4Q2JA

A novel structure-based mechanism for dna-binding of satb1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
169
Chain Sequence
GPGSGTMLPVFCVVEHKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords DNA-binding protein SATB1
total genus 38
structure length 169
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4q2jA02
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4q2jA01
3NZLA 4Q2JA 3TUOA 2L1PA
chains in the Genus database with same CATH superfamily
3J9CA 1HF0A 3TL5A 1DULA 1RM6C 3IG3A 1RRBA 2IO3B 1ZPSA 2XI8A 2M0XA 4YARA 3BZDB 3L4PA 3RCZA 1WXVA 4N9F4 1JWUD 3VTVA 3JXDL 2C7NB 1WX8A 3UQAA 4REZA 4LNNA 2IO0B 3TEPA 3DVGY 4DE8A 5IN7A 2AEHA 2M4HA 1V5TA 4LJOB 2DBYA 4UDUC 5EDSA 3LQXA 1L6UA 3R1FA 3UINB 4YSZB 5EE1A 2JXXA 2KMAA 4PYZA 4TV3A 1XT9B 3Q2AC 4EZJA 2CJNA 3AH7A 3BINA 2OOBB 4EKUA 1I42A 5E6OA 1WE6A 1EFAA 1PGBA 2N9LA 4IDIA 2L52A 2ONQA 2ICTA 1E0ZA 4OVZA 4Z59A 3DBHI 4NQLB 1IGDA 3KLSX 4YG4A 2MWSB 1XXGA 1GUAB 4TSSA 2Z0DB 3NUHB 2GRMA 3I5JC 3ZIMA 3VQIA 4YWGG 4GGQA 5D3DA 1V1PB 1FFUA 3HM3A 3WAPA 2WXJA 4KGRA 3IVPA 3IFWB 4HJGE 4YSXB 1DW9A 3RN9C 3ZNID 4KZCA 2PUBA 1TTNA 3G0TA 4NNJB 1SQ8A 2R2QA 2DYOA 1UZXB 4ANVA 2WYQA 4ITKA 3TEZA 1E7VA 1ZVVA 2G45B 2KLGA 4Z5DA 2J7UA 5GAGi 1SE9A 5BYRA 3NZ3A 2EWTA 3OJ4B 3OWQA 5LLIA 3OQMA 2CU1A 2O2VA 1RZRD 3VH4B 1M94A 3NS1A 2HCSA 3A1QA 2BNNA 2BYTA 2GBJA 2D3AA 1UGMA 2MRPA 1XLNA 4QAYA 2RSUA 5C3JB 2K3UA 1STEA 3AE8B 5LXHA 2N7JA 3ZXVA 3U2SC 1VPWA 2DLBA 2IV1A 2NMQA 3CSTA 2WWZA 4G50A 4K3CA 1HQRD 3I63C 2JRHA 4A3PA 3ZJUA 3PZDA 5C2TB 4KVGB 5A7LA 2FCQA 4US9A 4HWIB 2I1JA 1HZ5A 1EO6A 1L7YA 2KNBA 2UYZB 2PUEA 3AEGB 1HXYD 2KEIA 4AP4C 1QOGA 3B1LX 3SHQA 4NZLB 2JF5A 4Q2JA 2KFKB 2LGXA 1VRAB 2MBBB 3NZLA 3HK0A 1ZZ8A 4MACA 4W9HA 4ZHPA 2ZCBA 3L10B 