4Q1EA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 10 {2-{[(1r/s)-1-{2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol 4-yl}ethyl]sulfanyl}pyrimidine-4,6-diamine}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
231
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 231
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1eA00
4JIMA 1RPZA 1KMHB 4B73A 2FA9A 1A82A 2MMCA 5FBRB 3GLHA 1E9FA 2X77A 4JL6A 2Y8EA 4RVCA 4O25A 4KAXA 4KBFA 4QOSA 3CWQA 2J41A 4NYMR 4FXPA 1HT1E 3ECCA 3NH6A 4XVQA 2F7SA 3RWMB 1Z6AA 4DKXA 1S3SA 5EXSA 1M8PA 4POAA 4BFTA 3VR5A 2EYUA 4NYMQ 3WMEA 1VCIA 2J1LA 2ZTSA 4M8NE 4L9WA 1II0A 2VP4A 5DGXA 3KXIA 4I1VA 3SJAA 4HAYA 1IJEA 4Q1CA 4Y0VA 3EARA 2Q9AA 5TARA 3RYTC 5GJCA 1F2UB 1G8GA 1S3GA 4NHOA 1ZW6A 1GL7A 3GLGA 3U4QA 2OEPA 2WSSD 5CB6A 1N5JA 1ZUIA 1LS1A 4PPQA 3H4MA 1F60A 2FF7A 2GXQA 1IXRC 3K0AB 4ACAA 5AUQA 3LH5A 2P6UA 3GLFE 1TF2A 2W6JD 5JJKA 2O8BA 3U3OA 3SHFA 1LV7A 2FSIA 1IY2A 1GFIA 4AY2A 1Q1QA 5F2EA 3WP1B 4OHWA 3WBJA 2VSOA 3L8ZA 4LJ5A 4BE7B 1VDZA 1EFHA 3M4YA 2RH5A 4LHYA 3OEHD 2XOKA 4NCJA 1G18A 5HTKA 3Q7QA 4MRRA 3D7MA 3FGNA 4PFSA 3GJ5A 4ESHA 3QE0A 4QBHA 1BH2A 2K5UA 3A4LA 1KK1A 2XB2A 5FTMA 1KSHA 1W5SA 5H8WA 5HR5A 4TT3D 4F91B 3AVXA 2ZS8A 2F9LA 3T34A 2EQBA 4E03A 4IVRA 3CX8A 2FPKA 2W6JA 3GFPA 3KJEA 3FMOB 1J2JA 1WA5A 1QHXA 1EX7A 2ZJOA 4NL4H 1R8QA 4RY2A 3UMRA 1KI9A 1T6NA 2H8KA 2IYUA 1OFUX 4P4SB 4IOJA 1Z5ZA 2J0UB 4CEJB 3KKQA 4DT1B 3SNHA 3F0TA 3JVVA 4AI6A 3ZD6A 1T8TA 1M1YE 1XJQA 2GK6A 2WHXA 5FPHA 3DM9B 3NBFA 2VP9A 1X6VA 5C2JB 1RRCA 3A1TA 2VSXA 2WJHA 3GMTA 1DAIA 3SZRA 1HY3A 1WXQA 1UEJA 4NP6A 1EFTA 3A8TA 1O3YA 4W5WA 4EFLA 4ARZB 2HT1A 1U8AA 5B64A 1RRGA 2QROA 3MG9A 2X8AA 5CLQA 2RAPA 4GI7A 4IRUB 4OK5A 1TMKA 2XTNA 1SVIA 5DI3B 2QU8A 2ERYA 4FMCF 3NEYA 2J45A 1YHNA 3UWKA 1IQPA 2D2FA 2PBRA 3CO5A 1KK3A 3C16C 3X1DA 4R2HA 4JS0A 3FKSD 1ZP6A 5J4HA 2OXCA 2E1RA 3NWJA 3ICQB 1AS0A 4EDHA 2QTVB 3SYNA 4Q4JB 4KU4A 3KKMA 1T3HA 5BXQC 3GLIE 1S9DA 1RIFA 2OLJA 2ZS7A 4RCZA 1OB2A 1FZQA 1G17A 1DEKA 3T12A 2QM7A 2OV2A 3S1AA 4BECA 1QRAA 2IYTA 4TYPA 5SZJA 2VLIA 1ZU4A 1Q12A 4HLCA 4ERNA 4LYJA 3GLFA 3IEUA 1SXJC 4FI3C 3BFKA 3WHKA 1AM4D 3FKSA 3WYFA 1XMJA 1W36C 4EPRA 5KPDA 3AVTA 5TY0A 4IOLA 4LJAA 4LBVA 2O8DB 1JQLB 3QKSB 4P33A 2P6NA 2QSYA 2H1LA 4LJYA 5FUYA 4BFWA 3BB3A 3WNDA 3B1WA 4NMMA 2GESA 1EWRA 1W5TA 4LUCA 2H17A 1OIXA 2DY1A 4DLSA 2CLDX 5JBQA 2CJWA 4CT4B 4LYAA 2A7QA 3JZMA 2JJ2A 4HATA 1MO5A 1N5LA 1WRBA 3KJHA 4TYWA 3SJCA 2BBWA 2JEOA 4YMSA 3LXRA 1E1QD 3CPEA 3K09A 4BFYA 1PLKA 3L2OB 2BVNA 1XU4A 1GIAA 5CJ2A 2V1UA 1X1SA 1NG9A 5FUWA 2GBLA 3U3JA 1T8UA 3CNNA 2A5FA 3KKOA 4PPNA 4M9XA 2ZRIA 4LC1A 3AF4A 2EFDB 4AKEA 3U2QA 1MH1A 3U7FB 3PCRB 2ZUCA 3LAWA 1E0KA 1YRAA 2VHJA 1N6IA 521PA 1Z0AA 1MO6A 3DPUA 4HDCA 1G6HA 2W2TA 3NC1C 3CRRA 1SULA 4XVRA 4FCTA 4A92A 2JLXA 4Z54A 3THYA 1ZNZA 4PXAA 2KBEA 1GRNA 3LBIA 3OFNA 1G7SA 3FMFA 1BYIA 2BM1A 2PX0A 2CMKA 3FKQA 4TMTA 4JJKA 3G0HA 1VECA 4ZCIA 1JXMA 1CF4A 4Q1AA 3W5IA 1E1RA 1NBME 4IFBA 1SKQA 1NKSA 4EPTA 5J4YA 4NBSA 1Z6TA 1EFRD 2GCPA 3HU3A 1CJMA 3IIMA 4EFNA 4TYYA 4M1KA 1T0JB 4IDQA 4UJ3A 4TL7A 2W00A 1UFQA 1OFTA 3QPUA 4Q4AA 1XXHA 3QG1A 4URVR 1V43A 3AB3A 5KSZA 5ANRB 1LF0A 3MWLA 3IO3A 1DBSA 4I1OA 3GLIA 1E0AA 2V7QA 1SQ5A 1QHNA 1YZGA 2QGNA 4LX0A 4WIAA 4B34A 1U9IA 4V02A 1UEIA 3DOEA 2WKPA 1RZ3A 5J4LA 4FINA 1KSGA 1MT0A 3CF2A 1F2UA 1A2KC 4A82A 4F4JA 2O8FA 3AKYA 1IN4A 4GZMA 2ZM5A 1W44A 2Q3MA 4D81A 3U5ZB 2GETA 3PEYA 1OIVA 2PLFA 3GJ8A 3RC8A 2GEVA 3HDTA 5J40A 1FMLA 2FEOA 4C2UA 3KJGA 1SKYB 3Q7PA 2C9CA 1XTJA 4XTRA 2FSGA 2R6DA 1LS6A 2QL6A 5FOWA 1JAHA 2P65A 3K0AA 3MCAA 4XIGS 5D3MA 5EQTA 2WPDA 4HSEA 4NE2A 3I3SR 1OYWA 2PT7A 5JMTA 1YE8A 1YZKA 1HH4A 3ZIAD 3R9XA 5FTKA 1AGRA 3SJZA 5AUOB 3AKCA 1FX0A 4D2IA 5C1BA 2HEIA 1GZSA 1E9CA 2ZRHA 1ZCBA 1IY1A 3AVQA 5SZKB 4QJ4A 3KB2A 3G82C 5EE3A 1FQKA 4A6XA 1PZNA 1KI8A 4BUJA 1DAGA 2D4HA 1FW6A 1XPRA 4HB4A 4D25A 3PUVA 3QF4A 1E2GA 2PZGA 3C14C 3BIFA 3BBPA 1TQ2A 4IOMA 3C7KA 3GJ4A 1G41A 1L7VC 3MFYA 1EWQA 3B6EA 3ZVNA 4LV6A 3ZIAA 4DXAA 3CZQA 4EKDA 3AUYA 4EAQA 4PC1A 2HXYA 1KNXA 1MABA 1PUIA 3PQCA 2CCGA 4BFUA 2WJYA 1WBBA 3ADBA 1Q3HA 5E3HA 3NDPA 4UNQA 3P27A 4OYHA 2IL1A 4TZ0A 2ZUDA 3U6BA 2QMHA 1DADA 2WV9A 3EZ6A 3DKPA 3SC3A 5AJZA 4DCUA 1WBDA 3IUYA 4B3CA 1NIPA 3EPLA 3W6PA 3P20A 121PA 1U2RA 2D06A 1NBMA 5JJLA 3ASYA 2JLQA 4P3YA 2WJGA 3LVQE 1IXSB 4V0NA 4XD7D 4OHYA 2REBA 2BC9A 1SXJB 2D2EA 1B0UA 4OJQA 1KZGB 1NG1A 1W36B 1B23P 5L3SA 3THWB 4DSTA 2BJWA 3FTQA 1QF9A 2GJSA 1ELOA 3B85A 1TU3A 3AP3A 2XXAA 3REFA 1E4VA 1FMJA 1P6XA 4C4PA 1Z08A 1XZPA 1YZTA 1Z0KA 2VYFA 3OAAA 5EZ5A 3GJXC 4RD4A 4F4IA 4TLDA 5FH9A 1NVXQ 3V4FA 5JEEA 1W2GA 4UQOA 3F8TA 3N2EA 1P73A 1K5DA 4IDHA 1W48A 2XX3A 1YRBA 4LYHA 4LY6A 1KO4A 3QENA 1GUAA 1II8B 2XSZA 2ZIAA 1FQJA 2VP2A 1T5IA 2W6ID 2HJVA 1E9SA 4DUGA 1P7CA 2ZITA 2O8EA 1G8YA 1N6OA 2QBYA 1P2VA 3BH0A 4M21A 4PHTA 4HB0A 1XPUA 4KSCA 4M1WA 3KDSE 2ZAOA 1DAFA 5FI1B 3I61A 1Q20A 2F1HA 4KVAA 2P3SA 5DSZA 4RCYA 1AA9A 4IOKA 1OF1A 3TAUA 2RGBA 3DMNA 1IBRA 4CVNA 2VH5R 4S2EA 4HUQA 4BZPA 1UM8A 5JZVA 1ONBA 1LNZA 1KJYA 3G5UA 4XSGA 