4Q2JA

A novel structure-based mechanism for dna-binding of satb1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
169
Chain Sequence
GPGSGTMLPVFCVVEHKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
total genus 38
structure length 169
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4q2jA02
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4q2jA01
2L1PA 3TUOA 4Q2JA 3NZLA
chains in the Genus database with same CATH superfamily
5G5GA 1LQCA 1QLBB 1RZSA 1TGZB 3Q3MC 3A9ZA 2B76B 2QMTA 3QX1A 4EEWA 4N6EB 3Q8CA 1GPXA 2BB5A 1XT9B 3DBHB 5E6JA 3KYDD 1JMLA 4W9GA 4ZOHC 1QB2A 2D3AA 3PPAA 4C4VA 3A9KB 4HRSA 1QOAA 5DPSA 3W2DA 4JCXA 1ZOYB 1WE6A 2FJRA 5E6OA 3CROL 2UWQA 3RPFC 3RYTA 1J7AA 2ICTA 2ICPA 4KV2A 3CSTA 1LM8B 3U52E 3ZNHB 4ARIA 1FM0D 1AARA 1IC8A 3TMPB 2J7WA 4XGAB 2YBDA 4JE3B 3LXFA 1HXYD 1D4BA 4WJPA 3AI5A 4IG7B 4X57B 4EK9A 4I6NB 1WF9A 3F51A 3PLUA 1YSEA 1SEBD 2PE6B 2M17A 1RWSA 2KFJA 4NQKE 4WAAA 4HWIB 1HZ6A 1KRHA 2HDEA 5LXHA 1HTQA 2KWCA 3RNEC 1JFSA 1Y9QA 1PUTA 2RPVA 1T0SC 1O4XA 1FFVA 2RD0A 3IT4B 5J17A 1YJ1A 1HTOA 4MCTA 1AN8A 3FYMA 3QC8B 3MC8A 2JYEA 1L1MA 1LFDA 3ZW3A 3R1FA 1DULA 2G4SA 3IVPA 1ADRA 2PPHA 2JVCA 2LJ5A 3EECA 1ACCA 2I1KA 3MJ5A 4ARCA 5IO9A 3PZDA 1MHXA 4IWPA 1QT9A 4M00A 5CTRC 1KOTA 3LYYA 4PT5A 3JYUA 4FN2A 4DWFA 1L5PA 1DYQA 2BWES 2KO3A 3VWSA 3JW0X 3ZDMC 3ZPXA 3H9DA 1C76A 4J6IA 4N58A 1JCKB 1GOZA 1WRIA 1ET9A 1P98A 3SFEB 2XI8A 3N9YC 2JWZA 1TKEA 3QARA 3DBSA 1AYFA 1Y56A 2IZVB 1T0QC 2KKCA 4HRAA 3DBRB 1WH8A 3NS8A 3TJPA 2TSSA 2H88B 4K7UA 2JZ3B 2XXAA 1KH0A 5JH5C 3TCAA 5JZEB 1TZ1A 3JVZX 3T3OA 4EZIA 2C60A 3OWEB 1PQSA 3AE9B 2PE9A 2DX5B 2Y5CA 3L1PA 2KD0A 3VUXA 4DHJD 4G3XB 1RLFA 3KXAA 4HDOA 4FULA 2PVGC 3WCQA 1HQRD 1L0VB 3DCGA 1J7CA 2OHFA 2WXKA 1EO6A 1ZZ6A 1XCTL 2D11A 2LYRA 2N9EB 2HSGA 3LDZE 2D5GA 1NI3A 3DHIC 3HIZA 2ICIA 1SIJA 3Q8BA 1Q0WB 1Q1OA 5J2RA 1IPGA 3GBFA 1WIZA 4NNJB 3I9V1 1KTKA 3RNFC 1UXDA 2LGDA 1WX9A 1LMB3 4GOCA 1D3ZA 4WQOB 4MDKE 4OVVA 1UGJA 1FXTB 2H89B 4W9FA 3W1SA 3C8YA 3QAQA 2IU7A 5BYRA 2LEKA 3NVZA 4F8CB 1HE8A 1ZUD2 3RZZA 4DXFA 3H5TA 4OBMA 2QCZA 4GU2A 4B9KA 4BAXA 3GS2A 3PHXB 2KEKA 3DQVA 1XO3A 3APDA 3A1QB 3JSVB 2IVGA 1XXGA 2L32A 2Y5BB 5I4DA 3KL4A 3OQMA 4W9IA 4URKA 2WDQB 1QF6A 4K7WA 4N9F4 2GBRA 2KN5A 2FNJB 2V4LA 1UXCA 3PTFC 5CHWA 4MGZE 2J0KA 3L08A 1V2YA 4E71A 2IDYA 4YT0B 1ROEA 4MELA 4LTUA 2LYLA 4FBJB 3AE1B 5C3JB 3H7SA 4IW0A 1IUEA 1YX5B 2EBYA 2LGXA 3GP7A 4P7IA 3AEGB 2MX2A 3AH7A 3CIRB 3NOBA 1UZXB 4HPPA 1WGRA 1I7HA 3U30A 2MBQA 1WZ3A 2K1FA 4MEMA 4HCNB 5JXVA 2D10A 3L4PA 2BQQA 3PE5A 1QP4A 1TS3A 4L23A 2MJDA 4X4GA 4M01A 4A20A 1F2RC 1NEQA 2MEKA 4HVBA 2AWIA 4IWOA 4LJPB 4PU8A 4FJVB 3URYA 2QSDA 1WX7A 1A70A 4LNKA 3AU4A 2OEDA 2B3AA 1NENB 4JIOU 1EU4A 2WS3B 3ZRFA 4MM3B 2CHWA 3Q3FA 2KC1A 1BXTA 4NAMA 1UTXA 1YN5A 3P4SB 1IGDA 3FKYA 1YX6B 2QIEB 3GZDC 4PK1A 2DLBA 1V1PA 1I4GA 3Q8AA 3O65B 2PVOD 2KZ8A 1GG3A 5DRTA 3UINB 2EMTA 3V3XA 1MFQC 1OFFA 1WR6E 2IPKD 1KM7A 3VQIA 2YEPB 1POUA 4PS8A 1WI0A 3ZDTA 4YWGG 1MI0A 3PS6A 3TEZA 4OZCA 2YLMA 3S8QA 3Q3JA 1F2RI 4QAYA 1SGHA 1YJIA 3DM5A 4MH0E 2D3CA 5FKAC 1SBBB 2BVCA 4LCDE 1WX8A 2J4XA 1N62A 1ZE3D 5G5HA 3A4SC 4B0MA 3ZKJC 2KEIA 3WAPA 1QZXA 1IBXA 4DBGA 2JQEA 2JQRB 3PGEA 3TEPA 1WRDB 4IDIA 2M56B 3KUDB 2M19A 1Z2MA 2C7NB 2FUG1 1SQ8A 1Q10A 3ZJVA 1OQYA 3GB1A 3O13A 2XXPA 3NROA 1PFDA 2PEAA 3KZ3A 1ZXIA 4GGQA 3E9SA 2M4NA 4K7SA 5E6PA 1RPEL 1MG4A 4EZJA 2D07B 2WXHA 2RDGA 3TELA 1GC6A 2L0TA 1KLUD 2G9HD 1PRUA 2BS2B 3JXBC 4BKSD 1ZUGA 1UWMA 4M8NA 3I3TB 5JUWA 2CROA 3BVGA 2L83A 1ZS4A 1ZZ9A 5LNK1 3ZYYX 1T0YA 1DOXA 1SJED 1TS5A 2KDFB 2L05A 4BKSA 4M8MA 2O38A 4YTMB 5C1ZA 3ZQ4A 2CHZA 3QIJA 2KQSA 3OKZA 2UYZB 1JALA 3Q3OC 3EA6A 1ZKHA 1C3TA 4WWNA 2GBMA 1LGRA 2KXJA 2DHZA 4K81A 3BVZA 2O6VB 4Z5CA 3HRDD 3KUCB 4EKIA 2WU2B 3VTWA 1PRVA 2QDFA 4KZ0A 1WJ6A 1PGXA 3CSFA 1C1YB 3AECB 1V8CA 1GC7A 1L0XB 4XDDA 4WQMA 2PUAA 2KHWB 2CR5A 2IO3B 3DBRI 1CMXB 2KOXA 4AOFA 2EWTA 5DSXA 4YTPB 3B2FA 1YIWA 1R4MI 3KWVA 4NJ6A 4PS3A 2GBJA 3ZRCA 3GOEA 3GZNI 2N4FA 3DBLI 4TSSA 1K8RB 4S17A 1Z5SB 1VDVA 4A6QA 1L7YA 2WUSR 3BK1A 2PXEA 2NTSA 3CF6E 4EZLA 2WYQA 3PLVA 3MC0B 1BUIC 1I4RA 3OMTA 1ESFA 2M8SA 1CQTA 3VRAB 3PXPA 1UGMA 3RFZB 5BYQA 2K0PA 2V3CC 4GDKA 1STEA 1WMHB 3PRPB 1FNWA 4P16A 3WAMA 2ZNVB 2RR9A 2AL3A 2EMSA 3UGBB 2VEOA 2NBVB 3VK0A 1CZPA 2CHXA 2L7RA 4DHJB 5BMIA 3GE3C 5IOIA 1ISNA 4ICUA 1E0ZA 4YTNB 1H4RA 3BY4B 4MCXA 1FEHA 2ZW0A 2R2QA 2CKHB 3GZDA 3DVNV 2FCNA 4P6VF 5D2MB 4WAFA 2MBOA 2O6VD 2NR2A 2K9XA 4JWUC 4LNOA 3U7DA 1JFTA 1WR1A 3A9YA 4FADA 5TR5A 4MJSB 4J1XA 3AE3B 3GZNB 1X2LA 1SJHD 1N5XA 3L16A 2KN4A 2EKIA 4EUTA 1AW7A 1I4XA 3H1UA 1V1PB 2C7MB 2KC2A 2AQ2B 4UDUC 3X23A 1UUPA 3P4PB 2XK5A 2KDIA 4C7ZA 2D2QA 2C9WB 5HFYA 3E56A 1DOYA 1VZ7A 1WMHA 2MJ3A 3ENEA 3O9XA 2CU1A 3P63A 4IWQA 4F1SA 2IGHA 3VDZA 1C79A 2WXOA 1WXQA 3IAM1 2SEBD 3QOXA 3EFUA 1WJUA 1WGKA 2MBHA 1XLPA 3JXDL 2KX3A 4RNAA 5KHQA 3N3KB 2LZ6A 1WJ4A 3L10B 4C80A 2L0FA 3QQ8B 2H8RA 2PXFA 4YBAA 2IV1A 2N7JA 2WNMA 3S2AA 1NDDA 3KQ4A 3NG0A 3VTVA 4KDLB 2LMCA 3D32A 1V1OA 3DHHC 4XX5A 2N7EA 2KAJA 5H8YE 2G45B 1VZ6A 2DAJA 1E7UA 3PV1A 4JX1C 2C5LC 3ML8A 2M0XA 4EFOA 3PSEB 1C9FA 1ZZ7A 5AZFA 2JZZA 3QWZB 2MCNB 2DZIA 2IJ0A 3I5JC 3RN9C 1G6JA 5EDSA 2JU6X 4W9KA 4A8XC 2IUOA 3B0AA 1MJDA 3P1MA 3GE8C 4I6TA 3ZJTA 2JUOA 3NDBB 2JT4B 1UNSA 4HJGE 2K8BA 3CMMB 2Y3AA 2PUDA 1KLVA 1P9DU 1PGAA 2BGFA 2QILA 1UWXA 4IWRA 2WDVB 2HE7A 4HPMB 2MWSB 4AUQC 3ZJUA 5IAAC 1WWTA 4O8BA 1AWDA 1FPYA 3JXCL 2WXPA 2O6VA 4BKTA 2N9PC 1LQBA 4KIKB 3OJ4B 1U2ZA 3MHSD 2I38A 3DDCB 3ECIA 1JWMD 1QQBA 3ZHIA 1X57A 2PIAA 3GZCA 3RZFA 1E8YA 4EQZA 2AUWA 1PNRA 1WFYA 2AEHA 2G3QB 4J1WA 1NBFC 4KZCA 4AP4C 2KX0A 3W1SC 3VH3B 4ASWC 5IN7A 2KJ6A 2BWFA 1RIOA 1T6BX 1NW3A 2OR1L 2WGSA 1FNVA 2N1VA 1WXMA 5K98B 4GIVA 4ZRQA 3T9LA 2DNFA 3SD5A 2GBNA 2LYPA 3B9JA 4NY0A 4GDKB 1OEYA 4KGSA 1JH9A 1DWKA 5LXIB 1L0YB 1P0RA 4RM8A 1WETA 2ODRD 4IM2A 2LYJA 1TTNA 4EE2A 5DT2A 2LVPA 