5AZGA 2NPTB 3P2BA 3OQNA 4EE2A 3KW5B 2CS4A 1JFSA 1UWXA 3IHPC 3N1YC 4GXBA 3BYTB 1OQQA 3GOEA 2BS3B 2JT4B 5H8YE 1Q10A 2W54A 1OSLA 4J1WA 3WALA 2MEKA 5IO9A 1E9MA 4GDLA 1O4XA 3U52E 1GC6A 3MHSD 2FUG1 3AECB 4DHZE 1P7FA 5CHVC 4DHZB 4OHJA 3AB5A 1TY0A 1VR9A 3OQOA 4MCTA 4PT5A 2NR2A 5BMIA 3MEJA 1D5XC 2JVLA 1PRVA 5E6PA 3N1ZC 4Z5CA 1JWLA 1TYGB 1R4NB 4B9KA 3CSFA 3GZDA 2EF8A 1RIOA 3APCA 3RFZB 2PXPA 1SE2A 2XEWA 1YJIA 2PTLA 2B3AA 3L16A 2RDHA 1GG3A 3WIMA 2GRLA 2OFYA 1DGJA 1XO3A 2K39A 4ZRIA 1IBXB 1XLPA 2DYMA 5C23A 3ETRA 3SEBA 3IAM1 5JUWA 3O13A 4I6NB 3RT3B 4ZDVA 4HROA 2L7RA 1FCLA 1JWBD 1EWCA 4A8XC 1XCQL 3RNGC 4EKGA 2HJ8A 2QHOA 4M0WB 4WWMA 4CO7A 4IA8A 3FILA 3ZDMC 3BYYB 2M1MA 4XX5A 3TJPA 1N5WA 1TZOA 2O6VA 3RULA 2LWPA 5TR5A 1GOZA 3GZNB 2V3NA 1WGHA 1JH9A 2Z59B 2J7WA 1F2RC 1V6EA 3KWLA 1C76A 3IBEA 3M95A 1RPEL 1HZ6A 1UH6A 4X4CA 4NQKE 1GNUA 4FLHA 4BOSC 3ALBA 4RF1A 2ACZB 3ZYYX 1ZGUB 1OTRB 3L0WB 3WCQA 1LMB3 4JE3B 3QFIA 3MFGA 3PO0A 5IP4D 5IKCM 3EUB2 2LD9A 3PRPB 1YX5B 1WJ6A 3ML9A 4IC7B 4O8BA 2MJDA 5K98B 1U2ZA 1ROEA 1UUPA 2KQSA 3I9V1 2JQRB 3QK0A 2BWES 3VK0A 2RR9A 3H7SA 4A9AA 1UGJA 1QQAA 1QB2A 3U8ZA 1A5RA 2BW2A 1E3OC 1WWTA 1FCCC 2IO2B 1N60A 4L1BA 4C7ZA 3LFPA 3DVGX 3DVNU 2NS5A 1ZZ9A 1UF0A 1SBBB 5FR6A 2WXRA 1RLFA 1WYWB 3AN1A 2XCJA 2EMSA 4G0NB 3HIZA 1YN3A 3A4SC 1WF9A 1ZZ7A 2JZ3B 2JYTA 2WDTB 3A9KA 4P16A 4NJ7A 3T9LA 3BD1A 4GSWA 4W9DA 1T0SC 3ZJVA 2O49A 2PW9A 3U4EG 1GB1A 1DWKA 3U3WA 4K1RB 1T5XD 2KD0A 2XBBC 2FIDA 4MM3B 4Z58A 2LYPA 4RGTA 3Q6BA 3EFCA 2K0PA 2PIJA 1QP7A 2Y5CA 3R2TA 4L23A 1NI2A 4MGKE 1N61A 1H4RA 3DPDA 5DPRA 4IG7B 4MT5A 4IKGA 1WXMA 3AEFB 1J8CA 4WWOA 2KEJA 2IPKD 3SCHA 1QKZA 3SR4A 1FNVA 1MPEA 1CQTA 1OQRA 1LQCA 1YSEA 1LQBA 2CHZA 4IW0A 1XWRA 3D32A 3URYA 5D7GA 3VTUA 2FBWB 2LRWA 3IT6B 1HTOA 