2R6CA 2ZAMA 3IQWA 4ZPXA 5G3YA 5FPKA 1YKSA 3LQRA 3Q5EA 1PLJA 1G7TA 1XDBA 1WF3A 1FTSA 2XZLA 2OBNA 3F5FA 3I5YA 4K8OA 4KVGA 3U60B 3U7EB 2GILA 1FP7A 2NO1A 1G3RA 3AVVA 5LB4A 1T0HB 1OE0A 1HTWA 4FMDB 4CF7A 1XTKA 4ZCLA 6Q21A 1GKIA 3EC2A 4Q7LA 1G19A 4PR0A 2JLVA 5TVKA 4HZIA 4DLTA 2GJ9A 2ZANA 2IUSA 4HAZA 2XNDD 1JAIA 3DHWC 4GZLA 1P75A 2EU8A 2ZYUX 4OK6A 4C7OB 3FOZA 3RS5A 1SVOA 3N5CA 1OW3B 3BORA 2VA8A 4B2PA 4OI4A 2RGNA 2HT6A 2BM0A 2Q9BA 5CK4A 4D82A 3Q85A 1NP6A 4XVUA 4TZ6A 4OL0A 4ILEA 4ZDJA 3RNLA 3IBGA 1TAGA 3WHLA 3TBKA 2A3RA 5JI3E 2ERXA 2ZSBA 1U0JA 1US8B 2WOOA 1NY5A 3NVAA 2JJ1D 1E2PA 4DLVA 4E09A 4PO8A 4LBZA 3PUXA 3VKGA 1G20E 5DIFA 2IYLD 2QN6A 2ZRAA 1AQYA 5C4GB 1UADA 3U44A 1RC8A 3D6TB 1GKUB 1N5KA 4EPXA 5HZKA 1C9KA 1G6OA 1I2MA 1T5LA 5FFMA 3VQTA 5AUPB 5HE8A 2H16A 4BLOA 4QBGB 5KUTA 3I32A 3K1JA 1G21E 4AKGA 2KWIA 3LY5A 4B3XA 1VCOA 4LRWA 3C41J 4YLGA 3RVBA 3WNBA 2R65A 2WVJA 4CEIA 3K70C 3TVDA 2PCLA 3D3QA 2UKDA 4URUR 4XH9B 1Q22A 1U99A 1VMAA 2QORA 721PA 3DMDA 4P31A 1JJVA 4Q19A 3WYAA 4A8JC 1JNYA 1AKYA 1NMYA 2AKYA 3IPYA 4JLPA 4YC7A 2O0HA 2XB4A 1W4RA 4PTLA 2W58A 3B2EA 4LHXA 1LF5A 1JPNA 1RFLA 4UXJA 3VHLB 3ZDQA 1AKEA 2QQEA 4M1YA 3GJ6A 2G83A 2CL0X 4OQMA 4ZKEA 1ZU5A 3ETLA 5GVRA 1MKYA 4N0DA 2CVHA 4EJSA 3A37A 3EAQA 2A5YB 3QKRA 4IVPA 4PQRA 3AP2A 4A0GA 2G77B 4OHXA 2CCKA 2IHYA 3OIWA 4QGGA 5KNBA 1XEXB 2BJVA 4B6FA 3RABA 4O2LA 5JSZB 4V0LA 2JDIA 2WSMA 2C04A 2BBTA 5IK2D 2RCNA 2PMDA 1JR3E 221PA 4JVSB 1OH5A 1I4DD 2Q21A 2AXPA 2F43A 4PSKA 3SFVA 3UKDA 2HJGA 2ANBA 5DN6A 3QXHA 4RSGA 1H8HA 1KJZA 5HPYB 4A15A 1ZM7A 2FH5B 4DSNA 2O0JA 2N46A 2X1VA 3R7WB 1FL9A 1CBUA 1E79D 1E99A 2NO7A 4MH0R 2AFIE 4TLCA 1UBGA 3CIOA 2ZJYA 1T3LA 4DRZA 1OB5A 2VBCA 2WWXA 4BEBA 5J4KA 3THXB 4CEHA 4HAXA 1GNQA 2IYSA 3SR0A 4II7A 5ELXA 3K0SA 2HDNB 4MYHA 4MYCA 2F1JA 4JSYA 3GEHA 3OEEA 3EZFA 4PC3A 3BFXA 1F3OA 1LFDB 1QDEA 3TQFA 1E98A 1G4AE 4LI0A 1GRRA 1Z2CA 4WA7A 4DZZA 3X1YA 2GCNA 1ZVQA 2P6RA 3IGFA 4JLMA 2JLSA 2YZ2A 1MV5A 1ZIOA 4NU0A 1T91A 4C0AC 1E79A 3WYGA 3SYKA 4BFXA 4MRVA 4ZDIA 3Q3JB 4FCWA 3NKVA 4C0KA 1OHHD 3HWSA 1YR9A 3PJRA 3R20A 1NY6A 1XMVA 3C5HA 4JVMA 1KY3A 4NKRA 2X2FA 3VKHA 4C0LA 2F9MA 4KI0A 1OXXK 2JIZD 1KDTA 1MO4A 3AEZA 1VG8A 2IWRA 1SVKA 3AUXA 4NYJR 3DOFA 1X8KA 1Q1EA 1VG1A 4PHGA 4FMDF 4W5JA 4JBXA 4JVLA 2VTKA 1G64A 4V0MA 4NYJQ 4ON9A 3X1WA 2FDCA 2MSCB 3M1IA 5FOSA 1NKTA 2R6GA 4EPWA 3VU9A 4MDEA 4M1SA 4QM6A 3AF1A 1X3SA 3QKUA 4MKFA 1KAOA 4KLNA 1CS4C 3MUFA 4AURA 3QSYA 1KIMA 1M2OB 3ADKA 5FL3A 1DO2A 2EW1A 3QOFA 3K0FB 1W4AA 1XCGB 1N3BA 4JSTA 2ECKA 3IILA 1NVVR 3CLVA 2NZJA 1LW7A 3R9IA 2GNOA 4Q66C 4R2IA 2JLYA 1YJ5A 2ZJ5A 2GK7A 4JL5A 4JYCA 2ZVPX 3EA5A 3A58B 4V03A 2WTUA 1NVVQ 3KKNA 3LD9A 1X86B 1XCMA 4M53A 1KZ7B 1N0WA 3RS7A 2W0MA 2XNSA 3AF2A 2RGGA 2OSBA 3CONA 1JR3A 2ONKA 1HUQA 1RVDA 5FBWB 2J9RA 1NMXA 4HB3A 3A4NA 2AL7A 1GSIA 2QE7A 1N6PA 1TPZA 1ZRHA 5A5GA 5L3VA 2ZXUA 3KTAB 2AR7A 3AF0A 2OO7A 2PJRA 2WZQA 5A4JA 2QUZA 4Y0AA 3BE4A 4DLWA 4NCIA 1PVOA 4MUBA 2GCOA 3QBVA 4HDQB 1NRJB 1CJUC 2HF9A 1FNMA 4AYTA 1CLUA 3WMFA 1RJ9B 2PH1A 1W47A 4Q48A 2GA8A 1KI2A 2XOKD 1RYHA 4A4DA 3O8RA 4MGZR 4LJ4A 4RFVA 3A1VA 3B82A 2KB0A 2YOFA 3BFVA 3IEVA 3CRMA 2F6RA 3PITA 4WOPA 4P4UA 2RGNC 3K70B 5CITA 4JLBA 2IXFA 4WZAE 3FE2A 3FVQA 3LLMA 3MLEA 4X8LA 2ZRPA 1KSJA 5B30A 4IDNA 2YWHA 3EA0A 4FN5A 4U00A 3NHBA 1W0KD 2IC5A 5DYIA 2VIIA 4AK9A 4TMZA 1DAEA 1P2TA 3UK6A 1XD2B 1ZAKA 2IEYA 2V6IA 2OT3B 3AKEA 4QNMA 1UPTA 1SVLA 3GD7A 5HE9A 4RFSA 4IXMA 4X8OA 1QVAA 2Z43A 2QMUA 3RRZA 2DWOA 1XTQA 1VYTA 3H1TA 2D74A 4CDGA 4JLAA 4JLKA 1P2SA 2GXAA 3H0KA 5C18A 1WMSA 3L0OA 1KI3A 2C2HA 1L2TA 2QQ0A 2ZRGA 1UKEA 3LWNA 3VMFA 3ONWA 1AQUA 1GITA 3BERA 2KI5A 2MSDB 3SE0A 5BWMA 2ZREA 3K9HA 1P9WA 4ZIRA 1W0KA 2JLUA 3ICEA 2VHQA 4IW3B 4Q1FA 2IW3A 2QMEA 5KHOC 2BOVA 4IDPA 4DB2A 2QT1A 4AD8A 3KFVA 2YWFA 3WMGA 1HYQA 1MRNA 1R7RA 2QAGC 4BZQA 1QHSA 2ZVQX 4BGDA 4PC2A 1EX6A 3REGA 2CBZA 3TGPA 1QG2A 4JVNA 1YQTA 1SGWA 3CR8A 4LV8B 4E22A 1P9NA 1M34E 3TIFA 1G9XA 4BASA 4D4MA 4LBYA 2ZJ2A 4MGIR 3QVVA 4LYFA 2AN9A 1A5TA 1SVSA 2ODNA 1IY0A 3QBTA 5DNYB 2EYQA 1R5NA 3ZS9A 1XTRA 4G5GA 3TE6A 3TW4A 3OE7A 1V5WA 1X1RA 2ZE8A 1IONA 1C4OA 1S1CA 2ZE5A 2GF9A 3CX6A 1KYIA 1K5GA 3GQBA 1EFCA 4YXWD 4RKFA 1CR2A 4EPVA 3MD0A 4FWTA 3MAAC 1GWNA 4Z8YA 5EXXA 4OQXA 3TLXA 4B2IA 1AZTA 2IYWA 3TVTA 3VR2A 1P3JA 2YC4C 1NN1A 3PUYA 2SHKA 1ZBDA 2JJ2D 2WWWA 3PR1A 3WP0A 3FHTA 3BJIC 3AV0B 1OXTA 3AVPA 4WXRA 1OJLA 3BXZA 4GNKA 4YMVA 5F9HA 3K9GA 1GM5A 2IUTA 5CK5A 3MWYW 3EW9A 5KNDA 1NI3A 5GADl 1FPMA 3UPUA 5KO2A 4YXWA 2PZFA 4LBWA 4O0MA 4PO9A 4HAUA 3L82B 2QA5A 4A36A 5EUMA 4RD3A 3DL0A 3QIAA 2MMGA 4B6EA 2AXNA 3A4MA 1DG3A 3KL4A 3K0CA 1W49A 2NTYC 3U3KA 5TDHA 4MGYR 1S96A 4QGAA 4GPTA 1KI6A 1QZXA 2CL7X 2JA1A 3MMPA 2ZI4A 2V1XA 4HUTA 1R10A 1QVRA 5JWOA 1ZM9A 2VHTA 5CYPA 4Q4HA 4OHVA 2IBMA 2DFKB 4QHYA 2NG1A 4Q02A 3OFND 2B6HA 4QJ3A 3Q8XB 4EQ6B 4U7DA 1P62B 2ZSFA 1QHHA 4WVFA 3AH8A 1E9RA 4LWZA 3C8UA 2VHUA 1E1RD 1I4TD 1XD9A 4RZXA 4N1AA 2FZ4A 3OIVA 4TMWA 4LHWA 5E95A 2OBLA 3K9LA 4RZ3A 3THOA 4HZUB 3KFXA 2FNAA 4UXIA 3BAFA 2BBSA 2C9OA 1RRFA 4TQ9A 4DIEA 2NQ2C 2E87A 4Z51A 