNPA 1T0HB 2BV3A 4NZYA 2EWWA 1CEEA 1EFCA 4XWAA 1MABA 4KBFA 3LBNA 4UNSA 4FWIB 4B35A 2REXB 1HUQA 2QY9A 2C78A 5AJYA 5KYKA 3AVWA 1AIPA 1DADA 1DG1G 1XTQA 2EFHB 4HLQB 4Q02A 3THOA 5KSZA 2Q3HA 1JNYA 5DSZA 4A15A 3I5YA 1EESA 2ANCA 2OCPA 3AF3A 2HLDD 2IA5A 1WB9A 1DO0A 4WBSA 1U90A 1N5LA 2B7BA 5JI2E 2R6GA 4AYTA 2OO7A 1OB5A 4NYJQ 3IILA 1G7CA 2WVJA 2AN9A 4CF7A 3SYLA 1X8KA 2NPIA 3AGQA 1KK2A 1UEJA 3FMOB 4AURA 3EPKA 3H84A 2VHJA 3ZZTA 1A82A 3CX7A 2NGRA 2BJWA 4PR0A 1OSNA 3V00A 3PUWA 4YXWA 1S0UA 4OKSA 1T5LA 2ZSDA 3KL4A 3SBDA 3THXA 5JCZA 1R8QA 4HB4A 2REOA 1X3SA 1XRJA 5KO2A 3U61B 3I32A 2GNOA 3B6EA 4URWR 2WSSA 5CDFA 3U44B 2BHRA 3Q72A 3MGCA 3TQFA 4BZQA 5LBIA 1P9RA 4W5JA 3CZPA 4JKIA 4D81A 1NY5A 3EA5A 2HJVA 3Q8XB 3KUCA 4RFSB 3TAUA 2WIAA 3K0FA 3V4FA 1F2TB 3VQTA 5KNDA 1XEXA 2Q6TA 2ORVA 5FPHA 5HZHA 2WTUA 1OYWA 4DT1B 1KDOA 3FMIA 4PPNA 5K8IA 1IOZA 3TSZA 2QTHA 1FP7A 4GP7A 2JLQA 1E94E 5E4FA 5EZ6B 1P73A 4Q66C 3EX7C 4A36A 1D6JA 4B74A 4E5UA 1VHLA 3A58B 1UBGA 2KI5A 1TX4B 2F6RA 1OJLA 2IYRA 5G41A 5BYJA 5FH9A 5LB4A 3T1QA 2CLSA 5L3VA 2J5XA 3RWMB 1DVRA 5J4VA 3PEVA 3B13B 2GEDA 1RZ3A 1P61B 4P0TA 4HAWA 4WOPA 2XB4A 3CNNA 4FMDF 2IT1A 1QG4A 3VKHA 4URZR 2FSHA 2LWIA 4BRWA 4F7WA 1HV8A 2QBYA 4M2LA 3AVVA 4CT5A 4MYTA 4LJYA 4S35A 4F4CA 1XPRA 2IUSA 4KFRA 2QQ0A 3EIEA 3TAHA 1YVDA 2N42A 1VIYA 4C0KA 4ZDWA 3L8ZA 3OAAA 1VPLA 4H1UA 3U44A 5A0FA 3VAAA 1VCIA 4B76A 1XTKA 2O0JA 2XZPA 1ZNWA 1SKYB 3CW2A 1GOTA 4W5WA 1X6VA 1IXSB 2H5EA 4RZ3A 1RW4A 3CB4A 1N6HA 4EFLA 3T5DA 2NZJA 3HYTA 5L3SA 3LLMA 1MT0A 3QKRB 1TQ6A 5GJWC 3IQWA 4RKEA 2YYZA 3WNBA 3GJXC 3C7KA 2FSFA 2EW1A 5EP3A 2VHTA 4JLAA 3QPWA 1D8TA 1W0JA 2DYKA 3P1JA 2CCKA 2CJWA 4IKEA 1MRNA 4IFEA 3VR2A 2IBMA 2J3EA 1NVWQ 4Q9KA 4NHOA 2F1JA 4GDFA 1Z63A 2WJGA 2WJIA 4RCYA 5FUVA 3LLUA 3RDPA 3WXMA 1XJCA 2YC2C 4BUJA 1UBEA 1SXJE 1JR6A 4HAYA 4GP6A 3BORA 4LV8B 2AWNA 2OILA 1ZYUA 1U0JA 1E9AA 4AC9A 4LCBA 2O0HA 3FDIA 1H8HD 2W00A 4O25A 2HXYA 3AVTA 1CS4C 5HE9A 3GLHA 3QEJA 4ZPXA 3DMDA 1E69A 3VKWA 1EFUA 3H2YA 5J47A 4BPBA 2RGNA 1ZNYA 3CNOA 4US0R 3DOEA 3CRRA 1IJFA 1YKSA 3LW7A 4MYHA 5JS7A 2HEIA 2GJ9A 1OXVA 1D9XA 2OFXA 3QG5A 1KDTA 3U3JA 3O8CA 4Z51A 2BEKA 4A0HA 2C9YA 2J0QA 2DFTA 4LV5B 5E7IA 1I4LD 2VP0A 3TE6A 5KU1A 1E0SA 1U9IA 5KNBA 5EP2A 3EPHA 1E3MA 1GM5A 1LF5A 2YOHA 4JKYA 4QOSA 4AKGA 4R2IA 3AP1A 1AK2A 1E2GA 2XTNA 3MD0A 2V6IA 4OHWA 1IN4A 3IDQA 1E2HA 5EE5B 3OIWA 3EG5A 3OEHD 2P65A 4URYR 1XJQA 3WYFA 1YZGA 5AJVB 2R62A 3EC1A 4ZI2A 2WKRA 4KVGA 4JLBA 1Y63A 1FOEB 1ZD8A 4LJ4A 4YMSA 2IYLD 4ERNA 2RH5A 4DLXA 1CR0A 3SHFA 5DH9A 3TK1A 1KHTA 3KTAA 3LA6A 5EUMA 4F38A 1JB1A 5CIWA 5KDDA 3AF4A 3SNHA 5H68A 3MFYA 1KJWA 4J0QA 2D06A 4FCWA 1LY1A 4Q47A 3ZGXA 1IQPA 5M04A 5LPNA 4TSFA 5JWHA 2JLRA 2RGBA 3CUEF 2QPAA 1L8QA 2IC5A 5G53C 2XSZD 4FCTA 1KK3A 4MDFA 1D9ZA 4B48A 1YZKA 1J7KA 1EFHA 1P60A 4V0LA 2ZJ8A 2AX4A 2EQBA 2VL7A 4LJ5A 1Q1BA 4OJKA 3IIKA 4BFTA 2DWOA 4PC2A 2OUKA 4Z1MA 1RYHA 5JI3E 2ZS9A 3A1WA 5C4GB 1QHHB 1IN6A 3KB1A 3DOFA 2QMOA 5KOYA 3CR8A 1NJFA 1XZQA 2ZJYA 1TUEA 1G1MA 2V9PA 4RD0A 1JI0A 4NKRA 4ASUA 3I5XA 3ICQB 1A2BA 1ZM7A 4RSGA 4RZ2A 1NNEA 1HQYE 1JEEA 3K0SA 4HEJA 2W6JA 1XNJA 2MSEB 1GNRA 1PVOA 2VP5A 1J8YF 5FOWA 3HR8A 3CLVA 5EZ5A 1KYIA 2ZUDA 2H1LA 2IYVA 4A6PA 4DRZA 3K70D 2J7KA 1BIFA 4LI0A 1Z2AA 4LDJA 4TLDA 1IN7A 2VHCA 2WKQA 3KKOA 2C99A 2G1KA 1NLZA 2QAJA 3VR3A 4KHZA 1SXJD 3KKNA 1R5NA 5EP4A 1KMHA 1T91A 1KKMA 1Z06A 2DFLA 2CE7A 4EFMA 1HY3A 3BERA 3LD9A 2G88A 3O8BA 3PITA 1COWA 1N5KA 4NYJR 5F98A 1SVOA 4HZUB 4I99A 3A37A 3QUSA 4CEJB 1W48A 2V4ZA 3GJ6A 1AS3A 3EASA 2FH5B 5EXPA 2WWYA 2NTYC 1XEFA 3NIBA 2D3WA 2WJJA 4PQYA 5D3MB 4O0MA 1ZIOA 4XSHA 1G8YA 2HLDA 3FE2A 2HUPA 3EPJA 4KCGA 5BN4A 4XWKA 1XX6A 1WE2A 1NBME 1XMSA 1DAHA 5J4HA 1G8FA 3IGFA 4IFBA 3R7WB 4P3YA 4Q9JA 3CR7A 4DB4A 2ZJ5A 4PO8A 4JLVA 1KI4A 2GZDA 2QGZA 1G3UA 4HUQA 2YWFA 1E9DA 2VHUA 2GVDC 4V0KA 2XNDD 2PLFA 5GJCA 2P3SA 2OSBA 4P4TA 4Q4HA 4TMKA 3PFIA 4K8OA 3L0SA 5IRCD 1UFQA 5DISB 1OB2A 1DO2A 4DVGA 1KO1A 1COWD 2QMHA 2C2HA 2WWGA 3OFNA 1EX6A 2ZYVX 1P7CA 4C7OB 4QHTA 4IDHA 4M1TA 2V7QA 2ZS8A 2ORIA 2FFAA 1N6NA 2LKCA 2OV2A 3QKSA 1ETUA 1U81A 1YZNA 2G3YA 2MSDB 4LBWA 1KNQA 5FI1B 