2Q5WD 4X4IA 4XYCA 3VFKA 2BBCA 1F0ZA 4OW0A 1FRDA 2GRIA 2BNMA 1YMHE 4HEA1 3OP9A 4HDQA 4WVLA 1JWAD 1IGCA 3WAOA 2O2VB 3HK0A 2KPJA 4YXDB 3MTNB 1YN4A 1JRPA 4LLGM 2R2OA 3AEDB 4PU4C 1C4PA 3IT6B 3EUB2 1R4NB 1E8XA 1WJNA 3UIPB 3Q6BA 2W9NA 4NAWA 5GXGB 3RCZA 4WH4A 2BW2A 2QJLA 4RM9A 2FE8A 4DDID 2KEJA 2ZZPB 4PU7A 4HROA 4Z59A 1OCTC 4USAA 1C78A 2DZMA 4L2YA 4XWTA 4TUUA 4WWPA 2HD5B 1J0GA 1IYFA 1VJKA 3B1LX 3M63B 1D5MC 2QHOA 3F6WA 3R8BA 1WXAA 3DWGC 3TBLD 3KWLA 4KX6B 2L1AA 2HCSA 1RRBA 2K8CA 1TS2A 3P4RB 3UWPA 1XCQL 2BS4B 2E3TA 4FLHA 3QF3A 1GNUA 4GHJA 2BB6A 4Y42A 1RZRD 3PRZA 3V05A 3VUWA 2KLCA 5G2NA 1I4QA 4I6RA 4X4CA 4HK2A 4JQDA 1WE7A 2IVBA 1WIAA 2HINA 3ML9A 5HG2A 3VHTC 1L4DB 1RZRA 1HQ1A 2PE5A 2AQ3B 4PS7A 2WXRA 4JPSA 2INDC 4O1NA 2BF8B 4Z5DA 1WGGA 1WSPA 2YEPF 4A9AA 2BKFA 4A3PA 2ONQA 3AEAB 3M62B 2XN9C 1UELA 1OQQA 1R4NI 3MC9A 3ABVB 4JGHB 2LUEA 4G50A 2FAZA 4DDGD 2XXQA 4GMVA 4KSKC 3R09A 1V6EA 3NHEB 3BZDB 3L17A 4GSWA 4MGYE 1WYWB 4MGIE 1ZZ8A 3W1YA 2LFIA 3AXCA 3ZIMA 3VXWA 2PKOA 2KT7A 3U7ZA 1QOGA 2AL6A 4LJOB 1N61A 1ZP0B 2LLVA 1OSLA 1Y7YA 4DQOC 1DGJA 2R1JL 2J52A 1ZPSA 3L13A 3V6EB 2RPQA 1S1QB 2WX1A 3EGRA 4LNNA 5EE0A 5H92C 1E10A 3A9XA 3DHGC 4ITKA 4P1BC 4P1CC 4EKGA 3VRBB 1L4ZB 1V86A 4MH8A 1SE3A 3Q8EA 3N1XC 1P3QU 1E6EB 4KGTA 2GBKA 1S7EA 4XZ4A 1FCLA 2J42A 2BT6A 5HKHA 1H8CA 2D3GA 2XK5B 3PHWB 3LFPA 2KMCA 5C2TB 2JRIB 3LJ3A 2BKRB 1XF5L 1WGDA 2LVOA 3NZUA 1VCBA 1MPEA 3N1YC 4XWWA 4KVGB 1CJGA 2LI5A 3C0RB 1RAXA 4KGRA 4HLEA 2WQYB 2V3NA 4ZRIA 2BNNA 2AQ1B 3HVZA 4MSMB 4E74A 1Q5WB 1VPWA 4G0NB 3OAWA 3H8HA 2KQ4X 4MM3A 2WIUB 4ICVA 4G11A 4MJSA 4YG4A 1S3SG 3HM6X 2KVZA 4BBNC 1OTRB 1I35A 1WZ0A 3K9OB 4C00A 2FIDA 1XEEA 2Y5PA 3ZNID 2WXLA 2XBBC 5IKCM 1EF5A 4FA6A 2NS5A 2GMIC 3PT2B 2V9HA 2WDTB 3SFDB 1QILA 1GB1A 4WJQA 1F9JA 3KLSX 2WXNA 3SX0A 3ALBA 3P2BA 3AB5A 1WXVA 2NVUI 1MG8A 4US9A 2V4IB 2N1WA 4X4EA 2KNBA 2Z8LA 4FHJA 2PPXA 3MLFA 3RULA 5BMGA 2LCVA 3DBHI 2MQKA 2KMAA 3CWIA 2ASQA 2BYTA 1PGBA 3GUUA 2XCJA 2PTLA 4TKNA 1QQAA 2K8HA 3VVWB 3KW5B 3HM3A 2L76A 1CJEA 3TUOA 2FIFA 2WXQA 4GQMA 4W9DA 4NAWB 2L8JA 3FAHA 3QCAA 1TBEA 1T3QA 2K25A 2BS3B 2KJHB 1D5XC 2BPSA 3Q2AC 1FD6A 2KANA 2IVQA 5D3DA 1QP0A 2WXIA 3A9JB 2MEZA 4MT5A 3DWMA 4AJWA 4EZKA 2B5AA 4ZHPA 4L1BA 1N5WA 1JRUA 1E8WA 1CK1A 1SIFA 3FMYA 2LYSA 1JW9D 2DYOA 3AULA 3BD1A 4BKGA 2D3BA 1PRAA 1MVKA 5J18A 1QPZA 4IVZA 2WDRB 4LNFA 4OZBA 4X4FA 4GXBA 1WH6A 2L49A 3JSVA 5AZGA 2FUHB 2JVLA 1KF6B 2IGGA 3U2SC 5KHOA 2LWPA 3UFDA 3SU8X 1NERA 1V5TA 2GLSA 2LGYA 1WM3A 2PUEA 3SR6A 2KDBA 4KIKA 4E3CA 1QKZA 1EF1A 2MSED 2IO0B 2ZW1A 2JRHA 1I4HA 3RZWC 2OJWA 1SE2A 2AYOB 1PDXA 2CJNA 2GB1A 1OGWA 2KJRA 3VUYA 3DOWA 1EUVB 2V0GA 1NYQA 2W54A 2ZEQA 4D2KA 3BVMA 2GZUA 2LUMA 1JWSD 4YL8A 1QOFA 3PO0A 4W9CA 4YSYB 2N9LA 3W9CB 4EKUA 1QOBA 1XQQA 3RT3B 3ME5A 1WGHA 4DK5A 2INCC 4KDIC 1YQ3B 4B6WA 2ZPYA 1V97A 4RMAA 1JWBD 2AXZA 3P4QB 4PU3C 3SHQA 2FCSA 1TS4A 1I42A 1C4CA 3BINA 3AE6B 2A6CA 1L6UA 3BYYB 1FCCC 2RGFA 4ZDVA 3TFLA 4HJKA 3B2GA 1XLOA 1C4AA 1WYGA 1FO4A 5E6NA 4RGOS 4W9LA 1T0RC 4OB4A 3ONSA 3VTUA 2KACA 5IA7A 3RI7C 1R63A 4JLCA 1UBQA 3IBEA 1E7VA 2KYWA 2D5VA 1RM6C 3R7QA 3V60A 1HF0A 1WM2A 3IAS1 1QQRA 1J8CA 4W9JA 2X38A 1JROA 4GDLB 4BFRA 1ZDXA 1I4PA 1N6ZA 5T8IA 5GMVA 1LO5D 2XEWA 3RNCC 1IP9A 2WX0A 4ZYSA 3H6NA 2PXLA 2A4ZA 5DPRA 5FR6A 4WJOA 4CHKA 4YG7B 3FYAA 1B1ZA 3AEEB 3RD2A 4H2AA 2LGIA 1ZAYA 5EE3A 4ZHOA 1M94A 3DVNU 2MA9B 3IG3A 4YSZB 2JY6A 2MHJA 2BYEA 4C56C 1XD3B 3U4EG 2Z0EB 3NXHA 3H7PA 1ZPQA 2SAKA 1VR9A 2K6QA 3N1ZC 4K1RB 3EUSA 2FCMA 3LB8C 2FBWB 5CHFA 4HCPB 1GUAB 2R63A 2G1EA 2K5PA 5D6JB 1EM7A 5AUKA 4IM3A 2N9XA 4AQ7A 2AWTA 3UI3A 2J53A 3UIOB 4X4BA 2PUCA 4I6UA 1P1AA 4XDCA 4C4VB 2WXJA 2ON8A 3G0TA 4NZLB 5DCNA 2WWZA 2LHEA 1E7PB 4KKIA 2RSUA 5DPWA 2VH2A 3BS3A 4AWJA 1PERL 3AE7B 4S0RA 3HUIA 4IM0A 1XLNA 1HEZE 2GOWA 2NMQA 2IY1B 1X1MA 4GN1A 1D6EC 3AE8B 4M02A 2KWUB 2QC8A 2W55A 1FXIA 3NUHB 4DHZB 3T3NA 4NDWA 3A9JA 2FFHA 2BYVE 3TL5A 4FJYA 1OEYJ 3VR8B 3G5GA 1ZGUB 4YSXB 2IGDA 2KVRA 2I2YA 3SCFA 2MXDA 2VZKD 2L52A 2PXTA 1RFKA 3QJZA 1TIFA 2J7QB 3WANA 1L2NA 1KJTA 1YQ4B 2LHDA 3KJXA 4DXAB 2OFYA 2AX5A 4JWSC 1WXSA 3MHZA 2R61A 3W5UB 2LYQA 3AU5A 3OQNA 2IY0B 3ZNZB 2BTEA 2ZPNA 3KVFB 1PYWD 2KFKB 4FHKA 3LISA 4IKGA 3BDNA 3R66C 5GAHi 2PUFA 3A4RA 3ZHMA 4BOZB 5DPTA 3T8MA 2RMMA 4FXCA 3WIMA 2PXBA 4BBNF 5AEKB 2HFZA 2RDBC 2W3SA 2GRLA 2BJCA 4NPNA 1SB3C 4HXDA 2REXA 1YJJA 3V6CB 1NEKB 1D5ZC 2ZNVC 5LLIA 2N7DA 2DZJA 4BOSC 1F77A 2W82A 2LRWA 1GJZA 3ZXVA 3I63C 3DVGX 1LXDA 2MP2A 3B7HA 2KK8A 3AM9A 5FR3A 4RGNA 3QWGA 2Z59B 4C7YA 3AE4B 1GAQB 2A5UA 3IHPC 3ZGZA 2BNOA 2ZCBA 2KWVB 3APCA 1YQBA 3DPDA 3NJTA 1C77A 3QFIA 3MEJA 3GN5A 1SXTA 4ZRJA 2LXAA 5A7LA 5BO4B 1N60A 3J9CA 4HKZE 3ZVVA 4ER5A 3M3JA 1FIQA 4IOIE 3SCHA 3OLMD 2HJ1A 3SCGA 1F52A 1GB4A 3C19A 1CQVA 4GDLA 3K9PB 3LQXA 1UBIA 2MBEA 3L54A 1QP7A 1MHHE 3FILB 3Q8FA 2C7HA 2WXFA 4ER6A 1SSNA 2PXKA 3PZ8A 3DVGY 4LNIA 2K6DB 2AXUA 4BZAA 1P7FA 3M95A 1KFYB 1XWRA 3OWQA 2MBBB 4ACFA 4LK0M 4DXGA 1TY2A 3VR9B 2XNAC 3TRBA 5C23A 4CO7A 4DE8A 3QOWA 1ZZBA 3IXSA 2KLGA 3NS1A 1R4MB 4FJZA 2M4HA 2KQ7A 4CYEA 4Z58A 4ER7A 5D3IB 3GN5B 3MFGA 3UQAA 1EFAA 1FXAA 1K53A 2ZVOA 4WURA 3H7PB 3NZ3A 5D7GA 1XLQA 5JHAA 2KWDA 1P7EA 1TKGA 4FBIA 1K50A 3R3MA 4TQ1A 4A3OA 4AJYB 2KDEB 4X4DA 4Z5HA 1B9RA 1HZ5A 3OJ3A 1V80A 2PIJA 1SE9A 1A5RA 3HHMA 2PXUA 3NVYA 2LLWA 2VZKB 3NY5A 3NZLA 2DYMA 1U4AA 3RNGC 1TZOA 3B08A 2LD9A 2J0JA 5G55A 3L0WB 2MLBA 2K39A 2V1YA 1R7SA 3QQ6A 1VLBA 3TSSA 2JXTA 3RNBC 3ZKCA 4HPLB 2PXDA 2PMVA 1DW9A 3N32A 1TJEA 2HJ8A 4B95A 5BMHA 1E9MA 4WIPA 1RFAA 2AW6A 2J7UA 2WXGA 2PUBA 4MSQB 3UF8A 2O4AA 3HZIB 3MJWA 4YG1A 2ZVNA 3RNAC 1JWLA 2PJHA 3A9KA 3SR4A 4A55A 2WP9B 3KH0A 1VZ8A 2AXVA 2DZKA 5DTQA 2DYBA 4RH6A 2O49A 5AZHA 1BDIA 1WH3A 2IO2B 4IC7B 3ZNGC 2JSVX 3U8ZA 1QZEA 3WA0A 4ER0A 2KDMA 3EC8A 5BYSA 4IA8A 1VD2A 4LDTB 1E8ZA 2JZPA 3R2TA 1MFWA 3NRZA 2KFKA 2LASA 2G4DB 1EWYC 3I57A 3AEBB 1ZDVA 4Q2JA 2JX5A 2LXCA 