4Q2JA

A novel structure-based mechanism for dna-binding of satb1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
169
Chain Sequence
GPGSGTMLPVFCVVEHKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
total genus 38
structure length 169
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4q2jA02
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4q2jA01
4Q2JA 3TUOA 3NZLA 2L1PA
chains in the Genus database with same CATH superfamily
4X4EA 3VUWA 3HRDD 1M4VA 5IAAC 2LUEA 3Q3OC 4WJOA 2LUMA 4RGOS 2O2VB 2JUOA 3AB5A 3ZIMA 2JY6A 4LNKA 2N9LA 3BYYB 2KEIA 2BB5A 5DRYA 2HTME 1X57A 1JMLA 3SD5A 1XCQL 3X23A 1VJKA 3A1QB 3EUB2 3R1FA 2LYRA 4F1SA 1QQAA 2AW6A 2ZPNA 4X4GA 4WAFA 2L7RA 2KC2A 3AU4A 3PTFC 4ZDVA 4S17A 2BS3B 1PFDA 2BYEA 4LNFA 2MBEA 3NVZA 4AJYB 4B95A 2K22A 3UQBA 2WS3B 3DVGY 1WH6A 3M3JA 1WXQA 3EUSA 2LGSA 3CSFA 4HVBA 4BOZB 2KXJA 3O13A 4ER3A 2MJDA 1JALA 2L1AA 1XLQA 3LXFA 1FXIA 4HCNB 3VWSA 4B9KA 1WI0A 2NPTA 3ZQ4A 3WAOA 3IXSA 3NVWA 4URKA 2D5GA 1LM8B 1YN3A 4FA6A 2PXTA 2R2OA 2WDQB 2BNNA 3AH7A 4W9IA 3BS3A 1P0RA 4G0NB 1POUA 2IBIB 2KN5A 3ZNZB 5DRTA 4WURA 3AEDB 4JQWC 1OQQA 1QOBA 3UI3A 5DPSA 3UF8A 2G9HD 2M4HA 2RDBC 2WX1A 3ZW3A 4PU7A 2PXUA 4XC2A 4X4BA 4W9LA 1UWMA 3CMMB 4YL8A 3AE8B 2Z8LA 4X4HA 2JRIB 3TIXA 4LDTB 2K0PA 1WR1A 1SIFA 2Z0DB 2V0GA 3KH0A 2H89B 2XEWA 3T8MA 3NVYA 2A5UA 4F7ZA 2MA9B 1VZ8A 2MJEA 4MM3A 2FIDA 2QDFA 3V61A 1MPEA 4XE0A 4KKIA 4OB4A 1CQVA 3VTWA 4MCTA 1JRUA 2LYSA 4NNJB 3FMYA 4GB9A 4R3DA 4CO7A 1QP0A 1T6BX 2RD0A 2LFIA 4LJPB 2XN9C 4NQLB 4HDOA 2LVQA 2KJ6A 2KJRA 4JX1C 1E6EB 1PYWD 4B0MA 2L05A 2XXPA 1FFVA 3Q8EA 1EF1A 3E56A 1FEHA 2WXNA 2N7EA 3TSSA 2DYOA 4ZYNA 3L13A 3BVMA 2KHWB 5AZHA 1L6UA 3R09A 2HCNA 3C0RB 3TEWA 3WAMA 3OJ3A 1RIOA 3QYXA 2FNJB 2KKCA 2GBJA 3NHEB 2QIEB 3OLMD 1E5WA 1TKYA 2WIUB 3AEFB 3NZ3A 2BVCA 2MXDA 3P1MA 1XQQA 1SJHD 3DHIC 2IYDB 3D1NI 3LFPA 3D32A 3L16A 5J2RA 4C00A 1MHHE 4PS7A 3T3NA 3DVNV 3W1SC 2JWUA 5C23A 1O4XA 4ER0A 2GBRA 2N9XA 4IWPA 2FAZA 1E90A 2WUSR 4PU4C 2KZRA 3IAS1 1MG8A 4MDKE 1FNUA 4ZRIA 1FNVA 1YIWA 5KHOA 4KZ0A 1WWTA 2DHZA 5DTQA 3SHQA 1GJZA 2LEKA 1J7CA 3AU5A 4MGYE 2PLPA 2XI8A 3A9YA 3TELA 1L5PA 2PMVA 2RMMA 3CWIA 3T3OA 1FNWA 4FADA 1S7EA 3LYYA 1PGAA 4G11A 3JSVA 2ZW0A 1B0NA 4EKIA 1TKEA 3RUIB 5IOIA 4KGTA 4MT5A 3L4PA 4WJPA 2FCMA 1ZXHA 3NZSA 3R3MA 1WE7A 4FJVB 2RDHA 2WNMA 3QK0A 3A4RA 3RI7C 1YMHE 4A6QA 4OVZA 4JQDA 2OJWA 2NPTB 2BBCA 4YT0B 2OOBB 1Q10A 1I35A 1I4PA 1WETA 2YBDA 3SFDB 4Y42A 4F8CB 3RNAC 3MEJA 3BVGA 4JL9A 2N9PC 1V49A 3U2SC 4LTUA 2ACZB 2D07B 1ZE3D 3QF3A 4KDIC 1UTXA 3VUXA 4M8NA 4YXDB 1XT9B 3SFEB 3SU8X 3P4RB 4TKNA 5L83A 3PRZA 4OVVA 5LLIA 2KMAA 5G5GA 3JW0X 2MEKA 1TJEA 1YN5A 2GRIA 2MEZA 4C56C 3PZDA 1TTNA 2A4ZA 1U4AA 5CX3A 2N9KA 2DZMA 1YQ3B 3OG5A 3OMTA 1BT0A 4M0WB 1E7PB 4NAWB 3G7DA 2EF8A 1CJEA 1WGGA 1T3QA 3A4SC 2Y3AA 1QILA 3CLCA 3DWGC 2ON8A 1S3SG 3NS8A 4RNAA 4WQOB 4DDID 2M0AA 3NVVA 3IT4B 1AARA 3F51A 3P42A 4YG1A 4H2AA 2MHJA 1ZZCA 3SR4A 5E6OA 2EWTA 1JH9A 3X0WA 2KTFA 1MFWA 1FCLA 2LGDA 2L76A 2FBWB 1WX8A 4RGMA 1P1AA 4IWRA 3U52E 3AV8A 1LLIA 1ENFA 2JSVX 4M0WA 2W9NA 1L6VA 2IV1A 1QQRA 3TMPB 2XJ3A 4II3B 3IVPA 3AEAB 1EFAA 1MVKA 2LYJA 2L0FA 4E3CA 3U30A 4IC7B 1DGJA 4A9AA 1V1PA 3VTVA 1J19A 2IGGA 1GC7A 2GRMA 2WXIA 2IDYA 1OFFA 4OZCA 4BFRA 1ZS4A 3Q3FA 4GSWA 2W54A 2AQ2B 3H5TA 2MBHA 1WX9A 2MBOA 1NI2A 2DAFA 4NJ6A 5AZGA 2KDFB 3HZIB 5D3IB 4AUQC 1T0QC 2BJCA 3OQNA 3K9PB 4W9FA 2XK5B 2KFKA 4W9EA 3IFWB 4N58A 1HQ1A 1C76A 2VRRB 1WXSA 3I9V1 4YTMB 1TGZB 2DYMA 4G3XB 5KHQA 3B0AA 1OSLA 2NCNA 4Z58A 2JU6X 4RGTA 4EFOA 2HDEA 1WZ0A 1YQ4B 1LXDA 3TBLD 1UH6A 2N9EB 1KFYB 4KKJA 2M1MA 4KZCA 4YTNB 3RULA 3GE3C 4YWGG 1SE3A 2ZPYA 2INNE 2JVLA 2PUFA 3BWUD 2LJ5A 4ICUA 5BYSA 2J4XA 2D11A 4MEMA 4UDUC 3TCAA 3OQOA 4W9CA 1N63A 2MSED 1XD3B 1V2YA 4WJQA 4FLHA 1QLBB 3EFUA 3MFGA 3VR9B 3WA0A 1QP4A 3ZJTA 1WIZA 2O38A 5D3DA 3U7DA 1L2NA 2DYBA 2LRWA 1JFTA 2ZCCA 3A9ZA 1ZPSA 2CU3A 4JLCA 2LYLA 2V1YA 2QJLA 3I63C 1SEBD 3Q3MC 3AE1B 4ER6A 4ASWC 1Z2MA 3H8HA 4TQ1A 4WIPA 1Q5WB 3SEBA 3LQXA 1C3TA 1NEKB 1P3QU 1RYJA 1F0ZA 3AXCA 3PLUA 4P6VF 2WGSA 2B3AA 3AE5B 2KZ8A 1CK1A 4DDGD 3PZ7A 2GMIC 2RR9A 3U4EG 3QX1A 1F2RC 1V97A 3Q3JA 4K81A 4K7WA 5EE0A 4EKGA 3V62A 2HCSA 2DBYA 2WXJA 5EE9A 4TQ0A 4ARIA 4RF1A 4JGHB 2ONQA 1TS2A 3PVLA 4E74A 4WWPA 1WGDA 2K39A 3KWVA 2KDIA 4RM8A 5IP4D 4XGAB 3L54A 3A33B 1JWMD 2XIUA 4HDQA 4PU8A 1LO5D 2J53A 4FHJA 3MTNB 3OP9A 3HIZA 4OZAA 2REXA 3N20C 2BKRB 4C4VA 2K8BA 4M00A 3VQIA 3W1YA 2O49A 4GHJA 2QC8A 1SJED 3KUCB 1WYWB 1WR6E 3PRPB 3UIPB 5EDSA 3ZPXA 4IM3A 2D5VA 3NS1A 2C7MB 1L1MA 1WXAA 5C3JB 3GZDC 2MX2A 2LXAA 1DULA 2AWTA 3P4QB 2BYFA 1SQ8A 4ZOHC 3HM6X 2CKHB 4AWJA 3A9XA 3J9CA 4HLEA 1IYFA 4RGNA 2XSDC 4FN2A 4EOYA 3UIOB 1AYFA 1C1YB 4Z59A 3L0WB 3MJWA 3OJ4B 1KTKA 2L49A 2LVPA 2JCGA 4L1BA 2WHIA 2PXFA 3PLVA 3TEPA 1RPEL 3SCFA 3OAWA 4HPMB 2E3TA 3A9KA 2PUGA 1TS3A 4IKGA 4Z5CA 4J1WA 3PO0A 4RFBA 4ANUA 1ZW7A 2MQJA 3QWZB 1QPZA 1E9MA 1JWAD 2BKFA 3KXAA 3ML9A 1N60A 2ZVNA 5BYRA 4N6EB 2D3AA 2DWQA 3E9SA 5BO4B 4WWOA 4YTPB 2PTLA 5DT2A 3KVFB 2IJ0A 3KQ4A 3FYMA 4HRAA 1IPGA 2AL3A 1LFDA 4GOCA 1AWDA 2NR2A 5DPWA 1NEQA 3O9XA 3UGBB 4ANVA 2PXPA 3B08A 3Q8CA 1P7EA 1GC6A 1QP7A 4TUUA 2L52A 2WXFA 3G5GA 2R63A 1RM6C 2KJHB 4KGSA 2ICTA 3N1YC 3MC9A 3H7PB 4GDLA 2G1EA 3JXBC 2DX5B 4PU3C 2IO1B 2JQEA 2V3SA 4MELA 3ZLZA 3JXDL 1VDVA 3DBSA 4YSYB 5BMIA 4AJWA 1RFAA 4W9GA 1WSPA 4DE8A 3BK1A 3RMKC 1FCCC 4JPSA 1ACCA 3C8YA 2AX5A 3GZCA 3TRBA 4BKTA 2JXXA 3TJPA 4ZRQA 2J7UA 4C7ZA 1K50A 2PVOD 1MHXA 4MH8A 2I38A 3VRAB 2YVCA 3ZYYX 4RCOA 2QILA 2PKOA 2XK5A 3ZHMA 2GZUA 4FBJB 2UYZB 1MJDA 1KJTA 1ZVVA 1HZ5A 5GMVA 1D5XC 1KLGD 1WGKA 2KWDA 3BK2A 4G50A 1EU4A 2N1VA 2Y5BB 1JW9D 3DPDA 1OQRA 3V6EB 5FK9C 1VRAB 1H8CA 4DHZE 2KWUB 1E8YA 2YLMA 2NTSA 2N4FA 3RN9C 2V9HA 2INCC 3CECA 3QWGA 3KZ3A 2DLBA 4XDCA 1FRRA 3N30A 2C7NB 5E6PA 2HD5B 2WDRB 2KFKB 1TYGB 1JWBD 3FILA 1I4QA 5IO9A 1ZZBA 1QOFA 2GI9A 1YOVB 2PXBA 2A6CA 4KIKB 