5TMPA 2O8CB 1UBCA 4FXPA 1G5PA 3U3MA 4ZKEA 3B1YA 3OIYA 3RHFA 3BH6A 3HP1A 3BJIC 3CM0A 4CEJA 4Q9HA 1F60A 1KJYA 1Z22A 1JXMA 3K0AA 3QPUA 3PG5A 1DOAA 1W4RA 1TEVA 2ZE6A 5JSZA 1R8SA 4E22A 2NO0A 1WCV1 4G0NA 1E1QD 1R0WA 1KI6B 4TZ6A 4JVLA 3OEHA 2OFWA 3ZVMA 2AKYA 1G7SA 4Q00A 3WMEA 1NKSA 4B33A 1OKKA 2GZAA 2NO7A 2IYXA 3K9HA 2ZS7A 2FFBA 4TL9A 2CVHA 4NMMA 4HAVA 4CVNA 4P4SA 4JLDA 3TKLA 2CHQA 1HE1C 2PBRA 4HB3A 5K8TA 4HDOB 4A1FA 1KK1A 2ZSFA 1NVVR 4CDGA 2H57A 4HAZA 4Q4HB 4C30A 4KLZA 2C95A 4C0HA 2B7CA 3VNUA 1QF9A 2ODNA 5JWOA 5JMTA 4XH9B 4RZUA 4V02A 1N25A 2JLYA 2O8FA 3VKGA 3PENA 3GJ7A 2E87A 1L4UA 1FQJA 2O52A 2W2VA 5EE1A 1E2FA 4V0NA 3GMTA 1G16A 1NP6A 2XTZA 3RABA 3C14C 2JLXA 4ZI3A 4G5OA 4WVFA 5H70A 4GBMA 3SFVA 1GAJA 3ADBA 3LX5A 3SR0A 3CPEA 5TB5A 1J99A 6Q21A 1XTIA 3REGA 4JSYA 5FFMA 5J4YA 2KSQA 4AK9A 4MH0R 2V1UA 1G8GA 3D7MA 4ZKDA 4M1YA 2IYWA 5JSZB 1NLYA 1HURA 3A6PC 2QMEA 3SU8A 4JVSB 4B3XA 1S8FA 5FBWB 4U02A 1M7HA 4G5RA 5HR5A 1KNXA 4WXRA 1S96A 3D6TB 5B57C 3KFXA 4A2WA 2O8DA 4M0LA 5K8LA 4B73A 3DVLA 3Q85A 1KAGA 1UJ2A 4UXIA 4Q9IA 1KOFA 3R8FA 1M2OB 1N6KA 4OHVA 4B3BA 3OE7D 4IXMA 1OH8A 4TMVA 2VP4A 4QBHA 1JQLB 1GNQA 3ND8A 4TSFD 2ODEA 3QXSA 5JEDA 4NP6A 1SZPA 4Q7LA 2JAQA 4HAUA 2WOJA 1XD8A 5FOTA 1W36D 4KVAA 4N0EA 4TYQA 3A1VA 2WPDD 4A8JA 1NMZA 3WRXC 4KFTA 2JCSA 4HB0A 1OXUA 5D3QA 1FPMA 2FGJA 1XEWY 1GL9B 2ZR9A 3CRMA 4A0RA 1Z0AA 2AR7A 1IONA 3GJ5A 4FMCB 5KSYA 3IBGA 3THYA 3HWSA 4QL3A 4LY6A 4ZV4A 3C41J 1Q22A 1X1SA 3ZD6A 1Q1QA 4I1VA 3K09A 4Y0AA 2VYFA 5K8UA 1ELOA 1JR3A 1MV5A 1LS6A 2FJUA 4OK5A 2OBLA 3MWLA 1BOFA 3NBZC 2QENA 3O47A 4BFZA 4TLCA 4LGMA 3QXCA 4AIIA 4DBLC 3K53A 1X1RA 3PVSA 5SZJA 2IUUA 1XTSA 3ZZUA 1UEIA 3E5HA 4NCIA 1VYVA 3B1ZA 3MSXA 1GZSA 1CJTC 1PUIA 2WJHA 1Q3HA 4M9QA 4DSNA 5B2ZA 3TSOA 4C0JA 1I2DA 3RNLA 2FSIA 3SYNA 3C5HA 1JR3E 1GTVA 2DY1A 4Z54A 1XD2B 2JA1A 2OAP1 1QVRA 2AXNA 2XOKA 4LC0A 3LBHA 1QHIA 1F2UB 3B85A 3SYKA 5JRJA 3W5IA 1OHHD 3HR7A 3FHTA 2J59A 4DJTA 2Q0HA 1HEIA 4RD3A 4GMDA 3FYHA 1A7JA 1H8HA 1NF3A 1TQ4A 5JZVA 1NSTA 4UJ3A 4EPWA 4QM6A 2QP4A 5FPYA 2NQ2C 1SKYE 5B64A 1IJEA 3LWNA 2XEXA 4OK3A 4RD1A 1U99A 2P6RA 4FW9A 2GCNA 4II7A 2P0EA 3GLIA 1XU4A 3MJHA 4TT3A 2IEYA 4Q4LA 1ZM3A 1FMJA 3NBXX 5FTLA 3U60B 2MMGA 1NBMD 1T9HA 2IK8A 2W0MA 5J40A 4DCSA 1HA3A 3RS2A 4A9AA 1RFLA 4A8JC 2D74A 3QPVA 1MRSA 3LQQA 4Q18A 3QI2A 3RSLA 2PMKA 5JFGA 1AA9A 1P9WA 1YU9A 3MMPA 4HDQB 3ZYCA 1X8JA 2VH5R 1G5RA 2IYSA 2P6UA 2KJQA 2EFEB 3KUDA 2OG2A 3VTKA 5FBRB 4A0FA 2BMDA 4TMXA 2WV9A 1DAEA 2GJ8A 3X1DA 2IS4A 1UKYA 1X8LA 4NU0A 4FI3C 2QPTA 4L15A 4NCHA 4XWOA 4JLPA 3OAAD 4F91B 5LDDC 5IDVA 4MGZR 4K46A 1YZQA 3GCGA 4OI1A 3V9PA 3K8YA 1U8AA 1TMKA 4PHGA 4LHVA 5EQTA 3CPHA 3T34A 1CJVC 3BB4A 1XCPA 4YMUA 1YE8A 5JRZA 3GFTA 4MRRA 4HYYA 2YC4C 4NTZA 5AWFC 4DC9A 1KI9A 4NCJA 1RYFA 1XZPA 2DWQA 4PHTA 3ZZ0A 1UPTA 5C1BA 2NMVA 4BGDA 2AFIE 3VFDA 1E4VA 5B30A 1II8A 2F9LA 3QKUA 4B6EA 2MMCA 1M8PA 521PA 4I1UA 4A82A 1YRBA 1NIJA 4A92A 1M1YE 5IT5A 4B47A 2EYUA 3M0EA 2H16A 1ZP6A 1U8ZA 1B0UA 3EXAA 2QM8A 3WBKA 1NN1A 2HDNB 1U9IC 5FUXA 1Z5ZA 1AKYA 1E0JA 1T8TA 1WRBA 5FTJA 4D0GA 3SFZA 1IN5A 3TGPA 3WNDA 3DPUA 1NN3A 3BB1A 1Y3AA 1KIMA 1ODFA 5DE3A 1KI1A 1T3SA 3MG9A 2BWJA 4DUGD 5KUTA 1CBUA 3A4MA 1HT2E 5GVRA 4ZCIA 3UXMA 2ZSEA 4AD8A 3HU3A 5EE3A 3ZS8A 4WZAE 1W0KD 4IDOA 5E95A 2EFCB 2BBOA 3SN6A 2REBA 4R7ZA 5DN6A 3AKYA 5C18A 4ITRC 5AJXA 2IHYA 3LRPA 3OZXA 2IS1A 1CRPA 1KY3A 2FEMA 2IYTA 4IJMA 3W9YA 2ECKA 1E0AA 3CBQA 3PUYA 3BFVA 4TYNA 3EWSA 1BS1A 4HSEA 4I4LA 2BDTA 3A36A 2FDCA 1Q3TA 1T5IA 2IYUA 2YJTD 3SJZA 5LD2C 1XJ0A 5CM8B 1ZUNB 2VIIA 4C3ZA 5HCIA 1JEDA 4A2QA 3T1VA 1AGPA 1E2IA 1H8ED 5FR1A 2E9SA 4GMXA 5G3YA 1D2MA 1E2JA 1E4YA 3QQ5A 1SXJA 1N6IA 4KI0A 1G6OA 4QGFA 3ZH9B 4EUNA 2IWRA 1ZD9A 2J45A 3U6KA 1Z0KA 4TTQA 1W46A 1EWRA 2NO1A 1OFUX 3SDZA 1FW6A 3NBFA 4ACBA 1RRCA 3PEUA 1XF9A 1SQ5A 2BBWA 1Z2CA 2GVZC 4OQLA 4DEXA 5AUPB 4H1VA 4KYIB 2H17A 3DM5A 5FPSA 1D5CA 1EGAA 3VX4A 4BECA 4KV9A 1W5TA 3QKRA 1Z47A 2QM7A 1HT1E 1VYTA 2YZ2A 3X1YA 4GI7A 5LD2B 3TH5A 1II0A 1P3JA 2QL6A 3WYGA 2ZRMA 3LAWA 4ACAA 3PV0A 2XITA 4IVRA 4PC6A 1NG9A 3AKDA 2NO9A 3AP2A 1IY0A 4TTRA 3T35A 4LYFA 4Q4AB 4OQMA 4X8OA 