2ZPNA 1YNTE 2EELA 2XXPA 3AE1B 4GB9A 5E6JA 3KUCB 2KKCA 4BKGA 1V81A 1WRIA 2DX5B 3OMTA 5HG2A 2WP9B 2L76A 4N59A 1U4AA 3AE7B 1NYRA 3V61A 3PLUA 1K8RB 2BB6A 5DTRA 4OVUA 3UI3A 1WRDB 3PHXB 4K7UA 5KHOA 2INCC 2EKEC 2HTHA 4RCOA 2IYDB 2XK5B 2OHFA 3BWUD 1DOIA 4HDOA 4MH8A 4HKQA 2LGDA 2WGSA 4F8DA 2IGDA 2PJHA 3SR6A 2MSED 1FRRA 1D3ZA 3JSVB 2WU2B 4ER6A 2UWQA 4EZIA 3AE3B 1NDDA 2HD5B 2YBDA 4WURA 2GOWA 5BMHA 4NPNA 3V3XA 2OR1L 1Q1OA 1NI3A 3BK1A 2KDMA 3QX1A 1F2RI 3FC4A 1NERA 3ENEA 1JWSD 3L17A 4E74A 1YJ1A 1MFWA 3ABVB 3ECIA 1DOYA 1R4MB 1KM7A 3QOXA 1G6JA 3GN5B 4EZLA 3MJ5A 1FRDA 1CMXB 2J0KA 2KJRA 1AW7A 3QQ8B 3DDCB 3H7PA 3VUXA 2FCNA 1WGRA 2AYOB 4A3OA 3QWZB 1MJDA 2E3TA 4X4DA 4ZRPA 4W9LA 2V4IB 3P4SB 4C4VA 2PLPA 2L0TA 3V62A 1R63A 2BBCA 2Y5BB 2LCVA 1VDVA 2QC8A 3WA0A 1J7CA 2RDBC 2LUEA 4P7IA 2WXQA 3AM9A 4JWSC 3L08A 1E90A 4XDCA 2MBQA 3ZRFA 3ZRCA 2IU7A 3GZNI 3B9JA 2KXJA 4EK9A 1FIQA 4GIVA 2LYQA 2N7DA 4JGHB 3DNVB 2DNFA 2LHDA 3MJWA 2N0SB 1LCCA 2AWIA 3NVZA 3NVYA 3VUWA 4DWFA 4LNKA 4LK0M 1R7SA 2QEJC 4YL8A 1I35A 1B9RA 1KH0A 2KO3A 3H9DA 1B0NA 1DOXA 2AXZA 3NG0A 2PMVA 1L0YB 3Q69A 4YTNB 4PU4C 2BT6A 2W3SA 4ANXA 3QA8A 1YOVB 1ZE3D 2HINA 3QCAA 1QOAA 3NROA 4Y42A 3NJTA 1JW9D 4MM3A 4X4IA 1YQ4B 3H7PB 3VXWA 2NBWB 3Q3FA 2BB5A 2QCZA 3ZHMA 2CR5A 5EE9A 3ZLZA 4M8NA 2AXUA 2WXPA 4B0EA 4DBGA 4BVUC 1PDXA 4FBJB 3A9XA 3EECA 4MGYE 4NAWA 3C19A 1JMLA 2FE8A 1TS5A 2I1KA 4HDQA 1OCTC 1RYJA 1FEHA 4JX1C 1I4PA 3NZSA 3VHTC 5J2RA 4ZHOA 2L8JA 4WIPA 1QP0A 1LGRA 2CHXA 2LRUA 3U7ZA 4J3OD 4DXGA 3GE8C 3W2DA 1ZXIA 2WUSR 2L49A 1WI0A 1BDIA 2MQJA 1E7UA 5FK9C 2KC1A 2KTFA 5AZFA 2BS4B 1JQ4A 2PIAA 5HKHA 2KN5A 4OBMA 2G1EA 4XDDA 1TT5B 2FJRA 3MC8A 2DAFA 3BS3A 5BYSA 3LISA 1UTXA 4C56C 1EU3A 1P9DU 2NVUI 4YT0B 3FMYA 5D6JB 5TSSA 1I4RA 1WSPA 2XK5A 3UQBA 