5BN3A 4I1UA 1HURA 3CRVA 4D4LA 3VNVA 1UBEA 4QG7A 2NPFA 1ZC3A 3KQNA 4DDUA 2V7QD 4IFEA 1LVGA 4Q01A 3K0FA 4LC0A 2F55A 4TMVA 3PEUA 4GDFA 4GMXA 4BLPA 2QPTA 1KK2A 2QRZA 3NXSA 4JLDA 4E07A 3AQ4A 3LW7A 4FW9A 1KMHA 4DDWA 3ZLJA 4D4JA 1HE8B 5KYKA 2EFGA 2XTMA 1KAGA 2JLWA 3U61B 4IDOA 1RYFA 3SOPA 2QTFA 2JLZA 3ZD7A 1JB1A 5A0FA 3DVLA 3LRPA 1IJFA 3MWKA 2GAOA 4GBMA 3NTUA 4MRNA 1KO1A 2WPDD 5FI0B 4OJKA 5E7IA 3TUJC 1D8TA 1TUEA 2CE7A 3KTAA 1XTSA 2OAP1 3EASA 1UAAA 4A2WA 2VO1A 1KMQA 3ZYCA 2BKEA 5HZHA 2IHBA 4ZV4A 1LB1B 4TSFA 3ZVMA 2VL7A 4OQFA 1O87A 1NN0A 1G3MA 1XX6A 4PX9A 5JRJA 3TUIC 4PANA 5DE3A 4KHZA 2V3CC 3SS8A 3NC0C 3SFZA 1X8LA 2XEXA 4L5BA 1ETUA 3LW8A 3BS4A 1E2LA 2OFXA 1S2MA 2IX3A 2WJJA 2X2EA 2KBFA 1VYVA 1Z0FA 3NIBA 2HXSA 3NBZC 4B3BA 2FPMA 2OG2A 1ZM3A 2RGAA 2ZJZA 1D5CA 2ASEA 3B5JA 3GCGA 4HYYA 4N0EA 5FBQB 1KI4A 2QAGB 3EX7C 4PO1A 4JLNA 3VTKA 2L0XA 1TX4B 4P0TA 5LBIA 4M9SA 1J7KA 2FEMA 2QSZA 5FR1A 1RRPA 4KV9A 5CLLA 4CRWB 3OZXA 5CIWA 1AIPA 5TB5A 3NH9A 2ZRNA 2RMKA 5HKKD 4D0NA 2B92A 2C98A 2PL3A 4A2QA 2WAXA 2Z5FA 4QNRA 3ZVRA 2ZR9A 1E94E 1ZD8A 621PA 4TQUS 2PT5A 3PVSA 3QEOA 2F3TA 1D6JA 3H84A 1NBMD 3HR8A 3T1OA 1K8RA 1IN8A 5GVSA 1WQ1R 1CR1A 2GTPA 3I1FA 5FUVA 4M4SA 4Q9LA 4A0HA 3RSOA 1F2TB 3RAPR 3MJHA 1E0JA 2VQSA 1N6LA 1XF9A 2CLSA 3CX7A 1GKYA 1U94A 4Q18A 3W3AA 3QQ5A 2Q3HA 4FCVA 3ADCA 1E2NA 3DM5A 4P4SA 1RE0A 4DIDA 4CEJA 2J0UA 4DT1A 4WZBE 1JEEA 5HKKA 4AKHA 2QT0A 3OAAD 5JEDA 4TN1A 3HR7A 5L3RA 4HEJA 2WWHA 5TMPA 4ABYA 2Q9CA 1XCPA 2ORWA 4B76A 2FOLA 4OI2A 4B3GA 2I4IA 2OM2A 4L8GA 4UNSA 1WDTA 1W0JA 2ZR0A 1H65A 2XSZD 1BIFA 1GP2A 3VR6A 4ARZA 2GJAA 4PC6A 1E2KA 4WAUA 4LPSA 4G5OA 4L4UA 4DUGD 4TTQA 5AJXA 2GZDA 2GZHA 3LO5A 2G88A 2AWOA 3W5JA 5DI3A 4L16A 1UKYA 2JCSA 2XITA 4IVQA 1P72A 4EPYA 5K8UA 2IF2A 1HEIA 4U5XA 2RGCA 2CDNA 2LCFA 4Q9IA 2V55B 4XSHA 3AVUA 1KK0A 2OZEA 1FUUA 4KLZA 3ZVLA 4X8MA 4F92B 4GOXA 2C96A 3IIJA 1DE0A 2F1IA 4GSYA 5K8TA 4Q4JA 1XBTA 1IN6A 3UG6A 4QM7A 3SU8A 1ZD1A 4MUAA 3OHMA 5JCZA 3ND9A 2O8CB 4DLUA 1TQDA 2J7PA 4N3NA 2H57A 4HLUA 3WXMA 4XOIA 2FG5A 2FMXA 3BH7A 5JRZA 1IOZA 3RRMA 3T5DA 1OPXA 2W2VA 3OIUA 5BQ5A 4QC2A 3AVOA 2PEZA 5LB2A 3PEWA 1W4BA 3CR7A 4O2RA 1Q0UA 4O3MA 2FFQA 1SKYE 4IHQA 5JFGA 3P4XA 2EFHB 2O8DA 3QKSA 4HAWA 2DR3A 5CYOA 4DEYA 4TTPA 3LFUA 3MGCA 3DZ8A 1BKDR 2I1QA 1ZM4A 2PZEA 2O52A 3HU2A 3WNCA 4B43A 1IHUA 5IDVA 4Q1DA 2J0SA 3TQCA 3CF6R 3KZ1E 3WRYC 1D2MA 3KUDA 2NO6A 5L3QB 2IXGA 3GLHB 3QY0A 2G6BA 2FV8A 3K09C 2JASA 2VP5A 4NH0A 2DBYA 4MRPA 3L43A 4D4KA 3QNUA 4EQ6A 3QKTA 1OH6A 2GBLC 4KXFB 3ZZUA 3MRSA 4A0FA 1NVWQ 4JZKA 1COWA 2YC2C 4AC9A 1KKLA 1N6HA 2IK8A 3K9NA 1XEWY 2P0EA 2GEUA 1KOFA 5KSYA 3IIKA 4H1VA 3E5HA 1U8YA 5LPNA 5DO9A 3SQXA 4QGFA 2A2ZA 5FR2A 1W4CA 4PAQA 3EC1A 1F5NA 3QVUA 4KFRA 2FFHA 2J87A 3KX2A 3GLGB 3U4QB 2C03A 3NDBB 4BLRA 5DH9A 1CU1A 4QRHA 5H70A 2V6JA 1CR0A 1JEDA 2AD1A 2B7CA 3PIRA 3RRNA 3RWOA 4R9UC 1VTKA 2DCUA 3ZQJA 4HDOB 2YNMA 4KBGA 4C0HA 2IYQA 1E32A 4JT4A 4LZZA 3WY9A 4L9SA 3T15A 2Q6TA 1DARA 5AR1A 1SXJE 2QP4A 2XTZA 1ZC4A 2O8BB 1H8EA 4XWAA 4FIDA 4Q21A 4DLYA 4PZLA 4QBFA 4PPFA 1N6RA 3U3RA 5J5CA 1NN3A 5FBLB 1U9IC 2AHOA 2BEKA 2HLDD 5EE0A 2ZI6A 1WE2A 4ACBA 3QPWA 2GF0A 2QENA 1ZM2A 3AF3A 4B3FX 2JDID 3PG5A 2G3YA 2OFOA 4Z1MA 1DG1G 2ZRJA 1KGDA 4ZI3A 2J0QA 2B8TA 2EWWA 2VRWA 1GNRA 1Z3IX 4Q5IA 3LVRE 3PEVA 4UNPA 2ZI9A 2GXUA 4G5SA 4NCKA 3X1ZA 5H68A 1H8HD 1PJRA 2W0SA 2D62A 2ZUBA 4GT1A 3VHXA 4YQFA 5G41A 5KSOA 3Q72A 2JLRA 2XZOA 4URWR 4ZDWA 3KQLA 1FUKA 1P4SA 2OBMA 5FPYA 1E6CA 5AJWA 2HLDA 5DLQC 4TL9A 5FUXA 3LQQA 4OQNA 4EUNA 3HYTA 1P61B 1J90A 5FTLA 5IF9A 4B44A 1CRQA 2QAJA 2ZPTX 2ZJ8A 3FMPB 1BS1A 3W6OA 2WM9B 2DFTA 3OEED 1UJ2A 4XTCS 2WWGA 1E2EA 3LBNA 3AVYA 4M1TA 4DCVA 3O8CA 3V00A 1D9ZA 2ZE7A 2YKGA 1ESMA 3C4JA 2RGDA 5LDDC 3TSWA 2YWGA 1UDXA 2QNRA 2NGRA 4BLQA 1ODFA 3CRQA 4Q47A 1VYUA 3GLHE 1KO7A 1ZD9A 2HCJB 1FP6A 1CTQA 1J8MF 3OIYA 3RS0A 1LY1A 3RC3A 4DC9A 1J99A 1VHLA 2YVUA 2ZRFA 3B9QA 4BWYA 4OQLA 5LD2C 1YR8A 1W36D 1IM2A 5G40A 5G53C 2F3RA 3X2SA 3W3ZB 1TTTA 2G1JA 1N6NA 2D7DA 3SDZA 3S1AB 5KTYA 4ITRC 4JKIA 4M22A 3CZPA 2CVFA 4C0QC 4EFMA 5B2ZA 2X19A 4AG6A 4UNNA 1K6MA 1KKMA 2AX4A 4DCTA 2XZPA 3HYRA 3LDAA 2HCBA 2DFNA 2LKCA 3P26A 5EE5B 1KNQA 1U90A 1YR7A 3GLFB 3QPVA 3VX4A 4BLSA 5BYKA 2IS1A 1SXJA 3GFOA 3RS3A 2B21A 3BGWA 5JS7A 2CXXA 3QXCA 5FOXA 4ESVA 4Q7JB 4C0BA 5GJVC 3THWA 1JI0A 3KXKA 2FPLA 2YOHA 1G8PA 3TUZC 4PSAA 3JZAA 2QPAA 4HAVA 4MA4A 1OH8A 4LV5B 3A1UA 3LA6A 4LK2A 2CNWD 4AYWA 3DDCA 4HB2A 4FMCB 3PXGA 2CJWB 3I92A 3T1QA 3R8FA 2R2AA 1CR4A 2C77A 2GWHA 2I1VB 4I99A 2WAYA 4ZDKA 1XD8A 2QPOA 1Z28A 3UWOA 3GJ3A 1EG7A 1JR3D 1CIPA 1R8SA 2O8CA 1Z07A 2OXRA 1II8A 4R98A 3SQWA 1N2CE 4C30A 1DS6A 4R7ZA 3T61A 4B3DA 2QE7D 1W7AA 2GJKA 2WWYA 4Q7KA 2BKUA 3O8DA 3B13B 2QMOA 3CH4B 2QRNA 1AGPA 2AK3A 1DTSA 4Q9JA 2P5TB 1DVRA 1ZYUA 3BC1A 4LHZA 4W7SA 2IS6A 2ANCA 1WP9A 2CNWA 4UJ5A 1R5BA 2HYDA 1GRQA 3L8YA 4US0R 4Z8XA 2BIFA 4LCBA 4FMBB 2EFEB 1GDDA 3V4RA 2OCYC 3SHWA 2BV3A 3GEEA 2EWVA 2IEZA 5JLJA 2PJZA 5D3QA 4TWZA 3RDPA 4I4LA 2A30A 2UZ3A 4DDTA 2R6AA 1BMFD 3R8CA 1G5RA 1X8JA 3TK1A 4C9BA 3IHLA 1R0ZA 5CJPA 4KITB 