1R63A 3QOWA 2VH2A 2J0KA 2JRHA 2O2VA 1V5TA 3WAPA 2ZJDA 3PS6A 1X2LA 5AZFA 3UQAA 2PUAA 1WRIA 1TS5A 1K53A 2WXKA 3L1PA 2LHEA 3ONSA 3QJZA 4FJZA 3U3WA 3V60A 3Q8AA 3GS2A 2IY1B 5DSXA 1WGRA 3P63A 4JCXA 3ZGZA 1N5XA 4OZBA 4KIKA 4ITKA 1UGJA 5JHBA 3APFA 1R4NI 2L1PA 1FFUA 2QEJC 1I4HA 2HINA 1IBXB 4IWOA 2WDVB 3A1QA 4NAMA 2FCSA 2KQ4X 1RAXA 1XLOA 1V80A 2HE7A 3BVZA 1E0ZA 1ZZ6A 2PXLA 3M95A 3BD1A 1WH8A 4A8XC 2KDBA 2LASA 2BF8B 2BWES 1GB4A 4XX5A 2IGHA 1K8RB 4X4IA 4QAYA 5J18A 4C7YA 2YEPB 4DXFA 4HKQA 1PDXA 4FJYA 4IUMB 2CHWA 4N59A 3GB1A 3N32A 1RZRD 3Q8FA 3VHTC 4CYEA 3F52A 1K52A 5MPOA 2BS4B 5DTMA 4XWTA 3RNBC 3DBHI 1GB1A 2KQ7A 3QHTA 3QAQA 3GP7A 2INDC 2O6VD 2BQQA 2KEJA 4GXBA 2LHDA 4RMAA 1ZZ9A 2LYPA 4K1RB 4GIVA 2WXHA 4OBMA 4MSMB 3UFDA 1RZSA 1AW7A 1DW9A 3DOWA 2GBKA 1HZ6A 1C4AA 3MC8A 2JT4B 3QIJA 2M8SA 1KM7A 2G3QB 2PUCA 4ARCA 2MLBA 1I7HA 3CF6E 1J7BA 2R1JL 4NJCA 2KYWA 5G55A 3R7RA 1IGCA 1UGMA 2KPJA 3ZXVA 2BTEA 1ROEA 3MHSD 1WFYA 1FXAA 4KDLB 3B2FA 2J42A 1C77A 2NBUA 4ZHPA 1TZ1A 1CMXB 4K3BA 3AE6B 1R4NB 1VZ6A 4IM2A 3V05A 3N1XC 3SX0A 2CJOA 3WANA 1DOXA 2BNMA 1C4CA 3ZRFA 2V3CC 2OR1L 3R66C 1KOTA 4DE9A 3AEBB 1TIFA 5JUWA 4ACFA 3V6CB 2O6VA 2ICPA 1Z5SB 4GN1A 5E6NA 5LXIB 5DPTA 4L2YA 3LB8C 3KL4A 5D2MB 1QOAA 4XZ4A 4O8BA 3W2DA 1CZPA 4WQMA 2ASQA 1GG3A 2NTTA 1KF6B 2PUEA 1V9JA 2LYQA 2LD9A 2IO3B 2EELA 2O4AA 2L0TA 2ZCBA 5LNK1 5HG2A 3AULA 3AECB 1EU3A 3RYTA 5AUKA 4A55A 1F77A 3HM3A 1QF6A 2PW9A 2Z0EB 1C79A 2BGFA 3EECA 3QQ6A 4ZHOA 4ANXA 3NXHA 3SCGA 5IA7A 3RZZA 5D7GA 3DBLB 3I57A 1N6ZA 4HKZE 3JYUA 3W5VB 2XBBC 4NQKE 4DWFA 3LJ3A 2RPVA 2WYQA 3TEYA 4YG4A 4JE3B 4BAXA 1SE4A 1FO4A 1YJIA 2LVOA 1ZP0B 3SR6A 3R2IA 4EZJA 2CHZA 1S1QB 1T0YA 1E7UA 1UD7A 1TZOA 3GOEA 1PERL 5A7LA 3NOBA 4GDLB 1WMHA 4EQZA 2EMTA 1XF5L 3NY5A 4GGQA 4XWWA 5I4DA 2K5PA 1D6EC 3OWEB 3SCHA 3ENEA 5CTRC 1YSEA 1ET9A 3VH3B 4P1BC 3ZVVA 3BY4B 3TL5A 1K51A 4EK9A 1R69A 5IKCM 5JHAA 2BB6A 3ETRA 3DNVB 3ZTCA 1LCCA 2L3ZA 1UWXA 4X4CA 1M94A 4J1XA 2Z59B 3BZDB 3C19A 3RT3B 5EE3A 2BYTA 5GAHi 4N9F4 2X8XX 4DHJD 2JVCA 3R2TA 3KJXA 4EZIA 3ZKJC 3KYCD 2D3CA 2M19A 4HXDA 1MI0A 4S0RA 4DHJB 1NDDA 2LJIA 2ZW1A 3EGRA 2W55A 1Q0WB 1R7SA 5D94A 3MP9A 4DXGA 2IO2B 4M02A 3V3XA 4L23A 1QT9A 2IUOA 2AQ3B 1DOIA 2EKEC 2RPQA 2K3UA 4MGKE 3M9LA 3RNCC 3KUDB 2AEHA 2WXGA 3AMZA 2IVGA 1WMHB 1EWCA 2M17A 2KLGA 3DBRB 1E7VA 1D4BA 4LCDE 1OEYJ 2QSDA 2LYKA 1WY8A 2KX3A 5DCNA 2JPHA 1V1OA 3H1UA 1WJ4A 3ZXRA 4WWMA 3VVWB 5DTRA 3PHWB 3OQMA 1PQSA 2EMSA 3ALBA 2D3GA 3RFZB 2CSFA 2MWSB 1SXTA 1C78A 4DQOC 2QHOA 2MP2A 4REZA 3GE8C 1ISNA 1GUAB 4A90A 4EE2A 4BKSD 2WXOA 2K8CA 2L32A 5CHWA 3GZNI 1YN4A 3IHPC 4I6RA 4PYUA 3GZDA 2KDEB 2AQ1B 1FRDA 3PE5A 2ZNVC 1UZXB 2G4SA 2LLWA 4ICVA 1ZXIA 2DZIA 2MQKA 3DVGX 2FJRA 1SBBB 4HEA1 1ZDVA 2CR5A 4WJNA 1ZDXA 1HTQA 5CHVC 1D5ZC 2KAJA 2W3SA 1JWSD 3CIRB 3PRMB 1ZKHA 4CHKA 1IUEA 5TSSA 4GU2A 1L4ZB 5G2NA 1LMB3 3GBFA 1JRPA 1UXDA 4BZAA 3Q3NC 3ZHIA 4HJKA 1KLUD 2KD0A 3Q69A 3DQVA 1AU7A 2JF5A 3URYA 3ZJUA 1PRUA 2KC1A 4FXCA 4MJSB 4ER5A 1GNUA 2JWZA 4X4DA 3MLFA 4MSQB 2N7DA 3DDCB 3Q14C 4YBAA 3AI5A 4US8A 2HJ1A 3KW5B 4TMAB 2J0JA 2E6XA 1WH3A 4HRSA 1NENB 3H9DA 5JXVA 2K9XA 1L0VB 2VZKB 3CROL 1VZ7A 1LQBA 2BS2B 3W9CB 1Y9QA 3SDLC 1WJUA 2PE6B 3DVNU 4ZRPA 2VH1A 4GQMA 4K3CA 2MCNB 1UBQA 1TY2A 1BUIC 3LISA 4JCYA 4MM3B 1PGBA 3RNFC 3PSEB 4FBIA 3BDNA 2RGFA 3DWMA 2JX5A 4K7UA 4BOSC 1ZPQA 2PXKA 1NW3A 3IAM1 2O6VB 4M01A 4BKSA 1XEEA 2NVUI 2KMMA 1NVID 3Q2AC 3QQ8B 3GN5A 1PGXA 3AE9B 4WWNA 3I5JC 2PE9A 2OFYA 2D3BA 4HROA 2HFZA 1Y8RC 1B9RA 3HK0A 2J7QB 4Z5DA 1RRBA 1WF9A 3VRBB 2BWFA 2B5AA 1DYQA 2FFHA 2DNFA 3VTUA 4W9JA 2QCZA 5BMHA 1LGRA 1QB2A 1SGHA 2LWPA 3HUIA 2JXTA 2ZZPB 2BW2A 2DZKA 1YX5B 4JWUC 2LMCA 4AP4C 4KSKC 2NBVB 1I42A 2LGXA 3MHZA 1V81A 2FUG1 1C4PA 1UXCA 4IW0A 3DM5A 1HXYD 2SAKA 2NMQA 3PZ8A 1SSNA 1CQTA 2KNBA 3BYTB 1WJNA 2DENB 3CSTA 2WQYB 1WXMA 1SB3C 3TEXA 2OJRA 2WXLA 4C80A 4ZRJA 3ZJVA 3APDA 1ZZ7A 4EUTA 4LLGM 1WYGA 3VH4B 1WE6A 1XO3A 1JROA 4DXAB 1AN8A 3AN1A 3HHMA 2LGYA 2MBQA 1SE9A 3BINA 1BXTA 4WVLA 1U2ZA 1UELA 2VEOA 3L08A 2JQRB 3BIID 3VR8B 1PUTA 3NRZA 4B6WA 3HVZA 3ZNHB 3ZKCA 4I6TA 4HK2A 1HQRD 2WXRA 1VR9A 4I6UA 1B1ZA 4I6LB 2MRPA 2KFJA 3IBEA 1VCBA 3APCA 4RH6A 3H7PA 4C4VB 1LCDA 2CU1A 3N3KB 1T5XD 2H88B 2AL6A 1ZUGA 2B76B 4PS8A 2WXMA 4AS1A 3GUUA 4DK5A 3G0TA 1FM0D 1L7YA 2KVZA 2PXVA 5IN7A 4W9DA 5FKAC 3ZDTA 1STEA 3W5UB 2LI5A 2MH7A 4FN3A 4Q2JA 1V6EA 2C9WB 2ICIA 1GOZA 1EWYC 2LLVA 3L10B 3ME5A 3R8BA 2CJNA 3JVZX 1NYQA 2KWVB 2WDTB 3B9JA 1QZEA 2K8HA 3KLSX 4YSXB 5HFYA 2C5LC 3AEEB 3AE7B 4KSLC 4EEWA 1NYRA 4IWQA 3RNGC 5AEKB 2AXUA 3RZFA 2JYTA 4OW0A 3QOXA 1TT5B 2L00B 2LZ6A 5FR3A 3FILB 2NS5A 5GXGB 3ZUNA 2GOWA 3VDZA 2J0MA 3AE3B 1WJ6A 2INPE 1H4RA 1BMLC 3ZNGC 1NI3A 4LJOB 3PREA 2XCJA 4NDWA 3O65B 4US9A 2V4IB 5G5HA 2N0SB 1XWRA 2D10A 1L0XB 4AQ7A 2WLBA 4DHZB 4JIOU 4O1NA 1QKZA 4BBNF 2OEDA 3VFKA 2M0XA 1KLVA 2W3RA 2CROA 4D2KA 3RPFC 2LGIA 2PUBA 3OWQA 1UNSA 1EM7A 1SF0A 3VXWA 2AYOB 3S8QA 3PT2B 2K6QA 5FR6A 5H8YE 1ESFA 3VUYA 3N1ZC 1JWUD 3ZTDA 2BNOA 1X1MA 4HWIB 1P7FA 3R7QA 5H92C 3PPAA 1F52A 2PXEA 3K9OB 1DWKA 2PXDA 2M56B 1D3ZA 3P4PB 2WWZA 2C60A 4IA8A 3RNEC 1HA5A 4GMVA 5L95C 2RDGA 2KDMA 4P1CC 2KN4A 1QOGA 4A20A 1C9FA 2PIAA 1F2RI 1XCTL 3U7ZA 1OGWA 2D2QA 2FUHB 4EKUA 2IU7A 2MBBB 1TBEA 1A5RA 1IBXA 3FC4A 2CHXA 3W1SA 3GZNB 2KTRB 1ZZ8A 2XXAA 3Q8BA 1UUPA 1FPYA 1YNTE 3P4SB 4WH4A 1G6JA 1YD8U 2BYVE 3RCZA 2OHFA 1XXGA 4MH0E 1BDIA 1FXTB 1WRDB 1E8XA 4I6NB 4JWSC 4LNIA 4WAAA 4X57B 2MW5A 1YJJA 4P16A 4HPLB 2KQSA 3UWPA 1JWLA 5E6JA 2G4DB 4MGZE 1WIAA 2UWQA 2PXQA 3MJ5A 1GPXA 3NROA 4F8DA 2WXQA 3DBRI 2Q5WD 1QZXA 1ZOYB 1T0SC 3B7HA 3U8ZA 4TSSA 1P98A 3A9JB 3HVDA 1XLPA 3DBLI 3Q6BA 1ADRA 1J8CA 3A9KB 3VAWA 2CS4A 1XLNA 3FAHA 1OEYA 4LNNA 3AE2B 2GLSA 2RSUA 4PYZA 3WCQA 1HTOA 3TEZA 1BDHA 1LQCA 3ABVB 3A9JA 3DBHB 4AOFA 2KWCA 4KVGB 4ER7A 3NDBB 1UF0A 4BBNC 4MJSA 1YJ1A 3IT6B 2C7HA 3M63B 3PGEA 4OVUA 2N7JA 2X38A 2GBMA 2K6DB 2L83A 3H7SA 3F6WA 