1V9JA 3FC4A 3ZTCA 1YD8U 1IBXB 1YNTE 3VH4B 2KTRA 1M4VA 2RDHA 3FILA 4AS1A 2PXPA 2LRUA 1LCDA 5DTMA 4IUMB 4KSLC 2NCNA 1ZXHA 4B0EA 4JCYA 1EWCA 1NYRA 4MGKE 4F8DA 4M0WB 4KKJA 5L95C 2E6XA 2XJ3A 5DTRA 3EFCA 1JQ4A 1KLGD 2OOBB 2NBWB 4NJCA 2FCQA 4X4HA 1NVID 3PREA 3TEWA 2WHIA 2XIUA 4W9EA 3HVDA 2X8XX 1SF0A 3N20C 3SEBA 3G7DA 5CX3A 3IVFA 3ZTDA 2YVCA 3CECA 1K52A 3SDLC 2N0SB 3NVWA 3OQOA 1UH6A 2UU7A 3IFWB 3BWUD 5IP4D 2WXMA 1TKYA 3Q14C 2MW5A 4JQWC 4R3DA 3ZXRA 3UQBA 2PUGA 4I8TA 1Y8RC 1RYJA 4J3OD 1YN3A 4DE9A 2N9KA 3VAWA 1ZZCA 2LGSA 5JHBA 4A90A 4RGMA 3TIXA 2M1MA 5MPOA 2HTME 4ANWA 4EOYA 2DENB 2NPTB 3BIID 2QEJC 3NZSA 4GB9A 2ZJDA 3Q69A 5DRYA 2IYDB 3U3WA 2J0MA 4I6PA 2BYFA 4LDTD 4RF0A 4RCOA 4OZAA 1J7BA 2L00B 1UF0A 3DNVB 4WWOA 2M0AA 4REZA 2ACZB 3ETRA 2EF8A 2HCNA 3RUIB 2JWUA 2GI9A 2INPE 1K51A 1HA5A 2Z0DB 1VRAB 5EE1A 2IO1B 2PW9A 2L3ZA 3AE2B 4W9HA 2L8NA 4MACA 4OVUA 3Q3NC 1DOIA 3DBLB 4PYZA 4CQNA 1TYGB 1UD7A 2MJEA 3AN1A 2MH7A 2DBYA 3KUZA 3NVVA 2WLBA 1R69A 2JYTA 5EE9A 3BYTB 4TMAB 2LYKA 2EKEC 2LNMA 3R7RA 5TSSA 4XE0A 4JL9A 1EU3A 4RGTA 1LLIA 1LCCA 2LVQA 5D94A 3KYCD 1F1HA 1TY0A 4ER3A 2PLPA 2JCGA 3X0WA 5HHDG 4ANXA 4I6LB 4NQLB 2MRPA 2HTHA 2INNE 3QK0A 4WJNA 4TV3A 4NJ7A 5GAGi 1WY8A 2LJIA 2K22A 3F52A 1TT5B 1FMAD 2MQJA 1OQRA 2KTRB 3A1QA 2MP2B 2JPHA 1E90A 1L6VA 1SE4A 1J19A 1AU7A 1FRRA 2ZCCA 3A33B 2NTTA 4US8A 3TEYA 1NI2A 1FNUA 1BMLC 1E3OC 1ENFA 3QA8A 4RF1A 2L1PA 2DWQA 4M0WA 4GLSC 3PRMB 2VH1A 4WWMA 4ANUA 2JXXA 3CLCA 2CS4A 4ZRPA 2K3UA 3AE5B 4F7ZA 1JWUD 1FFUA 2KZRA 4K3CA 3W5VB 4PYUA 5AUIA 3AMZA 1GT0C 5FK9C 1WGYA 2CJOA 3R2IA 4XC2A 4ZRKA 3OG5A 4BVUC 2O2VA 4HKQA 4ZYNA 3M9LA 4OHJA 4YARA 4N59A 2XSDC 3V62A 1BT0A 3P42A 1V5OA 3QYXA 3AEFB 1BDHA 2OJRA 2EELA 2JF5A 2GRMA 3RMKC 2WU5B 1YOVB 4OVZA 2PXVA 3PVLA 1N63A 1V49A 2CU3A 2IBIB 5CHVC 2DAFA 4II2B 3QHTA 1T5XD 3APFA 3ZUNA 1E5WA 2V3SA 4ANVA 3BK2A 3EHVA 2KMMA 2W3RA 1B0NA 4RFBA 3PZ7A 2VRRB 2NPTA 3N30A 4TQ0A 1ZVVA 5HI1A 3ZLZA 1ZW7A 2NBUA 2V3PA 3MP9A 3TEXA 4DHZE 3V61A 2PXQA 1V81A 3ZO5B 3D1NI 2KTFA 4FN3A 2CSFA 4K3BA 4II3B 2I1JA 5L83A 1ET6A 3AV8A 3WALA
chains in the Genus database with same CATH topology
1MPEA 5G5GA 4XWWA 1QLBB 1MHHE 4KGRA 3FILB 2WQYB 2V3NA 3A9ZA 4TSSA 2AQ1B 2B76B 3HVZA 2QMTA 3Q8FA 4N6EB 3Q8CA 2WXFA 1VDVA 4ER6A 1SSNA 4A6QA 1GPXA 2BB5A 3PZ8A 3BK1A 3H8HA 2KQ4X 5E6JA 2NTSA 1JMLA 4ZOHC 1P7FA 3MC0B 1KFYB 4HRSA 1QOAA 3W2DA 1BUIC 1I4RA 3OWQA 1ESFA 1ZOYB 3VRAB 4LK0M 4DXGA 3RFZB 5BYQA 2K0PA 3RPFC 1XEEA 2Y5PA 2WXLA 1J7AA 1TY2A 1STEA 3VR9B 2XNAC 3U52E 1FNWA 4DE8A 3QOWA 3SFDB 1QILA 1GB1A 4P16A 3IXSA 4ARIA 3KLSX 3NS1A 1FM0D 2WXNA 3SX0A 2J7WA 2M4HA 2YBDA 3AB5A 3LXFA 4JE3B 1HXYD 4ER7A 5D3IB 3MFGA 2VEOA 1D4BA 4US9A 1FXAA 1CZPA 1K53A 2V4IB 4EK9A 4WURA 5BMIA 2Z8LA 3NZ3A 1SEBD 5D7GA 1XLQA 2KWDA 5BMGA 1E0ZA 4YTNB 1RWSA 1P7EA 1TKGA 3CWIA 1HZ6A 1KRHA 2HDEA 2BYTA 1K50A 1PGBA 4TQ1A 3GUUA 1FEHA 2ZW0A 2PTLA 1PUTA 2RPVA 3GZDA 1B9RA 1HZ5A 4P6VF 4WAFA 2K9XA 4JWUC 1FFVA 1CJEA 3TUOA 3IT4B 3NVYA 2LLWA 2VZKB 2WXQA 4NAWB 3NZLA 1AN8A 3A9YA 2DYMA 3FAHA 1T3QA 2JYEA 1TZOA 3AE3B 1N5XA 1SJHD 2BS3B 2KN4A 1D5XC 2EKIA 1FD6A 1AW7A 1I4XA 1V1PB 5D3DA 4UDUC 2AQ2B 2WXIA 1UUPA 4MT5A 1ACCA 3MJ5A 3DWMA 3P4PB 4C7ZA 4ARCA 4ZHPA 1R7SA 1VLBA 3TSSA 2JXTA 4L1BA 1MHXA 5HFYA 3E56A 1DOYA 1N5WA 1QT9A 1VZ7A 2MJ3A 2PMVA 1CK1A 3LYYA 4PT5A 1TJEA 1JW9D 3P63A 2IGHA 1L5PA 2DYOA 1C79A 1DYQA 1E9MA 1WXQA 1MVKA 3VWSA 2WXOA 3IAM1 4WIPA 5BMHA 2J7UA 2WXGA 2WDRB 2SEBD 4OZBA 3ZPXA 3QOXA 1C76A 1KF6B 2IGGA 3U2SC 4N58A 1JCKB 1GOZA 1WRIA 1WGKA 1XLPA 1ET9A 3SFEB 4RNAA 3N9YC 3SR4A 4A55A 1TKEA 2WP9B 4C80A 1VZ8A 1AYFA 1Y56A 3SR6A 5DTQA 4RH6A 4HRAA 2N7JA 2WNMA 3KQ4A 1QKZA 2JSVX 2TSSA 2H88B 2LMCA 2ZW1A 1V1OA 4ER0A 2KDMA 1I4HA 5BYSA 1KH0A 1SE2A 2KAJA 1PDXA 5H8YE 2CJNA 2GB1A 1VZ6A 2JZPA 3R2TA 3NRZA 4JX1C 2V0GA 1NYQA 2W54A 3T3OA 4EZIA 1EWYC 4D2KA 1C9FA 3OWEB 3BVMA 3I57A 3AE9B 3AEBB 2LUMA 1ZDVA 4Q2JA 2Y5CA 1JWSD 2JX5A 1QOFA 3PO0A 2IJ0A 4YSYB 2N9LA 3FC4A 1IBXB 2JU6X 1YNTE 3W9CB 4A8XC 1QOBA 1M4VA 2RDHA 3FILA 3ME5A 3P1MA 2PVGC 4AS1A 3ZJTA 3WCQA 5DTMA 1UNSA 1HQRD 1L0VB 4HJGE 1ZXHA 1YQ3B 1J7CA 2OHFA 2Y3AA 2WXKA 4B0EA 1XCTL 1EWCA 1NYRA 1V97A 1PGAA 2D5GA 1UWXA 2QILA 1JWBD 1NI3A 4KKJA 2WDVB 2E6XA 3P4QB 5DTRA 2ICIA 1TS4A 1SIJA 3Q8BA 3ZJUA 1C4CA 1WWTA 3AE6B 1JQ4A 1KLGD 3I9V1 1AWDA 1KTKA 1L6UA 4NJCA 2WXPA 3BYYB 1FCCC 1NVID 3TFLA 3TEWA 3B2GA 1XLOA 1U2ZA 1C4AA 3HVDA 1SF0A 1UGJA 2I38A 2H89B 3W1SA 3SEBA 3C8YA 1WYGA 1FO4A 4RGOS 1JWMD 2PIAA 3GZCA 4EQZA 5BYRA 2LEKA 1K52A 2KACA 3NVZA 2N0SB 3NVWA 1ZUD2 3BWUD 4DXFA 4OBMA 2WXMA 1TKYA 1RM6C 3GS2A 4R3DA 3IAS1 1QQRA 1XO3A 2X38A 1JROA 1T6BX 1XXGA 2L32A 4GDLB 1NW3A 1ZDXA 1RYJA 5I4DA 1I4PA 4J3OD 5T8IA 1YN3A 4DE9A 2N9KA 1FNVA 2WDQB 1LO5D 1QF6A 4ZRQA 4ZYSA 4A90A 4RGMA 3B9JA 4GDKB 4KGSA 5MPOA 2HTME 2IDYA 4YT0B 1B1ZA 1ROEA 3AEEB 3BIID 1L0YB 4H2AA 2LGIA 4LTUA 2ODRD 3AE1B 2QEJC 5C3JB 5EE3A 4EE2A 4ZHOA 5DT2A 1IUEA 3Q69A 5DRYA 2Q5WD 3GP7A 4RF0A 4YSZB 3AEGB 4RCOA 3AH7A 3CIRB 2BBCA 4OZAA 1J7BA 4OW0A 1FRDA 4C56C 1F0ZA 3U4EG 2GRIA 1YMHE 2M0AA 4REZA 1I7HA 4HEA1 2ACZB 3NXHA 3ETRA 4WVLA 2SAKA 1JWAD 5JXVA 2HCNA 1IGCA 1VR9A 2JWUA 3L4PA 3PE5A 2GI9A 1TS3A 4L23A 2MJDA 3LB8C 2FBWB 4YXDB 2INPE 1F2RC 1K51A 2MEKA 1HA5A 1YN4A 1JRPA 2G1EA 2K5PA 4LLGM 3URYA 2QSDA 1A70A 1EM7A 5AUKA 4AQ7A 1VRAB 3AEDB 2OEDA 1C4PA 5EE1A 3IT6B 3EUB2 2PW9A 1NENB 1EU4A 2WS3B 3UI3A 4MM3B 3AE2B 2J53A 4MACA 4NAMA 1BXTA 1DOIA 4CQNA 1YN5A 1TYGB 3P4SB 5GXGB 1IGDA 4XDCA 4WH4A 2MJEA 2BW2A 3AN1A 2QIEB 2WXJA 3GZDC 2ON8A 2QJLA 2DLBA 2MH7A 3G0TA 2DBYA 2FE8A 1V1PA 4NZLB 3NVVA 2WLBA 1I4GA 2JYTA 5EE9A 3BYTB 3Q8AA 2PVOD 4TMAB 2LNMA 2LHEA 5DRTA 4HROA 5TSSA 4USAA 4XE0A 1E7PB 4KKIA 1EU3A 1C78A 4RGTA 3V3XA 1OFFA 4L2YA 4XWTA 2IPKD 3VQIA 2YEPB 1VJKA 3AE7B 4YWGG 1MI0A 3HUIA 1TY0A 4ER3A 2PLPA 1XLNA 1HEZE 2NMQA 1D5MC 4OZCA 3TEZA 3R8BA 3DWGC 5HHDG 1F2RI 3KWLA 4KX6B 2L1AA 1D6EC 1YJIA 3AE8B 2HCSA 