4MDEA 1SVSA 2O8EA 821PA 1K5GA 1TPZA 1Z6TA 4NYMR 4ESVA 5TXGA 1IAQA 3UMSA 1E1QA 2ZREA 2PX0A 3ZJYA 1E2DA 4M1MA 2VLIA 1OIWA 1KJZA 2OLKA 2JGNA 2IYQA 1ZC3A 2RCNA 5H1YA 1ZINA 4B44A 1OH7A 4MYUA 4MRPA 1PLKA 4PC7A 3N5CA 3GLHB 1G3RA 4MKIA 1R0YA 1QHNA 1CXZA 3C15C 1M6NA 1ZMXA 4PC1A 5TARA 2CLDX 3QNUA 4GOJA 3NXSA 1Z07A 3P4XA 1NY6A 2BM0A 3F5FA 2YHSA 3QENA 4M22A 3QEOA 3AVQA 2G1JA 4LUCA 2QUZA 1BYUA 4QJ5A 2VTKA 4LJ7A 3CWZA 2FZ4A 2IYYA 3RRNA 4D25A 3DL0A 4NCKA 3S1AB 4D4MA 2GXQA 4XSGA 3K70B 4D4JA 1SGWA 4LV6A 1GP2A 4OL0A 3KKMA 4TL6A 5FPKA 1R4AA 4Q1BA 4QGGA 4BLOA 4G01B 2QTFA 1W0JD 4WW0A 2CBZA 1P6XA 3L0PA 4JLJA 4M9XA 4Q1AA 4AKIA 2Z43A 5EXTA 4RD6A 1XMIA 2ERYA 2A3RA 4IEIA 4GFDA 3UMFA 5IF9A 4TLEA 3QIAA 2ZI3A 4TZ0A 1C4OA 4OQFA 3JVUA 1DPFA 3AB3A 4R71A 1G4UR 2JIZA 2H92A 1YR8A 4V0OA 3A1UA 4QXAA 3GLGE 3TUZC 4XD7A 2GEVA 1ZAKA 2G9NA 5JEEA 4PC3A 3PUXA 3SQXA 2F55A 1P5ZB 4MRVA 3GLIE 2C96A 1NLFA 4JBYA 4GRAA 4WIAA 3MWYW 4B34A 4GNKA 1ZVQA 4W5HA 2JJ1A 1Z29A 3NDPA 4NYIR 4V03A 4XJXA 4BFWA 5DYGA 3LXXA 4Q4JA 2RGEA 2WKPA 3NVAA 4Q7JB 4G5SA 4MKGA 1I2MA 1XB2A 3RC3A 1P72A 1XCGB 1QHHA 2DCUA 2BCGY 1XP8A 4F4IA 2PZGA 2YNMA 3U3OA 1RPZA 2IXGA 2BM1A 4KSCA 4DSUA 1W0KA 3E70C 4B32A 1NKTA 3CKLA 2WMOB 3C16C 1AGRA 1KSFX 2GF9A 2ZTSA 1S3SA 2IHBA 1N0UA 4RCZA 4WA7A 3VNVA 4M1KA 3RLFA 2HCJB 2IXEA 4BLPA 1ZJ6A 2WAXA 4C0BA 2PEZA 3ZVRA 2FE4A 3K0EA 3EPLA 1ZNXA 1GRRA 4QG7A 3KJIA 1CR1A 3Q9LA 2X8AA 2O8BB 4ILEA 3KDSE 3KJEA 4UNQA 4ZDIA 1Z6AA 2WAYA 2GDJA 4JYCA 4LJAA 3VR6A 1CJUC 4DLRA 1Z0IA 2JLUA 4JVNA 2XSZA 4OI4A 1JECA 5EXXA 1KKLA 2PZFA 3FMFA 2NPFA 2Z5FA 1KZGB 2QA5A 1CR4A 1G19A 2ATXA 4DCTA 2D4HA 4DIEA 1LW7A 1GL6A 4OQNA 2WWWA 1FX0B 1RKBA 4U5XA 3AVXA 2W6IA 3BIFA 4OQXA 2QP9X 5CIQA 1G3QA 1G7TA 4AYWA 3ICEA 2Q9AA 3RRYA 4JL6A 1JAIA 1NVUQ 2OAQ1 3LNCA 3OIUA 1NRJB 2HT6A 2WICA 4LYJA 1ZUHA 2WWHA 3U5ZB 2XJ9A 3TBKA 4HATA 4EPYA 2Y8EA 3LVRE 1W2GA 2QE7A 3N2EA 3ETLA 3F8TA 5FI0B 2HV8A 4DCNA 2AHOA 2ZUCA 3LVQE 5AUQA 3A4LA 1EX7A 1GIAA 5JLJA 2BCJQ 2CNWD 3KTAB 1Z0JA 3A1TA 4LOAA 2XTMA 4EJSC 2DHRA 1YQTA 4BFVA 4L4UA 5HKKA 2GXUA 2JJ8A 4CGZA 2X19A 3R9XA 1NBMA 1YJ5A 3R8CA 5BXQC 4G5GA 1GITA 4GZLA 4B71A 4JT2A 1Z0FA 2QSZA 1CU1A 2JASA 3LX8A 2ZI4A 4P31A 1DAGA 1TNDA 2I1VB 4BFUA 3ZLJA 2ZVQX 4RVCA 4TN1A 3OIVA 3B60A 2WWIA 3CRQA 4LHYA 3C4JA 4EPXA 2VP2A 3QXHA 5FTKA 3L8YA 3IPYA 3RAPR 5CB6A 3IEUA 3EIHA 1U0LA 4JS0A 3K0AB 2CL7X 4G3XA 3RRMA 1FX0A 2IS2A 4TYYA 5KPJA 1E9CA 4KXFB 3SOPA 2QN6A 1VCOA 3TW8B 2R9VA 4ZCMA 4BFXA 3GQBA 1MO3A 3B82A 2JIZD 4W9MC 4QJ4A 1OFHA 3O8DA 1AZTA 3MCAA 2XNDA 2CDNA 3TJZA 1VCNA 5C4MA 3N2IA 5DGXA 1F6BA 3CRVA 2WM9B 2CMKA 3W34A 3W6PA 4DCUA 4NH0A 1CJMA 1P2UA 1UKVY 4QRHA 1KSGA 4BASA 5B58C 1RIFA 1XMJA 2PLRA 1DG3A 2ZRNA 1NVVQ 1N6RA 1T3HA 2EVWX 3DEFA 4DUGA 3KQKA 3W3ZB 4NCNA 4BRUA 1LFDB 1O87A 1OFIA 1SVIA 2ZRJA 4KFSA 3F3YA 3MAAC 2OLJA 2QSYA 4M1WA 4ZIRA 4TMWA 1CIPA 4IDQA 5CK4A 2ZRBA 4URUR 3B9PA 2R6FA 1V5WA 2X1VA 3Q7PA 4TQ9A 3LQRA 3KXLA 1SKQA 3GEEA 4MQBA 4DCVA 2RMKA 5IHPA 1YZTA 4JJKA 2CL6X 2VHQA 1Q12A 5CDFE 3I4LA 2W6ID 3WBJA 1LF0A 3R7WA 3L2OB 3RS7A 2V6JA 5L8VA 4JZKA 4A2PA 1Z08A 1EFTA 2QP3A 4HB2A 4X8MA 2CHGA 2HXSA 3UIEA 4DEYA 3W90A 1KDPA 8OHMA 2JJ1D 3IO5A 2ZROA 2HF8A 4HZIA 3WYAA 4D0LB 5JECA 1M74A 5JCPA 1IXZA 4IOMA 1FL9A 1DELA 1GVNB 3KQHA 1DAFA 2RGGA 4ON9A 3TMKA 2CNWA 1T0JB 1E1RD 1PJRA 2KWIA 3A4NA 3M4YA 4RKFA 2PCJA 5SZIA 1II9A 3CF6R 4LHZA 2WIBA 2GCOA 3TNFA 4QM7A 1KO8A 1MO5A 2JLWA 5J4LA 1R10A 2ZJOA 4OK6A 3E1SA 3QKSB 4D82A 2D7DA 1W49A 4DDTA 1L4YA 1OIXA 5SZHB 2VSOA 4TYPA 5TVKA 3WHLA 5E3HA 2XZLA 2VP9A 1XCMA 1XMVA 2F3TA 2QPOA 3QY0A 3GLGB 5JS8A 1YHNA 5KTYA 2NO6A 4HLUC 4BFSA 4M1SA 3ADDA 4Q1FA 2JJ2A 3BS4A 3HJNA 3AQ4A 5HPYB 2GAOA 4FD2A 1XPUA 3F0TA 4PZYA 1OE0A 1LV7A 3REFA 3VU9B 1G64A 2JDID 2C8VA 1E98A 2KE5A 3PIRA 1RJ9B 4YXWD 3UPUA 4R2HA 2OESA 2YINC 3G5UA 4AY2A 2IXFA 5DHFA 4BZPA 1E2PA 4M21A 2GETA 3Q7QA 1HE8B 3AVOA 2DFNA 2FPLA 5FR2A 1F48A 3CX6A 5GJBA 4P4SB 1GRNA 1UDXA 3ND9A 3UKDA 3BAFA 4CEIB 2ZJZA 3NHAA 1S1MA 4Z8XA 3ZIAA 1OH6A 2JJ2D 3B5JA 3VR1A 4PPGA 1ZC4A 2FU5C 4IVPA 4Q5IA 4G5QA 2D7CA 1UDWA 2YVUA 3GEIA 1KI3A 3I92A 4GOXA 4B2IA 1ZW6A 4PSKA 5J4KA 3AVYA 2RB4A 