1FMAD 3S2AA 1SIJA 2EBYA 2AXVA 2W82A 3DCGA 3ZNID 2KTRA 2EKIA 2JZ3B 1E10A 3H6NA 1R4MI 2KT7A 3GN5B 2Y5PA 2JZZA 1RLFA 2KANA 1ZGUB 2K25A 2YEPF 2HSGA 2IY0B 1WGYA 1CJGA 3KUZA 2TSSA 3MC0B 1SE2A 4P7IA 4A3OA 3OKZA 1N62A 1V86A 2VZKD 3RZWC 4MGIE 4DBGA 2ZNVB 3UINB 4RM9A 2N1WA 3TFLA 5JZEB 4EZLA 1A70A 3M62B 2MJ3A 2V4LA 1IP9A 2XXQA 4W9KA 1GAQB 1Q1OA 2KVRA 1JQ4A 1VD2A 2FE8A 2PE5A 5J17A 1J7AA 3WIMA 3P2BA 1VPWA 2BT6A 1E8ZA 5EE1A 4HJGE 4K7SA 2IZVB 1HF0A 1ZAYA 2KMCA 2GRLA 2PIJA 1V8CA 1WXVA 3QA8A 5DPRA 3ZO5B 5C1ZA 3QCAA 2R2QA 3JSVB 3FYAA 3NZLA 2PUDA 4ZRKA 1YQBA 2KX0A 1I4RA 1TKGA 2WXPA 1OCTC 1KH0A 1JFSA 2L8NA 3KYDD 3I3TB 1IC8A 2NBWB 2M4NA 2R61A 3EC8A 5AUIA 2PVGC 1MG4A 2LCVA 1OQYA 4PK1A 2IGDA 2AXZA 1WM3A 5K98B 1HEZE 2Y5CA 4MCXA 2FIFA 1WZ3A 1MFQC 3FKYA 4OHJA 1HE8A 4X4FA 2KLCA 2WU5B 4YARA 4NPNA 1I4XA 1J0GA 1I4GA 2KACA 4A3PA 2PPXA 4BVUC 1FD6A 1WGHA 3ML8A 4RF0A 4NJ7A 5CHFA 3AEGB 4PS3A 2I2YA 1N61A 2AWIA 2J7WA 5BYQA 2PPHA 5HHDG 4IG7B 4MACA 4M8MA 1ET6A 2K1FA 4W9HA 1KRHA 3ZDMC 2I1KA 1V1PB 4GDKB 3VK0A 4I8TA 1Y56A 1PRAA 2AUWA 1RFKA 3QARA 1EF5A 3AM9A 1WX7A 2JYEA 2JZPA 3EFCA 3B1LX 5BMGA 2WX0A 1NBFC 1DOYA 1L4DB 2H8RA 4NZLB 1NERA 2J52A 2QMTA 4E71A 2PEAA 3EA6A 1RZRA 5HI1A 2IVBA 4KX6B 4HCPB 4LDTD 1EUVB 2KK8A 1F9JA 1YX6B 4IM0A 3PXPA 4USAA 4FULA 2LXCA 1P9DU 2UU7A 4LNOA 3QC8B 3TUOA 4II2B 4IOIE 1F1HA 4GDKA 1PNRA 4B0EA 3ECIA 4PT5A 1IGDA 2KO3A 4BKGA 2DAJA 4XYCA 4YSZB 5C2TB 5LXHA 1TS4A 3WALA 5TR5A 1VLBA 3LDZE 1FIQA 3RD2A 3DHGC 2IO0B 3ZRCA 4GLSC 4NY0A 2ZEQA 4J6IA 4ZYSA 4I6PA 5GAGi 2WU2B 3PV1A 3IG3A 3L17A 3IVFA 1ZUD2 3DHHC 2I1JA 2ODRD 3NJTA 2LNMA 1PRVA 3QFIA 1QQBA 1JCKB 3PHXB 1R4MB 4KGRA 4LK0M 2FCQA 4KV2A 4TV3A 1D5MC 2DZJA 1E8WA 1E3OC 1N5WA 2KEKA 2IVQA 1WM2A 4Z5HA 2ZVOA 2V3NA 5T8IA 3N9YC 2IPKD 2FCNA 1GT0C 3T9LA 4XDDA 4IVZA 2HJ8A 4FHKA 5HKHA 3B2GA 3KWLA 3NZUA 2L8JA 2BPSA 2SEBD 2XNAC 4ANWA 1UBIA 1V5OA 2HTHA 4CQNA 4EZKA 1OTRB 1Y7YA 2GBNA 4HPPA 4IDIA 2KOXA 2WP9B 2GB1A 5JH5C 1TY0A 1EO6A 4NAWA 1RWSA 3JXCL 2G45B 4YG7B 4J3OD 2LRUA 5D6JB 1T0RC 2MP2B 2PJHA 3NUHB 2V3PA 3AE4B 3EHVA 3NG0A 1L0YB
chains in the Genus database with same CATH topology
1NYRA 4UDUC 1N63A 3HRDD 4L2YA 1M4VA 3LB8C 2JYTA 4OW0A 1QLBB 1QOAA 3MFGA 3QOXA 3VR9B 2LUMA 4RGOS 5FR3A 3FILB 5GXGB 3W2DA 1CZPA 3AB5A 4WQMA 3ZJTA 3AE3B 2NTTA 5D3DA 2N9LA 3BYYB 1KF6B 2INPE 1BMLC 1NI3A 2BB5A 5DRYA 4US9A 2HTME 2EELA 1JMLA 2V4IB 1XCQL 5HG2A 5LNK1 3AECB 5G5HA 1EU3A 2N0SB 3A9ZA 1L0XB 1VJKA 1ZPSA 2CU3A 2WLBA 3EUB2 1F77A 4O1NA 5AUKA 4A55A 2PW9A 1QKZA 1QF6A 1C79A 2OEDA 2QJLA 4ZHOA 3NXHA 1SEBD 3AE1B 4ER6A 2W3RA 4D2KA 5D7GA 3RPFC 4WAFA 2LGIA 3H8HA 3I57A 4TQ1A 4HKZE 4WIPA 3OWQA 3SEBA 3W5VB 1UNSA 1NEKB 1EM7A 1SF0A 2BS3B 2RPVA 1PFDA 1RYJA 3TEYA 1F0ZA 4JE3B 4P6VF 3AE5B 1FO4A 1SE4A 1CK1A 3NVZA 1YJIA 1ZP0B 3SR6A 2K22A 3PZ7A 5H8YE 1ESFA 3R2IA 3U4EG 1F2RC 2WS3B 1V97A 1JWUD 5EE0A 1TZOA 4EKGA 1WXQA 1P7FA 2HCSA 2DBYA 4AQ7A 2WXJA 4GDLB 5EE9A 3O13A 4ER3A 5H92C 4TQ0A 4ARIA 4EQZA 1XF5L 4RF1A 2MJDA 1JALA 2L1AA 4XWWA 2M56B 2ONQA 5I4DA 1XLQA 2K5PA 1FXIA 1TS2A 3LXFA 3P4PB 1D6EC 3OWEB 3VWSA 3KWVA 3ZQ4A 1HA5A 2RDGA 1ET9A 2KDMA 1JWMD 1K51A 3IXSA 1LO5D 2KN4A 1QOGA 2J53A 3NVWA 4EK9A 2D5GA 1C9FA 2PIAA 1F2RI 1XCTL 3U7ZA 1YN3A 2BB6A 4OZAA 3ETRA 2WDQB 1UWXA 1IBXA 3AH7A 3FC4A 3W1SA 5DRTA 3BZDB 3VQIA 4WURA 3AEDB 5EE3A 2BYTA 1OQQA 1QOBA 3Q8BA 1SJED 3UI3A 1UUPA 3P4SB 1YNTE 4WH4A 2G9HD 2M4HA 2OHFA 1XXGA 3R2TA 4JWSC 4EZIA 3ZPXA 1UWMA 2M19A 1MI0A 1YJJA 4P16A 3NS1A 5C3JB 3GZDC 2LJIA 3AE8B 2ZW1A 2Z8LA 3P4QB 3UWPA 5E6JA 4ZOHC 2K0PA 3EGRA 2W55A 1R7SA 3A9XA 3J9CA 3MJ5A 3MP9A 4DXGA 4RGNA 2V0GA 1GPXA 3NROA 2H89B 2WXQA 3V3XA 4L23A 1QT9A 2Q5WD 2AQ3B 1DOIA 3NVYA 1ZOYB 2K3UA 3M9LA 1AYFA 1KTKA 4TSSA 1VZ8A 3HVDA 1XLPA 2WXGA 2MJEA 3AMZA 1EWCA 3AE7B 4L1BA 1D4BA 1MPEA 3TEPA 4XE0A 4KKIA 1CQVA 1XLNA 3FAHA 2QSDA 3AE2B 3WCQA 3TEZA 4R3DA 2E3TA 1T6BX 3ABVB 2LFIA 1V1OA 2XN9C 4WWMA 1TS3A 4IKGA 5DTRA 4JX1C 4ER7A 3PO0A 1E6EB 4RFBA 1PYWD 4B0MA 3RFZB 2XXPA 1FFVA 1SXTA 1C78A 3IT6B 4DQOC 1E9MA 1JWAD 2N7JA 2X38A 3E56A 3Q8EA 4REZA 1FEHA 1N60A 2WXNA 3TSSA 2L83A 5BYRA 4A90A 4N6EB 4EE2A 2DYOA 1FMAD 2DWQA 3E9SA 2WXOA 3BVMA 1L6UA 3R09A 2HCNA 2L32A 4YTPB 2PTLA 5DT2A 1SIJA 2IJ0A 3TEWA 3KQ4A 1YN4A 2W82A 4HRAA 2EKIA 3GZDA 2AQ1B 1FRDA 1AWDA 3PE5A 2QIEB 1E10A 2LLWA 1TKYA 2Y5PA 3Q8CA 3AEFB 3NZ3A 1P7EA 1ZXIA 2MXDA 3P1MA 1SJHD 2YEPF 2L52A 2WXFA 2TSSA 1RM6C 1SBBB 3MC0B 4HEA1 1SE2A 1ZDVA 4KGSA 3OKZA 1N62A 2VZKD 1ZDXA 1MHHE 1D5ZC 3T3NA 2KAJA 2JWUA 2G1EA 2W3SA 4ER0A 1JWSD 3CIRB 1IUEA 3TFLA 5TSSA 1VDVA 1A70A 1L4ZB 4YSYB 3IAS1 5BMIA 2MJ3A 1FNUA 1WSPA 1FNVA 2XXQA 1JRPA 1GAQB 1WWTA 4DE8A 5DTQA 3BK1A 1JQ4A 1FCCC 2FE8A 1ACCA 3C8YA 4JPSA 1KLUD 2AX5A 2LEKA 1J7CA 1J7AA 3GZCA 3Q69A 2PLPA 2BT6A 3TELA 3A9YA 1L5PA 2PMVA 2RMMA 3CWIA 5EE1A 1FNWA 4ZRQA 3T3OA 4HJGE 2J7UA 4C7ZA 3LYYA 1PGAA 3URYA 3ZJUA 1K50A 4FXCA 4ER5A 2PVOD 1MHXA 1V8CA 2I38A 2ZW0A 4MH8A 4EKIA 3VRAB 1TKEA 3ZYYX 4RCOA 2QILA 2PKOA 4KGTA 4US8A 4MT5A 3L4PA 4TMAB 3NZLA 1ZXHA 2E6XA 1I4RA 1TKGA 2WXPA 4HRSA 1HZ5A 1KH0A 2RDHA 2WNMA 1NENB 1D5XC 1KLGD 1WGKA 2KWDA 3BK2A 2K9XA 5JXVA 1EU4A 1JW9D 1L0VB 1OQRA 1YMHE 4A6QA 4OVZA 2R61A 1VRAB 2VZKB 5FK9C 5AUIA 1VZ7A 2PVGC 2BBCA 2BS2B 4YT0B 3W9CB 2IGDA 1Q10A 1I4PA 2NTSA 2YBDA 3SFDB 1HEZE 4ZRPA 2Y5CA 3MEJA 3BVGA 4OHJA 1TY2A 2DLBA 4XDCA 1BUIC 1FRRA 2WU5B 3U2SC 4LTUA 4MM3B 2ACZB 1PGBA 1ZE3D 1I4XA 2WDRB 1I4GA 3DWMA 2KACA 2JX5A 1TYGB 1JWBD 3FILA 1FD6A 1I4QA 1NW3A 3IAM1 4RF0A 4YXDB 3SFEB 1XEEA 3AEGB 1QOFA 2I2YA 2GI9A 2KMMA 3P4RB 1N61A 1NVID 2J7WA 5BYQA 1PGXA 3AE9B 3QOWA 5HHDG 4MACA 5G5GA 2MEKA 1TJEA 1ET6A 1YN5A 2GRIA 1KRHA 4HROA 4C56C 2HFZA 1B9RA 1WRIA 1TS5A 1K53A 2WXKA 2LHEA 2N9KA 1YQ3B 3VRBB 1V1PB 4GDKB 3Q8AA 3GS2A 5DSXA 1E7PB 3P63A 4NAWB 1Y56A 1DYQA 3ZGZA 1CJEA 1T3QA 1RFKA 1N5XA 5BMHA 4OZBA 2Y3AA 1UGJA 3AM9A 4ITKA 1QILA 3HUIA 2JXTA 2BW2A 2JYEA 2ON8A 2L1PA 1FFUA 2QEJC 3DWGC 