3LXXA 3TSZA 4DVGA 1AJEA 1MR3F 4DSOA 1A7JA 3PFIA 3NHAA 1L8QA 1R0XA 2XGJA 1TNDA 1E2DA 4AIIA 4A9AA 2YV5A 1CJVC 3CH5A 4XWOA 1UDWA 2JGNA 3UIEA 5L3QA 1W46A 3W9YA 1T3SA 1G3QA 1M7HA 5KPJA 1OH7A 1II9A 4Q4LA 2FZLA 4GL2A 1NVUQ 2R62A 4Q4AB 1TADA 1XXHB 2ZYWX 4TYNA 1MO3A 3B8HA 5FOTA 1U8ZA 3GLIB 2FSHA 4C7OA 1ZJ6A 2CHQA 1BMFA 5IHPA 2B8WA 2QY9A 5F9FA 3ZJYA 4KSBA 1ZNYA 1VKJA 3PUZA 4A8JB 2O8FB 4C0JA 3ZQ6A 1XB2A 4GFDA 2ONJA 2J46A 1Z6GA 4L15A 2KJQA 5AWFC 5C4MA 4C2TA 1TQ6A 1US8A 5IRCD 3T35A 1VIYA 4LOAA 3ND8A 1YZQA 4CT5A 1LTQA 2CEAA 3M6AA 1DO0A 2Z4SA 4DDVA 4TL8A 2I3BA 1S8FA 5CM9C 5D3MB 1G291 1SHZA 2W2XA 2ZEJA 4YDSA 4G1UC 4BFZA 4M9ZA 1GL9B 2GJ8A 1CJTC 5CM8B 1NMZA 3QF7A 5DI9A 4CW7A 4JKYA 2CCJA 2FSFA 3QI2A 1OXUA 1FX0B 3PUWA 2J5XA 5L8VA 3LV8A 1T9HA 2ZU0C 2WSSA 4K46A 4US1R 1NSTA 4F38A 3F3YA 3CB4A 3P1JA 3CNOA 1GTVA 3K53A 4LHVA 3W34A 1G16A 2J59A 4A6PA 4ZKDA 4G5QA 1ZIPA 2IYVA 3OE7D 5DHAA 3J81k 2H92A 4ZO4A 1OFHA 3BB1A 3HPQA 2HUPA 3AM1A 1E9EA 4GMDA 4XWKA 4WW0A 4AYXA 3ZZ0A 3O8BA 2R44A 1ZINA 3QF4B 4OHZA 5KDOA 3B60A 4G0NA 1C1YA 5FBVB 1N0UA 3SYLA 1F6BA 4RKEA 3H2YA 4EIWA 1FTNA 2AK2A 4JL8A 2V8OA 1MABB 2XJ4A 5LD2B 3A1WA 2WJIA 3LLUA 4QXAA 3SBEA 4EJSC 5AK0A 1Q1BA 3A1SA 4WBSA 2IF0A 3OEHA 4URYR 4OI0A 4JYBA 4GOKA 3RSLA 2VP6A 1XRJA 2OHFA 4PAMA 5DISB 1XEXA 3QXJA 2A5DA 5AJYA 2QG6A 4M2LA 2Q0HA 3EZ2A 1E2MA 4M1MA 4RD0A 1M6NA 2WWFA 5JSZA 2WIBA 1M7BA 1Z47A 3D31A 1OV4A 2C9YA 2OLKA 2ZRMA 4TT3A 4KFTA 1JECA 2IYXA 2GZAA 2NPIA 1SZPA 5BN4A 3BRWD 2ZRKA 3UXMA 2GVDC 1HQCA 4LDJA 1YZUA 4V0OA 4MKHA 2VEDA 4C0SA 4YMTA 1G4UR 1Z0DA 2WJVA 3KUCA 1E9BA 1RKBA 1Z2AA 4W5HA 3SN6A 3R9WA 2BBOA 3KQKA 4MDFA 5L3SB 2QEQA 1YVDA 4U02A 3R7WA 4B32A 2XXAB 2FU5C 4ASUD 4FD2A 4P32A 5KSPA 1UKVY 3Q9LA 3DEFA 2J7KA 4I1SA 1Z22A 2ZU6A 3VR4A 1EK0A 3W8RA 3X1XA 1U0LA 3D8BA 1J70A 1DOAA 5AJVB 1FOEB 3SBDA 1Z83A 3THXA 1XXHE 1Q44A 2VP0A 4R71A 3TKLA 5EP4A 4PPGA 3U3MA 1TEXA 1VG9B 2YYZA 3RS4A 1HE1C 3N2IA 2OCBA 2IYRA 1PUJA 1Z0IA 2EVWX 3VX3A 3SEAA 1WB9A 2O8EB 1VCMA 2GHIA 2ZQ5A 2QP9X 4TL6A 4Q9HA 5J47A 2QBYB 2QTHA 3CRW1 2ZYVX 4G01B 4ASUA 1ZUHA 4LJ9A 1ANKA 3EXAA 2P67A 2V9PA 3Q5DA 1FNNA 2FFAA 1EGAA 2XAUA 1OKKD 4BFSA 4JMPA 4JLJA 3P4YA 2Z6VA 4HUQB 1Y63A 2RHMA 4TLBA 2FJUA 1Q21A 4X8HA 3IKJA 3ZH9B 3LNCA 4LJ7A 2YINC 1G8FA 2GKSA 2C95A 3NEJA 2GAAA 4RD2A 1DAMA 1I4LD 1BOFA 1Q57A 4MQBA 4K81B 1E0SA 1EFUA 4IEIA 3L0SA 1G5PA 2BCGY 1DAKA 4NYIR 2REXB 4WXPA 4B71A 1PV4A 4B74A 1R0WA 3QXXA 3KKPA 4JLVA 1E96A 1SVWA 1OKKA 2CK3D 1OFIA 2Q3FA 3BK7A 1Z29A 3RANA 3VKWA 2ZETA 4NYIQ 1NNEA 2AD5A 3N70A 5DHFA 5FTJA 3EPJA 3W90A 4B75A 4LJ8A 1MRSA 3FHCB 2NMVA 2ZI5A 3ZZTA 2IA5A 2ZSDA 3QXSA 1OSNA 2RB4A 4M0LA 4TSFD 2R9VA 5FTNA 2H18A 2OILA 2OCPA 1OIWA 2E9SA 4UXHA 1JJ7A 1Z6XA 3TW8B 3GEIA 1DPFA 1TF7A 1OXSC 4JBYA 4JLOA 5EJEA 3K70D 1E1QA 2V54A 1EESA 1KI7A 1S0UA 2CK3A 2Z83A 3B1VA 4MRSA 2UZIR 1HA3A 1IN7A 1G3UA 2FFBA 3ASZA 4DLXA 3U44B 1Z6YA 4D6PA 2ZI7A 3ZGXA 4BLTA 4LPKA 5KOYA 4D0GA 1NJFA 2LKDA 1Y3AA 2CLCX 2C5LA 1R2QA 3NBYC 5B58C 1ZUNB 1RJ9A 1XEWX 4BRUA 4MGKR 4DWJA 2NZ8A 4PZZA 1HT2E 3AKDA 1FFHA 2BMDA 3QUSA 1CRPA 1XP8A 4I81A 4CEIB 1U81A 1S9HA 4LJ6A 1DAHA 1XMSA 1TU4A 3FDIA 4URXR 2FN4A 5CDFE 3TAHA 5DYGA 2VF7A 4GP7A 2DHRA 4KFUA 2RKOA 2FE4A 1Z0JA 3CNLA 3AP1A 3E1SA 4A8JA 4DCSA 3ADDA 1DELA 5HCNA 2IXEA 4JJZA 3GP8A 4E5UA 1EFRA 1CJKC 1GILA 1CXZA 1Q1ZA 3EZ7A 3TNFA 3V9PA 1G8HA 1AZSC 2O5VA 2WOJA 1VG0B 4RZUA 1XD2A 1BO6A 4IJMA 5F98A 4DCNA 3KQHA 4B2LA 1G7CA 2GVZC 421PA 2HV8A 3I4LA 4PQYA 1A2BA 3E70C 2HF8A 4JT2A 1GOTA 2IS2A 2WMNB 1S1MA 4LGMA 4EJSB 5KDLA 1VCNA 1OT3A 3QKRB 3EPKA 1TEVA 2DYKA 3PV0A 4KODA 5J4VA 3BWDD 2NO0A 3CF0A 1KTVA 4QBIA 1W0JD 3JVUA 4XJXA 5JWHA 2ODEA 3W8NA 2B7BA 1QBKC 3BD9A 4NZYA 1YR6A 2PEYA 4CIDA 3NG1A 3LX5A 2F43B 1VPLA 2XJ9A 4NCHA 2P5SA 2CL6X 2WWIA 2QGZA 3UANA 2CHVA 3IBYA 3CPJB 2ZROA 4BEJA 3W6NA 2A5JA 2H5EA 4YMWA 1OLOA 5EXTA 3LX8A 4D80A 2REOA 1YZNA 4URZR 1VIAA 2J0VA 5FOVA 3UG7A 4P4TA 5UKDA 4QHTA 3VFDA 5F3WB 3KQUA 2MSEB 4UNRA 2OFWA 3I5XA 4H9GA 1U98A 1ESNA 4CEHB 4KO8A 4OBEA 5BW8A 2J7PD 3IQXA 1XEFA 3CM0A 2DWQA 1E2QA 1AN0A 4Q00A 3UMSA 1XPOA 4A2PA 4C3ZA 4PZYA 2PCJA 5JJIA 4OKSA 4DB4A 2ZRBA 2AKAB 2J3EA 1KSFX 3TSOA 1NSFA 2ZRCA 4MYTA 4KFSA 1XNJA 1UKZA 2A5GA 3C5CA 5TXGA 3E2IA 1E9DA 1JPJA 2ATVA 1GG2A 1CEEA 2KSQA 2C78A 3IPXA 1D9XA 1N25A 4BQSA 1AS2A 1ZNXA 1A4RA 4LSGA 4BPBA 3FYHA 4GRAA 5JWRA 1XJCA 2P2LA 2DFLA 2Z0MA 4PSVA 4Q1EA 2AWNA 4RZ2A 3B1XA 4IXNA 2EFCB 1JXOA 4TQAA 4TLEA 5CDFA 3WRXC 2DWPA 4OK3A 1OXVA 1TQ4A 5GJWC 2ODWA 4DJTA 1E2FA 3VR3A 2R6FA 2JATA 3FB4A 2D7CA 1L4UA 1IXZA 4S35A 3VU9B 3I73A 3EIEA 1COWD 5KDDA 4XD7A 5E7MA 3K0CC 2C8VA 2JAQA 1N5IA 1QHGA 4HI0E 5JHHB 4TMXA 4F7WA 4KJZA 5K8IA 5DN6D 2ZI3A 8OHMA 5GJBA 3GJ7A 3CWZA 1NIJA 1KI1A 2OAQ1 4RJLA 4ZI2A 5C46F 4NTZA 3LBHA 4MKGA 3FWYA 1W1WA 5EUQB 4TTRA 1Q3TA 3A36A 1IAQA 1MOZA 1E3MA 3KJIA 2UVQA 3U7HB 1NL3A 2VHCA 1L4YA 4TMKA 4B47A 1D2NA 1A1VA 2NOAA 2ZSEA 5SZHB 1JQJC 2BMEA 2WMOB 4PHFA 4M1OA 3OF5A 1M74A 4RD1A 5E7JA 4KCGA 4DLZA 3RRYA 4US2R 2W6IA 1QHIA 1XFAA 3FMIA 4HZUA 2GRJA 3DO6A 2O0KA 2C99A 2PLRA 3OESA 4Q9KA 2OUKA 3RHFA 3U6KA 2PX3A 2WKRA 