1TS2A 1FXIA 2INNE 2W55A 3NUHB 3UWPA 3P4RB 3T3NA 5FKAC 1SBBB 1XCQL 2BS4B 2E3TA 2J4XA 1N62A 2LJIA 1ZE3D 5G5HA 2K22A 3VR8B 4B0MA 4YSXB 2BB6A 3KWVA 2IGDA 1IBXA 2JQRB 1FMAD 2I2YA 3TEPA 1OQRA 3V05A 2MXDA 2VZKD 1I4QA 2L52A 4IDIA 1RFKA 2M56B 1L6VA 1SE4A 1FRRA 2NTTA 4US8A 3TEYA 2M19A 1FNUA 1BMLC 1YQ4B 2LHDA 2FUG1 1ENFA 5HG2A 2AX5A 1L4DB 4RF1A 2L1PA 1Q10A 4JWSC 3MHZA 2DWQA 3ZJVA 2AQ3B 2R61A 4M0WA 4GLSC 3W5UB 2WXRA 4JPSA 3GB1A 4WWMA 3O13A 4O1NA 2XXPA 3NROA 1PFDA 2BTEA 1WSPA 1ZXIA 1PYWD 2YEPF 4ZRPA 2K3UA 4IKGA 4A9AA 3AE5B 1JWUD 1FFUA 2ONQA 3E9SA 3AEAB 3W5VB 2XN9C 1OQQA 5AUIA 2WXHA 3ABVB 3AMZA 2RDGA 3TELA 5FK9C 1KLUD 2CJOA 3R2IA 2G9HD 2BS2B 2RMMA 2XXQA 4FXCA 3R09A 4HKQA 3BZDB 3M9LA 4OHJA 4N59A 1UWMA 3P42A 2HFZA 3AEFB 5JUWA 2EELA 2W3SA 3BVGA 2L83A 2LFIA 2WU5B 2PKOA 1SB3C 5LNK1 3U7ZA 3ZYYX 1QOGA 4OVZA 1YJJA 1DOXA 1NEKB 1SJED 1D5ZC 1TS5A 1N61A 1ZP0B 2LLVA 4DQOC 4YTMB 1N63A 2CU3A 1DGJA 3ZQ4A 1F77A 2J52A 2W82A 1T5XD 3OKZA 1ZPSA 1JALA 5H92C 3EA6A 3EGRA 5EE0A 1E10A 3A9XA 4ITKA 3BK2A 4EKGA 3VRBB 1L4ZB 3BVZA 4MH8A 2KMMA 2W3RA 3HRDD 4RFBA 4EKIA 3AM9A 3PZ7A 5FR3A 4RGNA 1SE3A 4C7YA 2WU2B 3AE4B 1GAQB 3Q8EA 4TQ0A 1E6EB 4KGTA 3ZGZA 1FCLA 2J42A 1PGXA 2BT6A 5HI1A 2V3PA 3MP9A 3TEXA 1C77A 3QFIA 3AECB 1V8CA 3MEJA 1L0XB 4XDDA 4WQMA 1SXTA 1N60A 3J9CA 4HKZE 5C2TB 5DSXA 4ER5A 1FIQA 4IOIE 1XF5L 4YTPB 3B2FA 1ET6A 3AV8A 1GB4A 1CQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1P A;  3TUO A;  4Q2J A;  3NZL A; 
#chains in the Genus database with same CATH topology
 5G5G A;  1LQC A;  1QLB B;  1RZS A;  1TGZ B;  3Q3M C;  3A9Z A;  2B76 B;  2QMT A;  3QX1 A;  4EEW A;  4N6E B;  3Q8C A;  1GPX A;  2BB5 A;  1XT9 B;  3DBH B;  5E6J A;  3KYD D;  1JML A;  4W9G A;  4ZOH C;  1QB2 A;  2D3A A;  3PPA A;  4C4V A;  3A9K B;  4HRS A;  1QOA A;  5DPS A;  3W2D A;  4JCX A;  1ZOY B;  1WE6 A;  2FJR A;  5E6O A;  3CRO L;  2UWQ A;  3RPF C;  3RYT A;  1J7A A;  2ICT A;  2ICP A;  4KV2 A;  3CST A;  1LM8 B;  3U52 E;  3ZNH B;  4ARI A;  1FM0 D;  1AAR A;  1IC8 A;  3TMP B;  2J7W A;  4XGA B;  2YBD A;  4JE3 B;  3LXF A;  1HXY D;  1D4B A;  4WJP A;  3AI5 A;  4IG7 B;  4X57 B;  4EK9 A;  4I6N B;  1WF9 A;  3F51 A;  3PLU A;  1YSE A;  1SEB D;  2PE6 B;  2M17 A;  1RWS A;  2KFJ A;  4NQK E;  4WAA A;  4HWI B;  1HZ6 A;  1KRH A;  2HDE A;  5LXH A;  1HTQ A;  2KWC A;  3RNE C;  1JFS A;  1Y9Q A;  1PUT A;  2RPV A;  1T0S C;  1O4X A;  1FFV A;  2RD0 A;  3IT4 B;  5J17 A;  1YJ1 A;  1HTO A;  4MCT A;  1AN8 A;  3FYM A;  3QC8 B;  3MC8 A;  2JYE A;  1L1M A;  1LFD A;  3ZW3 A;  3R1F A;  1DUL A;  2G4S A;  3IVP A;  1ADR A;  2PPH A;  2JVC A;  2LJ5 A;  3EEC A;  1ACC A;  2I1K A;  3MJ5 A;  4ARC A;  5IO9 A;  3PZD A;  1MHX A;  4IWP A;  1QT9 A;  4M00 A;  5CTR C;  1KOT A;  3LYY A;  4PT5 A;  3JYU A;  4FN2 A;  4DWF A;  1L5P A;  1DYQ A;  2BWE S;  2KO3 A;  3VWS A;  3JW0 X;  3ZDM C;  3ZPX A;  3H9D A;  1C76 A;  4J6I A;  4N58 A;  1JCK B;  1GOZ A;  1WRI A;  1ET9 A;  1P98 A;  3SFE B;  2XI8 A;  3N9Y C;  2JWZ A;  1TKE A;  3QAR A;  3DBS A;  1AYF A;  1Y56 A;  2IZV B;  1T0Q C;  2KKC A;  4HRA A;  3DBR B;  1WH8 A;  3NS8 A;  3TJP A;  2TSS A;  2H88 B;  4K7U A;  2JZ3 B;  2XXA A;  1KH0 A;  5JH5 C;  3TCA A;  5JZE B;  1TZ1 A;  3JVZ X;  3T3O A;  4EZI A;  2C60 A;  3OWE B;  1PQS A;  3AE9 B;  2PE9 A;  2DX5 B;  2Y5C A;  3L1P A;  2KD0 A;  3VUX A;  4DHJ D;  4G3X B;  1RLF A;  3KXA A;  4HDO A;  4FUL A;  2PVG C;  3WCQ A;  1HQR D;  1L0V B;  3DCG A;  1J7C A;  2OHF A;  2WXK A;  1EO6 A;  1ZZ6 A;  1XCT L;  2D11 A;  2LYR A;  2N9E B;  2HSG A;  3LDZ E;  2D5G A;  1NI3 A;  3DHI C;  3HIZ A;  2ICI A;  1SIJ A;  3Q8B A;  1Q0W B;  1Q1O A;  5J2R A;  1IPG A;  3GBF A;  1WIZ A;  4NNJ B;  3I9V 1;  1KTK A;  3RNF C;  1UXD A;  2LGD A;  1WX9 A;  1LMB 3;  4GOC A;  1D3Z A;  4WQO B;  4MDK E;  4OVV A;  1UGJ A;  1FXT B;  2H89 B;  4W9F A;  3W1S A;  3C8Y A;  3QAQ A;  2IU7 A;  5BYR A;  2LEK A;  3NVZ A;  4F8C B;  1HE8 A;  1ZUD 2;  3RZZ A;  4DXF A;  3H5T A;  4OBM A;  2QCZ A;  4GU2 A;  4B9K A;  4BAX A;  3GS2 A;  3PHX B;  2KEK A;  3DQV A;  1XO3 A;  3APD A;  3A1Q B;  3JSV B;  2IVG A;  1XXG A;  2L32 A;  2Y5B B;  5I4D A;  3KL4 A;  3OQM A;  4W9I A;  4URK A;  2WDQ B;  1QF6 A;  4K7W A;  4N9F 4;  2GBR A;  2KN5 A;  2FNJ B;  2V4L A;  1UXC A;  3PTF C;  5CHW A;  4MGZ E;  2J0K A;  3L08 A;  1V2Y A;  4E71 A;  2IDY A;  4YT0 B;  1ROE A;  4MEL A;  4LTU A;  2LYL A;  4FBJ B;  3AE1 B;  5C3J B;  3H7S A;  4IW0 A;  1IUE A;  1YX5 B;  2EBY A;  2LGX A;  3GP7 A;  4P7I A;  3AEG B;  2MX2 A;  3AH7 A;  3CIR B;  3NOB A;  1UZX B;  4HPP A;  1WGR A;  1I7H A;  3U30 A;  2MBQ A;  1WZ3 A;  2K1F A;  4MEM A;  4HCN B;  5JXV A;  2D10 A;  3L4P A;  2BQQ A;  3PE5 A;  1QP4 A;  1TS3 A;  4L23 A;  2MJD A;  4X4G A;  4M01 A;  4A20 A;  1F2R C;  1NEQ A;  2MEK A;  4HVB A;  2AWI A;  4IWO A;  4LJP B;  4PU8 A;  4FJV B;  3URY A;  2QSD A;  1WX7 A;  1A70 A;  4LNK A;  3AU4 A;  2OED A;  2B3A A;  1NEN B;  4JIO U;  1EU4 A;  2WS3 B;  3ZRF A;  4MM3 B;  2CHW A;  3Q3F A;  2KC1 A;  1BXT A;  4NAM A;  1UTX A;  1YN5 A;  3P4S B;  1IGD A;  3FKY A;  1YX6 B;  2QIE B;  3GZD C;  4PK1 A;  2DLB A;  1V1P A;  1I4G A;  3Q8A A;  3O65 B;  2PVO D;  2KZ8 A;  1GG3 A;  5DRT A;  3UIN B;  2EMT A;  3V3X A;  1MFQ C;  1OFF A;  1WR6 E;  2IPK D;  1KM7 A;  3VQI A;  2YEP B;  1POU A;  4PS8 A;  1WI0 A;  3ZDT A;  4YWG G;  1MI0 A;  3PS6 A;  3TEZ A;  4OZC A;  2YLM A;  3S8Q A;  3Q3J A;  1F2R I;  4QAY A;  1SGH A;  1YJI A;  3DM5 A;  4MH0 E;  2D3C A;  5FKA C;  1SBB B;  2BVC A;  4LCD E;  1WX8 A;  2J4X A;  1N62 A;  1ZE3 D;  5G5H A;  3A4S C;  4B0M A;  3ZKJ C;  2KEI A;  3WAP A;  1QZX A;  1IBX A;  4DBG A;  2JQE A;  2JQR B;  3PGE A;  3TEP A;  1WRD B;  4IDI A;  2M56 B;  3KUD B;  2M19 A;  1Z2M A;  2C7N B;  2FUG 1;  1SQ8 A;  1Q10 A;  3ZJV A;  1OQY A;  3GB1 A;  3O13 A;  2XXP A;  3NRO A;  1PFD A;  2PEA A;  3KZ3 A;  1ZXI A;  4GGQ A;  3E9S A;  2M4N A;  4K7S A;  