2JZPA 4RNAA 4JWUC 2LMCA 1I4HA 5BMGA 2M0AA 3NVVA 3IT4B 1IBXB 2WDVB 1DOYA 4NAMA 2KQ4X 3P42A 1XLOA 1L4DB 4H2AA 3SR4A 3MHZA 3BVZA 2FUG1 1E0ZA 4NZLB 1C4PA 2J52A 2QMTA 3EA6A 1HXYD 5HI1A 2SAKA 4A8XC 1FCLA 2NMQA 3PZ8A 1SSNA 4KX6B 3BYTB 2FBWB 4RGMA 2WQYB 1SB3C 3U52E 3TEXA 2WXLA 4C80A 4USAA 1GB4A 3ZJVA 2IGHA 3AV8A 4C7YA 2YEPB 1ENFA 3TUOA 2JSVX 4IOIE 4DXFA 4HKQA 1PDXA 4M0WA 4LLGM 1L6VA 4N59A 4B0EA 1WYGA 1QQRA 4PT5A 3GB1A 1IGDA 3AEAB 1MVKA 3Q8FA 1XO3A 5C2TB 1JROA 4YSZB 1TS4A 1AN8A 3AN1A 1VLBA 1FIQA 1K52A 1DGJA 1BXTA 4WVLA 2BS4B 5MPOA 5DTMA 4A9AA 1U2ZA 1V1PA 4XWTA 1GB1A 4GLSC 2VEOA 2JQRB 2IGGA 4ZYSA 3BIID 3VR8B 1PUTA 2WXIA 2IDYA 1OFFA 3GP7A 3HVZA 3NRZA 2WU2B 4OZCA 2LHDA 1ZUD2 2W54A 1HQRD 2AQ2B 2ODRD 2WXRA 1VR9A 2LNMA 1B1ZA 2WXHA 3QFIA 1JCKB 4KGRA 4OBMA 4LK0M 1AW7A 1D5MC 1N5WA 5D3IB 4RH6A 1HZ6A 1C4AA 4ARCA 1T5XD 1I7HA 2H88B 1J7BA 2V3NA 3N9YC 5T8IA 4N58A 2IPKD 4NJCA 1C76A 2B76B 3I9V1 2WXMA 4AS1A 4XDDA 1IGCA 4YTMB 3GUUA 2DYMA 3G0TA 1FM0D 3B2GA 3KWLA 2BTEA 1ROEA 5FKAC 1STEA 3W5UB 2SEBD 2JU6X 2XNAC 2MH7A 4RGTA 1FXAA 4CQNA 2HDEA 4Q2JA 2J42A 1C77A 3B2FA 4ZHPA 1YQ4B 2ICIA 4IDIA 1GOZA 2WP9B 1VZ6A 2GB1A 1KFYB 3AE6B 4KKJA 1TY0A 1EWYC 3V05A 2LLVA 4YTNB 1RWSA 3ME5A 3SX0A 4YWGG 1SE3A 3R8BA 2CJNA 2CJOA 1DOXA 1NYQA 1C4CA 2INNE 4J3OD 3B9JA 3KLSX 3NUHB 2V3PA 3AE4B 3BWUD 4DE9A 4YSXB 5HFYA 3AEBB 5BYSA 3AEEB 5JUWA 2J4XA 1L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2J A;  3TUO A;  3NZL A;  2L1P A; 
#chains in the Genus database with same CATH topology
 4X4E A;  3VUW A;  3HRD D;  1M4V A;  5IAA C;  2LUE A;  3Q3O C;  4WJO A;  2LUM A;  4RGO S;  2O2V B;  2JUO A;  3AB5 A;  3ZIM A;  2JY6 A;  4LNK A;  2N9L A;  3BYY B;  2KEI A;  2BB5 A;  5DRY A;  2HTM E;  1X57 A;  1JML A;  3SD5 A;  1XCQ L;  3X23 A;  1VJK A;  3A1Q B;  3EUB 2;  3R1F A;  2LYR A;  4F1S A;  1QQA A;  2AW6 A;  2ZPN A;  4X4G A;  4WAF A;  2L7R A;  2KC2 A;  3AU4 A;  3PTF C;  4ZDV A;  4S17 A;  2BS3 B;  1PFD A;  2BYE A;  4LNF A;  2MBE A;  3NVZ A;  4AJY B;  4B95 A;  2K22 A;  3UQB A;  2WS3 B;  3DVG Y;  1WH6 A;  3M3J A;  1WXQ A;  3EUS A;  2LGS A;  3CSF A;  4HVB A;  4BOZ B;  2KXJ A;  3O13 A;  4ER3 A;  2MJD A;  1JAL A;  2L1A A;  1XLQ A;  3LXF A;  1FXI A;  4HCN B;  3VWS A;  4B9K A;  1WI0 A;  2NPT A;  3ZQ4 A;  3WAO A;  3IXS A;  3NVW A;  4URK A;  2D5G A;  1LM8 B;  1YN3 A;  4FA6 A;  2PXT A;  2R2O A;  2WDQ B;  2BNN A;  3AH7 A;  4W9I A;  3BS3 A;  1P0R A;  4G0N B;  1POU A;  2IBI B;  2KN5 A;  3ZNZ B;  5DRT A;  4WUR A;  3AED B;  4JQW C;  1OQQ A;  1QOB A;  3UI3 A;  5DPS A;  3UF8 A;  2G9H D;  2M4H A;  2RDB C;  2WX1 A;  3ZW3 A;  4PU7 A;  2PXU A;  4XC2 A;  4X4B A;  4W9L A;  1UWM A;  3CMM B;  4YL8 A;  3AE8 B;  2Z8L A;  4X4H A;  2JRI B;  3TIX A;  4LDT B;  2K0P A;  1WR1 A;  1SIF A;  2Z0D B;  2V0G A;  3KH0 A;  2H89 B;  2XEW A;  3T8M A;  3NVY A;  2A5U A;  4F7Z A;  2MA9 B;  1VZ8 A;  2MJE A;  4MM3 A;  2FID A;  2QDF A;  3V61 A;  1MPE A;  4XE0 A;  4KKI A;  4OB4 A;  1CQV A;  3VTW A;  4MCT A;  1JRU A;  2LYS A;  4NNJ B;  3FMY A;  4GB9 A;  4R3D A;  4CO7 A;  1QP0 A;  1T6B X;  2RD0 A;  2LFI A;  4LJP B;  2XN9 C;  4NQL B;  4HDO A;  2LVQ A;  2KJ6 A;  2KJR A;  4JX1 C;  1E6E B;  1PYW D;  4B0M A;  2L05 A;  2XXP A;  1FFV A;  3Q8E A;  1EF1 A;  3E56 A;  1FEH A;  2WXN A;  2N7E A;  3TSS A;  2DYO A;  4ZYN A;  3L13 A;  3BVM A;  2KHW B;  5AZH A;  1L6U A;  3R09 A;  2HCN A;  3C0R B;  3TEW A;  3WAM A;  3OJ3 A;  1RIO A;  3QYX A;  2FNJ B;  2KKC A;  2GBJ A;  3NHE B;  2QIE B;  3OLM D;  1E5W A;  1TKY A;  2WIU B;  3AEF B;  3NZ3 A;  2BVC A;  2MXD A;  3P1M A;  1XQQ A;  1SJH D;  3DHI C;  2IYD B;  3D1N I;  3LFP A;  3D32 A;  3L16 A;  5J2R A;  4C00 A;  1MHH E;  4PS7 A;  3T3N A;  3DVN V;  3W1S C;  2JWU A;  5C23 A;  1O4X A;  4ER0 A;  2GBR A;  2N9X A;  4IWP A;  2FAZ A;  1E90 A;  2WUS R;  4PU4 C;  2KZR A;  3IAS 1;  1MG8 A;  4MDK E;  1FNU A;  4ZRI A;  1FNV A;  1YIW A;  5KHO A;  4KZ0 A;  1WWT A;  2DHZ A;  5DTQ A;  3SHQ A;  1GJZ A;  2LEK A;  1J7C A;  3AU5 A;  4MGY E;  2PLP A;  2XI8 A;  3A9Y A;  3TEL A;  1L5P A;  2PMV A;  2RMM A;  3CWI A;  3T3O A;  1FNW A;  4FAD A;  1S7E A;  3LYY A;  1PGA A;  4G11 A;  3JSV A;  2ZW0 A;  1B0N A;  4EKI A;  1TKE A;  3RUI B;  5IOI A;  4KGT A;  4MT5 A;  3L4P A;  4WJP A;  2FCM A;  1ZXH A;  3NZS A;  3R3M A;  1WE7 A;  4FJV B;  2RDH A;  2WNM A;  3QK0 A;  3A4R A;  3RI7 C;  1YMH E;  4A6Q A;  4OVZ A;  4JQD A;  2OJW A;  2NPT B;  2BBC A;  4YT0 B;  2OOB B;  1Q10 A;  1I35 A;  1I4P A;  1WET A;  2YBD A;  3SFD B;  4Y42 A;  4F8C B;  3RNA C;  3MEJ A;  3BVG A;  4JL9 A;  2N9P C;  1V49 A;  3U2S C;  4LTU A;  2ACZ B;  2D07 B;  1ZE3 D;  3QF3 A;  4KDI C;  1UTX A;  3VUX A;  4M8N A;  4YXD B;  1XT9 B;  3SFE B;  3SU8 X;  3P4R B;  4TKN A;  5L83 A;  3PRZ A;  4OVV A;  5LLI A;  2KMA A;  5G5G A;  3JW0 X;  2MEK A;  1TJE A;  1YN5 A;  2GRI A;  2MEZ A;  4C56 C;  3PZD A;  1TTN A;  2A4Z A;  1U4A A;  5CX3 A;  2N9K A;  2DZM A;  1YQ3 B;  3OG5 A;  3OMT A;  1BT0 A;  4M0W B;  1E7P B;  4NAW B;  3G7D A;  2EF8 A;  1CJE A;  1WGG A;  1T3Q A;  3A4S C;  2Y3A A;  1QIL A;  3CLC A;  3DWG C;  2ON8 A;  1S3S G;  3NS8 A;  4RNA A;  4WQO B;  4DDI D;  2M0A A;  3NVV A;  3IT4 B;  1AAR A;  3F51 A;  3P42 A;  4YG1 A;  4H2A A;  2MHJ A;  1ZZC A;  3SR4 A;  5E6O A;  2EWT A;  1JH9 A;  3X0W A;  2KTF A;  1MFW A;  1FCL A;  2LGD A;  2L76 A;  2FBW B;  1WX8 A;  4RGM A;  1P1A A;  4IWR A;  3U52 E;  3AV8 A;  1LLI A;  1ENF A;  2JSV X;  4M0W A;  2W9N A;  1L6V A;  2IV1 A;  1QQR A;  3TMP B;  2XJ3 A;  4II3 B;  3IVP A;  3AEA B;  1EFA A;  1MVK A;  2LYJ A;  2L0F A;  4E3C A;  3U30 A;  4IC7 B;  1DGJ A;  4A9A A;  1V1P A;  3VTV A;  1J19 A;  2IGG A;  1GC7 A;  2GRM A;  2WXI A;  2IDY A;  1OFF A;  4OZC A;  4BFR A;  1ZS4 A;  3Q3F A;  4GSW A;  2W54 A;  2AQ2 B;  3H5T A;  2MBH A;  1WX9 A;  2MBO A;  1NI2 A;  2DAF A;  4NJ6 A;  5AZG A;  2KDF B;  3HZI B;  5D3I B;  4AUQ C;  