4QGHA 3L0PA 5JECA 3CW2A 1H8ED 3BOSA 4NCNA 1XJ0A 1G3IA 2OE2A 2GCOB 3I72A 5EE1A 2WICA 3H86A 5KNCA 1NLYA 3TMKA 5AUNB 2ATXA 1G1MA 3EIHA 4IKEA 2IYZA 2BDTA 5JS8A 2ZRDA 4PAOA 3HU1A 2ZJAA 1R5OA 1ZCAA 4TYQA 4AWXA 1M7GA 4Z1MD 4BFVA 1T4GA 2D3WA 2G1KA 4D0LB 1ZMXA 3UMFA 5BN5A 3GJ0A 5EP1A 1BYUA 2NO9A 3L0IB 1TUIA 3EIQA 2F1RA 1WCV1 1E2IA 2YHSA 2N42A 3BB4A 4MKIA 3EG5A 3HPRA 1XMIA 3M0EA 2RGEA 2BEJA 3QEJA 1KHTA 1Z8FA 4MYUA 4RFSB 1R6BX 1UF9A 3VR1A 4DHEA 4Q1BA 2XNDA 4D26A 2GEDA 4AG5A 3AVWA 1U0HC 4YDHB 5TV2A 3PENA 5HCIA 3HP1A 2VPPA 1GAJA 3NBXX 1OYYA 3EZ9A 5M04A 3MSXA 1KDPA 2ODBA 2R8RA 3I62A 4ZIRB 2A78A 3AGQA 2TMKA 3IHWA 3K8YA 1JR6A 1ZNWA 3EWAA 4Q7MB 1I2DA 3RS2A 3IO5A 1E9AA 1CP2A 4CGZA 2ORVA 2JJ1A 4HLQB 2A9KA 3MWJA 4BRWA 1HV8A 1TL7C 2CE2X 4DBLC 4KYIB 3SI7A 5EZ6B 1AS3A 3FFBA 1XTIA 5FL7D 3B9PA 4V0ME 3WBKA 2NIPA 2QAGA 2QM8A 1R0YA 4F93B 4UKDA 3CKLA 1G7RA 3T1VA 3U7GA 3VNUA 2DPXA 4OI1A 3T06B 1P2UA 1QG4A 2G0NA 1PLLA 2JJ8A 3VAAA 1S4QA 1JALA 4DEXA 1E2HA 1KDOA 3P32A 3AGPA 1E2JA 2FGJA 1P9RA 3TRFA 1NJGA 1GVNB 1QHYA 3C15C 2KE5A 1NF3A 3CBQA 1Z06A 2BCJQ 2VF8A 4HLDA 1D2EA 4W9MC 4G3XA 4JBWA 5EE9A 2H7VA 5CIQA 2AFHE 5FL7A 2HYIC 3KB1A 3B1YA 1SXJD 2CHGA 2WBLC 5JI2E 1F2TA 1KJWA 3TH5A 1J8YF 1TF5A 2GDJA 2Z4RA 1N0VC 5IT5A 2WIAA 4G5RA 1P60A 2V4ZA 4IEEA 3GPLA 2BWJA 2ZRLA 4QHSA 2G0TA 1EXMA 2BMJA 3CUEF 1NLFA 1KY2A 3IDQA 3K0EA 3EPHA 1VHTA 1GL6A 4A0RA 4F4CA 3I8XA 4KYUA 4Q03A 2ZYTX 2DB3A 2ZSAA 4FWIB 3QG5A 2ZE6A 4QJ5A 2WKQA 5G3ZA 3GLGE 1UBCA 4QL3A 3I8SA 3TR0A 2BMFA 2ZS9A 1P5ZB 4B35A 1KDRA 2VSFA 3B78A 1KO8A 3CPHA 5EP2A 2YJTD 4RD6A 5IK2A 3T5GA 2FWRA 5KU1A 3FHOA 4CYMA 1YZLA 1KO5A 1HQYE 2BHRA 3BH6A 5SZIA 2IYYA 3SJBA 2ORIA 1N6KA 2N1BA 2OCAA 1R4AA 1GNPA 2ZJBA 2G9NA 1CKEA 4BZXA 4DSUA 4PHHA 5B57C 4H1UA 1G5TA 3EWSA 1NLZA 1KI6B 1XZQA 3ZS8A 3T1TA 2IS4A 5K8LA 4AKIA 3KXLA 4QFMA 2QZ4A 3DKVA 5CB8A 4NPHA 3MJRA 4M9QA 4Q4HB 2YOGA 3GFTA 3DZDA 3TR5A 1AK2A 4B48A 4J0QA 2FX3A 4HLUC 5H1YA 4CZ2A 4DLRA 4ZCMA 1CULC 5EXPA 4NDZA 2QI9C 1QHHB 3HJNA 821PA 3A6PC 5FPSA 2IUUA 1JBKA 4QKQA 1YU9A 1NN5A 2QP3A 3B1ZA 3B7GA 4MITA 4B33A 3RLFA 2FGKA 5E4FA 1XWIA 3QJYA 3TJZA 4A1FA 5JHGB 1RW4A 2RGXA 2OESA 5FPTA 5JCPA 3THYB 4GP6A 2PMKA 1IN5A 4WZ6A 5EP3A 1F48A 1SVMA 1SHKA 1Z63A 5BYJA 2YWEA 1E69A 4PC7A 1OHHA 4GOJA 4V0KA 1UBFA 4PQFA 1E4YA 2IWHA 2W83A 5FOUA 2GXSA 2RHDA 4TLAA 2LWIA 5P21A 4YMUA 1W2HA 2ZR7A 3UATA 4NONA 4YONB 3O47A 2IT1A 2JIZA 3FPAA 3FFAA
chains in the Genus database with same CATH superfamily
4JIMA 3ETGA 3M6WA 3ND5A 2F00A 4QOJA 4YS6A 1N7HA 1M6HA 2V7EA 2X77A 1ZHOA 2X3UA 3GRZA 4FHGA 1WUJS 1JDSA 2Z8XA 4NRDA 2CB9A 1X7DA 1L7AA 1G0OA 2F7SA 3NUGA 3KZXA 1S3SA 2JLBA 4S05A 1O94D 4CGYA 5EXSA 1USGA 3A9TA 3FJOA 2PS1A 5DWDA 4N5DA 3VR5A 3WMEA 3QJ5A 4GBJA 1DWOA 5ARDA 4D9MA 1II0A 2CVQA 1QPZA 1HDOA 4MRMA 1ULTA 4I1VA 1IJEA 3GLSA 3K1AB 2CN1A 4Q1CA 3EARA 3WI7A 5A4MS 3Q88A 1IBMB 2Q9AA 1GPKA 1QTQA 2II6A 3GLGA 2WSSD 3H9BA 3MGGA 3PHLA 5F52A 2MOKA 2LCQA 1ODTC 2WJPA 2X5XA 3C3KA 4I50A 1Q77A 1Q92A 1I3NA 2B3DA 4LZAA 4YBZA 2ZCJA 4JB0A 4M37A 3QOWA 3HUFA 5IF3A 1LZLA 1GXSA 1DXYA 2IH5A 5EPEA 3N7UA 2H1SA 3WWDA 2IJGX 3JAKA 5JBIA 4NCBA 3V4ZA 1Z2DA 2ZSJA 3HKBA 1VLLA 2W6JD 3VU3A 2E4VA 1C9EA 2RARA 4DAOA 1W1UA 2ZYRA 2XH8A 3U1BA 1RZRA 1J97A 1SURA 3OSZA 3Q3GE 1RU3A 2I33A 5IZCA 3WP1B 4F2WA 2H07A 4D3SA 4G24A 2BFBA 3M6IA 4K6CA 4MS4A 4N65A 1EFHA 4OKNA 3ZHOA 2K2WA 5EJ6A 1NONA 1V26A 4HV4A 2BMAA 4NCJA 1N2CA 3Q7QA 5HTKA 4MRRA 3EEOA 3ONNA 5IP5A 3DE1X 1VPDA 1F7UA 1L8OA 4ND3A 1YBAA 3QP9A 4BNDA 4C43A 2JIOA 4QBHA 3VBEA 2OCDA 5JYDA 3E84A 4DMHA 4FOOA 1LEHA 5H8WA 2VSYA 4TT3D 4F91B 3DVQX 4B3JA 3HSSA 2VDWB 1PG0A 2EQBA 2O8NA 4WSOA 2NSYA 1GDHA 4KX5A 2FPKA 4WKBA 4IUDS 3ZHTA 5ER6A 4YQZA 3DB2A 5AQ1A 2YW2A 1F0YA 3CEAA 1JKFA 2J6HA 2RSLA 2Z8YM 4TTTS 5AKHA 1KI9A 1Y0BA 3ZE7A 4R54A 4DA4A 2IYUA 3BQMB 4P4SB 2VXBA 2YXPX 1EFDN 1Z5ZA 2V7BA 4CEJB 1HFWA 1T1SA 3C6BA 2ODQA 2Y9MB 3F0TA 3AHGA 3JVVA 4FOPA 4HHEA 5ALGA 4RZHA 1T8TA 2GPTA 5LMNB 5DK6A 4BJ5A 2WHXA 4OGFA 3TB4A 5BUCA 3A1TA 1LPNA 3GMTA 2Q2VA 2XNHA 1EXNA 3UJPA 4TWBA 4P4LA 5EYPB 4DNXA 2O2GA 5DTRA 3V80A 3A8TA 1K06A 3M1YA 5FEUA 5DBFA 3F1LA 3M49A 5KVAA 4YV1A 4RUKA 3AR9A 1NW5A 3RNOA 2HT1A 1D0VA 2NZXA 5B64A 5ES4B 1RTTA 4TXNA 3INNA 4KKVA 3PQ7A 4GI7A 2X5NA 2HF2A 4OK5A 4Z5XA 2VNIA 1TMKA 3GB9A 4F3TA 1AXGA 4Y9SA 3B1FA 3H4IA 3PNKA 3LXMA 4L7QA 4QNNA 4ZREA 4CKXA 3UAYA 4CQJA 1J22A 2J45A 2QDKA 4I6JA 3C4VA 5K3CA 5AICA 3IV6A 3CO5A 4D74A 4YNBA 3C16C 1OILA 5CDYA 3DHYA 1X7WA 4X6LA 4CV0A 1MJGA 5SYAA 2M6LA 2CDRA 4N40A 2FUCA 3NVDA 3SYNA 4EDHA 4EMBA 5CFNA 2XRMA 3O8OB 4D42A 1CDEA 3LSYA 1XTVA 1F4PA 3V3TA 1DUIA 1UJNA 3AJDA 1I5OA 1HLFA 1T24A 3M9LA 2LE0A 5E4TA 2FW0A 4K05A 4D6YA 3L5KA 2OV2A 2Q4TA 2FG6C 3ZWQA 4RZSA 2LVBA 4CQLA 4EMUA 3IVXA 1B93A 5ALIA 3FNGA 4BECA 2NT4A 1MDBA 2EJBA 1GAWA 1HM5A 1NXTA 2LRHA 2OO3A 2P3LA 2VK4A 4XCQA 4Y9TA 3U0VA 4UVHA 4NJEB 3NETA 4G0ZA 4HTFB 1GCGA 4E4TA 4CLEA 4HH0A 5LIPA 2YV2A 3ETEA 3OMWA 2PBZA 4J91A 1D1TA 1XMJA 7REQB 1T9GR 1R9JA 4YRTA 4V1CA 3RI3A 2RH4A 3WNZA 2B94A 4Y2XA 4ZXFA 2ZAYA 2VQ3A 1NUUA 3T95A 3IUPA 1L8AA 2X0RA 3B1WA 