1FPYA 3VDZA 4TMAB 3FYAA 2LVQA 2V3CC 3R2IA 2WDRB 3VH3B 4K81A 4M8MA 2B76B 2LEKA 4ZRQA 5IA7A 3F6WA 2PXEA 1T3QA 3BVZA 2NPTA 2W3RA 1L1MA 5JH5C 4LJPB 3ZVVA 3SCFA 1PYWD 4XGAB 3AV8A 1IP9A 3UF8A 5AEKB 2LFIA 5JXVA 3UWPA 3DBSA 1A70A 3TEYA 1UBQA 4IM2A 2L1PA 2TSSA 3JW0X 2BPSA 2PXFA 4DDGD 1L0VB 3ONSA 2AW6A 4ICUA 3T3NA 1LM8B 2RMMA 4IWPA 2JWUA 2L8NA 4RMAA 1ZDVA 2DZKA 5HI1A 3RPFC 2KWCA 4M0WA 2BGFA 4JLCA 1KFYB 2WDQB 3BK2A 1LO5D 3CMMB 1OQYA 4GLSC 3VAWA 3A9YA 3HM6X 4F8CB 5L83A 2LXCA 1VZ8A 3Q3JA 4IOIE 1LXDA 1TKYA 2L00B 1D6EC 1ZXHA 3PXPA 1GB4A 1D4BA 3F51A 2N7EA 3W5VB 1F1HA 4AJWA 3N32A 2K9XA 2KLCA 3RNEC 2O38A 3E56A 4WJPA 1RFKA 1X2LA 3X0WA 2SAKA 3IVFA 5DCNA 2MHJA 1C79A 1C1YB 4DHJB 2BWFA 3GBFA 2ZJDA 4H2AA 4GMVA 2WXIA 4S0RA 1MI0A 2WXNA 1Q0WB 2LYSA 1I4XA 1S7EA 1N6ZA 2FAZA 2IO1B 2NTTA 3U7DA 3G7DA 1VZ6A 3A9KB 5CHFA 3RYTA 3ZTCA 4HLEA 3KUDB 4B6WA 3PSEB 2LYLA 2PXBA 3B08A 3JSVA 2N9PC 3OLMD 3HVZA 1JWMD 4HPPA 4XWWA 4ANUA 1SIJA 4JWUC 5DPTA 2ODRD 3Q8EA 5G2NA 2KZ8A 2KWUB 3TELA 2W55A 4OW0A 4XZ4A 1I4HA 3FYMA 2ICPA 2XXQA 4B95A 2KX3A 1FMAD 2PVGC 1UNSA 1KOTA 4FULA 3CECA 1K50A 2YEPB 5KHQA 2HJ1A 3UFDA 4K7SA 3AU5A 2M4NA 4X57B 2CHWA 4GU2A 4AS1A 2N1WA 1V97A 1PUTA 2BVCA 1WGKA 1SXTA 4FBIA 3KZ3A 2H89B 2N9XA 3V6EB 3ZNGC 2WQYB 2XSDC 4GDKB 1PRUA 1DYQA 3V60A 3BVMA 1Y8RC 1UXDA 2MJ3A 1V5OA 3NY5A 3R7RA 5DPWA 2J0JA 3RUIB 4KDLB 4LDTD 4NJ6A 3D1NI 2KVRA 1SF0A 3AE9B 3K9OB 1T0RC 2BYFA 2PXUA 2BNOA 3Q14C 1NVID 1FNWA 2WX0A 1V8CA 1VLBA 4DK5A 1MG4A 2BQQA 3WANA 2WLBA 3N20C 1K53A 4I6RA 2M0AA 1J0GA 5I4DA 3TIXA 3DHGC 5MPOA 3R8BA 2HFZA 1JROA 4URKA 2Z0EB 2JY6A 5H92C 1WFYA 1ZKHA 3DCGA 3U30A 4FHJA 3DM5A 2C9WB 4I6LB 5DTMA 2N1VA 4C4VB 1L0XB 3GZCA 1ZUGA 2LUMA 1ISNA 1J7BA 1ADRA 1IBXA 4TUUA 4II3B 4FA6A 3NS8A 3GN5A 4JPSA 1XD3B 4MCXA 3DBLB 