5E6P A;  1RPE L;  1MG4 A;  4EZJ A;  2D07 B;  2WXH A;  2RDG A;  3TEL A;  1GC6 A;  2L0T A;  1KLU D;  2G9H D;  1PRU A;  2BS2 B;  3JXB C;  4BKS D;  1ZUG A;  1UWM A;  4M8N A;  3I3T B;  5JUW A;  2CRO A;  3BVG A;  2L83 A;  1ZS4 A;  1ZZ9 A;  5LNK 1;  3ZYY X;  1T0Y A;  1DOX A;  1SJE D;  1TS5 A;  2KDF B;  2L05 A;  4BKS A;  4M8M A;  2O38 A;  4YTM B;  5C1Z A;  3ZQ4 A;  2CHZ A;  3QIJ A;  2KQS A;  3OKZ A;  2UYZ B;  1JAL A;  3Q3O C;  3EA6 A;  1ZKH A;  1C3T A;  4WWN A;  2GBM A;  1LGR A;  2KXJ A;  2DHZ A;  4K81 A;  3BVZ A;  2O6V B;  4Z5C A;  3HRD D;  3KUC B;  4EKI A;  2WU2 B;  3VTW A;  1PRV A;  2QDF A;  4KZ0 A;  1WJ6 A;  1PGX A;  3CSF A;  1C1Y B;  3AEC B;  1V8C A;  1GC7 A;  1L0X B;  4XDD A;  4WQM A;  2PUA A;  2KHW B;  2CR5 A;  2IO3 B;  3DBR I;  1CMX B;  2KOX A;  4AOF A;  2EWT A;  5DSX A;  4YTP B;  3B2F A;  1YIW A;  1R4M I;  3KWV A;  4NJ6 A;  4PS3 A;  2GBJ A;  3ZRC A;  3GOE A;  3GZN I;  2N4F A;  3DBL I;  4TSS A;  1K8R B;  4S17 A;  1Z5S B;  1VDV A;  4A6Q A;  1L7Y A;  2WUS R;  3BK1 A;  2PXE A;  2NTS A;  3CF6 E;  4EZL A;  2WYQ A;  3PLV A;  3MC0 B;  1BUI C;  1I4R A;  3OMT A;  1ESF A;  2M8S A;  1CQT A;  3VRA B;  3PXP A;  1UGM A;  3RFZ B;  5BYQ A;  2K0P A;  2V3C C;  4GDK A;  1STE A;  1WMH B;  3PRP B;  1FNW A;  4P16 A;  3WAM A;  2ZNV B;  2RR9 A;  2AL3 A;  2EMS A;  3UGB B;  2VEO A;  2NBV B;  3VK0 A;  1CZP A;  2CHX A;  2L7R A;  4DHJ B;  5BMI A;  3GE3 C;  5IOI A;  1ISN A;  4ICU A;  1E0Z A;  4YTN B;  1H4R A;  3BY4 B;  4MCX A;  1FEH A;  2ZW0 A;  2R2Q A;  2CKH B;  3GZD A;  3DVN V;  2FCN A;  4P6V F;  5D2M B;  4WAF A;  2MBO A;  2O6V D;  2NR2 A;  2K9X A;  4JWU C;  4LNO A;  3U7D A;  1JFT A;  1WR1 A;  3A9Y A;  4FAD A;  5TR5 A;  4MJS B;  4J1X A;  3AE3 B;  3GZN B;  1X2L A;  1SJH D;  1N5X A;  3L16 A;  2KN4 A;  2EKI A;  4EUT A;  1AW7 A;  1I4X A;  3H1U A;  1V1P B;  2C7M B;  2KC2 A;  2AQ2 B;  4UDU C;  3X23 A;  1UUP A;  3P4P B;  2XK5 A;  2KDI A;  4C7Z A;  2D2Q A;  2C9W B;  5HFY A;  3E56 A;  1DOY A;  1VZ7 A;  1WMH A;  2MJ3 A;  3ENE A;  3O9X A;  2CU1 A;  3P63 A;  4IWQ A;  4F1S A;  2IGH A;  3VDZ A;  1C79 A;  2WXO A;  1WXQ A;  3IAM 1;  2SEB D;  3QOX A;  3EFU A;  1WJU A;  1WGK A;  2MBH A;  1XLP A;  3JXD L;  2KX3 A;  4RNA A;  5KHQ A;  3N3K B;  2LZ6 A;  1WJ4 A;  3L10 B;  4C80 A;  2L0F A;  3QQ8 B;  2H8R A;  2PXF A;  4YBA A;  2IV1 A;  2N7J A;  2WNM A;  3S2A A;  1NDD A;  3KQ4 A;  3NG0 A;  3VTV A;  4KDL B;  2LMC A;  3D32 A;  1V1O A;  3DHH C;  4XX5 A;  2N7E A;  2KAJ A;  5H8Y E;  2G45 B;  1VZ6 A;  2DAJ A;  1E7U A;  3PV1 A;  4JX1 C;  2C5L C;  3ML8 A;  2M0X A;  4EFO A;  3PSE B;  1C9F A;  1ZZ7 A;  5AZF A;  2JZZ A;  3QWZ B;  2MCN B;  2DZI A;  2IJ0 A;  3I5J C;  3RN9 C;  1G6J A;  5EDS A;  2JU6 X;  4W9K A;  4A8X C;  2IUO A;  3B0A A;  1MJD A;  3P1M A;  3GE8 C;  4I6T A;  3ZJT A;  2JUO A;  3NDB B;  2JT4 B;  1UNS A;  4HJG E;  2K8B A;  3CMM B;  2Y3A A;  2PUD A;  1KLV A;  1P9D U;  1PGA A;  2BGF A;  2QIL A;  1UWX A;  4IWR A;  2WDV B;  2HE7 A;  4HPM B;  2MWS B;  4AUQ C;  3ZJU A;  5IAA C;  1WWT A;  4O8B A;  1AWD A;  1FPY A;  3JXC L;  2WXP A;  2O6V A;  4BKT A;  2N9P C;  1LQB A;  4KIK B;  3OJ4 B;  1U2Z A;  3MHS D;  2I38 A;  3DDC B;  3ECI A;  1JWM D;  1QQB A;  3ZHI A;  1X57 A;  2PIA A;  3GZC A;  3RZF A;  1E8Y A;  4EQZ A;  2AUW A;  1PNR A;  1WFY A;  2AEH A;  2G3Q B;  4J1W A;  1NBF C;  4KZC A;  4AP4 C;  2KX0 A;  3W1S C;  3VH3 B;  4ASW C;  5IN7 A;  2KJ6 A;  2BWF A;  1RIO A;  1T6B X;  1NW3 A;  2OR1 L;  2WGS A;  1FNV A;  2N1V A;  1WXM A;  5K98 B;  4GIV A;  4ZRQ A;  3T9L A;  2DNF A;  3SD5 A;  2GBN A;  2LYP A;  3B9J A;  4NY0 A;  4GDK B;  1OEY A;  4KGS A;  1JH9 A;  1DWK A;  5LXI B;  1L0Y B;  1P0R A;  4RM8 A;  1WET A;  2ODR D;  4IM2 A;  2LYJ A;  1TTN A;  4EE2 A;  5DT2 A;  2LVP A;  2Q5W D;  4X4I A;  4XYC A;  3VFK A;  2BBC A;  1F0Z A;  4OW0 A;  1FRD A;  2GRI A;  2BNM A;  1YMH E;  4HEA 1;  3OP9 A;  4HDQ A;  4WVL A;  1JWA D;  1IGC A;  3WAO A;  2O2V B;  3HK0 A;  2KPJ A;  4YXD B;  3MTN B;  1YN4 A;  1JRP A;  4LLG M;  2R2O A;  3AED B;  4PU4 C;  1C4P A;  3IT6 B;  3EUB 2;  1R4N B;  1E8X A;  1WJN A;  3UIP B;  3Q6B A;  2W9N A;  4NAW A;  5GXG B;  3RCZ A;  4WH4 A;  2BW2 A;  2QJL A;  4RM9 A;  2FE8 A;  4DDI D;  2KEJ A;  2ZZP B;  4PU7 A;  4HRO A;  4Z59 A;  1OCT C;  4USA A;  1C78 A;  2DZM A;  4L2Y A;  4XWT A;  4TUU A;  4WWP A;  2HD5 B;  1J0G A;  1IYF A;  1VJK A;  3B1L X;  3M63 B;  1D5M C;  2QHO A;  3F6W A;  3R8B A;  1WXA A;  3DWG C;  3TBL D;  3KWL A;  4KX6 B;  2L1A A;  2HCS A;  1RRB A;  2K8C A;  1TS2 A;  3P4R B;  3UWP A;  1XCQ L;  2BS4 B;  2E3T A;  4FLH A;  3QF3 A;  1GNU A;  4GHJ A;  2BB6 A;  4Y42 A;  1RZR D;  3PRZ A;  3V05 A;  3VUW A;  2KLC A;  5G2N A;  1I4Q A;  4I6R A;  4X4C A;  4HK2 A;  4JQD A;  1WE7 A;  2IVB A;  1WIA A;  2HIN A;  3ML9 A;  5HG2 A;  3VHT C;  1L4D B;  1RZR A;  1HQ1 A;  2PE5 A;  2AQ3 B;  4PS7 A;  2WXR A;  4JPS A;  2IND C;  4O1N A;  2BF8 B;  4Z5D A;  1WGG A;  1WSP A;  2YEP F;  4A9A A;  2BKF A;  4A3P A;  2ONQ A;  3AEA B;  3M62 B;  2XN9 C;  1UEL A;  1OQQ A;  1R4N I;  3MC9 A;  3ABV B;  4JGH B;  2LUE A;  4G50 A;  2FAZ A;  4DDG D;  2XXQ A;  4GMV A;  4KSK C;  3R09 A;  1V6E A;  3NHE B;  3BZD B;  3L17 A;  4GSW A;  4MGY E;  1WYW B;  4MGI E;  1ZZ8 A;  3W1Y A;  2LFI A;  3AXC A;  3ZIM A;  3VXW A;  2PKO A;  2KT7 A;  3U7Z A;  1QOG A;  2AL6 A;  4LJO B;  1N61 A;  1ZP0 B;  2LLV A;  1OSL A;  1Y7Y A;  4DQO C;  1DGJ A;  2R1J L;  2J52 A;  1ZPS A;  3L13 A;  3V6E B;  2RPQ A;  1S1Q B;  2WX1 A;  3EGR A;  4LNN A;  5EE0 A;  5H92 C;  1E10 A;  3A9X A;  3DHG C;  4ITK A;  4P1B C;  4P1C C;  4EKG A;  3VRB B;  1L4Z B;  1V86 A;  4MH8 A;  1SE3 A;  3Q8E A;  3N1X C;  1P3Q U;  1E6E B;  4KGT A;  2GBK A;  1S7E A;  4XZ4 A;  1FCL A;  2J42 A;  2BT6 A;  5HKH A;  1H8C A;  2D3G A;  2XK5 B;  3PHW B;  3LFP A;  2KMC A;  5C2T B;  2JRI B;  3LJ3 A;  2BKR B;  1XF5 L;  1WGD A;  2LVO A;  3NZU