3V42A 4NMMA 2B34A 4NZPA 1EWRA 4M7PA 3CJTA 5TMEA 2DY1A 4A73A 4AX4A 3U4AA 4EDFA 3SR4A 1TZMA 3LC1O 4AZ0A 4RF4A 1NFRA 2A7QA 3JZMA 4KQGA 4CKEA 1JHOA 1N5LA 2FDXA 3OPQA 4C6SA 1NTRA 4TYWA 1MJFA 3SJCA 3GNSA 2QVLA 2BBWA 3HY3A 4XDYA 2XCIA 5IAGA 1QCCA 1RD4A 3K09A 3QWFA 4QRDA 2NN3C 4WUTA 4BFYA 1PLKA 3WIOA 1SHJA 3A9UA 3D2AA 3L2OB 3U3JA 4R84A 1OZGA 1T8UA 2GYUA 1HDEA 4O2BB 4PPNA 3DFKA 1JEQA 5JXJA 4HDSA 1PT7A 4G07A 3U2QA 5ALUA 2JBHA 1YV9A 2GK4A 3IT3A 4MHOA 2VHJA 4UM9D 2GASA 1N6IA 2FB9A 4DNQA 1H4SA 3DPUA 1QBGA 2W2TA 3UT0A 1OFUA 4I3HA 4H7KA 1XROA 2X7HA 2X2PA 1QPGA 3SSNA 2OYCA 4PXAA 2VWQA 4IZOA 5FWYA 1UANA 4QOGA 1U7XA 4CQMD 3LBIA 1ID8A 3ETDA 3NHFA 3DEJA 3DS8A 3PNOA 2HNAA 1BYIA 4J1NA 2CMKA 1FDWA 4JJKA 5JQGB 2OORC 2OK7A 4C6TB 4ZCIA 3E7DA 3D1JA 2X2OA 1CF4A 3W5IA 1NBME 4Z7NB 2Y9PB 2YH2A 1PV2A 4CTKA 2JKYA 3C3YA 2C1XA 1TT7A 5CA1A 4EPTA 1D4FA 2DUWA 5CX4A 1KAEA 3ZTYA 4MQ4A 2C5AA 2GCPA 2HA4A 1WXGA 1GA4A 1CJMA 3IIMA 4REMA 4TYYA 5AXDA 3PXXA 4YV2A 4M1KA 1VHDA 1Z88A 1JHZA 4W9RA 1UFQA 3HGQA 3H4VA 4YB8A 3WL8A 2NV6A 3WDSA 3AB3A 5KSZA 3AKZA 4R5HA 2OV6A 3SLKA 2QZSA 4JT8A 1B43A 3OHSX 5CDTA 3GLIA 3Q11A 3AEQB 3HDYA 1E0AA 3PYLA 1NVMB 2QGNA 4G67A 1T8SA 1GZUA 4B34A 2VAXA 5A62A 1DV2A 1QH0A 1X0VA 3RCBA 2GWRA 1RZ3A 4ESOA 4ZYVA 1V11B 4N5NA 3UJ7A 2O7SA 1F2UA 1A2KC 2V4UA 4F4JA 1ZIXA 3H5AA 3AKYA 4GSLA 4JYPA 1V6SA 2Q3DA 5DWVA 5AXCA 1FDSA 1RKQA 3TG8A 6LDHA 3EN0A 2ACEA 3U5ZB 4D96A 3J80A 2XUKA 3SQMA 3GJ8A 4QODA 1OGYA 3O3OB 1VI6A 3FN4A 3HDTA 1O94C 3KJGA 1SKYB 3Q7PA 5DP2A 4IHJF 4XTRA 2FSGA 4JJAA 5I45A 2R6DA 1K2WA 4LNUA 5FOWA 2Q29A 2P65A 3K0AA 3MCAA 5D3MA 4MR8B 1S3IA 4M60A 3TIIA 3TPFA 4NWIA 2E4UA 1WOYA 2KMLA 5DT2A 1H2YA 1Z12A 3JQBA 5B3JC 4KE7A 3ER9A 1OTYA 1VGRA 3AKCA 3L7IA 1NXXA 3PK0A 4QIHA 3E6AA 5C1BA 2HEIA 5JVDA 3WADA 4PZDA 3VPAA 2WA2A 2ZRHA 1ZCBA 1IY1A 3AVQA 3GHYA 3HLYA 3MLBA 4L6CA 3AZQA 3JV7A 1BEEA 3QWBA 2J5RA 3G82C 1MXFA 3A6DA 1FQKA 1VPWA 2BI4A 1PZNA 3MIZA 1FXSA 5HKKD 2P35A 5JSYA 1T8RA 4RS4A 3WO0A 1A8IA 2D4HA 3PEFA 1FW6A 3MC1A 4UCWA 5JALA 4HB4A 2ESRA 4MSUA 4QTUB 3OO1A 3R6LA 2DE0X 4ZQGA 1E2GA 4FKZA 1Y8RB 3BBPA 3C7KA 3MFYA 1G41A 1T0UA 3WB2A 4MAFA 3L6DA 4MV0A 3ZVNA 2W2KB 1U8FO 2FWPA 3F46A 5LP6C 3B2NA 3HCEA 3O9ZA 1IOVA 4NAVA 5I7AA 4MW7A 3NIDB 5HK9A 3ADBA 1WBBA 3EOBI 2H2WA 4OREX 2JHFA 1WDWB 3KZOA 5L51A 4OYHA 2IL1A 4TZ0A 3C5EA 1LX7A 2ZUDA 4DCUA 1RQRA 5AJZA 5DX8A 1T2VA 5F73A 4KIJA 4DYDA 5IKMA 3IUYA 4ND7A 1DB3A 1X7XA 1NIPA 4B3CA 4TWIA 5KVVA 1XZIA 1C29B 121PA 4DFDA 3LQKA 4NU6A 5AW4A 2MYTA 2O05A 4D8TA 1QGAA 1K1EA 1WCIA 2O48X 1ZQ1A 1RFGE 4DIUA 1GV1A 3R74A 3I64A 1KU0A 1N4DA 2REBA 1A4IA 2Q3BA 2BC9A 2CMDA 2EBHX 2IODA 2LW7A 2VJBA 3GUVA 4L4ZA 2D2EA 3AEKA 4CMKA 4TKUA 1KZGB 2HEGA 2HU8A 5LDHA 1MRZA 1B23P 2R1TA 1AO3A 5JS2A 3V33A 4ZWNA 4E94A 2W7TA 4CCAA 1SBYA 2Q5OA 2BJWA 2I71A 3B85A 3FTQA 5HF5A 4KPUA 3RJ5A 2XXAA 3F96A 1FDIA 1XKQA 2CJFA 1E4VA 3G3EA 3REFA 4C4PA 3WLRA 4KUGA 5CDSA 2J33A 4RD4A 5FH9A 4RQUA 4TLDA 3CEHA 2WG1A 3T0FA 5IG2A 5JEEA 1W2GA 1KARA 1T1EA 2VFAA 4LOKA 1WDKA 1AURA 1K5DA 2QOEA 2RHHA 2BD0A 2JRLA 2PGJA 4IMPA 3K4PA 1E3TA 1U9CA 2FP4B 2VJQA 1KO4A 4LYHA 1UT8A 1JDPA 2HRCA 2WZCA 4R1LA 3E7FA 4TWJA 2I4LA 4O2BF 1ISPA 2XUOA 4YUZA 2NZVG 4GX5A 3WA6A 4IP0A 3PDIB 4PLGA 2HJVA 1X3LA 4NIMA 3PI6A 2VK2A 4QXMA 2J6BA 1KQNA 3IAFA 3OFJA 1H2BA 1QP8A 4TSKA 3BH0A 4M21A 3VO8A 4HB0A 4KSCA 2I6SA 2IDMA 2SKDA 2F1HA 4FDLA 5DF1A 4A16A 4LWPA 5U4XA 4RCYA 4UAGA 1C0KA 1AA9A 4IUCS 1YDMA 4IOKA 1OF1A 2BTQA 4PLCA 1ZR4A 2RGBA 1IBRA 4J0CA 4K8RB 2YMMA 2WVAA 2HHLA 3NKLA 7ADHA 5AVYA 1UM8A 5JZVA 1ONBA 1ZDMA 4XSGA 5ALTA 2XMQA 4RA9B 5SYNA 3T5BA 2R6CA 3IQWA 4UZEA 3CS3A 1YKSA 1MV8A 3LQRA 4M0EA 5BWCA 1G7TA 1WF3A 2O6HA 2OBNA 2ZYHA 1Y5IA 4MMYB 1LBTA 1QYCA 1QFMA 3IEKA 4L4YA 4AZWA 3FYTA 4JLSA 3U7EB 3JWEA 5KKNB 1XNQB 1L8LA 4AJNA 1G3RA 5A3SA 3AVVA 2QVBA 4ZVNA 3WYDA 2Z8ZA 1QFXA 4NABA 2ZWOA 1T0HB 4Q37A 3L7MA 4XVCA 6Q21A 2P9QA 1Y9AA 1QVZA 3EC2A 4IIVA 4GICA 5M34A 1NC3A 4Q7LA 1VJGA 3LF2A 5MN6A 3V55A 1OBOA 4JQSA 1YRWA 1ZJJA 2ATCA 1Y8QB 3L8MA 2HCFA 1J2RA 4N3AA 5EIAA 4BMCA 4QTYA 2IUSA 3UJBA 1IC6A 4RIGA 3LUKA 4YBRA 1AXRA 2G9VA 1JAIA 3DHWC 2RDMA 4DMMA 4LFBB 2F8MA 3AFHA 3ROTA 4DMGA 3FOZA 1IUPA 3FPHA 3FMGA 4D9NA 3BREA 1V39A 4P7FA 5HK8A 4OI4A 1Y89A 2RGNA 1QIGA 3PWKA 2HT6A 3W3AH 1JZSA 4MQFB 3M6MD 4ZDJA 3DFZA 4TTAA 2FR8C 4KPGA 3RNLA 3IBGA 1TAGA 4HBGA 4MR9B 1T2AA 1US8B 4H0FA 5K6AA 5DBGA 3EZLA 2W6ZA 3ACBA 2Q5QA 1E8DA 4GPZA 4OYLA 4IV0A 4R1SA 5DM2A 1OZHA 3UT5B 3ZLBA 1CF2O 4DMCA 3PUXA 4LIPD 1M5TA 4FHCA 5DIFA 5JD4A 3D4IA 3U4GA 1W96A 3N2YA 4WBNA 1K4KA 1C9KA 1G6OA 1I2MA 4PQEA 4QTXA 4XYEA 2I78A 5AUPB 1DSSG 5I5EA 2V5AA 4KW7A 1QTNA 4B3XA 2YDYA 2E5FA 3PGXA 1YZYA 3MB8A 2C5GA 5CD1A 4YLGA 3RYCA 2WVJA 4WK4B 1BKSB 2P4SA 2YVKA 1FYFA 1TZBA 2H2FA 3D3QA 3DE0X 4XH9B 1JU9A 2PBLA 2H9IA 1JJVA 5G1PA 4NOJA 2XMBA 4RDXA 3JD0A 3WYAA 2O50A 5LA6A 5L53A 3M4XA 3T3DA 4YHHB 3IPYA 5T4BA 1IEVA 1RWKA 3GN1A 4GH5A 4JLPA 4YACA 4YC7A 3ENQA 4EB8A 4FFLA 3AJAA 4N5IX 4PTLA 3TX6A 1U0SY 3L0ZA 5DMXA 5CEFA 3RADC 4KRYA 2ZDHA 3ZDQA 4L73A 1TYCA 3P5BA 1BCRA 2DQSA 4E6EA 4HWOA 4WGFA 5D6NA 4HX2A 