1T0Q C;  2BJC A;  3OQN A;  3K9P B;  4W9F A;  2XK5 B;  2KFK A;  4W9E A;  3IFW B;  4N58 A;  1HQ1 A;  1C76 A;  2VRR B;  1WXS A;  3I9V 1;  4YTM B;  1TGZ B;  2DYM A;  4G3X B;  5KHQ A;  3B0A A;  1OSL A;  2NCN A;  4Z58 A;  2JU6 X;  4RGT A;  4EFO A;  2HDE A;  1WZ0 A;  1YQ4 B;  1LXD A;  3TBL D;  1UH6 A;  2N9E B;  1KFY B;  4KKJ A;  2M1M A;  4KZC A;  4YTN B;  3RUL A;  3GE3 C;  4YWG G;  1SE3 A;  2ZPY A;  2INN E;  2JVL A;  2PUF A;  3BWU D;  2LJ5 A;  4ICU A;  5BYS A;  2J4X A;  2D11 A;  4MEM A;  4UDU C;  3TCA A;  3OQO A;  4W9C A;  1N63 A;  2MSE D;  1XD3 B;  1V2Y A;  4WJQ A;  4FLH A;  1QLB B;  3EFU A;  3MFG A;  3VR9 B;  3WA0 A;  1QP4 A;  3ZJT A;  1WIZ A;  2O38 A;  5D3D A;  3U7D A;  1L2N A;  2DYB A;  2LRW A;  1JFT A;  2ZCC A;  3A9Z A;  1ZPS A;  2CU3 A;  4JLC A;  2LYL A;  2V1Y A;  2QJL A;  3I63 C;  1SEB D;  3Q3M C;  3AE1 B;  4ER6 A;  4ASW C;  1Z2M A;  3H8H A;  4TQ1 A;  4WIP A;  1Q5W B;  3SEB A;  3LQX A;  1C3T A;  1NEK B;  1P3Q U;  1RYJ A;  1F0Z A;  3AXC A;  3PLU A;  4P6V F;  2WGS A;  2B3A A;  3AE5 B;  2KZ8 A;  1CK1 A;  4DDG D;  3PZ7 A;  2GMI C;  2RR9 A;  3U4E G;  3QX1 A;  1F2R C;  1V97 A;  3Q3J A;  4K81 A;  4K7W A;  5EE0 A;  4EKG A;  3V62 A;  2HCS A;  2DBY A;  2WXJ A;  5EE9 A;  4TQ0 A;  4ARI A;  4RF1 A;  4JGH B;  2ONQ A;  1TS2 A;  3PVL A;  4E74 A;  4WWP A;  1WGD A;  2K39 A;  3KWV A;  2KDI A;  4RM8 A;  5IP4 D;  4XGA B;  3L54 A;  3A33 B;  1JWM D;  2XIU A;  4HDQ A;  4PU8 A;  1LO5 D;  2J53 A;  4FHJ A;  3MTN B;  3OP9 A;  3HIZ A;  4OZA A;  2REX A;  3N20 C;  2BKR B;  4C4V A;  2K8B A;  4M00 A;  3VQI A;  3W1Y A;  2O49 A;  4GHJ A;  2QC8 A;  1SJE D;  3KUC B;  1WYW B;  1WR6 E;  3PRP B;  3UIP B;  5EDS A;  3ZPX A;  4IM3 A;  2D5V A;  3NS1 A;  2C7M B;  1L1M A;  1WXA A;  5C3J B;  3GZD C;  2MX2 A;  2LXA A;  1DUL A;  2AWT A;  3P4Q B;  2BYF A;  1SQ8 A;  4ZOH C;  3HM6 X;  2CKH B;  4AWJ A;  3A9X A;  3J9C A;  4HLE A;  1IYF A;  4RGN A;  2XSD C;  4FN2 A;  4EOY A;  3UIO B;  1AYF A;  1C1Y B;  4Z59 A;  3L0W B;  3MJW A;  3OJ4 B;  1KTK A;  2L49 A;  2LVP A;  2JCG A;  4L1B A;  2WHI A;  2PXF A;  3PLV A;  3TEP A;  1RPE L;  3SCF A;  3OAW A;  4HPM B;  2E3T A;  3A9K A;  2PUG A;  1TS3 A;  4IKG A;  4Z5C A;  4J1W A;  3PO0 A;  4RFB A;  4ANU A;  1ZW7 A;  2MQJ A;  3QWZ B;  1QPZ A;  1E9M A;  1JWA D;  2BKF A;  3KXA A;  3ML9 A;  1N60 A;  2ZVN A;  5BYR A;  4N6E B;  2D3A A;  2DWQ A;  3E9S A;  5BO4 B;  4WWO A;  4YTP B;  2PTL A;  5DT2 A;  3KVF B;  2IJ0 A;  3KQ4 A;  3FYM A;  4HRA A;  1IPG A;  2AL3 A;  1LFD A;  4GOC A;  1AWD A;  2NR2 A;  5DPW A;  1NEQ A;  3O9X A;  3UGB B;  4ANV A;  2PXP A;  3B08 A;  3Q8C A;  1P7E A;  1GC6 A;  1QP7 A;  4TUU A;  2L52 A;  2WXF A;  3G5G A;  2R63 A;  1RM6 C;  2KJH B;  4KGS A;  2ICT A;  3N1Y C;  3MC9 A;  3H7P B;  4GDL A;  2G1E A;  3JXB C;  2DX5 B;  4PU3 C;  2IO1 B;  2JQE A;  2V3S A;  4MEL A;  3ZLZ A;  3JXD L;  1VDV A;  3DBS A;  4YSY B;  5BMI A;  4AJW A;  1RFA A;  4W9G A;  1WSP A;  4DE8 A;  3BK1 A;  3RMK C;  1FCC C;  4JPS A;  1ACC A;  3C8Y A;  2AX5 A;  3GZC A;  3TRB A;  4BKT A;  2JXX A;  3TJP A;  4ZRQ A;  2J7U A;  4C7Z A;  1K50 A;  2PVO D;  1MHX A;  4MH8 A;  2I38 A;  3VRA B;  2YVC A;  3ZYY X;  4RCO A;  2QIL A;  2PKO A;  2XK5 A;  3ZHM A;  2GZU A;  4FBJ B;  2UYZ B;  1MJD A;  1KJT A;  1ZVV A;  1HZ5 A;  5GMV A;  1D5X C;  1KLG D;  1WGK A;  2KWD A;  3BK2 A;  4G50 A;  1EU4 A;  2N1V A;  2Y5B B;  1JW9 D;  3DPD A;  1OQR A;  3V6E B;  5FK9 C;  1VRA B;  1H8C A;  4DHZ E;  2KWU B;  1E8Y A;  2YLM A;  2NTS A;  2N4F A;  3RN9 C;  2V9H A;  2INC C;  3CEC A;  3QWG A;  3KZ3 A;  2DLB A;  4XDC A;  1FRR A;  3N30 A;  2C7N B;  5E6P A;  2HD5 B;  2WDR B;  2KFK B;  1TYG B;  1JWB D;  3FIL A;  1I4Q A;  5IO9 A;  1ZZB A;  1QOF A;  2GI9 A;  1YOV B;  2PXB A;  2A6C A;  4KIK B;  1R63 A;  3QOW A;  2VH2 A;  2J0K A;  2JRH A;  2O2V A;  1V5T A;  3WAP A;  2ZJD A;  3PS6 A;  1X2L A;  5AZF A;  3UQA A;  2PUA A;  1WRI A;  1TS5 A;  1K53 A;  2WXK A;  3L1P A;  2LHE A;  3ONS A;  3QJZ A;  4FJZ A;  3U3W A;  3V60 A;  3Q8A A;  3GS2 A;  2IY1 B;  5DSX A;  1WGR A;  3P63 A;  4JCX A;  3ZGZ A;  1N5X A;  4OZB A;  4KIK A;  4ITK A;  1UGJ A;  5JHB A;  3APF A;  1R4N I;  2L1P A;  1FFU A;  2QEJ C;  1I4H A;  2HIN A;  1IBX B;  4IWO A;  2WDV B;  3A1Q A;  4NAM A;  2FCS A;  2KQ4 X;  1RAX A;  1XLO A;  1V80 A;  2HE7 A;  3BVZ A;  1E0Z A;  1ZZ6 A;  2PXL A;  3M95 A;  3BD1 A;  1WH8 A;  4A8X C;  2KDB A;  2LAS A;  2BF8 B;  2BWE S;  1GB4 A;  4XX5 A;  2IGH A;  1K8R B;  4X4I A;  4QAY A;  5J18 A;  4C7Y A;  2YEP B;  4DXF A;  4HKQ A;  1PDX A;  4FJY A;  4IUM B;  2CHW A;  4N59 A;  3GB1 A;  3N32 A;  1RZR D;  3Q8F A;  3VHT C;  4CYE A;  3F52 A;  1K52 A;  5MPO A;  2BS4 B;  5DTM A;  4XWT A;  3RNB C;  3DBH I;  1GB1 A;  2KQ7 A;  3QHT A;  3QAQ A;  3GP7 A;  2IND C;  2O6V D;  2BQQ A;  2KEJ A;  4GXB A;  2LHD A;  4RMA A;  1ZZ9 A;  2LYP A;  4K1R B;  4GIV A;  2WXH A;  4OBM A;  4MSM B;  3UFD A;  1RZS A;  1AW7 A;  1DW9 A;  3DOW A;  2GBK A;  1HZ6 A;  1C4A A;  3MC8 A;  2JT4 B;  3QIJ A;  2M8S A;  1KM7 A;  2G3Q B;  2PUC A;  4ARC A;  2MLB A;  1I7H A;  3CF6 E;  1J7B A;  2R1J L;  4NJC A;  2KYW A;  5G55 A;  3R7R A;  1IGC A;  1UGM A;  2KPJ A;  3ZXV A;  2BTE A;  1ROE A;  3MHS D;  1WFY A;  1FXA A;  4KDL B;  3B2F A;  2J42 A;  1C77 A;  2NBU A;  4ZHP A;  1TZ1 A;  1CMX B;  4K3B A;  3AE6 B;  1R4N B;  1VZ6 A;  4IM2 A;  3V05 A;  3N1X C;  3SX0 A;  2CJO A;  3WAN A;  1DOX A;  2BNM A;  1C4C A;  3ZRF A;  2V3C C;  2OR1 L;  3R66 C;  1KOT A;  4DE9 A;  3AEB B;  1TIF A;  5JUW A;  4ACF A;  3V6C B;  2O6V A;  2ICP A;  1Z5S B;  4GN1 A;  5E6N A;  5LXI B;  5DPT A;  4L2Y A;  3LB8 C;  3KL4 A;  5D2M B;  1QOA A;  4XZ4 A;  4O8B A;  3W2D A;  1CZP A;  4WQM A;  2ASQ A;  1GG3 A;  2NTT A;  1KF6 B;  2PUE A;  1V9J A;  2LYQ A;  2LD9 A;  2IO3 B;  2EEL A;  2O4A A;  2L0T A;  2ZCB A;  5LNK 1;  5HG2 A;  3AUL A;  3AEC B;  1EU3 A;  3RYT A;  5AUK A;  4A55 