4BKSD 3N3KB 4XE0A 1I7HA 2JZZA 1YJJA 1T6BX 1C4CA 4TQ0A 4MEMA 2LNMA 3PRZA 2KJHB 2QJLA 2BTEA 1IC8A 1EUVB 4F7ZA 1MVKA 1V86A 4YG1A 3S2AA 2RGFA 1L4ZB 3NDBB 2OJWA 4ZRKA 1ACCA 4GN1A 4NAWB 4FJVB 2BKRB 4JCXA 2KHWB 2JCGA 3ZJTA 2KOXA 3R7QA 4DXAB 1ZAYA 3ZUNA 1FM0D 1WX9A 1AARA 1ENFA 1E10A 1UXCA 1XQQA 3SFEB 3X23A 3O9XA 1WGDA 3P4PB 2W82A 5G55A 3KL4A 4WAFA 1TZ1A 2J42A 3HZIB 4WWNA 3O65B 1OGWA 3PHWB 2V3SA 4ICVA 1YN5A 3KVFB 4PU8A 4J1XA 1K52A 3M3JA 4S17A 2D5VA 2KFJA 5IOIA 1UWMA 2GI9A 3ZGZA 1PFDA 3KH0A 5AUIA 1SIFA 1PGAA 2Y3AA 1C77A 1WR1A 4HKZE 2HE7A 3RZWC 2V1YA 1RZRA 1L4DB 4HK2A 4RM8A 4L2YA 3AXCA 1IYFA 5G5GA 3W1SC 1C78A 3TUOA 2MEZA 4OVVA 1KJTA 2JVCA 2PKOA 2EBYA 4IM0A 3H1UA 4RH6A 4BAXA 3PV1A 2WS3B 4GHJA 3RNAC 1KF6B 3H6NA 3HUIA 2XN9C 2G9HD 4G11A 3UGBB 3R66C 3EC8A 4BBNF 4KV2A 3V6CB 1WXQA 4ER5A 3VWSA 2O2VB 3B7HA 1JCKB 2PUAA 2D3GA 2H88B 3QWGA 2GBNA 4W9EA 1TKGA 3N1XC 3ZHIA 4LNIA 4W9CA 2D10A 4DDID 2BNMA 4JQWC 2GBRA 5EE3A 2ZPYA 1TS4A 3LB8C 4ASWC 4RFBA 2DZIA 2NCNA 2XNAC 3PGEA 1WH3A 5L95C 4HRSA 2WXHA 2IGGA 4ZYNA 1QQRA 1ET9A 2N9KA 2MX2A 1KLUD 1R4NI 2KTRB 2MLBA 1P3QU 3PZ8A 3PREA 5E6NA 2LI5A 2AXVA 4Z5HA 1I4GA 3H8HA 4AOFA 2IJ0A 1WJUA 2K6QA 2V9HA 4KGSA 1TBEA 3DHIC 4X4FA 4OZAA 2BJCA 2KJ6A 4II2B 3B2GA 4GDLB 5CTRC 1WY8A 1RZSA 4HXDA 1SEBD 4LLGM 3MC0B 2VRRB 4P6VF 5JZEB 4BKSA 4LDTB 1EF5A 4I8TA 1QLBB 3KWVA 2NBUA 2AQ3B 2G4DB 3V05A 1SE4A 4DHJD 2ZVNA 3VR9B 3MP9A 4FHKA 3TEXA 4EUTA 5LNK1 2WXFA 1BDHA 2ZNVC 1D5MC 4FJZA 3DOWA 3ME5A 4EFOA 1BMLC 4KSLC 2ZW1A 4US8A 4PS7A 3SX0A 2KFKA 3ZDTA 2FFHA 3ZXRA 4PU7A 1ZOYB 2QILA 3M62B 4GQMA 3OKZA 3C0RB 3KYCD 3SU8X 1FO4A 3OG5A 4KX6B 3MTNB 3CROL 3AEDB 2J52A 2O6VB 3T3OA 3APDA 3RNFC 2JU6X 2KDFB 1ZW7A 3RNCC 3Q3NC 3NXHA 2LMCA 1WXSA 1ZZCA 4KSKC 3IT4B 1E8YA 4JCYA 1YD8U 3PLVA 