1MKYA 3QNWA 1SC9A 5EN4A 5GVRA 3RIGA 3ZWVA 4PFQA 4N0DA 3Q0EA 4RMIA 4RK5A 2ZBEA 4RYLA 3OP1A 4C03A 2EGGA 4EY5A 3S3TA 3AT1A 3UH0A 1TVCA 3QKRA 1VB5A 3AP2A 3JX9A 4DUZB 5KNBA 3FPLA 3G2HA 4XJVA 2A9RA 5D7NA 2BJVA 1DX9A 2F3QA 4F1KA 1J9ZA 4B6FA 3IKVA 2A14A 3DA8A 5I9NA 2HA2A 2HMYB 2V98A 1GGNA 3O8LA 4V0LA 5HA5A 2Q62A 2O06A 3K2QA 2O59A 1B8NA 1K3UB 1Y9JA 2QZJA 2RCNA 2PMDA 3F47A 1IY9A 2WYIA 4MEBA 1VJRA 1LFAA 2QUJA 1BZYA 2X4DA 1D2RA 3ENWA 4INOA 2AXPA 4YAUA 1WZEA 1QGDA 3HBAA 3R5SA 2ANBA 4DADA 4L57A 4J90A 5AP9A 1C2TA 1ZONA 3L0CA 4QDTA 4A15A 1ZM7A 2VK8A 2FH5B 4Y1FA 1T25A 3OT1B 4YALA 4ZYWA 3L8DA 1UQRA 1T1JA 4OQ4A 4EKIA 5AI0A 1CBUA 2ZZMA 3DHNA 3DMTC 1DGQA 4MH0R 5JNWA 3IALA 1DRUA 3DV2A 1BMDA 2WWXA 1EFPB 3QJGA 4P93A 5I8PA 3LUDA 1A9ZA 1L7NA 1MOQA 4H08A 2O6LA 1DDIA 1PJBA 3OURA 4JUAA 3DP7A 5B37A 3UC5A 4I08A 4II7A 3SC2A 5ELXA 5K5EA 3ZU2A 4QU0A 2PGIA 2HDNB 4MYHA 4MYCA 1M2VA 3RSFA 3Q7EA 3L1UA 2R7AA 1GT6A 3OEEA 1IPEA 4PC3A 4LRXA 5BUQA 3WB9A 2B4KA 1JQAA 4KP7A 1Z2CA 4LI0A 2BPOA 4WA7A 3X1YA 2P6RA 3FNFA 4Y6LA 5DRYA 3PTAA 2G1UA 4WCDA 4JLMA 1SH7A 4G0XA 1XZJA 4X64B 2YZ2A 1MV5A 4ER3A 4NU0A 4NICA 3WV4A 5F7JA 5TQJA 4D92A 2OM6A 3WYGA 3SYKA 4BFXA 4ZDIA 4AULA 3QYJA 1CDZA 5DYWA 1RRVA 3NKVA 5BV1A 3I52A 3NHPA 4IIXA 5ITZA 1G21A 1OHHD 3UAZA 1IDN1 2W4QA 3HWSA 4OMFG 1F8UA 5KWEA 3OFKA 4Q15A 1XMVA 2W8BB 2WFMA 5KHAA 3UA4A 4MICA 2ENWA 4MV5A 4J6EA 1Z15A 4JBGA 3VKHA 4C0LA 2F9MA 4KI0A 5HIAA 2IXDA 2KLHA 3V7NA 2BMWA 1RLJA 3I04M 4NENB 5TT1A 1Z5VA 5DLPA 1BFUA 4IIJA 2XCLA 4PHGA 4AAYA 2GTIA 4TN1A 1HEYA 1L5LA 4W5JA 1OLSB 2JGRA 4JVLA 4PG5A 1H0HA 2AVNA 1I3KA 3ESRA 1EYZA 1G2QA 3A32A 1EE9A 3X1WA 3EAGA 3G8DA 1NKTA 4LMPA 2NU9B 1W8DA 2FPOA 3DL7A 4QM6A 3AF1A 1NYLA 3B8EA 4H3HB 2QN3A 4MKFA 1CS4C 1HDGO 3MUFA 4QXQA 3UAWA 4AURA 1KIMA 4MAMA 1M2OB 4UCFA 1XKXA 3OJ0A 4OXRA 5EC8A 1CEXA 1DO2A 2QTBA 2R96A 4N12A 3ZYZA 3E22A 3ZCUA 2D0OB 1EWKA 3TTXA 2OBYA 3FGOA 3Q87B 2RAFA 3MAGA 4UW9A 4Y18A 3IILA 3J7TA 5C8YA 3ZDXB 4M8IA 1QH1B 3ML1A 1FFDA 3CZ4A 4FE3A 3HWX1 2JLYA 4MB0A 2Y1LA 1JLLA 1O03A 4J3JA 1WBJB 3GFBA 1KC3A 4IM7A 3F1KA 3FVTA 2E82A 1PT9A 3EA5A 4JL5A 4JYCA 3GG2A 2D4AA 4EJFA 5KBYA 2WHEA 2YWXA 3KKNA 3PU6A 4CUKA 3AB7A 1XCMA 1KZ7B 2AFHA 2XUAA 4ZOAA 3ROPA 4B6SA 5A2GA 3C85A 3PUIA 3VU0A 1U3WA 3JVIA 4EL5A 1KYYA 2E2WA 4BLWA 2X8WA 2RHWA 5LQMA 2BGJA 1JR3A 2ONKA 5JFTA 1RVDA 1FFGA 1RP1A 5K3OA 2AKEA 4J7AA 5FBWB 1NMXA 4I6GA 5GM1A 1GSIA 2R1VA 1Z4QA 1YS9A 3G2LA 3ADPA 3K72B 4MVJA 5L3VA 2JHAA 3H1BA 3KTAB 3ONFA 4TUYB 2AR7A 2OOKA 2X5KO 1Y4ZA 3IA2A 3LE8A 5HIMA 5COQA 5A4JA 2J6CA 4OIFA 3UO8B 1GCAA 3BE4A 3L0BA 1A8QA 1D3AA 3IAEA 1QKKA 3PUHA 4DLWA 4GKKB 5INTA 2I6GA 1FNMA 5DCUA 3FWHA 1CLUA 3GVXA 1Z7YA 1RXUA 3IRUA 5DKFA 1EJ6A 4JR2A 3DE2X 1RRMA 2J4DA 1ZGBA 4A4DA 2HFJA 3I5AA 1A9XB 4RFVA 4RVDA 7AT1A 2C20A 3IMCA 4FOSA 2PO7A 2KB0A 1VKOA 3MLAA 1RM4A 4KQWA 3F9CA 4WWHA 4BWFB 2XMRA 1TDJA 2XWSA 2RG1A 3K70B 3N74A 3TO5A 1ODJA 4YR7A 1K6XA 2IXFA 3K30A 1EU1A 1Q1NA 4WZAE 3TDNA 1WNFA 4MIEA 1M2EA 3ZKWB 4HWRA 2PKRA 4PAGA 4HYEA 1NXQA 4KXUA 4FFVA 3Q1KA 3Q3VA 4YJDA 4CR6A 1I6KA 1R74A 3P2YA 4CL8A 4FN5A 2A0FA 3NHBA 1W0KD 3NT5A 4AMZA 4ZCRA 2ZSHA 2BI8A 4GBGA 1O2DA 3JPYA 4GF5A 3RFVA 1XCLA 1ZJ5A 2IEYA 4QVIA 4QNMA 3FHJA 2X8BA 1UPTA 1SVLA 2GN9A 2LUOA 3GD7A 1MVLA 4K81B 1W19A 3JQGA 3K1ZA 5JLAA 3SSOA 1VYTA 3VBCA 3TBHA 1WU7A 5HX7A 4CDGA 2UUAB 1Y1TA 4BZWA 2GXAA 4XW2A 1R64A 4H3SA 1T9CA 5C18A 1WMSA 3WJAA 1O1YA 3L0OA 2C2HA 3I5UA 3JQFA 4KZKA 2HDHA 2ZRGA 3LWNA 5D87A 1PJZA 4TN5A 5EIEA 3GGDA 2E6UX 3BERA 4ETIA 1Y9DA 2KI5A 2MSDB 5A3JA 5A7FA 4YR9A 2ZREA 4ZIRA 5CLJA 2RH8A 2OQIA 4KR2A 4Q1FA 2OGWA 1B8UA 4IW3B 4K28A 2BGGA 3SXUB 2QMEA 4ZCQA 2O4UX 4FJ0A 3NONA 2QWXA 5KHOC 4RQBA 4G9EA 4IDPA 1FQOA 2AR9A 2QT1A 1B4DA 1RJFA 2PGLA 3KFVA 4AD8A 2D0PB 4QO8A 1CVIA 1R7RA 5K0EA 1QHSA 4ALJA 1RWXA 1CUYA 2R0QC 2CBZA 2C2ZA 4QVKA 5AW0A 3QW4B 5BOVA 3T5PA 5IJAA 1SGWA 3CR8A 3NGMA 4LV8B 3MJSA 5CB4A 2IYNA 1P9NA 2WHQA 4R2WA 4PINA 4GAEA 2JD0A 3N76A 2R4UA 4I1YA 5T4FA 2CFSA 4JB8A 4BNWA 2BI7A 4ZJZA 4MGIR 1XMOB 4TRMA 5IABA 1O0CA 4LDPA 3VOTA 5D6OA 3V8QA 3HYSA 4AQYB 3O90A 1SVSA 1EVZA 2RHRA 4EG6A 13PKA 3AJEA 5I7FA 2P9FA 3QBTA 3JQAA 5IDQA 5DNYB 1CYEA 3ZS9A 3ES9A 3WK7A 1XTRA 5C32A 4JYZA 1BX3A 3LFHA 2AZMA 1V5WA 1Q7GA 1X1RA 3OE7A 1IOWA 1ZXLA 4L07A 3CX6A 1CUDA 2BUCA 4XDHA 1KYIA 5AK4A 1YA6A 1HDCA 1EFCA 3HCOA 4J94A 4YXWD 2Z8YA 1QLJA 2PV7A 4O2AA 5CX1B 4FWTA 3FRIA 4G41A 2D1TA 4R05A 1CHDA 3FNRA 3PJGA 5A6SB 4MQEB 5CNMA 3NXKA 1XYGA 5EXXA 5BV7A 3VNRA 3BGOS 2IYWA 3TVTA 1SU4A 3RF7A 3H1FA 4M8LA 4M6WA 5J2TB 2PD6A 2C61A 2OD9A 1NN1A 2W48A 2IKSA 4IILA 1EB8A 4UEJA 1E1DA 2GMWA 2C00A 2JJ2D 3TPCA 2WWWA 3PR1A 3BJIC 4YMVA 1OXTA 3WL4A 1M1NB 1OJLA 1WUYA 3BXZA 4NVRA 2QYHA 3K9GA 1E64A 2BEVB 3MWYW 2XT9A 1XCJA 1J1ZA 3OEWA 1H4QA 2WY2D 1FPMA 1K6IA 2GBCA 3UPUA 5KO2A 1E7SA 1YH3A 4O0MA 2Q28A 1TC1A 2FR1A 3DE4X 1MORA 3VPBA 4A36A 1BOOA 3DL0A 3SMQA 2YWRA 4B6EA 1RWNA 3A4MA 2PIDA 2X0DA 4AU1A 2GYWA 3ZBTA 2BEUB 1VSVA 4ZZ3A 1W49A 2NTYC 1PFKA 3WLLA 4DGSA 2WFLA 2CNKA 4AJ1A 1ZCZA 4QGAA 3GV0A 4WDRA 2UUBB 3TMAA 1BU8A 4OU5A 4Z0TA 4F5YA 2IYPA 4DRXA 