A;  1F77 A;  3HM3 A;  1QF6 A;  2PW9 A;  2Z0E B;  1C79 A;  2BGF A;  3EEC A;  3QQ6 A;  4ZHO A;  4ANX A;  3NXH A;  3SCG A;  5IA7 A;  3RZZ A;  5D7G A;  3DBL B;  3I57 A;  1N6Z A;  4HKZ E;  3JYU A;  3W5V B;  2XBB C;  4NQK E;  4DWF A;  3LJ3 A;  2RPV A;  2WYQ A;  3TEY A;  4YG4 A;  4JE3 B;  4BAX A;  1SE4 A;  1FO4 A;  1YJI A;  2LVO A;  1ZP0 B;  3SR6 A;  3R2I A;  4EZJ A;  2CHZ A;  1S1Q B;  1T0Y A;  1E7U A;  1UD7 A;  1TZO A;  3GOE A;  1PER L;  5A7L A;  3NOB A;  4GDL B;  1WMH A;  4EQZ A;  2EMT A;  1XF5 L;  3NY5 A;  4GGQ A;  4XWW A;  5I4D A;  2K5P A;  1D6E C;  3OWE B;  3SCH A;  3ENE A;  5CTR C;  1YSE A;  1ET9 A;  3VH3 B;  4P1B C;  3ZVV A;  3BY4 B;  3TL5 A;  1K51 A;  4EK9 A;  1R69 A;  5IKC M;  5JHA A;  2BB6 A;  3ETR A;  3DNV B;  3ZTC A;  1LCC A;  2L3Z A;  1UWX A;  4X4C A;  1M94 A;  4J1X A;  2Z59 B;  3BZD B;  3C19 A;  3RT3 B;  5EE3 A;  2BYT A;  5GAH i;  4N9F 4;  2X8X X;  4DHJ D;  2JVC A;  3R2T A;  3KJX A;  4EZI A;  3ZKJ C;  3KYC D;  2D3C A;  2M19 A;  4HXD A;  1MI0 A;  4S0R A;  4DHJ B;  1NDD A;  2LJI A;  2ZW1 A;  3EGR A;  2W55 A;  1Q0W B;  1R7S A;  5D94 A;  3MP9 A;  4DXG A;  2IO2 B;  4M02 A;  3V3X A;  4L23 A;  1QT9 A;  2IUO A;  2AQ3 B;  1DOI A;  2EKE C;  2RPQ A;  2K3U A;  4MGK E;  3M9L A;  3RNC C;  3KUD B;  2AEH A;  2WXG A;  3AMZ A;  2IVG A;  1WMH B;  1EWC A;  2M17 A;  2KLG A;  3DBR B;  1E7V A;  1D4B A;  4LCD E;  1OEY J;  2QSD A;  2LYK A;  1WY8 A;  2KX3 A;  5DCN A;  2JPH A;  1V1O A;  3H1U A;  1WJ4 A;  3ZXR A;  4WWM A;  3VVW B;  5DTR A;  3PHW B;  3OQM A;  1PQS A;  2EMS A;  3ALB A;  2D3G A;  3RFZ B;  2CSF A;  2MWS B;  1SXT A;  1C78 A;  4DQO C;  2QHO A;  2MP2 A;  4REZ A;  3GE8 C;  1ISN A;  1GUA B;  4A90 A;  4EE2 A;  4BKS D;  2WXO A;  2K8C A;  2L32 A;  5CHW A;  3GZN I;  1YN4 A;  3IHP C;  4I6R A;  4PYU A;  3GZD A;  2KDE B;  2AQ1 B;  1FRD A;  3PE5 A;  2ZNV C;  1UZX B;  2G4S A;  2LLW A;  4ICV A;  1ZXI A;  2DZI A;  2MQK A;  3DVG X;  2FJR A;  1SBB B;  4HEA 1;  1ZDV A;  2CR5 A;  4WJN A;  1ZDX A;  1HTQ A;  5CHV C;  1D5Z C;  2KAJ A;  2W3S A;  1JWS D;  3CIR B;  3PRM B;  1ZKH A;  4CHK A;  1IUE A;  5TSS A;  4GU2 A;  1L4Z B;  5G2N A;  1LMB 3;  3GBF A;  1JRP A;  1UXD A;  4BZA A;  3Q3N C;  3ZHI A;  4HJK A;  1KLU D;  2KD0 A;  3Q69 A;  3DQV A;  1AU7 A;  2JF5 A;  3URY A;  3ZJU A;  1PRU A;  2KC1 A;  4FXC A;  4MJS B;  4ER5 A;  1GNU A;  2JWZ A;  4X4D A;  3MLF A;  4MSQ B;  2N7D A;  3DDC B;  3Q14 C;  4YBA A;  3AI5 A;  4US8 A;  2HJ1 A;  3KW5 B;  4TMA B;  2J0J A;  2E6X A;  1WH3 A;  4HRS A;  1NEN B;  3H9D A;  5JXV A;  2K9X A;  1L0V B;  2VZK B;  3CRO L;  1VZ7 A;  1LQB A;  2BS2 B;  3W9C B;  1Y9Q A;  3SDL C;  1WJU A;  2PE6 B;  3DVN U;  4ZRP A;  2VH1 A;  4GQM A;  4K3C A;  2MCN B;  1UBQ A;  1TY2 A;  1BUI C;  3LIS A;  4JCY A;  4MM3 B;  1PGB A;  3RNF C;  3PSE B;  4FBI A;  3BDN A;  2RGF A;  3DWM A;  2JX5 A;  4K7U A;  4BOS C;  1ZPQ A;  2PXK A;  1NW3 A;  3IAM 1;  2O6V B;  4M01 A;  4BKS A;  1XEE A;  2NVU I;  2KMM A;  1NVI D;  3Q2A C;  3QQ8 B;  3GN5 A;  1PGX A;  3AE9 B;  4WWN A;  3I5J C;  2PE9 A;  2OFY A;  2D3B A;  4HRO A;  2HFZ A;  1Y8R C;  1B9R A;  3HK0 A;  2J7Q B;  4Z5D A;  1RRB A;  1WF9 A;  3VRB B;  2BWF A;  2B5A A;  1DYQ A;  2FFH A;  2DNF A;  3VTU A;  4W9J A;  2QCZ A;  5BMH A;  1LGR A;  1QB2 A;  1SGH A;  2LWP A;  3HUI A;  2JXT A;  2ZZP B;  2BW2 A;  2DZK A;  1YX5 B;  4JWU C;  2LMC A;  4AP4 C;  4KSK C;  2NBV B;  1I42 A;  2LGX A;  3MHZ A;  1V81 A;  2FUG 1;  1C4P A;  1UXC A;  4IW0 A;  3DM5 A;  1HXY D;  2SAK A;  2NMQ A;  3PZ8 A;  1SSN A;  1CQT A;  2KNB A;  3BYT B;  1WJN A;  2DEN B;  3CST A;  2WQY B;  1WXM A;  1SB3 C;  3TEX A;  2OJR A;  2WXL A;  4C80 A;  4ZRJ A;  3ZJV A;  3APD A;  1ZZ7 A;  4EUT A;  4LLG M;  1WYG A;  3VH4 B;  1WE6 A;  1XO3 A;  1JRO A;  4DXA B;  1AN8 A;  3AN1 A;  3HHM A;  2LGY A;  2MBQ A;  1SE9 A;  3BIN A;  1BXT A;  4WVL A;  1U2Z A;  1UEL A;  2VEO A;  3L08 A;  2JQR B;  3BII D;  3VR8 B;  1PUT A;  3NRZ A;  4B6W A;  3HVZ A;  3ZNH B;  3ZKC A;  4I6T A;  4HK2 A;  1HQR D;  2WXR A;  1VR9 A;  4I6U A;  1B1Z A;  4I6L B;  2MRP A;  2KFJ A;  3IBE A;  1VCB A;  3APC A;  4RH6 A;  3H7P A;  4C4V B;  1LCD A;  2CU1 A;  3N3K B;  1T5X D;  2H88 B;  2AL6 A;  1ZUG A;  2B76 B;  4PS8 A;  2WXM A;  4AS1 A;  3GUU A;  4DK5 A;  3G0T A;  1FM0 D;  1L7Y A;  2KVZ A;  2PXV A;  5IN7 A;  4W9D A;  5FKA C;  3ZDT A;  1STE A;  3W5U B;  2LI5 A;  2MH7 A;  4FN3 A;  4Q2J A;  1V6E A;  2C9W B;  2ICI A;  1GOZ A;  1EWY C;  2LLV A;  3L10 B;  3ME5 A;  3R8B A;  2CJN A;  3JVZ X;  1NYQ A;  2KWV B;  2WDT B;  3B9J A;  1QZE A;  2K8H A;  3KLS X;  4YSX B;  5HFY A;  2C5L C;  3AEE B;  3AE7 B;  4KSL C;  4EEW A;  1NYR A;  4IWQ A;  3RNG C;  5AEK B;  2AXU A;  3RZF A;  2JYT A;  4OW0 A;  3QOX A;  1TT5 B;  2L00 B;  2LZ6 A;  5FR3 A;  3FIL B;  2NS5 A;  5GXG B;  3ZUN A;  2GOW A;  3VDZ A;  2J0M A;  3AE3 B;  1WJ6 A;  2INP E;  1H4R A;  1BML C;  3ZNG C;  1NI3 A;  4LJO B;  3PRE A;  2XCJ A;  4NDW A;  3O65 B;  4US9 A;  2V4I B;  5G5H A;  2N0S B;  1XWR A;  2D10 A;  1L0X B;  4AQ7 A;  2WLB A;  4DHZ B;  4JIO U;  4O1N A;  1QKZ A;  4BBN F;  2OED A;  3VFK A;  2M0X A;  1KLV A;  2W3R A;  2CRO A;  4D2K A;  3RPF C;  2LGI A;  2PUB A;  3OWQ A;  1UNS A;  1EM7 A;  1SF0 A;  3VXW A;  2AYO B;  3S8Q A;  3PT2 B;  2K6Q A;  5FR6 A;  5H8Y E;  1ESF A;  3VUY A;  3N1Z C;  1JWU D;  3ZTD A;  2BNO A;  1X1M A;  4HWI B;  1P7F A;  3R7Q A;  5H92 C;  3PPA A;  1F52 A;  2PXE A;  3K9O B;  1DWK A;  2PXD A;  2M56 B;  1D3Z A;  3P4P B;  2WWZ A;  2C60 A;  4IA8 A;  3RNE C;  1HA5 A;  4GMV A;  5L95 C;  2RDG A;  2KDM A;  4P1C C;  2KN4 A;  1QOG A;  4A20 A;  1C9F A;  2PIA A;  1F2R I;  1XCT L;  3U7Z A;  1OGW A;  2D2Q A;  2FUH B;  4EKU A;  2IU7 A;  2MBB B;  1TBE A;  1A5R A;  1IBX A;  3FC4 A;  2CHX A;  3W1S A;  3GZN B;  2KTR B;  1ZZ8 A;  2XXA A;  3Q8B A;  1UUP A;  1FPY A;  1YNT E;  3P4S B;  4WH4 A;  1G6J A;  1YD8 U;  2BYV