2G3QB 3R3MA 1S1QB 2NTSA 5IAAC 3AE4B 1TS3A 1ESFA 3RMKC 4WJNA 5D2MB 2JWZA 4FXCA 4E3CA 3L13A 4YTPB 2MBHA 4CHKA 2RPQA 1OFFA 1P0RA 1E5WA 2YEPF 3VUYA 5DTQA 5DPSA 3P1MA 2BYEA 1KTKA 3OJ3A 1XLQA 2WXKA 4X4GA 3OAWA 2IVGA 1C9FA 3QOWA 3FKYA 3Q3MC 4MJSB 2PUDA 4ER3A 2DAJA 5G5HA 4EKIA 2VZKB 3GS2A 2AUWA 1YIWA 2O6VD 4W9IA 1JWAD 1TJEA 4BOZB 2KX0A 5DT2A 2V0GA 4USAA 1LLIA 2QDFA 2J7QB 3Q8AA 4G3XB 2UU7A 4MSQB 1C4AA 1AWDA 4IWQA 1EU4A 3BVGA 1R69A 2LVPA 2KPJA 5JHBA 2AWTA 3EGRA 4M02A 4DXFA 2REXA 2PE6B 2L83A 5DRYA 1LFDA 2DZMA 4WH4A 4EZKA 1WH8A 4EOYA 1QOFA 2N9EB 1RFAA 4N6EB 2ICIA 1X57A 3EFUA 1VD2A 2NBVB 3C8YA 2L32A 2YVCA 3P4RB 3TSSA 3VFKA 2M19A 3A4RA 5CHWA 2MBOA 1MFQC 2V4LA 3AE5B 4WJOA 1L2NA 4ER7A 3QARA 4ACFA 2JRIB 3AI5A 4I6UA 3I57A 3M63B 4LNFA 2ZW0A 1EM7A 3NVWA 3PVLA 1CK1A 4C00A 4KKIA 2AQ1B 2O4AA 1OEYJ 5T8IA 3PPAA 3DVNV 2KZRA 2WXMA 2GRIA 4YTMB 1HA5A 3KJXA 1M4VA 4YG7B 2HSGA 4DQOC 3T8MA 3AEEB 3DBHB 4RM9A 2FCMA 1L5PA 2K8CA 1PQSA 1MHHE 1VJKA 3A9JA 1N63A 3FILB 1ZP0B 2LVOA 3QQ6A 3LYYA 3KXAA 1Q5WB 2LHEA 3DBRB 3GZDC 2R1JL 3TRBA 2PE5A 3JXCL 3RD2A 5JHAA 1VCBA 1ET6A 5BMGA 4I6PA 2LJ5A 2R61A 2RPVA 1V2YA 2MW5A 1YX6B 2IGHA 4AWJA 1V80A 2MXDA 1MHXA 4F1SA 2KQ7A 4C80A 1UBIA 3LXFA 2M56B 3AE6B 4EQZA 4YSYB 2PXLA 1TS2A 1Y9QA 1FFVA 3ZKJC 1WR6E 3HVDA 1Z5SB 3RI7C 3VRBB 3GE3C 1E8XA 2RDGA 3QYXA 5HFYA 4NAMA 4MSMB 4PS8A 2INNE 2OEDA 2E6XA 2KDBA 3E9SA 2LYJA 3DWGC 1FXIA 2D07B 1P7EA 4NY0A 3VVWB 1BXTA 3NHEB 4PS3A 3UIOB 3FAHA 2K8BA 1V1PA 2ZCCA 2KTRA 4K3BA 1KLGD 2LGIA 2HTME 3RZFA 3ZW3A 4PU3C 4KGTA 1GAQB 3LJ3A 3JXBC 2MCNB 1OEYA 2WXLA 2INDC 1ZPQA 3HHMA 2C5LC 2A5UA 3L54A 1D5ZC 4AQ7A 4LNOA 3ZO5B 1EWYC 3ZQ4A 1X1MA 3PT2B 4CQNA 1E8ZA 1N62A 2IVQA 4IVZA 3AEAB 3BIID 3OWEB 1LCDA 1WMHA 2GBKA 2PPHA 4RF0A 1NENB 4HEA1 1P1AA 1XEEA 