4LC1A 3WMGA 4XOIA 1CRQA 1JQJC 3TQCA 2O8FB 1PUJA 2ZYTX 2NZ8A 1K6MA 2QAGB 2J41A 2YOFA 3SBEA 4DLYA 1GDDA 3QBTA 3G0HA 4D26A 3BBPA 4DZZA 2K5UA 2N46A 2HCBA 2A5GA 5FUYA 4A6XA 4OHXA 1ZU4A 1JR3D 4GPTA 1IXRC 5JWRA 1HTWA 1E99A 2OCAA 2B8WA 2VEDA 3PJRA 4P4UA 3UWKA 1W36B 2AK2A 2QE7D 2GCPA 2GK6A 3CIOA 3HU2A 4RJLA 5JHGB 3SC3A 2WBLC 3NEJA 1N6LA 1US8B 1JJVA 2Z0MA 1RRPA 2AWOA 3AVPA 1BMFD 4Q01A 3T15A 4TTPA 1DE0A 5HTKA 2H8KA 2C9CA 3NTUA 4PZZA 3VU9A 4JLNA 2AXPA 1R0ZA 1D2NA 3X1ZA 4LJ9A 2YWEA 2RHDA 3OESA 4DLWA 2QROA 1ZBDA 1Q21A 4DLUA 4L5BA 4FMBB 2GXSA 3B1VA 2GJSA 4BFYA 2IW3A 2VRWA 2FWRA 3BH7A 2RGXA 5DNYB 3MWJA 1G20E 1G3IA 2ODWA 2BMEA 2F1RA 4I1SA 3QG1A 1QBKC 1QHGA 1I4TD 3QE0A 3RS4A 2ZRPA 3BFXA 3N70A 2ZE8A 4L9WA 4CEHB 4BWYA 3K70C 2QI9C 4JVMA 1W7AA 1DBSA 4XTCS 3GLFA 2PJRA 1BH2A 5CLQA 1JALA 1QRAA 4GSYA 3WHKA 4EFNA 3PEWA 1G9XA 1YZLA 4EDHA 3SJCA 1V43A 2AKAB 2V55B 1GKYA 5KHOC 2CHVA 2J0VA 2ZEJA 3RS0A 3QXJA 3H4MA 1VG8A 4WXPA 1CULC 5P21A 1MABB 3IIMA 4BE7B 1S9HA 1EK0A 3K9GA 4FMCF 1N5JA 5GVSA 3KB2A 4KBGA 1AJEA 4DDWA 4QBFA 1Q20A 2X2EA 2R65A 5A5GA 1YR9A 5CYOA 5JJIA 1VTKA 2ZRCA 3P26A 3NH9A 1ZCAA 2ZYUX 4YDSA 3EZFA 1T4GA 3H1TA 1IY1A 1CLUA 5G3ZA 2B6HA 3SHWA 2ZE7A 2C98A 2ONKA 2BEJA 1NMYA 4N0DA 2YWGA 1GNPA 3M6AA 5BYKA 4CRWB 1J70A 1AZSC 1BMFA 4HLDA 2V1XA 4HAXA 3M1IA 3DKVA 4B6FA 4MKHA 2FSGA 4ASUD 3DM9B 1JAHA 2I1QA 4S2EA 4WZBE 5DYIA 2R6DA 2VQSA 3ZQJA 1EXMA 1S9DA 3L82B 2PZEA 3ASYA 5AR1A 4V0ME 3ADCA 2VSXA 3CF2A 2I4IA 4YDHB 3MUFA 3I73A 3SQWA 4JLKA 2BIFA 3TIFA 4ABYA 5BW8A 4PTLA 2ZR0A 3L43A 3I8SA 5KDLA 4NONA 1AN0A 1G8PA 1GWNA 4NE2A 4CW7A 4ARZA 4RFSA 4PXAA 1XEXB 3TSWA 3HU1A 5CYPA 4C9BA 2RAPA 3KKQA 1J8MF 4DT1A 3QVVA 5DI3B 4EQ6A 2ORWA 2QMUA 1W1WA 2OBMA 1NSFA 2GBLA 2FFHA 4LX0A 1N0VC 2AD1A 2L0XA 1PV4A 1KO4A 2P5SA 1H65A 4PO1A 3K0CA 2FG5A 2ZI7A 3L0OA 4KU4A 4RFVA 4GL2A 2WPDA 3B1XA 3FFAA 1GRQA 4LZZA 2W2XA 3VMFA 4UJ5A 1R7RA 5F9FA 3RYTC 3B8HA 4C0QC 2PT7A 4L8GA 4ZO4A 3W6NA 5F3WB 3AKCA 1NVXQ 2BMFA 2A5FA 3SJBA 4RD2A 2Q3FA 4PQFA 4JSTA 2PMDA 1OXTA 3LV8A 5FOVA 1Z3IX 2D2FA 4MUBA 1XTJA 3NWJA 3NC0C 2V3CC 3B7GA 1II8B 2CXXA 2XXAA 3BC1A 4FWTA 1RRGA 3TUJC 3SI7A 2WJYA 1EFRA 1YR6A 2XOKD 4TLBA 1Z8FA 3BB3A 1JPNA 1VECA 4D80A 4MA4A 1G6HA 5HCNA 4BEJA 3SJAA 4DSTA 3RSOA 1KAOA 1UKZA 1TF2A 1E9SA 2DBYA 4MGIR 4FN5A 2ANBA 2C04A 1W4CA 1W5SA 5FBQB 3CPJB 2FNAA 5FTNA 4IDPA 3FFBA 5FOUA 2DPXA 2J0UB 2UZIR 2EYQA 5IK2A 4ARZB 3THYB 1WXQA 1N3BA 1Z28A 1Z6XA 3W3AA 2A5YB 4KLNA 4IOLA 1MKYA 3KQUA 3TW4A 1E32A 2EFDB 1E2LA 2DR3A 4GZMA 5ANRB 5HZKA 1S3GA 5TY0A 3QKTA 2F3RA 2FEOA 5EE0A 2R8RA 1CTQA 1GKUB 1WQ1R 3DZDA 1EWQA 2N1BA 2VF7A 3K9NA 5E7MA 2QGNA 4QBIA 1LNZA 2RGCA 1P2TA 4JBWA 4NYMQ 2EU8A 5KDOA 1DS6A 2XNSA 3JZAA 1M34E 3AVUA 1OV4A 3UK6A 1P4SA 2Q3MA 1KMQA 2YV5A 3U2QA 2G0TA
chains in the Genus database with same CATH superfamily
1J2EA 2E6KA 2O4CA 2J7PA 1JLRA 1R1DA 1ZGGA 2HMSA 1NJ6A 4P2BA 4X1IB 3R9IA 4HPXB 3TX2A 1G4AE 2QTVB 4YI3A 1Q16A 5E3IA 5BRNA 4ALIA 2E49A 3HJUA 3EGEA 5IH7A 3UAWA 2OENG 4LRXA 1NUQA 3L92A 3LBIA 5KHLB 1FJGB 3KB6A 3M2TA 5CR9A 2QW0X 5LDGA 1JS1X 3N2GB 3IUEA 2FUKA 1FU7A 4D99A 3I61A 1QH0A 3BEOA 2NSLA 1JE1A 3SIWA 4DWOA 5FEMA 2VOEA 2QLTA 3Q9SA 3AKEA 3PNPA 4DM4A 1XFAA 3GLIB 1JHRA 4EW2A 3RIYA 3IBFA 1VE6A 3JRXA 4YLGA 1MVOA 2AFHB 2CEAA 1ZDMA 4D4IA 1BJRE 2XCQA 2I29A 3D3QA 3KEOA 1W4AA 2I0FA 5MGNA 3AF2A 2WTBA 5ITWA 2YWBA 2WIDA 3RG2A 3LK7A 4XJSA 3BRWD 4EYOA 4OCZA 5EXDA 3GY0A 5ALYA 3R7SA 5KVAA 3O9MA 1S01A 3VR4A 6AT1A 3I52A 2QYSA 4HYQA 4ND1A 1CUGA 1I2CA 2G0NA 2GA8A 2LDXA 2V7PA 1G9SA 3K6RA 3KZCA 3MRSA 4LOIA 4QOGA 4TXHA 4UBLA 4AN4A 5K8TA 2OYSA 1FMCA 1H2YA 1XCLA 2O8EB 5LP6F 1OT3A 4NZNA 2ZJ4A 1V45E 2P2YA 2GN4A 5B2EA 5JTTA 5I01A 2H1SA 4OM7A 3NGMA 1IRXA 1OLSA 2H54A 4ODIA 1H6AA 3PIIA 5IAJA 3EAQA 1MOZA 2O4UX 4U2GA 3OZSA 3ZLVA 4JXXA 3AUYA 3EE6A 4GGOA 4URHA 3ZD7A 2FOLA 5ALZA 4DCGA 3DZHA 4AM8A 3JQRA 4A8TA 4CLRA 5DK6A 3GARA 5JJKA 1TJPB 1FLAA 3EZ6A 1G2IA 1QGYA 1LH0A 1I3NA 3KOUA 3SG0A 5L9AA 1SY7A 4FHEA 1E2EA 4F2WA 1EH5A 4V0SA 5SZKB 3NU1A 2BZ0A 1JQEA 2BBTA 2XA9A 3QV1A 3WGNA 2O8BA 5DZSA 3H2HA 2H7VA 3BE4A 1H4QA 4ALJA 2WB2A 3IP3A 4LOJA 1FNBA 2ZBGA 1HE2A 