1QZXA 2CL7X 2I7DA 5LZ9A 4EJ6A 3HRIA 3G88A 4PBTA 10MHA 1ZM9A 1B2LA 2HF7A 4WN9B 5CYPA 1JKJB 1OAOC 2QE6A 3DAGA 4OHVA 2XGOA 5D5QA 3W2EA 4KOEC 4QA9A 1CY4A 3KUUA 4ZOLA 2AMVA 4U7DA 3ZE1B 2Q5EA 1WXDA 4H15A 1U1GA 1QAMA 3RBAA 3SQDA 1PHRA 4L0MA 4MWCA 2JD2A 1H22A 3C8UA 4MWTA 1E1RD 1UPBA 3WWOA 3HA3A 4YH1A 4TMWA 1YVEI 4YTEA 3WLAA 4D0SA 4ML3A 2QJTA 3GP3A 1EP2B 2GRUA 4UXIA 3H11B 1KYVA 4BO4A 2HAEA 2C9OA 3BAFA 4O4LF 1DAPA 1YCGA 2E87A 5BN3A 1SIWA 1ZK3A 4M46A 1KJ9A 5CR9A 4QGBA 1M34A 2QYOA 4J2TA 3AMVA 3KPWA 2F55A 5ER9A 5A4AA 4GMXA 5DBEX 4EY8A 2QPTA 1FNCA 1X1BA 4BMNA 3EWIA 1TZJA 4QAQA 5H81A 4CMIA 4F56A 4E07A 2VUUA 1TAUA 5CJJA 2VATA 1DJPA 5D85A 4DDWA 1QFSA 5J9FA 1NDHA 2GRAA 3V4SA 5KWIA 5ED4A 2Y2UA 1HDRA 1ECGA 3DEYX 1P5JA 1LC0A 4FDTA 4V2UA 5LLDA 1U1EA 3U61B 2JLWA 1EIWA 3RIMA 4C06A 4ZAXA 2QTFA 3ZD7A 1JB1A 4NR0A 1QRSA 2BM8A 4J1QA 5IU6A 1OWLA 2YJ6A 3LRPA 5ALVA 4A0SA 1IJFA 1KBZA 4CMGA 3U3ZA 3U4CA 1Y4SA 4UZFA 1WW3A 1UKCA 3W8EA 3GG9A 5FI0B 2B2NA 2HMVA 3B36A 5K03A 2WZBA 4Q3KA 3RU7A 1QAOA 1J7JA 4UBLA 4A8TA 2YZGA 4EKGA 1YS4A 3R5HA 4L27A 3F5QA 2P7IA 4PCUA 2VH2A 4OP2A 3KUKA 3WRVA 4F86A 5M2QA 4KWTA 3UMBA 1HYBA 3IDFA 4BJHB 1R5JA 2R1ZA 3NHYA 2JGLA 3HC7A 4OAPA 3SS8A 2WINI 1SEPA 1X8LA 3K3PA 3Q41A 3SFZA 5AM3A 4ER0A 1AU9A 3BS4A 4AB1A 1E2LA 4UUOA 3ZUPA 5HGXA 2X2EA 3CO0S 2AW5A 1RLUA 2I4RA 2UZ1A 2XE7A 3ISVA 1SD1A 2CUTA 2PX2A 4IX9A 2DHQA 2FPMA 2OG2A 1DV1A 2UVPB 1KI4A 2F3SA 3IDZA 4UASA 4YV0A 1UQTA 4QSMA 4PO1A 4JLNA 4UM7A 5IBCA 1TX4B 5IX8A 2UAGA 4GI3A 3CW9A 4IMJB 1IVSA 4RZQA 3C3DA 1RRPA 1EAYA 4YMIA 2F67A 3IPRA 5BSVA 4MDYA 5CCDA 1QQAA 3WWZA 1E59A 2FX2A 2JGEA 2PL3A 1JF8A 3BWYA 4YEDA 5IVDA 4EG3A 1EHYA 5ISMA 4FFPA 1S2GA 2B1QA 2ZR9A 2ZGVA 3IJ5A 5C1PA 1IFXA 4TQUS 5J23A 1ZSNA 3MQFA 3VSEA 3IA7A 1NBMD 1CZNA 3P9RA 4ZEXA 4EFKA 5ALSA 1LDGA 2R3SA 1QRUA 3OCYA 1A5AB 1J5XA 3UCEA 1ATZA 3BK2A 5DTJA 1B8VA 1TUBA 4Q9LA 2KLBA 1F2TB 4NJMA 2J3LA 1Z2OX 3OU7A 1K9SA 1PT8A 4LVNA 3CX7A 4TOIA 1U94A 3E9DA 1EA7A 1Z0UA 2QYSA 2Q3HA 1W9MA 3H1AA 3CINA 4C7KA 1D03A 3DM5A 3ADCA 1RE0A 5J2TF 1CY7A 2J0UA 3DGEC 3F3SA 4WZBE 2QD4A 4QLBA 3KFLA 5B6IA 4LK3A 4CUZA 1OWPA 2P2NA 3HR7A 3UJHA 3P0FA 2MDTA 3RR2A 4FIZA 4D1YA 3WYCA 2A9JA 5TQ0B 3SX4A 4Q82A 3MINA 2FOLA 3MTQA 5LQCA 3UQZA 3WLTA 1NBEA 4CF4A 1IVNA 1DT5A 3VA7A 1SELA 3GZJA 5JDCC 1YVRA 1H65A 1NNI1 3VR6A 1RTKA 2GJAA 2JJYA 1B6SA 4G5OA 4YQEA 5U1PA 2GO7A 1X7ZA 2VN8A 4JX8A 1PS0A 2GZHA 4MWGA 2G88A 5JD5A 3W5JA 2VRBA 2P2DA 3LUPA 5LSAA 4BFCA 4BBPA 1HT0A 1XL0A 1P3DA 3LHFA 1C4WA 5NLLA 3E3MA 4DA8A 5K8UA 1PU2A 1AT1A 3B12A 2CBGA 1DQNA 1HNNA 2CDNA 2LCFA 2RGCA 2V55B 3MRXA 4KLZA 3C43A 1FUUA 2VDVE 3KJQA 5B7NA 4BEWA 2XECA 3ZVLA 3TQFA 1CB7A 1CIVA 1MX1A 2P9HA 3LS2A 5I9BA 4B5LA 4YX9A 1I7QB 3WQHA 3NVMB 4J7UA 3KCQA 2C2WA 4Q4JA 1IN6A 2R85A 4UHHA 2DLNA 3PDCA 3SU8A 4MUAA 4X6YA 4IGIA 2YZNA 4YUWA 2V7UA 2WE7A 2Y1EA 3B38A 2Z2IA 3TZEA 2DOKA 4HADA 4EVRA 5ICSA 1T8PA 3GBPA 5G0SA 2CMGA 3UW3A 4C5CA 3OJFA 3CY6A 3IT1A 4I4CA 1I51A 3QU5A 4J16A 5DBHX 3BH7A 5JNSA 1SMKA 3QFFA 3BCHA 3FPEA 1OPXA 1KDVA 3OIUA 1WXFA 4QC2A 2XYRA 5EERA 1ZD3A 1AKNA 2PEZA 3K7EA 2MSWA 3AW8A 1N2GA 2XGGA 3NHSA 1I30A 4MW5A 3A0UA 3VSBA 3CR7A 3ROKA 3I42A 5ADHA 3CPSA 4I4TB 4U2FA 1RLMA 3EDYA 1SKYE 1U3FA 3WGMA 2NPOA 3P4XA 2EFHB 2DBRA 3QKSA 4HDRA 4BO0A 2FEKA 2DR3A 4YMGA 1I32A 2VF5X 3ANTA 3I9LA 1GGEA 4DEYA 4G6ZA 1DO8A 1T1GA 2G28A 2L18A 1GTSA 2I1QA 4RAOA 3HJBA 3IBCA 4JX9A 4D9JA 2PXAA 4W1QA 4JUCA 3UPTA 4I9GA 3R44A 4NMHA 3NW9A 2XEDA 3IR6A 3QVXA 4DAEA 3CF6R 2BP7B 3R3SA 4X24A 3D2BA 1D2MA 3KUDA 4WH0A 3MUOA 3E48A 2HSJA 5FHRA 5HGJA 2IXGA 5T3YA 4UE3S 1RWWA 3FZYA 3Q7SA 4RDIA 3C6XA 1B1AA 1MQSA 4RCVA 1EJ0A 4HQRA 2PGDA 4LW8A 3ZZUA 4CM7A 1V8ZA 2FKNA 1HYHA 1YUBA 1UBJS 1COWA 2G8NA 3GLIB 1B2RA 1KKLA 2H4YA 3GNQA 3KPVA 3SDSA 1FEZA 3AXTA 4IIYA 2BR3A 3DV9A 2QW1A 3VV3A 1VL5A 2H5JA 1XEWY 3GFQA 1JILA 2VYCA 4FPXA 2NUPA 2AE2A 4KIFA 1TUGA 4IBOA 1UXKA 5F3RA 3CU5A 1N8SA 1N3YA 1R00A 5K4GA 1EGMB 1W4CA 4EVQA 1SQ6A 2VTBB 1TECE 2FFHA 4AJLA 3KLBA 2C03A 4FX2A 3S8MA 5A03A 3D8NA 1RI5A 3NHRA 1XQ1A 1CJSA 4DCCA 1I8TA 1ZMTA 1JEYA 1R9MA 3IJRA 4QRHA 1Y1PA 3VU1A 3R09A 1JEDA 3BMNB 3I4CA 3T3HA 2VPTA 3KKKA 1XQYA 2QRVB 5FV4A 3O0TA 3N2GA 3NHUA 3ITKA 1RJEA 1PNQA 1XZLA 4R9UC 4G97A 1KEEA 1EP9A 3ONDA 4C0HA 2ZT5A 1JS1X 2C54A 4JT4A 4UDOA 4F1WA 3QEKA 1DARA 4HK4A 4W8HA 2XTZA 3O1JC 1G2IA 2IPAB 1YA8A 2L82A 3A14A 3RS8A 4Q21A 1R50A 1MB3A 3BCRA 4DLYA 4PZLA 3RYHA 1CHNA 1CUVA 4RJIA 1OX4A 3AFMA 1VJ0A 1THGA 4Q93A 1H6CA 2EX4A 5J5CA 2EIHA 2OXIA 2BEKA 1H93A 1D6MA 1JSRA 3T3EA 4DQXA 5EE0A 4DA7A 1F0KA 1E7YA 2QENA 4IICA 2JDID 3G9QA 5JNUA 4Q3EA 4XUCA 1BROA 1TKBA 1TXGA 2OFOA 4Z1MA 3NBUA 2ZRJA 4YJ3A 3S2YA 1RM3A 1CZUA 2WUDA 3L05A 4ZI3A 3W2FA 1L5NA 1Z5UA 2B8TA 2Q41A 1LPAB 1O97C 1Z3IX 3OKFA 4Q5IA 4RORA 3V4LA 2GXUA 4NCKA 1ZKDA 1GO2A 1FNBA 1TOAA 1JXQA 1JSLA 3F49S 4FSDA 1JHRA 3KDPA 4G23A 4E11A 1ACMA 3DNFA 3VSCA 4HGNA 1IEQA 1XA3A 3ESDA 2OBMA 3FHLA 2DTXA 1NQTA 3LC0A 3MTIA 2J48A 4FGUA 2XA1A 1JKXA 2EEZA 3VUFA 1E6CA 1JDBB 1WVGA 2WD7A 1QORA 2EGHA 2HLDA 2H1RA 3UNXA 1Z62A 1JH8A 4OQNA 1Z9BA 2ZAGA 4OQPA 3H5RA 3QU2A 4ZJPA