E;  3RCZ A;  2OHF A;  1XXG A;  4MH0 E;  1BDI A;  1FXT B;  1WRD B;  1E8X A;  4I6N B;  4JWS C;  4LNI A;  4WAA A;  4X57 B;  2MW5 A;  1YJJ A;  4P16 A;  4HPL B;  2KQS A;  3UWP A;  1JWL A;  5E6J A;  2G4D B;  4MGZ E;  1WIA A;  2UWQ A;  2PXQ A;  3MJ5 A;  1GPX A;  3NRO A;  4F8D A;  2WXQ A;  3DBR I;  2Q5W D;  1QZX A;  1ZOY B;  1T0S C;  3B7H A;  3U8Z A;  4TSS A;  1P98 A;  3A9J B;  3HVD A;  1XLP A;  3DBL I;  3Q6B A;  1ADR A;  1J8C A;  3A9K B;  3VAW A;  2CS4 A;  1XLN A;  3FAH A;  1OEY A;  4LNN A;  3AE2 B;  2GLS A;  2RSU A;  4PYZ A;  3WCQ A;  1HTO A;  3TEZ A;  1BDH A;  1LQC A;  3ABV B;  3A9J A;  3DBH B;  4AOF A;  2KWC A;  4KVG B;  4ER7 A;  3NDB B;  1UF0 A;  4BBN C;  4MJS A;  1YJ1 A;  3IT6 B;  2C7H A;  3M63 B;  3PGE A;  4OVU A;  2N7J A;  2X38 A;  2GBM A;  2K6D B;  2L83 A;  3H7S A;  3F6W A;  1FMA D;  3S2A A;  1SIJ A;  2EBY A;  2AXV A;  2W82 A;  3DCG A;  3ZNI D;  2KTR A;  2EKI A;  2JZ3 B;  1E10 A;  3H6N A;  1R4M I;  2KT7 A;  3GN5 B;  2Y5P A;  2JZZ A;  1RLF A;  2KAN A;  1ZGU B;  2K25 A;  2YEP F;  2HSG A;  2IY0 B;  1WGY A;  1CJG A;  3KUZ A;  2TSS A;  3MC0 B;  1SE2 A;  4P7I A;  4A3O A;  3OKZ A;  1N62 A;  1V86 A;  2VZK D;  3RZW C;  4MGI E;  4DBG A;  2ZNV B;  3UIN B;  4RM9 A;  2N1W A;  3TFL A;  5JZE B;  4EZL A;  1A70 A;  3M62 B;  2MJ3 A;  2V4L A;  1IP9 A;  2XXQ A;  4W9K A;  1GAQ B;  1Q1O A;  2KVR A;  1JQ4 A;  1VD2 A;  2FE8 A;  2PE5 A;  5J17 A;  1J7A A;  3WIM A;  3P2B A;  1VPW A;  2BT6 A;  1E8Z A;  5EE1 A;  4HJG E;  4K7S A;  2IZV B;  1HF0 A;  1ZAY A;  2KMC A;  2GRL A;  2PIJ A;  1V8C A;  1WXV A;  3QA8 A;  5DPR A;  3ZO5 B;  5C1Z A;  3QCA A;  2R2Q A;  3JSV B;  3FYA A;  3NZL A;  2PUD A;  4ZRK A;  1YQB A;  2KX0 A;  1I4R A;  1TKG A;  2WXP A;  1OCT C;  1KH0 A;  1JFS A;  2L8N A;  3KYD D;  3I3T B;  1IC8 A;  2NBW B;  2M4N A;  2R61 A;  3EC8 A;  5AUI A;  2PVG C;  1MG4 A;  2LCV A;  1OQY A;  4PK1 A;  2IGD A;  2AXZ A;  1WM3 A;  5K98 B;  1HEZ E;  2Y5C A;  4MCX A;  2FIF A;  1WZ3 A;  1MFQ C;  3FKY A;  4OHJ A;  1HE8 A;  4X4F A;  2KLC A;  2WU5 B;  4YAR A;  4NPN A;  1I4X A;  1J0G A;  1I4G A;  2KAC A;  4A3P A;  2PPX A;  4BVU C;  1FD6 A;  1WGH A;  3ML8 A;  4RF0 A;  4NJ7 A;  5CHF A;  3AEG B;  4PS3 A;  2I2Y A;  1N61 A;  2AWI A;  2J7W A;  5BYQ A;  2PPH A;  5HHD G;  4IG7 B;  4MAC A;  4M8M A;  1ET6 A;  2K1F A;  4W9H A;  1KRH A;  3ZDM C;  2I1K A;  1V1P B;  4GDK B;  3VK0 A;  4I8T A;  1Y56 A;  1PRA A;  2AUW A;  1RFK A;  3QAR A;  1EF5 A;  3AM9 A;  1WX7 A;  2JYE A;  2JZP A;  3EFC A;  3B1L X;  5BMG A;  2WX0 A;  1NBF C;  1DOY A;  1L4D B;  2H8R A;  4NZL B;  1NER A;  2J52 A;  2QMT A;  4E71 A;  2PEA A;  3EA6 A;  1RZR A;  5HI1 A;  2IVB A;  4KX6 B;  4HCP B;  4LDT D;  1EUV B;  2KK8 A;  1F9J A;  1YX6 B;  4IM0 A;  3PXP A;  4USA A;  4FUL A;  2LXC A;  1P9D U;  2UU7 A;  4LNO A;  3QC8 B;  3TUO A;  4II2 B;  4IOI E;  1F1H A;  4GDK A;  1PNR A;  4B0E A;  3ECI A;  4PT5 A;  1IGD A;  2KO3 A;  4BKG A;  2DAJ A;  4XYC A;  4YSZ B;  5C2T B;  5LXH A;  1TS4 A;  3WAL A;  5TR5 A;  1VLB A;  3LDZ E;  1FIQ A;  3RD2 A;  3DHG C;  2IO0 B;  3ZRC A;  4GLS C;  4NY0 A;  2ZEQ A;  4J6I A;  4ZYS A;  4I6P A;  5GAG i;  2WU2 B;  3PV1 A;  3IG3 A;  3L17 A;  3IVF A;  1ZUD 2;  3DHH C;  2I1J A;  2ODR D;  3NJT A;  2LNM A;  1PRV A;  3QFI A;  1QQB A;  1JCK B;  3PHX B;  1R4M B;  4KGR A;  4LK0 M;  2FCQ A;  4KV2 A;  4TV3 A;  1D5M C;  2DZJ A;  1E8W A;  1E3O C;  1N5W A;  2KEK A;  2IVQ A;  1WM2 A;  4Z5H A;  2ZVO A;  2V3N A;  5T8I A;  3N9Y C;  2IPK D;  2FCN A;  1GT0 C;  3T9L A;  4XDD A;  4IVZ A;  2HJ8 A;  4FHK A;  5HKH A;  3B2G A;  3KWL A;  3NZU A;  2L8J A;  2BPS A;  2SEB D;  2XNA C;  4ANW A;  1UBI A;  1V5O A;  2HTH A;  4CQN A;  4EZK A;  1OTR B;  1Y7Y A;  2GBN A;  4HPP A;  4IDI A;  2KOX A;  2WP9 B;  2GB1 A;  5JH5 C;  1TY0 A;  1EO6 A;  4NAW A;  1RWS A;  3JXC L;  2G45 B;  4YG7 B;  4J3O D;  2LRU A;  5D6J B;  1T0R C;  2MP2 B;  2PJH A;  3NUH B;  2V3P A;  3AE4 B;  3EHV A;  3NG0 A;  1L0Y B; 
#chains in the Genus database with same CATH homology
 1NYR A;  4UDU C;  1N63 A;  3HRD D;  4L2Y A;  1M4V A;  3LB8 C;  2JYT A;  4OW0 A;  1QLB B;  1QOA A;  3MFG A;  3QOX A;  3VR9 B;  2LUM A;  4RGO S;  5FR3 A;  3FIL B;  5GXG B;  3W2D A;  1CZP A;  3AB5 A;  4WQM A;  3ZJT A;  3AE3 B;  2NTT A;  5D3D A;  2N9L A;  3BYY B;  1KF6 B;  2INP E;  1BML C;  1NI3 A;  2BB5 A;  5DRY A;  4US9 A;  2HTM E;  2EEL A;  1JML A;  2V4I B;  1XCQ L;  5HG2 A;  5LNK 1;  3AEC B;  5G5H A;  1EU3 A;  2N0S B;  3A9Z A;  1L0X B;  1VJK A;  1ZPS A;  2CU3 A;  2WLB A;  3EUB 2;  1F77 A;  4O1N A;  5AUK A;  4A55 A;  2PW9 A;  1QKZ A;  1QF6 A;  1C79 A;  2OED A;  2QJL A;  4ZHO A;  3NXH A;  1SEB D;  3AE1 B;  4ER6 A;  2W3R A;  4D2K A;  5D7G A;  3RPF C;  4WAF A;  2LGI A;  3H8H A;  3I57 A;  4TQ1 A;  4HKZ E;  4WIP A;  3OWQ A;  3SEB A;  3W5V B;  1UNS A;  1NEK B;  1EM7 A;  1SF0 A;  2BS3 B;  2RPV A;  1PFD A;  1RYJ A;  3TEY A;  1F0Z A;  4JE3 B;  4P6V F;  3AE5 B;  1FO4 A;  1SE4 A;  1CK1 A;  3NVZ A;  1YJI A;  1ZP0 B;  3SR6 A;  2K22 A;  3PZ7 A;  5H8Y E;  1ESF A;  3R2I A;  3U4E G;  1F2R C;  2WS3 B;  1V97 A;  1JWU D;  5EE0 A;  1TZO A;  4EKG A;  1WXQ A;  1P7F A;  2HCS A;  2DBY A;  4AQ7 A;  2WXJ A;  4GDL B;  5EE9 A;  3O13 A;  4ER3 A;  5H92 C;  4TQ0 A;  4ARI A;  4EQZ A;  1XF5 L;  4RF1 A;  2MJD A;  1JAL A;  2L1A A;  4XWW A;  2M56 B;  2ONQ A;  5I4D A;  1XLQ A;  2K5P A;  1FXI A;  1TS2 A;  3LXF A;  3P4P B;  1D6E C;  3OWE B;  3VWS A;  3KWV A;  3ZQ4 A;  1HA5 A;  2RDG A;  1ET9 A;  2KDM A;  1JWM D;  1K51 A;  3IXS A;  1LO5 D;  2KN4 A;  1QOG A;  2J53 A;  3NVW A;  4EK9 A;  2D5G A;  1C9F A;  2PIA A;  1F2R I;  1XCT L;  3U7Z A;  1YN3 A;  2BB6 A;  4OZA A;  3ETR A;  2WDQ B;  1UWX A;  1IBX A;  3AH7 A;  3FC4 A;  3W1S A;  5DRT A;  3BZD B;  3VQI A;  4WUR A;  3AED B;  5EE3 A;  2BYT A;  1OQQ A;  1QOB A;  3Q8B A;  1SJE D;  3UI3 A;  1UUP A;  3P4S B;  1YNT E;  4WH4 A;  2G9H D;  