3LXRA 1JDBB 1M5UA 2XDQB 2Y92A 4BNWA 3GP8A 4S1NA 4GKAA 3RI3A 4WECA 1UF9A 2W0SA 3LL4A 5B37A 1Z4IA 4JJIA 2XT9A 3PPYA 5DULA 2BYTA 3PS9A 5JH7B 5E1OA 2FZKA 2RK3A 4M3NA 4QTZA 4TMZA 3KT3A 3ADKA 4G1EB 4U2EA 4WY5A 5KCZA 1Y9DA 4CKWB 1EA7A 1TADA 4K6KA 1WF3A 4OLHA 4CN8A 1JHYA 1NVDA 4N03A 2VBCA 4Q0MA 4DV4B 4BB5A 1CKEA 1NRXA 5CHYA 4LMPA 2J46A 5JHHB 1LLQA 1SXQA 2QI9F 1CY6A 3H42B 1E8DA 1V8PA 5AVXA 2XYGA 4QXQA 4LCJA 2NIPA 3TXXA 5L3SB 4L9SA 5G4KA 4LHWA 3RSZA 2OCKA 1LWOA 2GPAA 1C3EA 1JL3A 5FQOA 5TQ2A 2H59A 2IGBA 3NAMA 3ZDYB 3ZU5A 3CVVA 3BOSA 1OU4A 1U8CB 2CJWB 2NU8A 1FJXA 5IEJA 2HA5A 1TE2A 1TC1A 2FN8A 2VNKA 1A7AA 1E0KA 2P0AA 2NUPB 3D4LA 1YWGO 2YIVX 3L0ZA 1CQWA 1R0XA 5K2OA 4AXXA 2OZPA 4ARAA 1YFZA 4KMRA 3W9UA 4WBXC 3ZLBA 4LPKA 4XTRA 3K7EA 2BCEA 4HR7A 3WZ2A 1OKKD 3VPFA 1WDTA 2CLFB 2Z04A 4BQOA 3WV4A 2QTGA 4XB6B 4DIDA 3LW8A 5DYWA 4A1OA 1M2JA 1NXOA 3EMDA 3GQVA 3HPQA 4C05A 3R77A 2NUBA 4Z1MD 3LC7O 4GOMD 2NVUA 4OJQA 1GLVA 2AJBA 1AB5A 1N2JA 4LC9A 4R9RA 4CKEB 2V0GA 1O2DA 1Z4NA 4G8JA 1TVMA 2FRXA 1QR6A 4BX2A 3KQOA 3RQIA 1HXHA 4P4NA 1U98A 5HRCA 3SR3A 1TM3E 1A9OA 2O2SA 3NDBB 1ZSYA 3PE6A 3T1OA 1E1DA 1JLSA 2DQ4A 4RADA 3WC4A 3BE8A 4UNNA 2SHKA 3VSAA 4JBXA 1VYHA 1MO6A 2ZBDA 5BN1A 1R27A 2Q1YA 1G21E 1CQZA 4LK2A 2PU5A 1G7RA 4R2MA 1KQPA 1IQRA 3LDAA 4QUKA 9ABPA 1JFLA 1T43A 1RWOA 4H15A 4IEEA 1EUCA 4L5IA 3BTSA 5G0SA 3G1TA 3SC6A 7REQB 1TRHA 1TUBA 1FNSA 2IYAA 3F5DA 4OATA 1RJDA 4TWZA 5HQJA 2OA0A 5LYJB 1M0WA 5FWXB 2GXAA 4OP2A 3KEQA 3EGWA 4Q4AA 5EZYF 2PT6A 3LPLA 3RRXA 2QPLA 4B2PA 4ZOLB 3GIWA 4RESA 3GT3A 5EMLA 4KR6A 1P45A 1XEWX 2X6TA 1EB8A 2PMFA 2X5JO 3VDXA 4DR7B 3WMWA 1Z18A 3NC4A 1A97A 1IQ0A 3GU3A 5GZ3A 4XR9A 3AFNA 4Z4HA 2DLCX 1I4DD 1DC4A 3F6YA 2O2GA 2YZKA 3FHLA 1CVRA 1DIBA 4GXTA 1BMTA 3TW0A 4ZIRB 5FXMA 5LZ7A 2BH9A 3NHLA 1VB3A 1PZNA 2OCYC 1Q50A 5KOJB 1ICIA 3JV7A 2G9QA 3G7UA 2OCBA 4YQEA 2IRWA 2G8LA 4ZP1A 2H2IA 1UWVA 3OZUA 2VRCA 2WWXA 4XIGS 4YP6A 5JXGA 1LTQA 1U3DA 3IP1A 3AEXA 1GCOA 4KGXA 1LBTA 4CL2A 1PQYA 1I0ZA 4HRVA 1J49A 2GBPA 4IOJA 4P34A 4LF7B 4LHSA 1UM8A 5BN5A 2PO7A 4LI3X 1FQKA 5K9ZA 4XVUA 3C45A 1ONBA 2PYDA 2ZRQA 3ZJTA 4IRUB 6REQB 1A5TA 4NXMB 2BKUA 5FWYA 4OBEA 1J8FA 1PFKA 2F43B 4IMJB 2FE1A 1O96A 5FUWA 1U28C 1WCIB 3GLFE 1PQUA 5KYXA 5JARA 4R84A 1EDOA 2BAGA 2B94A 4WLVA 3IAEA 1HE3A 5L3ZA 3MCTA 1DT5A 2AC7A 1BXRB 1CSEE 1LSUA 1OLOA 2ETXA 4BKRA 2XB9A 1BE0A 4PLWA 2ISQA 2DG2A 3GG9A 3UT6A 2A6PA 4YMGA 5FL7A 3LO5A 2X1MA 1V41E 2X8JA 4BAZA 5TDHA 3VR2D 1TQDA 3FDFA 1Z4PX 2ZTLA 3DFFA 3LGSA 3WLFA 4DLKA 1U3UA 5EN4A 5HF5A 3K0CC 1BX3A 1Y4UA 3MVEA 2CLCX 1J4AA 3F7TA 4RK5A 2WOOA 5LQMA 3OSUA 3FETA 4FP9A 4RHCA 2HRRA 2BRUA 1AXGA 2IOYA 3UB3A 1GG9A 4YUXA 3IOMA 3B7PA 2VJYA 4NECA 1Y34E 5IUNC 1NDQA 2AH5A 3SXUA 3AM1A 3DBRB 4KWEA 4MPRA 1T8UA 1P7PA 2J9YB 1LI7A 4HZUA 3U7GA 3FIUA 1Z73A 2CMGA 1T36A 4DKXA 1AOXA 5BMVA 5K8CA 1Q57A 1EFRD 5I51A 5C52B 2QZPA 2JFHA 3IJ5A 1SU7A 4C5BA 4Y0VA 1ADYA 2QZZA 2CVOA 1ULAA 1ZI9A 1M7BA 5FFFA 3I6BA 1RWKA 2B6NA 3C0KA 4MICA 3QITA 1X86B 3E2IA 4D4KA 4FFPA 1RKVA 1AQUA 2QRMA 3IP5A 5J9FA 4BV2A 1H2WA 4PICA 1OW3B 1ESNA 2GAAA 1S8AA 3A10A 5FO0A 4BLTA 4YAWA 2PX8A 2QRUA 4HUQB 4Q7MB 3RTDA 4NV3A 2JLZA 2ZYRA 4Z4FA 1BVHA 1FFHA 1PIWA 2ZETA 3H1BA 2VNAA 3IO3A 3U7HB 4AF6A 3C3KA 3LHDA 3U4DA 5KS2A 1T3LA 2VOJA 5IAAA 3UV3A 1JXOA 5DBGA 4JENA 3GN1A 1JKFA 1I80A 1XRQA 2X0JA 4J2TA 4FUTA 1V7CA 4YRDA 3Q5GA 3KX2A 4JLOA 4JOQA 2WHXA 1TA9A 2PUBA 1QQ5A 4P3KA 3HYRA 1HYEA 1SUBA 1QIGA 3BRWA 3N8KA 5K8JB 3WDMA 3B51X 2FEXA 3M6MD 4JT8A 3LFUA 3RRZA 4I5GA 1KDYA 3BSSA 3VHXB 2TMDA 1FSFA 1V48A 5HK8A 1U6IA 4QDTA 5ILGA 1DEHA 1QKJA 1OYYA 1MH9A 4GMKA 4YAEA 4D4LA 5AJHA 5ADHA 1J7JA 4CYMA 2VJLA 1EK6A 4WEQA 5BVGB 3VU3A 4C4OA 1F3OA 1V1MA 1TUIA 3CONA 4ZI7F 1WVIA 3L0IB 4L4YA 1AF4A 3PKZA 3D7SA 4WY8A 3S2YA 3UW1A 4DC1A 4BC1A 4X92A 4TS1A 4LJ6A 4EO4A 3ABQB 3W8NA 3ZKWB 5G2OA 2QQ5A 3PKJA 5KWSA 1KO7A 1RSZA 3W1EA 3ILXA 5CDTA 1DP4A 1W8DA 2DQZA 1E96A 3UVEA 1U9YA 1YI1A 3B78A 4EJFA 2EW2A 1YQDA 1IZ7A 3CKMA 3NHYA 2O3SA 3DVRX 3D4BA 1IY8A 1L2TA 1AGYA 2JD1A 3GJ3A 3IVAA 1Z0ZA 4UEWA 5IBRA 2HUNA 2DJ5A 2FPOA 5DEIA 1BS9A 2CV0A 5BY2A 1OGIA 1THMA 1ORDA 1U9CA 4EDFA 1QYDA 