3TBLD 2D2QA 3SDLC 4A90A 1QT9A 5CX3A 5AZHA 4KDIC 1B1ZA 1WJNA 1QQBA 1GJZA 4RGNA 3W9CB 2KMCA 4O1NA 2EMTA 2AQ2B 2JSVX 5FR3A 5GAHi 3AE2B 2PEAA 2W9NA 2KK8A 3CF6E 1SSNA 1QILA 4W9FA 1NW3A 2I2YA 3EUSA 4X4BA 4C7YA 4OZCA 2FUHB 1TKEA 1WGGA 3N9YC 2ASQA 4FN2A 3TCAA 2MH7A 1NEKB 1QZEA 1C4PA 3TMPB 2FNJB 4WJQA 4P1CC 4NJCA 1H8CA 4DE9A 2PUFA 3A1QB 2WNMA 2C60A 4HJKA 4AJYB 2LGYA 3OP9A 2WHIA 2IDYA 2LYRA 1YQBA 1CJEA 2QMTA 4XC2A 2L1AA 5J18A 1GPXA 2XIUA 1JRUA 3NZUA 2XJ3A 1NEQA 1KLVA 2C7MB 3APFA 2FIFA 2V3PA 4PK1A 3KYDD 4BZAA 2MP2B 2WXOA 3L1PA 3VRAB 1CJGA 2VEOA 5J17A 1BT0A 4WWPA 3EHVA 2J0MA 3IXSA 2CJOA 2G4SA 2PUGA 2KMMA 3BDNA 1Y7YA 1EF1A 1F9JA 3TEWA 3RZZA 3S8QA 1PGXA 4JL9A 2DWQA 2JQEA 2KT7A 1ZZBA 3A9ZA 1VZ7A 4JIOU 3QHTA 4HCPB 2LLVA 4X4EA 1TY2A 2WIUB 1IGCA 2Q5WD 1E8WA 4RGMA 3ZPXA 2PUCA 3DWMA 1JRPA 3WAOA 2BYVE 1WYGA 4A6QA 4KKJA 4R3DA 3IAS1 3RNBC 1Z2MA 1HE8A 5DSXA 2ZZPB 2D5GA 2D3BA 4ZOHC 4EEWA 1V9JA 4XWTA 2VH2A 3NRZA 2LXAA 1R4MI 2IUOA 3MHZA 1WIAA 1YQ3B 2GMIC 3B2FA 1ZZ6A 4ARIA 3H5TA 3N30A 3NVVA 2PXKA 1PERL 3Q8FA 1UD7A 2L05A 3W5UB 2M17A 3HRDD 2IBIB 2KQ4X 4YBAA 1WM2A 4WQMA 1J19A 3PTFC 4PYUA 2LASA 2KDIA 2KANA 2L0FA 4FJYA 3BY4B 4RNAA 2A4ZA 2DHZA 3WAMA 1HEZE 3DBRI 2X8XX 4W9GA 2B5AA 4X4HA 2HDEA 1F0ZA 2K1FA 5BYQA 1HTQA 4MELA 3DBLI 3JVZX 1XLOA 1E6EB 2JXTA 2GZUA 5GMVA 2AL6A 4BFRA 3GP7A 4IWRA 2EKIA 2YLMA 2ZVOA 3QC8B 2GBMA 1GC7A 4OB4A 4CYEA 3AEBB 3R09A 1WGYA 1JFTA 1PNRA 4M01A 2PPXA 3VTWA 3ZTDA 4RGOS 4HVBA 4GDKA 3A33B 3NOBA 4P1BC 2AX5A 1SE3A 1L6VA 2IY1B 4IUMB 3P4QB 1AU7A 2QIEB 5HHDG 1WIZA 2KVZA 2WX1A 3Q3OC 1T0YA 1XF5L 1Y56A 2LZ6A 1ZDXA 3Q8BA 1WZ0A 1RAXA 2Y5PA 1ZUD2 1MG8A 2LJIA 2BF8B 3W1YA 4ZYSA 1WH6A 4ANWA 2LYKA 3ZNHB 3QJZA 4I6TA 4ER0A 2JYEA 3CIRB 3JYUA 4WQOB 3Q8CA 2KYWA 1HQ1A 2K25A 1POUA 2J4XA 2X38A 