2M4H A;  2OHF A;  1XXG A;  3R2T A;  4JWS C;  4EZI A;  3ZPX A;  1UWM A;  2M19 A;  1MI0 A;  1YJJ A;  4P16 A;  3NS1 A;  5C3J B;  3GZD C;  2LJI A;  3AE8 B;  2ZW1 A;  2Z8L A;  3P4Q B;  3UWP A;  5E6J A;  4ZOH C;  2K0P A;  3EGR A;  2W55 A;  1R7S A;  3A9X A;  3J9C A;  3MJ5 A;  3MP9 A;  4DXG A;  4RGN A;  2V0G A;  1GPX A;  3NRO A;  2H89 B;  2WXQ A;  3V3X A;  4L23 A;  1QT9 A;  2Q5W D;  2AQ3 B;  1DOI A;  3NVY A;  1ZOY B;  2K3U A;  3M9L A;  1AYF A;  1KTK A;  4TSS A;  1VZ8 A;  3HVD A;  1XLP A;  2WXG A;  2MJE A;  3AMZ A;  1EWC A;  3AE7 B;  4L1B A;  1D4B A;  1MPE A;  3TEP A;  4XE0 A;  4KKI A;  1CQV A;  1XLN A;  3FAH A;  2QSD A;  3AE2 B;  3WCQ A;  3TEZ A;  4R3D A;  2E3T A;  1T6B X;  3ABV B;  2LFI A;  1V1O A;  2XN9 C;  4WWM A;  1TS3 A;  4IKG A;  5DTR A;  4JX1 C;  4ER7 A;  3PO0 A;  1E6E B;  4RFB A;  1PYW D;  4B0M A;  3RFZ B;  2XXP A;  1FFV A;  1SXT A;  1C78 A;  3IT6 B;  4DQO C;  1E9M A;  1JWA D;  2N7J A;  2X38 A;  3E56 A;  3Q8E A;  4REZ A;  1FEH A;  1N60 A;  2WXN A;  3TSS A;  2L83 A;  5BYR A;  4A90 A;  4N6E B;  4EE2 A;  2DYO A;  1FMA D;  2DWQ A;  3E9S A;  2WXO A;  3BVM A;  1L6U A;  3R09 A;  2HCN A;  2L32 A;  4YTP B;  2PTL A;  5DT2 A;  1SIJ A;  2IJ0 A;  3TEW A;  3KQ4 A;  1YN4 A;  2W82 A;  4HRA A;  2EKI A;  3GZD A;  2AQ1 B;  1FRD A;  1AWD A;  3PE5 A;  2QIE B;  1E10 A;  2LLW A;  1TKY A;  2Y5P A;  3Q8C A;  3AEF B;  3NZ3 A;  1P7E A;  1ZXI A;  2MXD A;  3P1M A;  1SJH D;  2YEP F;  2L52 A;  2WXF A;  2TSS A;  1RM6 C;  1SBB B;  3MC0 B;  4HEA 1;  1SE2 A;  1ZDV A;  4KGS A;  3OKZ A;  1N62 A;  2VZK D;  1ZDX A;  1MHH E;  1D5Z C;  3T3N A;  2KAJ A;  2JWU A;  2G1E A;  2W3S A;  4ER0 A;  1JWS D;  3CIR B;  1IUE A;  3TFL A;  5TSS A;  1VDV A;  1A70 A;  1L4Z B;  4YSY B;  3IAS 1;  5BMI A;  2MJ3 A;  1FNU A;  1WSP A;  1FNV A;  2XXQ A;  1JRP A;  1GAQ B;  1WWT A;  4DE8 A;  5DTQ A;  3BK1 A;  1JQ4 A;  1FCC C;  2FE8 A;  1ACC A;  3C8Y A;  4JPS A;  1KLU D;  2AX5 A;  2LEK A;  1J7C A;  1J7A A;  3GZC A;  3Q69 A;  2PLP A;  2BT6 A;  3TEL A;  3A9Y A;  1L5P A;  2PMV A;  2RMM A;  3CWI A;  5EE1 A;  1FNW A;  4ZRQ A;  3T3O A;  4HJG E;  2J7U A;  4C7Z A;  3LYY A;  1PGA A;  3URY A;  3ZJU A;  1K50 A;  4FXC A;  4ER5 A;  2PVO D;  1MHX A;  1V8C A;  2I38 A;  2ZW0 A;  4MH8 A;  4EKI A;  3VRA B;  1TKE A;  3ZYY X;  4RCO A;  2QIL A;  2PKO A;  4KGT A;  4US8 A;  4MT5 A;  3L4P A;  4TMA B;  3NZL A;  1ZXH A;  2E6X A;  1I4R A;  1TKG A;  2WXP A;  4HRS A;  1HZ5 A;  1KH0 A;  2RDH A;  2WNM A;  1NEN B;  1D5X C;  1KLG D;  1WGK A;  2KWD A;  3BK2 A;  2K9X A;  5JXV A;  1EU4 A;  1JW9 D;  1L0V B;  1OQR A;  1YMH E;  4A6Q A;  4OVZ A;  2R61 A;  1VRA B;  2VZK B;  5FK9 C;  5AUI A;  1VZ7 A;  2PVG C;  2BBC A;  2BS2 B;  4YT0 B;  3W9C B;  2IGD A;  1Q10 A;  1I4P A;  2NTS A;  2YBD A;  3SFD B;  1HEZ E;  4ZRP A;  2Y5C A;  3MEJ A;  3BVG A;  4OHJ A;  1TY2 A;  2DLB A;  4XDC A;  1BUI C;  1FRR A;  2WU5 B;  3U2S C;  4LTU A;  4MM3 B;  2ACZ B;  1PGB A;  1ZE3 D;  1I4X A;  2WDR B;  1I4G A;  3DWM A;  2KAC A;  2JX5 A;  1TYG B;  1JWB D;  3FIL A;  1FD6 A;  1I4Q A;  1NW3 A;  3IAM 1;  4RF0 A;  4YXD B;  3SFE B;  1XEE A;  3AEG B;  1QOF A;  2I2Y A;  2GI9 A;  2KMM A;  3P4R B;  1N61 A;  1NVI D;  2J7W A;  5BYQ A;  1PGX A;  3AE9 B;  3QOW A;  5HHD G;  4MAC A;  5G5G A;  2MEK A;  1TJE A;  1ET6 A;  1YN5 A;  2GRI A;  1KRH A;  4HRO A;  4C56 C;  2HFZ A;  1B9R A;  1WRI A;  1TS5 A;  1K53 A;  2WXK A;  2LHE A;  2N9K A;  1YQ3 B;  3VRB B;  1V1P B;  4GDK B;  3Q8A A;  3GS2 A;  5DSX A;  1E7P B;  3P63 A;  4NAW B;  1Y56 A;  1DYQ A;  3ZGZ A;  1CJE A;  1T3Q A;  1RFK A;  1N5X A;  5BMH A;  4OZB A;  2Y3A A;  1UGJ A;  3AM9 A;  4ITK A;  1QIL A;  3HUI A;  2JXT A;  2BW2 A;  2JYE A;  2ON8 A;  2L1P A;  1FFU A;  2QEJ C;  3DWG C;  2JZP A;  4RNA A;  4JWU C;  2LMC A;  1I4H A;  5BMG A;  2M0A A;  3NVV A;  3IT4 B;  1IBX B;  2WDV B;  1DOY A;  4NAM A;  2KQ4 X;  3P42 A;  1XLO A;  1L4D B;  4H2A A;  3SR4 A;  3MHZ A;  3BVZ A;  2FUG 1;  1E0Z A;  4NZL B;  1C4P A;  2J52 A;  2QMT A;  3EA6 A;  1HXY D;  5HI1 A;  2SAK A;  4A8X C;  1FCL A;  2NMQ A;  3PZ8 A;  1SSN A;  4KX6 B;  3BYT B;  2FBW B;  4RGM A;  2WQY B;  1SB3 C;  3U52 E;  3TEX A;  2WXL A;  4C80 A;  4USA A;  1GB4 A;  3ZJV A;  2IGH A;  3AV8 A;  4C7Y A;  2YEP B;  1ENF A;  3TUO A;  2JSV X;  4IOI E;  4DXF A;  4HKQ A;  1PDX A;  4M0W A;  4LLG M;  1L6V A;  4N59 A;  4B0E A;  1WYG A;  1QQR A;  4PT5 A;  3GB1 A;  1IGD A;  3AEA B;  1MVK A;  3Q8F A;  1XO3 A;  5C2T B;  1JRO A;  4YSZ B;  1TS4 A;  1AN8 A;  3AN1 A;  1VLB A;  1FIQ A;  1K52 A;  1DGJ A;  1BXT A;  4WVL A;  2BS4 B;  5MPO A;  5DTM A;  4A9A A;  1U2Z A;  1V1P A;  4XWT A;  1GB1 A;  4GLS C;  2VEO A;  2JQR B;  2IGG A;  4ZYS A;  3BII D;  3VR8 B;  1PUT A;  2WXI A;  2IDY A;  1OFF A;  3GP7 A;  3HVZ A;  3NRZ A;  2WU2 B;  4OZC A;  2LHD A;  1ZUD 2;  2W54 A;  1HQR D;  2AQ2 B;  2ODR D;  2WXR A;  1VR9 A;  2LNM A;  1B1Z A;  2WXH A;  3QFI A;  1JCK B;  4KGR A;  4OBM A;  4LK0 M;  1AW7 A;  1D5M C;  1N5W A;  5D3I B;  4RH6 A;  1HZ6 A;  1C4A A;  4ARC A;  1T5X D;  1I7H A;  2H88 B;  1J7B A;  2V3N A;  3N9Y C;  5T8I A;  4N58 A;  2IPK D;  4NJC A;  1C76 A;  2B76 B;  3I9V 1;  2WXM A;  4AS1 A;  4XDD A;  1IGC A;  4YTM B;  3GUU A;  2DYM A;  3G0T A;  1FM0 D;  3B2G A;  3KWL A;  2BTE A;  1ROE A;  5FKA C;  1STE A;  3W5U B;  2SEB D;  2JU6 X;  2XNA C;  2MH7 A;  4RGT A;  1FXA A;  4CQN A;  2HDE A;  4Q2J A;  2J42 A;  1C77 A;  3B2F A;  4ZHP A;  1YQ4 B;  2ICI A;  4IDI A;  1GOZ A;  2WP9 B;  1VZ6 A;  2GB1 A;  1KFY B;  3AE6 B;  4KKJ A;  1TY0 A;  1EWY C;  3V05 A;  2LLV A;  4YTN B;  1RWS A;  3ME5 A;  3SX0 A;  4YWG G;  1SE3 A;  3R8B A;  2CJN A;  2CJO A;  1DOX A;  1NYQ A;  1C4C A;  2INN E;  4J3O D;  3B9J A;  3KLS X;  3NUH B;  2V3P A;  3AE4 B;  3BWU D;  4DE9 A;  4YSX B;  5HFY A;  3AEB B;  5BYS A;  3AEE B;  5JUW A;  2J4X A;  1L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...