5IN5A 4J3NA 3Q1KA 2QYHA 4NBSA 4P80A 3BA6A 2OZLA 2XMZA 2BHSA 7MHTA 3FVVA 3FUVA 2BFOA 4Q93A 3ZV6A 4B4KA 4OQDA 1DQPA 3L7DA 2NSHA 3R20A 3ROXA 4C4RA 2QRLA 4DSZA 1EJ2A 3CNEA 4WLEA 5JNUA 1PJTA 2VWHA 2ZVPX 3OX1A 2PVSA 4QPNA 4L76A 4H0NA 2ZSBA 2BUCA 1HKHA 4Z4QA 2NOAA 4PAMA 4OYLA 4XQCA 4L0MA 2N9UA 1GAXA 1URPA 1FQOA 1QDLB 5IFKA 5HJEA 1LRLA 1U0TA 2W2TA 3R4VA 1XUOA 3CPSA 4FQ7A 4KWTA 4W1SA 4IXNA 1KTVA 4LSWA 5CB8A 3U4QB 3P7MA 5JC8A 4D42A 1YQXA 1RTTA 3BK7A 4I14A 2HJ9A 5DGCA 1B6GA 2I3BA 3BH0A 4ZD6A 3EHEA 1ZEJA 3RFTA 4Z7JA 5EJ7A 4R1NA 4BY9E 1DGQA 4NBKA 4CLDA 4Q03A 2CFOA 2A86A 2PWPA 2WKSA 3RASA 3DMRA 3TQRA 2WFLB 2ZIWB 4G0OA 5DGHA 4BVAA 4BFLA 3L07A 1H0HA 1P5HA 2P4EA 3IHKA 3ZK8A 3TPZA 1K4YA 2FPSA 3UGKA 3KXIA 3DOCA 3VR0A 5LLSA 2CCJA 3HB7A 3ESCA 1QVZA 3WLRA 1LK7A 5BSMA 1TM5E 2ZI6A 4RK4A 1MNAA 1K6IA 5HBGA 3O74A 1PUXA 3OOJA 1KAQA 3BJEA 1KK0A 4JNCA 4LF9B 1QH1B 1WA5A 1A4IA 4R4JA 5BR8B 1MU0A 4TVSA 2B1GA 2FZLA 2HIAA 2ZYWX 1WUYA 3X0DA 3RTEA 5JQGA 4MQUA 3DKPA 2QXUA 4HWTA 3DLAA 3M9XA 1KE2A 2D5BA 2R6CA 4PSUA 1C1DA 3BD9A 3T7TA 5EJEA 1YTLA 3EQ2A 3G0DA 4JGIA 1BDIA 4OYYA 4GXQA 5JATA 1RADA 4J75A 2X77A 5IJ0A 1HBJA 2HF2A 3OE7A 4FJ1A 3RH0A 4E03A 1A27A 1DSSG 1N4DA 3FPAA 3MJVA 2IF0A 3VVMA 7YASA 3DXYA 1MPXA 3F4LA 3PC6A 4C0AC 1CFZA 2NW6A 4UKDA 2FMKA 5FBKA 3P5BA 3IMCA 3PBKA 3W8RA 4XX0B 1AHHA 5ESRA 2HEGA 1EP9A 3NFYA 2GR9A 4RHYA 4B7CA 1JJAA 5IKEA 2WTXA 3U3XA 4CCAA 2PKXA 1EEHA 2EARA 2I22A 3GRUA 4FEEA 5ALUA 5K99A 3KT0A 4RHFA 1GTSA 3O9VA 5I4BA 1NE7A 4MCJA 3T5GA 3IDOA 1QH8B 1ZMTA 3C48A 4KQWA 1USVA 3TVDA 2RHMA 4ZGWA 4XWTA 1C7RA 1VDZA 2GHIA 1C9YA 1VHTA 3X1JA 5JBIA 5DJ5A 1N2CB 5ELXA 1B1CA 3TIXB 3WGLA 3U3RA 1TTTA 1E6KA 1JJ7A 1QIDA 2HA0A 4RK0A 1JSRA 4C4PA 4EQ6B 3F5MA 3FFWA 2YWHA 3M9WA 4D9BA 4DLTA 4EO9A 1WMDA 2OM2A 2JHFA 1U9JA 3V8VA 1B43A 1BH6A 1J06A 2QVGA 4AECA 5H3CA 1TW2A 4U9HS 3F74A 4V0MA 1JT9A 2H1FA 2WP8J 3TZKA 1SULA 2WSSD 2W9XA 2ID8A 5GJVC 3V4LA 4D9NA 4C6HA 3FWZA 3ZDFA 1JJBA 3N2NA 4MVJA 3SZGA 1GO2A 1OQAA 3NETA 4KQXA 3UK2A 3NW9A 2X3FA 1Z8DA 3MWKA 3TG2A 2QXTA 1OF1A 1QGED 3MUNA 5FRDA 4KRFA 5EKUA 1XTRA 3HI4A 4N1AA 3TLZA 4MRMB 1ULTA 4EMUA 5K0NA 5I5GA 4IVQA 4HDKB 3EH2A 3OLYA 1NYLA 1ZJZA 4IIYA 3N0TA 1ZI6A 2WD9A 2R68A 1UAGA 1RYZA 4D9HA 2NXCA 3NFRA 1Z5PA 1M54A 4R2XA 5D87A 2QTTA 3NT2A 2AJDA 3DE7X 3K0HA 3QYAA 4HDAA 1G4HA 4R1UA 1SOMA 3KZMA 3RD5A 4GYJA 5DBEX 4YT8A 1OYOA 3RS3A 4E94A 1V8FA 3STUA 1PGPA 1ZG3A 2BJVA 2O2XA 3O75A 3ANTA 3GCWA 4QNRA 4RPHA 2A30A 4KOAA 1FC0A 1SD5A 1VFPA 5CFNA 1VPDA 4JCCA 1ARZA 1SKUA 2J9GA 4YMWA 2F7SA 2HR1A 3AEQA 4Q7KA 4X85A 5F77A 5EUCA 2W6QA 2X0NA 3D8SA 4LKRA 4WACA 3WA6A 1KOJA 1RP1A 2OQVA 1XPOA 4BP1A 3X2SA 2C2ZA 5E2AA 1P2SA 1E2NA 2XW6A 2NYAA 4BNLA 1XVLA 3PHBE 5BSTA 5LP6C 2ECOA 1TW3A 4ZVMA 3RT9A 3LECA 3QF7A 3UWOA 4DA0A 1SUAA 1Y0BA 3JPWA 1C8BA 4NMWA 4AG3A 4LZJA 4Z7NB 3FPKA 2GM4A 4F97A 1R0CA 1Z7BA 3IT0A 4D3FA 2HA3A 2PX3A 1OA1A 5DCYA 3R5XA 2QRHA 3KQLA 2D59A 2VK4A 3TRFA 2VTVA 3TUIC 2BOVA 3UG6A 2VPPA 3P97A 2Z9DA 4FFVA 3ANLA 3KPWA 1P18A 1OXXK 2GZHA 4NJMA 1VL8A 3P94A 5A4IS 1GTZA 2DHQA 1ILWA 3ZHXA 1PLJA 2P9EA 1XZJA 2V74B 3OJEA 5H82A 1GPWB 5I8ZA 5K0ZA 1CDDA 2ZM5A 1UBSB 4EJSB 3EIFA 3DMFA 2QTNA 1Y9AA 3DE0X 3Q4GA 4AKEA 5C4IA 3COPA 5J2UF 2IUTA 4N7BA 1IEWA 3HDTA 1H8EA 2P9FA 3RYIA 2V8OA 4EELA 3AH8A 2P2LA 3I12A 3TI9A 4LA4A 4KN5A 1QHSA 2V7XA 3IMGA 4FCVA 5T8KA 3CX8A 5JBQA 5A2QA 1J07A 1SOVA 3VR6D 5KJEA 2ST1A 2IELA 3AHEA 3KLMX 3Q3JB 1JXQA 4TSKA 1S2MA 3I8OA 3KU4A 3P4YA 1FY2A 5K09A 1EFVA 1FZQA 5FDFA 2GS9A 1RACA 5MFPA 3K09C 4KITB 1C9EA 4AS1A 2IV2X 3GFOA 3LUFA 3MLBA 3SZLA 3AEZA 1OPXA 1TZ2A 421PA 4GQBA 5LP6A 1C2YA 621PA 4F92B 3VUEA 2P78A 3DLBA 2FQYA 3DL2A 3CWCA 4PNHA 1XKTA 3ZPXA 2RHGB 1VCHA 3D0KA 4PX9A 3H75A 1HI9A 2PTGA 3GCXA 3RIGA 2EBUA 2HTFA 1GZUA 2B1QA 4BO1A 4OV6B 1L1QA 3L8DA 2ZU6A 4YECA 4AJ4A 1Q44A 3IHTA 2X9VA 5IC4A 1DWUA 2QNRA 5DHUA 1O6GA 4BO7A 1H2ZA 1C3JA 2C92A 5CPBA 5I7WA 1EX9A 3CNQS 3GF4A 1AKUA 3ML1A 1ZPDA 3ZXXA 2GWHA 2VBFA 4HVAA 2X7HA 2WHEA 3T4XA 4U7DA 4FIDA 2FPMA 4IW3B 5CFOA 3AUJB 2BMJA 2RAVA 4XQ0A 1AM4D 1EGVB 2V45A 2ZUBA 4XD2A 4CLRB 2VDMB 2ZT7A 3PQ6A 4G1CA 4HCJA 4PLPA 1P4JA 1FX1A 