A;  1VCB A;  1MPE A;  3N1Y C;  4XWW A;  4KVG B;  1CJG A;  2LI5 A;  3C0R B;  1RAX A;  4KGR A;  4HLE A;  2WQY B;  2V3N A;  4ZRI A;  2BNN A;  2AQ1 B;  3HVZ A;  4MSM B;  4E74 A;  1Q5W B;  1VPW A;  4G0N B;  3OAW A;  3H8H A;  2KQ4 X;  4MM3 A;  2WIU B;  4ICV A;  4G11 A;  4MJS A;  4YG4 A;  1S3S G;  3HM6 X;  2KVZ A;  4BBN C;  1OTR B;  1I35 A;  1WZ0 A;  3K9O B;  4C00 A;  2FID A;  1XEE A;  2Y5P A;  3ZNI D;  2WXL A;  2XBB C;  5IKC M;  1EF5 A;  4FA6 A;  2NS5 A;  2GMI C;  3PT2 B;  2V9H A;  2WDT B;  3SFD B;  1QIL A;  1GB1 A;  4WJQ A;  1F9J A;  3KLS X;  2WXN A;  3SX0 A;  3ALB A;  3P2B A;  3AB5 A;  1WXV A;  2NVU I;  1MG8 A;  4US9 A;  2V4I B;  2N1W A;  4X4E A;  2KNB A;  2Z8L A;  4FHJ A;  2PPX A;  3MLF A;  3RUL A;  5BMG A;  2LCV A;  3DBH I;  2MQK A;  2KMA A;  3CWI A;  2ASQ A;  2BYT A;  1PGB A;  3GUU A;  2XCJ A;  2PTL A;  4TKN A;  1QQA A;  2K8H A;  3VVW B;  3KW5 B;  3HM3 A;  2L76 A;  1CJE A;  3TUO A;  2FIF A;  2WXQ A;  4GQM A;  4W9D A;  4NAW B;  2L8J A;  3FAH A;  3QCA A;  1TBE A;  1T3Q A;  2K25 A;  2BS3 B;  2KJH B;  1D5X C;  2BPS A;  3Q2A C;  1FD6 A;  2KAN A;  2IVQ A;  5D3D A;  1QP0 A;  2WXI A;  3A9J B;  2MEZ A;  4MT5 A;  3DWM A;  4AJW A;  4EZK A;  2B5A A;  4ZHP A;  4L1B A;  1N5W A;  1JRU A;  1E8W A;  1CK1 A;  1SIF A;  3FMY A;  2LYS A;  1JW9 D;  2DYO A;  3AUL A;  3BD1 A;  4BKG A;  2D3B A;  1PRA A;  1MVK A;  5J18 A;  1QPZ A;  4IVZ A;  2WDR B;  4LNF A;  4OZB A;  4X4F A;  4GXB A;  1WH6 A;  2L49 A;  3JSV A;  5AZG A;  2FUH B;  2JVL A;  1KF6 B;  2IGG A;  3U2S C;  5KHO A;  2LWP A;  3UFD A;  3SU8 X;  1NER A;  1V5T A;  2GLS A;  2LGY A;  1WM3 A;  2PUE A;  3SR6 A;  2KDB A;  4KIK A;  4E3C A;  1QKZ A;  1EF1 A;  2MSE D;  2IO0 B;  2ZW1 A;  2JRH A;  1I4H A;  3RZW C;  2OJW A;  1SE2 A;  2AYO B;  1PDX A;  2CJN A;  2GB1 A;  1OGW A;  2KJR A;  3VUY A;  3DOW A;  1EUV B;  2V0G A;  1NYQ A;  2W54 A;  2ZEQ A;  4D2K A;  3BVM A;  2GZU A;  2LUM A;  1JWS D;  4YL8 A;  1QOF A;  3PO0 A;  4W9C A;  4YSY B;  2N9L A;  3W9C B;  4EKU A;  1QOB A;  1XQQ A;  3RT3 B;  3ME5 A;  1WGH A;  4DK5 A;  2INC C;  4KDI C;  1YQ3 B;  4B6W A;  2ZPY A;  1V97 A;  4RMA A;  1JWB D;  2AXZ A;  3P4Q B;  4PU3 C;  3SHQ A;  2FCS A;  1TS4 A;  1I42 A;  1C4C A;  3BIN A;  3AE6 B;  2A6C A;  1L6U A;  3BYY B;  1FCC C;  2RGF A;  4ZDV A;  3TFL A;  4HJK A;  3B2G A;  1XLO A;  1C4A A;  1WYG A;  1FO4 A;  5E6N A;  4RGO S;  4W9L A;  1T0R C;  4OB4 A;  3ONS A;  3VTU A;  2KAC A;  5IA7 A;  3RI7 C;  1R63 A;  4JLC A;  1UBQ A;  3IBE A;  1E7V A;  2KYW A;  2D5V A;  1RM6 C;  3R7Q A;  3V60 A;  1HF0 A;  1WM2 A;  3IAS 1;  1QQR A;  1J8C A;  4W9J A;  2X38 A;  1JRO A;  4GDL B;  4BFR A;  1ZDX A;  1I4P A;  1N6Z A;  5T8I A;  5GMV A;  1LO5 D;  2XEW A;  3RNC C;  1IP9 A;  2WX0 A;  4ZYS A;  3H6N A;  2PXL A;  2A4Z A;  5DPR A;  5FR6 A;  4WJO A;  4CHK A;  4YG7 B;  3FYA A;  1B1Z A;  3AEE B;  3RD2 A;  4H2A A;  2LGI A;  1ZAY A;  5EE3 A;  4ZHO A;  1M94 A;  3DVN U;  2MA9 B;  3IG3 A;  4YSZ B;  2JY6 A;  2MHJ A;  2BYE A;  4C56 C;  1XD3 B;  3U4E G;  2Z0E B;  3NXH A;  3H7P A;  1ZPQ A;  2SAK A;  1VR9 A;  2K6Q A;  3N1Z C;  4K1R B;  3EUS A;  2FCM A;  3LB8 C;  2FBW B;  5CHF A;  4HCP B;  1GUA B;  2R63 A;  2G1E A;  2K5P A;  5D6J B;  1EM7 A;  5AUK A;  4IM3 A;  2N9X A;  4AQ7 A;  2AWT A;  3UI3 A;  2J53 A;  3UIO B;  4X4B A;  2PUC A;  4I6U A;  1P1A A;  4XDC A;  4C4V B;  2WXJ A;  2ON8 A;  3G0T A;  4NZL B;  5DCN A;  2WWZ A;  2LHE A;  1E7P B;  4KKI A;  2RSU A;  5DPW A;  2VH2 A;  3BS3 A;  4AWJ A;  1PER L;  3AE7 B;  4S0R A;  3HUI A;  4IM0 A;  1XLN A;  1HEZ E;  2GOW A;  2NMQ A;  2IY1 B;  1X1M A;  4GN1 A;  1D6E C;  3AE8 B;  4M02 A;  2KWU B;  2QC8 A;  2W55 A;  1FXI A;  3NUH B;  4DHZ B;  3T3N A;  4NDW A;  3A9J A;  2FFH A;  2BYV E;  3TL5 A;  4FJY A;  1OEY J;  3VR8 B;  3G5G A;  1ZGU B;  4YSX B;  2IGD A;  2KVR A;  2I2Y A;  3SCF A;  2MXD A;  2VZK D;  2L52 A;  2PXT A;  1RFK A;  3QJZ A;  1TIF A;  2J7Q B;  3WAN A;  1L2N A;  1KJT A;  1YQ4 B;  2LHD A;  3KJX A;  4DXA B;  2OFY A;  2AX5 A;  4JWS C;  1WXS A;  3MHZ A;  2R61 A;  3W5U B;  2LYQ A;  3AU5 A;  3OQN A;  2IY0 B;  3ZNZ B;  2BTE A;  2ZPN A;  3KVF B;  1PYW D;  2KFK B;  4FHK A;  3LIS A;  4IKG A;  3BDN A;  3R66 C;  5GAH i;  2PUF A;  3A4R A;  3ZHM A;  4BOZ B;  5DPT A;  3T8M A;  2RMM A;  4FXC A;  3WIM A;  2PXB A;  4BBN F;  5AEK B;  2HFZ A;  2RDB C;  2W3S A;  2GRL A;  2BJC A;  4NPN A;  1SB3 C;  4HXD A;  2REX A;  1YJJ A;  3V6C B;  1NEK B;  1D5Z C;  2ZNV C;  5LLI A;  2N7D A;  2DZJ A;  4BOS C;  1F77 A;  2W82 A;  2LRW A;  1GJZ A;  3ZXV A;  3I63 C;  3DVG X;  1LXD A;  2MP2 A;  3B7H A;  2KK8 A;  3AM9 A;  5FR3 A;  4RGN A;  3QWG A;  2Z59 B;  4C7Y A;  3AE4 B;  1GAQ B;  2A5U A;  3IHP C;  3ZGZ A;  2BNO A;  2ZCB A;  2KWV B;  3APC A;  1YQB A;  3DPD A;  3NJT A;  1C77 A;  3QFI A;  3MEJ A;  3GN5 A;  1SXT A;  4ZRJ A;  2LXA A;  5A7L A;  5BO4 B;  1N60 A;  3J9C A;  4HKZ E;  3ZVV A;  4ER5 A;  3M3J A;  1FIQ A;  4IOI E;  3SCH A;  3OLM D;  2HJ1 A;  3SCG A;  1F52 A;  1GB4 A;  3C19 A;  1CQV A;  4GDL A;  3K9P B;  3LQX A;  1UBI A;  2MBE A;  3L54 A;  1QP7 A;  1MHH E;  3FIL B;  3Q8F A;  2C7H A;  2WXF A;  4ER6 A;  1SSN A;  2PXK A;  3PZ8 A;  3DVG Y;  4LNI A;  2K6D B;  2AXU A;  4BZA A;  1P7F A;  3M95 A;  1KFY B;  1XWR A;  3OWQ A;  2MBB B;  4ACF A;  4LK0 M;  4DXG A;  1TY2 A;  3VR9 B;  2XNA C;  3TRB A;  5C23 A;  4CO7 A;  4DE8 A;  3QOW A;  1ZZB A;  3IXS A;  2KLG A;  3NS1 A;  1R4M B;  4FJZ A;  2M4H A;  2KQ7 A;  4CYE A;  4Z58 A;  4ER7 A;  5D3I B;  3GN5 B;  3MFG A;  3UQA A;  1EFA A;  1FXA A;  1K53 A;  2ZVO A;  4WUR A;  3H7P B;  3NZ3 A;  5D7G A;  1XLQ A;  5JHA A;  2KWD A;  1P7E A;  1TKG A;  4FBI A;  1K50 A;  3R3M A;  4TQ1 A;  4A3O A;  4AJY B;  2KDE B;  4X4D A;  4Z5H A;  1B9R A;  1HZ5 A;  3OJ3 A;  1V80 A;  2PIJ A;  1SE9 A;  1A5R A;  3HHM A;  2PXU A;  3NVY A;  2LLW A;  2VZK B;  3NY5 A;  3NZL A;  2DYM A;  1U4A A;  