1LWNA 4QBGB 5HE8A 4ABTA 2Q21A 3RRJA 4C89A 1UFOA 1GSHA 2PLNA 5T64A 1F06A 4EW1A 3L84A 1B73A 1BXKA 4NDNE 1T9CA 1WZ2A 4WEOA 2D1SA 2QD2A 4FR5A 4CIVA 1P5JA 2VT3A 3MINB 4KXWA 1A69A 4BLSA 4BNXA 4EAQA 3NI2A 4M9SA 4US2R 4PFQA 5EPEA 4E4YA 4YAJA 1C4XA 2Z8YA 1G20A 2P2DA 4BB6A 2WW8A 3ENVA 3GN2A 3PTLA 5DM70 1MABA 3A1FA 5JE8A 4ED9A 3U81A 3HRHA 4GXNA 2F9FA 1TDJA 4OXKA 1DG1G 2IZOA 4HLQB 5EKSA 5JH7A 5KNBD 2PLWA 4BO9A 3OCYA 4K9RA 4ZOBA 2Q3HA 3UT5A 5DSZA 1GA1A 4DUPA 2Q3BA 1M2NA 2OCPA 1X2BA 3PNKA 4YMLA 5B1EA 3GYGA 4WBSA 1U90A 2B7BA 1VLMA 3OC0A 5EZYB 4CM9D 3R9KA 2ZAGA 1G0NA 2RGUA 2OO7A 1UANA 5A1JA 3BF7A 3EEBA 3T3MB 1IVSA 2CNLA 1A7UA 1G7CA 1R9GA 4CF7A 1KRXA 1M10A 4ND8A 2X4LA 3FMOB 2RKBA 1L5VA 3O2QB 4PHCA 3RIMA 5TQ2B 3EPKA 3GNSA 3BMNA 4HNAB 3ZZTA 4FE4A 5GINE 2YNMC 1XAJA 3M5WA 3JD4A 2NGRA 1SBNE 4N5HX 3R3YA 1OSNA 1X74A 2OK8A 2ZW9A 3MAJA 2ZGVA 4YXWA 3V00A 4W5RA 4GAEA 5HDQA 1T5LA 3TL6A 1NX9A 3NIGB 1QIFA 3SBDA 1IEQA 3EUEA 4ZVNA 4DNQA 3THXA 2D1QA 3NRBA 4IZHA 2YVLA 4HB4A 3RAEC 1VSBA 3OFVA 3U61B 3RBVA 2XWSA 3P0IA 4PLFA 2CF5A 3B6EA 5FBZA 2P41A 4MSUA 3EUWA 4DNPA 1QOQB 1KBOA 1SURA 3RT1A 2L69A 2BHRA 2R1ZA 1MAVA 3RV4A 3TRDA 1WZIA 4BZQA 1P9RA 3R1IA 4Z7QB 3IJEB 3A9UA 1XDDA 4QATA 2HF7A 3EA5A 1D2AA 4BN0A 4FFMA 4FHDA 4N76A 1TTHA 2AOTA 3V4FA 3RK0A 3LK6A 1XEXA 1JWLA 1E3DA 2NV6A 1SG9A 3G3EA 2VK8A 3LWZA 5E4JA 3UHAA 5HZHA 3NB0A 4Z9FA 2WTUA 4DT1B 1KDOA 3FMIA 4JBLA 4BNYA 2F8SA 3FZNA 1IB6A 3T38A 4GP7A 1HC7A 4FSHA 4XW2A 4UFPA 1OWOA 2C83A 1E94E 2CKDA 5E4FA 1P73A 2R86A 4FT4A 1JVNA 5EHQA 4DRYA 4PYJA 4E5UA 5K3AA 3AWIA 3IODA 3D1LA 5SYNA 4RMIA 1PK8A 1UBGA 2KI5A 4UHJA 4B7UA 3O8QB 2OMKA 5G41A 3PX3A 5FH9A 1GD1O 5ALFA 1IDOA 1R3DA 1NW6A 1ZD2P 3EFBA 4C6RA 1Y8ZA 1ITZA 1HF3A 1QUEA 2GEDA 1UMKA 1K8XB 4UBOA 1RZ3A 1EUCB 1M1NB 7REQA 3E9EA 1P61B 3FCUB 4G1BA 4GXRA 3OQVA 2EP5A 3I6QA 3NKFA 2G1AA 1N2ZA 1NNI1 1D1SA 4WQMA 5FYDA 3T7SA 2BLNA 4RTRA 4FUQA 2IT1A 3PDJA 3TEMA 2C5AA 2C7PA 3RIHA 1ZISA 1FU4A 1IXYA 1HV8A 2K6GA 2PWBA 1CJSA 4MYTA 1BKSB 3LF1A 3Q7IA 4V2UA 5EC8A 2IUSA 2CT8A 3D6NB 1LDBA 4C4AA 2CVQA 4KFRA 3OTOB 1W5AA 2I2BA 1I51A 3BJZA 3NHJA 4INOA 4MQ6A 3WGOA 2J07A 4C0KA 1I9GA 5CVUA 4YFVA 2FWNA 1U2TA 1JTEA 1VCIA 4PYNA 1JG7A 2AIRA 2O0JA 2JI8A 2XZPA 3KD2A 3LT4A 1AA6A 1SKYB 2FPGB 2NLOA 2LR0A 4W5WA 3BK1A 1XZLA 1JX6A 2R1UA 5IABA 1EZ4A 4JYAB 3NBMA 1ODCA 3PHCA 5J1SB 5CB4B 1PS8A 4QXMA 3SBOA 1MJGA 3Q7TA 3R0XA 3UMJA 2FW0A 3JVEA 3ECAA 4MAAA 4PRKA 1C0IA 1FLNA 5CVJA 4C04A 3H5TA 5BURA 2VZEA 2FP4B 3GJXC 2G17A 3JYHA 1P33A 3PDHA 4FX5A 3BDAA 5DKFA 1JPUA 2ZTUA 4E46A 4PIMA 2R6R1 4MQEB 3PZRA 2OCLA 3I64A 4HBGA 3UWDA 4AJKA 2IBMA 4Q9KA 4NHOA 3H4VA 1I1NA 2YYAA 1UINA 2WJIA 1EDEA 5ESDA 5AQEA 1O96B 3KSAC 5C8YF 4AO7A 2A59A 4KQGA 1Q0HA 1JR6A 1H1DA 1BHO1 3T3EA 4GP6A 3QFRA 4CPDA 2CMDA 2AWNA 2OILA 2WYHA 3FBTA 4RVHA 5EMNA 3DD1A 4YCSA 4LCBA 3SYTA 1PDVA 1R74A 1GEGA 1H8HD 2W00A 3FDIA 4EF4A 3AVTA 1KXZA 5J4KA 2A5LA 3H5AA 5AHXA 5THKA 1E69A 3VKWA 5KMGB 1T5OA 2FW1A 2RGNA 2BGUA 2Q6KA 1ZNYA 5BSRA 2GBCA 3V1LA 2ZG6A 2D0IA 3WOHA 4BE9A 4ZV9A 4CNBA 4MZDA 1PVVA 4ARBA 1KXJA 3AFIA 1HOTA 3KVYA 5JZSA 2NQTA 1D9XA 4DXDA 2YS7A 5AIAA 4YRCA 3U3JA 1ENOA 4Y6SA 3N87A 2C9YA 3PFHA 3OBIA 4DREA 5KU1A 2VP0A 5GIPE 1KFBB 3EW7A 3FR7A 4GSLA 2I54A 4JBGA 1U9IA 4RAOA 4BNVA 1Y7HA 4Z9BA 2UZ1B 3JQ7B 4O4LB 3BGDA 3W1VA 2YOHA 3LKVA 4GH5A 4PYMA 1A1SA 5LN1A 2YVAA 4AKGA 1C8VB 1JHXA 2I2CA 3PTAA 5A9SA 3AP1A 1AK2A 1U1IA 4FOTA 4DV5B 1R88A 1T5TA 4F12A 2FR8A 2OV3A 4WPGA 4OHWA 3S8YA 1WEHA 4DR3B 1U0OC 1PWHA 2VXYA 1QYIA 1USGA 3DEZA 3HP4A 3OIWA 1ZSNA 1VIVA 5REQA 3OPYI 1IQUA 1FVHA 2KS6A 4TXNA 1XJQA 4W5QA 1DUVG 3BWEA 4MGHA 4EECA 3DSRA 5DNUA 4DADA 4ZI2A 2WVAA 1Z36A 4JLBA 1XEAA 1Y63A 4EI7A 3TOXA 1Z68A 3FLBA 2GGSA 3P9SA 4YMSA 4GR9A 4ENUA 3I30X 4ERNA 1YVEI 3LBFA 1U9ZA 1QC5A 1E3IA 4N8SA 1GA6A 2X4DA 2Y1KA 4F71A 1KHTA 2G63A 3KTAA 2C2WA 4PCVA 5CIWA 5KDDA 1U7DA 2R8YA 1GUDA 2C2OA 2DSTA 1QMGA 1G8KA 3UFBA 3EBOA 1LY1A 3RAFC 3JQAB 4D44A 2VAMA 5JLAA 2JLRA 4DOMA 3O73A 2EJVA 2RGBA 1L8QA 4HJRA 5IAEA 1NDHA 4E7OA 1RXEA 3AHHA 1RHUA 3ICVA 1OI3A 4D6YA 3QOYA 5CA0F 4GI2A 4M0UA 5DCWA 3DLCA 4FGWA 3VRHA 2VL7A 3OO0A 3UAOA 2I8CA 