3RNG C;  1TZO A;  3B08 A;  2LD9 A;  2J0J A;  5G55 A;  3L0W B;  2MLB A;  2K39 A;  2V1Y A;  1R7S A;  3QQ6 A;  1VLB A;  3TSS A;  2JXT A;  3RNB C;  3ZKC A;  4HPL B;  2PXD A;  2PMV A;  1DW9 A;  3N32 A;  1TJE A;  2HJ8 A;  4B95 A;  5BMH A;  1E9M A;  4WIP A;  1RFA A;  2AW6 A;  2J7U A;  2WXG A;  2PUB A;  4MSQ B;  3UF8 A;  2O4A A;  3HZI B;  3MJW A;  4YG1 A;  2ZVN A;  3RNA C;  1JWL A;  2PJH A;  3A9K A;  3SR4 A;  4A55 A;  2WP9 B;  3KH0 A;  1VZ8 A;  2AXV A;  2DZK A;  5DTQ A;  2DYB A;  4RH6 A;  2O49 A;  5AZH A;  1BDI A;  1WH3 A;  2IO2 B;  4IC7 B;  3ZNG C;  2JSV X;  3U8Z A;  1QZE A;  3WA0 A;  4ER0 A;  2KDM A;  3EC8 A;  5BYS A;  4IA8 A;  1VD2 A;  4LDT B;  1E8Z A;  2JZP A;  3R2T A;  1MFW A;  3NRZ A;  2KFK A;  2LAS A;  2G4D B;  1EWY C;  3I57 A;  3AEB B;  1ZDV A;  4Q2J A;  2JX5 A;  2LXC A;  1V9J A;  3FC4 A;  3ZTC A;  1YD8 U;  1IBX B;  1YNT E;  3VH4 B;  2KTR A;  1M4V A;  2RDH A;  3FIL A;  4AS1 A;  2PXP A;  2LRU A;  1LCD A;  5DTM A;  4IUM B;  4KSL C;  2NCN A;  1ZXH A;  4B0E A;  4JCY A;  1EWC A;  1NYR A;  4MGK E;  4F8D A;  4M0W B;  4KKJ A;  5L95 C;  2E6X A;  2XJ3 A;  5DTR A;  3EFC A;  1JQ4 A;  1KLG D;  2OOB B;  2NBW B;  4NJC A;  2FCQ A;  4X4H A;  1NVI D;  3PRE A;  3TEW A;  2WHI A;  2XIU A;  4W9E A;  3HVD A;  2X8X X;  1SF0 A;  3N20 C;  3SEB A;  3G7D A;  5CX3 A;  3IVF A;  3ZTD A;  2YVC A;  3CEC A;  1K52 A;  3SDL C;  2N0S B;  3NVW A;  3OQO A;  1UH6 A;  2UU7 A;  3IFW B;  3BWU D;  5IP4 D;  2WXM A;  1TKY A;  3Q14 C;  2MW5 A;  4JQW C;  4R3D A;  3ZXR A;  3UQB A;  2PUG A;  4I8T A;  1Y8R C;  1RYJ A;  4J3O D;  1YN3 A;  4DE9 A;  2N9K A;  3VAW A;  1ZZC A;  2LGS A;  5JHB A;  4A90 A;  4RGM A;  3TIX A;  2M1M A;  5MPO A;  2HTM E;  4ANW A;  4EOY A;  2DEN B;  2NPT B;  3BII D;  2QEJ C;  3NZS A;  4GB9 A;  2ZJD A;  3Q69 A;  5DRY A;  2IYD B;  3U3W A;  2J0M A;  4I6P A;  2BYF A;  4LDT D;  4RF0 A;  4RCO A;  4OZA A;  1J7B A;  2L00 B;  1UF0 A;  3DNV B;  4WWO A;  2M0A A;  4REZ A;  2ACZ B;  3ETR A;  2EF8 A;  2HCN A;  3RUI B;  2JWU A;  2GI9 A;  2INP E;  1K51 A;  1HA5 A;  2Z0D B;  1VRA B;  5EE1 A;  2IO1 B;  2PW9 A;  2L3Z A;  3AE2 B;  4W9H A;  2L8N A;  4MAC A;  4OVU A;  3Q3N C;  1DOI A;  3DBL B;  4PYZ A;  4CQN A;  1TYG B;  1UD7 A;  2MJE A;  3AN1 A;  2MH7 A;  2DBY A;  3KUZ A;  3NVV A;  2WLB A;  1R69 A;  2JYT A;  5EE9 A;  3BYT B;  4TMA B;  2LYK A;  2EKE C;  2LNM A;  3R7R A;  5TSS A;  4XE0 A;  4JL9 A;  1EU3 A;  4RGT A;  1LLI A;  1LCC A;  2LVQ A;  5D94 A;  3KYC D;  1F1H A;  1TY0 A;  4ER3 A;  2PLP A;  2JCG A;  3X0W A;  5HHD G;  4ANX A;  4I6L B;  4NQL B;  2MRP A;  2HTH A;  2INN E;  3QK0 A;  4WJN A;  4TV3 A;  4NJ7 A;  5GAG i;  1WY8 A;  2LJI A;  2K22 A;  3F52 A;  1TT5 B;  1FMA D;  2MQJ A;  1OQR A;  2KTR B;  3A1Q A;  2MP2 B;  2JPH A;  1E90 A;  1L6V A;  1SE4 A;  1J19 A;  1AU7 A;  1FRR A;  2ZCC A;  3A33 B;  2NTT A;  4US8 A;  3TEY A;  1NI2 A;  1FNU A;  1BML C;  1E3O C;  1ENF A;  3QA8 A;  4RF1 A;  2L1P A;  2DWQ A;  4M0W A;  4GLS C;  3PRM B;  2VH1 A;  4WWM A;  4ANU A;  2JXX A;  3CLC A;  2CS4 A;  4ZRP A;  2K3U A;  3AE5 B;  4F7Z A;  1JWU D;  1FFU A;  2KZR A;  4K3C A;  3W5V B;  4PYU A;  5AUI A;  3AMZ A;  1GT0 C;  5FK9 C;  1WGY A;  2CJO A;  3R2I A;  4XC2 A;  4ZRK A;  3OG5 A;  4BVU C;  2O2V A;  4HKQ A;  4ZYN A;  3M9L A;  4OHJ A;  4YAR A;  4N59 A;  2XSD C;  3V62 A;  1BT0 A;  3P42 A;  1V5O A;  3QYX A;  3AEF B;  1BDH A;  2OJR A;  2EEL A;  2JF5 A;  2GRM A;  3RMK C;  2WU5 B;  1YOV B;  4OVZ A;  2PXV A;  3PVL A;  1N63 A;  1V49 A;  2CU3 A;  2IBI B;  5CHV C;  2DAF A;  4II2 B;  3QHT A;  1T5X D;  3APF A;  3ZUN A;  1E5W A;  2V3S A;  4ANV A;  3BK2 A;  3EHV A;  2KMM A;  2W3R A;  1B0N A;  4RFB A;  3PZ7 A;  2VRR B;  2NPT A;  3N30 A;  4TQ0 A;  1ZVV A;  5HI1 A;  3ZLZ A;  1ZW7 A;  2NBU A;  2V3P A;  3MP9 A;  3TEX A;  4DHZ E;  3V61 A;  2PXQ A;  1V81 A;  3ZO5 B;  3D1N I;  2KTF A;  4FN3 A;  2CSF A;  4K3B A;  4II3 B;  2I1J A;  5L83 A;  1ET6 A;  3AV8 A;  3WAL A; 
#chains in the Genus database with same CATH homology
 1MPE A;  5G5G A;  4XWW A;  1QLB B;  1MHH E;  4KGR A;  3FIL B;  2WQY B;  2V3N A;  3A9Z A;  4TSS A;  2AQ1 B;  2B76 B;  3HVZ A;  2QMT A;  3Q8F A;  4N6E B;  3Q8C A;  2WXF A;  1VDV A;  4ER6 A;  1SSN A;  4A6Q A;  1GPX A;  2BB5 A;  3PZ8 A;  3BK1 A;  3H8H A;  2KQ4 X;  5E6J A;  2NTS A;  1JML A;  4ZOH C;  1P7F A;  3MC0 B;  1KFY B;  4HRS A;  1QOA A;  3W2D A;  1BUI C;  1I4R A;  3OWQ A;  1ESF A;  1ZOY B;  3VRA B;  4LK0 M;  4DXG A;  3RFZ B;  5BYQ A;  2K0P A;  3RPF C;  1XEE A;  2Y5P A;  2WXL A;  1J7A A;  1TY2 A;  1STE A;  3VR9 B;  2XNA C;  3U52 E;  1FNW A;  4DE8 A;  3QOW A;  3SFD B;  1QIL A;  1GB1 A;  4P16 A;  3IXS A;  4ARI A;  3KLS X;  3NS1 A;  1FM0 D;  2WXN A;  3SX0 A;  2J7W A;  2M4H A;  2YBD A;  3AB5 A;  3LXF A;  4JE3 B;  1HXY D;  4ER7 A;  5D3I B;  3MFG A;  2VEO A;  1D4B A;  4US9 A;  1FXA A;  1CZP A;  1K53 A;  2V4I B;  4EK9 A;  4WUR A;  5BMI A;  2Z8L A;  3NZ3 A;  1SEB D;  5D7G A;  1XLQ A;  2KWD A;  5BMG A;  1E0Z A;  4YTN B;  1RWS A;  1P7E A;  1TKG A;  3CWI A;  1HZ6 A;  1KRH A;  2HDE A;  2BYT A;  1K50 A;  1PGB A;  4TQ1 A;  3GUU A;  1FEH A;  2ZW0 A;  2PTL A;  1PUT A;  2RPV A;  3GZD A;  1B9R A;  1HZ5 A;  4P6V F;  4WAF A;  2K9X A;  4JWU C;  1FFV A;  1CJE A;  3TUO A;  3IT4 B;  3NVY A;  2LLW A;  2VZK B;  2WXQ A;  4NAW B;  3NZL A;  1AN8 A;  3A9Y A;  2DYM A;  3FAH A;  1T3Q A;  2JYE A;  1TZO A;  3AE3 B;  1N5X A;  1SJH D;  2BS3 B;  2KN4 A;  1D5X C;  2EKI A;  1FD6 A;  1AW7 A;  1I4X A;  1V1P B;  5D3D A;  4UDU C;  2AQ2 B;  2WXI A;  1UUP A;  4MT5 A;  1ACC A;  3MJ5 A;  3DWM A;  3P4P B;  4C7Z A;  4ARC A;  4ZHP A;  1R7S A;  1VLB A;  3TSS A;  2JXT A;  4L1B A;  1MHX A;  5HFY A;  3E56 A;  1DOY A;  1N5W A;  1QT9 A;  1VZ7 A;  2MJ3 A;  2PMV A;  1CK1 A;  3LYY A;  4PT5 A;  1TJE A;  1JW9 D;  3P63 A;  2IGH A;  1L5P A;  2DYO A;  1C79 A;  1DYQ A;  1E9M A;  1WXQ A;  1MVK A;  3VWS A;  2WXO A;  3IAM 1;  4WIP A;  5BMH A;  2J7U A;  2WXG A;  2WDR B;  2SEB D;  4OZB A;  3ZPX A;  3QOX A;  1C76 A;  1KF6 B;  2IGG A;  3U2S C;  4N58 A;  1JCK B;  1GOZ A;  1WRI A;  1WGK A;  1XLP A;  1ET9 A;  3SFE B;  4RNA A;  3N9Y C;  3SR4 A;  4A55 A;  1TKE A;  2WP9 B;  4C80 A;  1VZ8 A;  1AYF A;  1Y56 A;  3SR6 A;  5DTQ A;  4RH6 A;  4HRA A;  2N7J A;  2WNM A;  3KQ4 A;  1QKZ A;  2JSV X;  2TSS A;  2H88 B;  2LMC A;  2ZW1 A;  1V1O A;  4ER0 A;  2KDM A;  1I4H A;  5BYS A;  1KH0 A;  1SE2 A;  2KAJ A;  1PDX A;  5H8Y E;  2CJN A;  2GB1 A;  1VZ6 A;  2JZP A;  3R2T A;  3NRZ A;  4JX1 C;  2V0G A;  1NYQ A;  2W54 A;  3T3O A;  4EZI A;  1EWY C;  4D2K A;  1C9F A;  3OWE B;  3BVM A;  3I57 A;  3AE9 B;  3AEB B;  2LUM A;  1ZDV A;  4Q2J A;  2Y5C A;  1JWS D;  2JX5 A;  1QOF A;  3PO0 A;  2IJ0 A;  4YSY B;  2N9L A;  3FC4 A;  1IBX B;  2JU6 X;  1YNT E;  3W9C B;  4A8X C;  1QOB A;  1M4V A;  2RDH A;  3FIL A;  3ME5 A;  3P1M A;  2PVG C;  4AS1 A;  3ZJT A;  3WCQ A;  5DTM A;  1UNS A;  1HQR D;  1L0V B;  4HJG E;  1ZXH A;  1YQ3 B;  1J7C A;  2OHF A;  2Y3A A;  2WXK A;  4B0E A;  1XCT L;  1EWC A;  1NYR A;  1V97 A;  1PGA A;  2D5G A;  1UWX A;  2QIL A;  1JWB D;  1NI3 A;  4KKJ A;  2WDV B;  2E6X A;  3P4Q B;  5DTR A;  2ICI A;  1TS4 A;  1SIJ A;  3Q8B A;  3ZJU A;  1C4C A;  1WWT A;  3AE6 B;  1JQ4 A;  1KLG D;  3I9V 1;  1AWD A;  1KTK A;  1L6U A;  4NJC A;  2WXP A;  3BYY B;  1FCC C;  1NVI D;  3TFL A;  3TEW A;  3B2G A;  1XLO A;  1U2Z A;  1C4A A;  3HVD A;  1SF0 A;  1UGJ A;  2I38 A;  2H89 B;  3W1S A;  3SEB A;  3C8Y A;  1WYG A;  1FO4 A;  4RGO S;  1JWM D;  2PIA A;  3GZC A;  4EQZ A;  5BYR A;  2LEK A;  1K52 A;  2KAC A;  3NVZ A;  2N0S B;  3NVW A;  1ZUD 2;  3BWU D;  4DXF A;  4OBM A;  2WXM A;  1TKY A;  1RM6 C;  3GS2 A;  4R3D A;  3IAS 1;  1QQR A;  1XO3 A;  2X38 A;  1JRO A;  1T6B X;  1XXG A;  2L32 A;  4GDL B;  1NW3 A;  1ZDX A;  1RYJ A;  5I4D A;  1I4P A;  4J3O D;  5T8I A;  1YN3 A;  4DE9 A;  2N9K A;  1FNV A;  2WDQ B;  1LO5 D;  1QF6 A;  4ZRQ A;  4ZYS A;  4A90 A;  4RGM A;  3B9J A;  4GDK B;  4KGS A;  5MPO A;  2HTM E;  2IDY A;  4YT0 B;  1B1Z A;  1ROE A;  3AEE B;  3BII D;  1L0Y B;  4H2A A;  2LGI A;  4LTU A;  2ODR D;  3AE1 B;  2QEJ C;  5C3J B;  5EE3 A;  4EE2 A;  4ZHO A;  5DT2 A;  1IUE A;  3Q69 A;  5DRY A;  2Q5W D;  3GP7 A;  4RF0 A;  4YSZ B;  3AEG B;  4RCO A;  3AH7 A;  3CIR B;  2BBC A;  4OZA A;  1J7B A;  4OW0 A;  1FRD A;  4C56 C;  1F0Z A;  3U4E G;  2GRI A;  1YMH E;  2M0A A;  4REZ A;  1I7H A;  4HEA 1;  2ACZ B;  3NXH A;  3ETR A;  4WVL A;  2SAK A;  1JWA D;  5JXV A;  2HCN A;  1IGC A;  1VR9 A;  2JWU A;  3L4P A;  3PE5 A;  2GI9 A;  1TS3 A;  4L23 A;  2MJD A;  3LB8 C;  2FBW B;  4YXD B;  2INP E;  1F2R C;  1K51 A;  2MEK A;  1HA5 A;  1YN4 A;  1JRP A;  2G1E A;  2K5P A;  4LLG M;  3URY A;  2QSD A;  1A70 A;  1EM7 A;  5AUK A;  4AQ7 A;  1VRA B;  3AED B;  2OED A;  1C4P A;  5EE1 A;  3IT6 B;  3EUB 2;  2PW9 A;  1NEN B;  1EU4 A;  2WS3 B;  3UI3 A;  4MM3 B;  3AE2 B;  2J53 A;  4MAC A;  4NAM A;  1BXT A;  1DOI A;  4CQN A;  1YN5 A;  1TYG B;  3P4S B;  5GXG B;  1IGD A;  4XDC A;  4WH4 A;  2MJE A;  2BW2 A;  3AN1 A;  2QIE B;  2WXJ A;  3GZD C;  2ON8 A;  2QJL A;  2DLB A;  2MH7 A;  3G0T A;  2DBY A;  2FE8 A;  1V1P A;  4NZL B;  3NVV A;  2WLB A;  1I4G A;  2JYT A;  5EE9 A;  3BYT B;  3Q8A A;  2PVO D;  4TMA B;  2LNM A;  2LHE A;  5DRT A;  4HRO A;  5TSS A;  4USA A;  4XE0 A;  1E7P B;  4KKI A;  1EU3 A;  1C78 A;  4RGT A;  3V3X A;  1OFF A;  4L2Y A;  4XWT A;  2IPK D;  3VQI A;  2YEP B;  1VJK A;  3AE7 B;  4YWG G;  1MI0 A;  3HUI A;  1TY0 A;  4ER3 A;  2PLP A;  1XLN A;  1HEZ E;  2NMQ A;  1D5M C;  4OZC A;  3TEZ A;  3R8B A;  3DWG C;  5HHD G;  1F2R I;  3KWL A;  4KX6 B;  2L1A A;  1D6E C;  1YJI A;  3AE8 B;  2HCS A;  1TS2 A;  1FXI A;  2INN E;  2W55 A;  3NUH B;  3UWP A;  3P4R B;  3T3N A;  5FKA C;  1SBB B;  1XCQ L;  2BS4 B;  2E3T A;  2J4X A;  1N62 A;  2LJI A;  1ZE3 D;  5G5H A;  2K22 A;  3VR8 B;  4B0M A;  4YSX B;  2BB6 A;  3KWV A;  2IGD A;  1IBX A;  2JQR B;  1FMA D;  2I2Y A;  3TEP A;  1OQR A;  3V05 A;  2MXD A;  2VZK D;  1I4Q A;  2L52 A;  4IDI A;  1RFK A;  2M56 B;  1L6V A;  1SE4 A;  1FRR A;  2NTT A;  4US8 A;  3TEY A;  2M19 A;  1FNU A;  1BML C;  1YQ4 B;  2LHD A;  2FUG 1;  1ENF A;  5HG2 A;  2AX5 A;  1L4D B;  4RF1 A;  2L1P A;  1Q10 A;  4JWS C;  3MHZ A;  2DWQ A;  3ZJV A;  2AQ3 B;  2R61 A;  4M0W A;  4GLS C;  3W5U B;  2WXR A;  4JPS A;  3GB1 A;  4WWM A;  3O13 A;  4O1N A;  2XXP A;  3NRO A;  1PFD A;  2BTE A;  1WSP A;  1ZXI A;  1PYW D;  2YEP F;  4ZRP A;  2K3U A;  4IKG A;  4A9A A;  3AE5 B;  1JWU D;  1FFU A;  2ONQ A;  3E9S A;  3AEA B;  3W5V B;  2XN9 C;  1OQQ A;  5AUI A;  2WXH A;  3ABV B;  3AMZ A;  2RDG A;  3TEL A;  5FK9 C;  1KLU D;  2CJO A;  3R2I A;  2G9H D;  2BS2 B;  2RMM A;  2XXQ A;  4FXC A;  3R09 A;  4HKQ A;  3BZD B;  3M9L A;  4OHJ A;  4N59 A;  1UWM A;  3P42 A;  2HFZ A;  3AEF B;  5JUW A;  2EEL A;  2W3S A;  3BVG A;  2L83 A;  2LFI A;  2WU5 B;  2PKO A;  1SB3 C;  5LNK 1;  3U7Z A;  3ZYY X;  1QOG A;  4OVZ A;  1YJJ A;  1DOX A;  1NEK B;  1SJE D;  1D5Z C;  1TS5 A;  1N61 A;  1ZP0 B;  2LLV A;  4DQO C;  4YTM B;  1N63 A;  2CU3 A;  1DGJ A;  3ZQ4 A;  1F77 A;  2J52 A;  2W82 A;  1T5X D;  3OKZ A;  1ZPS A;  1JAL A;  5H92 C;  3EA6 A;  3EGR A;  5EE0 A;  1E10 A;  3A9X A;  4ITK A;  3BK2 A;  4EKG A;  3VRB B;  1L4Z B;  3BVZ A;  4MH8 A;  2KMM A;  2W3R A;  3HRD D;  4RFB A;  4EKI A;  3AM9 A;  3PZ7 A;  5FR3 A;  4RGN A;  1SE3 A;  4C7Y A;  2WU2 B;  3AE4 B;  1GAQ B;  3Q8E A;  4TQ0 A;  1E6E B;  4KGT A;  3ZGZ A;  1FCL A;  2J42 A;  1PGX A;  2BT6 A;  5HI1 A;  2V3P A;  3MP9 A;  3TEX A;  1C77 A;  3QFI A;  3AEC B;  1V8C A;  3MEJ A;  1L0X B;  4XDD A;  4WQM A;  1SXT A;  1N60 A;  3J9C A;  4HKZ E;  5C2T B;  5DSX A;  4ER5 A;  1FIQ A;  4IOI E;  1XF5 L;  4YTP B;  3B2F A;  1ET6 A;  3AV8 A;  1GB4 A;  1CQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...