5AM4A 4E5DA 4WKBA 4E6EA 5ALDA 2XAAA 1GKKA 1C9DB 4ARUA 1KMIY 5JMWA 4A8PA 1C29B 2YN4A 4Z1MA 2C7QA 3HFGA 3HEBA 4XCQA 1GLNA 1QHHB 1IN6A 3HHEA 2CC2A 3JX9A 3KUUA 5C4GB 5HUJA 1FTGA 3ZUPA 3IXQA 1NJ5A 3CR8A 1TUEA 1Y48E 5HBRA 1WSBA 3DAHA 4EX7A 4LJRA 1WS6A 1A2BA 3A4YA 3CSDA 4YCLA 3M2PA 4RZ2A 1NNEA 1ZICA 3DBLA 4GE3A 1N34B 2XNHA 3MBKA 3MIZA 4HRAA 4EUEA 4F1JA 4OAOA 2W6JA 2Q99A 2Y4NA 1JIQA 1R37A 4KHPB 2PRZA 2IXAA 4LFBB 1N3YA 3B3JA 3EXG2 3CCCA 5EZ5A 1KYIA 3UO8B 3WBFA 2ZUWA 3IKMB 2J7KA 3EZYA 4N5LA 1Z2AA 4TLDA 3OLQA 1T6BY 2C99A 5I45A 3BHNA 2OMEA 1XI2A 2RK4A 4KHZA 3A7DA 3QE3A 4H6WA 1WZCA 4L2IA 1T2EA 4MCHA 4UW9A 5T67A 1R5NA 4GWGA 5BWNA 4CIXA 3Q3CA 4RDXA 1BMQA 3WLJA 2QRQA 4D0RA 4EYSA 3N7AA 1KKMA 3ETNA 3ZOZA 2DFLA 2CE7A 4EFMA 3D6UA 3G5LA 3UJNA 4X1YA 3FPSA 4RXMA 5A5EA 3QUCA 1GPH1 1SVOA 1RBYA 3AUFA 3QBJA 4JK3A 4CEJB 2V4ZA 1ID8A 3AM5A 3TPCA 3INRA 1AS3A 5EXPA 3SEQA 1LPAB 4CG0A 4O08A 2A7XA 3I5MA 2D3WA 1N3IA 3PC8C 1J1IA 5D3MB 4G6ZA 4MI6A 5CU7A 1BEZA 1CS0B 1M8KA 1M34B 2YW2A 1G8YA 1TCUA 4MAMA 4XSHA 2O59A 5IBPA 2P30A 2W43A 4GZ6A 3PWSA 5H7XA 4GVLA 3TZEA 1EVJA 2FR0A 5ECWA 5BN4A 1NBME 3KOMA 4X71A 1XMSA 1IJBA 2FUG6 1UBRS 1QXSA 5C3MA 3R7WB 1R6XA 4A2CA 4L0DA 1N1EA 3ETCA 4HDRB 2D0DA 2I6TA 5DM1A 4F3RA 5DLYA 1KI4A 5GGYA 4BQEA 1G3UA 1AKRA 3E2PA 1TK3A 2RIRA 3P19A 1E9DA 5JD6A 4HH0A 3E2MA 3ZE7A 3MPUA 2GVDC 4X63A 1UJBA 2ORYA 4V0KA 5E0KB 3UUGA 3WRVA 3VZBA 3NIFB 1Q3KA 1UOQA 1N1DA 5CXXA 4Q4HA 4P4TA 3Q8MA 2O7NA 5TS3A 4ARCA 3KQQA 3T5PA 3IAFA 4KX3A 1Z82A 4C4SA 1PR1A 3DD5A 3JTEA 4H0CA 4JP3A 4MP8A 3VNSA 4RDCA 1V7PC 4ZT4A 4AZ3B 4UEQA 2EZUA 1GPNA 2YV1A 1C7ZA 4PYQA 4RHTA 3N8IA 4CQNA 3OMWA 1GLGA 2AT1A 1OB2A 1JH9A 3FYUC 4DVGA 3R9XB 2QMHA 2WWGA 3F98A 1XRNA 1K3FA 4RL4A 3NHFA 4UHEA 4XZ3A 2YRFA 3OFNA 4LRQA 3UJHA 7GPBA 1IU9A 1QIIA 3MS4A 4DY4A 4IDHA 4BO6A 4RTKA 3QVGA 1Z9BA 3E0QA 1U65A 2V7QA 2A0WA 2XUFA 2ZS8A 4RENA 2FFAA 4MUMA 3QKSA 2O8CB 3EGXB 1YZNA 2G3YA 2MSDB 3OOYA 3PSHA 4G5HA 3ROMA 4F4DA 1T9AA 1UM9B 1UBCA 2P9JA 1G5PA 1G5IA 3U3MA 4ZKEA 3FPEA 4WT7A 1JIKA 2OORA 3BH6A 3HP1A 3NRCA 4ZAXA 5LQJA 1P17A 1F60A 1KJYA 2FLVA 1QH8A 1JXMA 1Z22A 1U80A 2GN9A 5KX5F 3OZCA 4CMCA 1YUBA 1W4RA 1TEVA 1W88B 2WR8A 2CVZA 1N2CA 3P2JA 4N7RA 4E22A 5F7OA 3S29A 1BX0A 1ZOLA 3Q8WA 1E1QD 1CUAA 3PFKA 1V39A 3IVMA 2WMYA 4YIKA 1XYYA 3VYSB 1OV6A 5IDWA 2OFWA 3UK7A 4ER7A 4F3YA 3ZVMA 2VCYA 1C7FA 3FMGA 3GRPA 3WMEA 3L8MA 5KVCA 5TF4A 2GZAA 3WLMA 1MOPA 1S2GA 2FETA 2W6PA 2XUZA 4BMNA 5HUQA 1F4PA 2X4GA 3Q6IA 4CVNA 1FCJA 1YBVA 2P3QA 3K5PA 4JLDA 1WDWB 3ZWVA 5LA6F 3QRWA 3WGKA 2PBRA 4ZQGA 4HB3A 2VJDA 3OLCX 1X9IA 4UQPA 3QBDA 5K3CA 4AF8A 4DW8A 1INLA 4NDAA 3RTAA 5DB4A 3M3HA 3WB1A 1I6KA 2QX9A 5AI6A 4HDKA 3T9BA 2AFIB 4XH9B 5BMOA 1D1TA 2YHIA 4F3CA 1N25A 2GN1A 4UMFA 4L8VA 3F6SA 3NYRA 1Q0TA 5CPFA 2V7VA 3K5IA 5E4YA 3HY6A 4H77A 9GPBA 5GQSA 5D3ZA 4TRMA 1X1DA 1BQEA 2ZYGA 3DLIA 1E2FA 1GU0A 3DMHA 3GMTA 1KS2A 3R7DA 5HMMA 3WNQA 3GNLA 2XTZA 4MI9A 4DGQA 3KHSA 1QCCA 1QG6A 3C14C 3MTJA 5E8JA 4K9DA 4AKSA 4JV5B 3RBAA 3UTCA 4ZI3A 1H2EA 3A28A 1KVTA 5G0WA 3H2GA 3BICA 1HFKA 3W8FA 1FS6A 1GSOA 1GGHA 1NZFA 3BIOA 3OD5A 4Y6LA 5A06A 2HHHB 1AKWA 3WMXA 3OF3A 1GGNA 3W05A 5J4YA 5ULLA 4J43A 4AZ0A 1G8GA 4K3UA 2NQ8A 4MVJM 4ZKDA 3EC7A 3M6LA 4RBNA 2BEWA 3J7AC 2QMEA 4OXYA 4EO7A 5FEUA 3SU8A 1DKQA 1CUWA 1D2CA 1KETA 2XMPA 4PO3X 4RLQA 3PIDA 1OX5A 2EATA 4G5RA 4R1MA 5FTWA 4LOKA 1S96A 3D6TB 3C4VA 4LRYA 2B8EA 5K8LA 3DVLA 4F8JA 1KAGA 2OCXA 3CX3A 4RKQA 4H2DA 5EIEA 1KOFA 3R8FA 2Z6AA 1MDBA 2BELA 3WFIA 4QTYA 4NJMB 4JD5A 1OH8A 5I9NA 4UUNA 4TMVA 1EVLA 3ZBPA 2WI8A 1GNQA 1Z0SA 2KHZA 3TL3A 5IPFA 4UVGA 2WUWE 1YJAA 4Q7LA 3G17A 3T1NA 4H6XA 3EY9A 2JAQA 4HAUA 4KVAA 3OWXA 2PVCA 4N0EA 3UJ3X 2Q1XA 5A1TA 2GZMA 1IPHA 1I13A 2R7LA 1UJ4A 1ZW1A 3DG9A 3WRXC 1IBSA 4A3SA 6NULA 3CEHA 1D4OA 1FPMA 4H7FA 5D3QA 1GL9B 3F8WA 3RYIB 3EDRA 5FLKA 2AR7A 3GJ5A 1Z7YA 3H11A 3KCQA 2WUDA 3Q3VA 4FMCB 4UOEA 3THYA 4QL3A 1I2AA 1S4MA 3C41J 2BFCA 1QYWA 3BD7A 3FBWA 4J0HA 1UFRA 5KX5A 1Q1QA 5B2FA 4GVPA 3C3XA 5H16A 4DVJA 2DWCA 1ELOA 1O9GA 3HGTA 4MV8A 3KOXA 4UDXX 4QUJA 4BLUA 2O3JA 4P35A 1G55A 3O84A 2QENA 3O47A 3ORFA 2B2XA 3Q6MA 4AIIA 5AXCA 4IMPA