4FN3A 4E71A 4MGIE 1K51A 3QIJA 4J6IA 1QOBA 2KN4A 1XCTL 4W9JA 3GB1A 4LTUA 2IVBA 1TIFA 4HPLB 3B0AA 5LXIB 4YXDB 2MP2A 1SB3C 3SFDB 3I3TB 2AL3A 2CROA 2DYBA 1C3TA 4WAAA 3F52A 4NDWA 5GXGB 1KRHA 4D2KA 3PZ7A 3SCGA 2IY0B 1E7PB 4GOCA 2FCSA 2A6CA 4WVLA 1QP4A 5DRTA 2K6DB 2DENB 3ML8A 4M00A 2ON8A 5BO4B 4KIKA 2BS2B 2KAJA 2PXQA 4XYCA 3VR8B 1SGHA 1WJ4A 2D11A 4BBNC 3AMZA 2JPHA 1QF6A 3CLCA 2KEKA 1WE7A 2WDVB 1P98A 1I4QA 3EA6A 3PRMB 1IUEA 3A9JB 1JALA 2R2OA 1YN4A 2WXGA 3W1SA 3SD5A 1J7AA 2JX5A 5D3IB 1WETA 4B0MA 5AUKA 2MBEA 3PS6A 2KWDA 2HCNA 2K22A 2KDEB 3GUUA 1WX7A 2N4FA 2JUOA 2WU5B 1FXTB 2KC2A 2I38A 1WM3A 4KIKB 2MJEA 3QAQA 2BKFA 2PXVA 4A55A 1WMHB 1QZXA 1WXAA 2INPE 4OZBA 2CU3A 3AU4A 1FXAA 3MLFA 3QF3A 1F77A 1NYQA 1RWSA 4A20A 2PE9A 4HPMB 2Z8LA 3CWIA 4W9KA 1BUIC 4ZRJA 2JZPA 4TKNA 3DQVA 2MQKA 2CSFA 4K7WA 1SJED 1IPGA 3P63A 1CZPA 5D94A 2XXAA 4IM3A 2H8RA 3UIPB 2PVOD 4TQ1A 3G5GA 3DHHC 1ZS4A 3LDZE 1GT0C 4MDKE 2GLSA 5FKAC 4FADA 4AUQC 1YMHE 2C7HA 3ZNZB 2K5PA 1QPZA 2MA9B 1AYFA 3TFLA 3MC9A 1UELA 3KQ4A 1F52A 4BKTA 2QSDA 4MH0E 2PXDA 1T0QC 3PE5A 3ZKCA 1V49A 2KACA 2R63A 1CQVA 2CKHB 1V1OA 2KWVB 1SJHD 1WZ3A 2ZEQA 4IWOA 4HRAA 2ZNVB 1N5XA 3AULA 3P42A 4KZ0A 2J53A 1S3SG 4MJSA 4N58A 2D3CA 4HCNB 5C1ZA 4ARCA 2VZKD 3M9LA 2LLWA 4JQDA 4LCDE 2IZVB 1PRAA 2RD0A 1TGZB 2K8HA 2PXTA 2LGSA 3KUZA 2VH1A 1FNUA 4MGZE 5EE0A 2OJRA 2DZJA 3K9PB 2SEBD 2GB1A 2L3ZA 1NBFC 1FD6A 1AN8A 2M8SA
chains in the Genus database with same CATH topology
2WP9B 3J9CA 2LNMA 4N59A 1D5ZC 4AQ7A 2QJLA 3AE7B 1NYRA 1RM6C 1EWYC 3ZQ4A 2BTEA 1MVKA 1ZPSA 4CQNA 2BB6A 1N62A 5DTRA 1L4ZB 3UI3A 3AEAB 3BZDB 3BIID 1ACCA 3OWEB 3L4PA 4RCOA 4NAWB 1JWUD 4RF0A 1NENB 4HEA1 4REZA 3TEPA 2OHFA 3ZJTA 3BWUD 1XEEA 1DOIA 4DE8A 2M4HA 4MH8A 4HKQA 2DBYA 4UDUC 1FM0D 1L6UA 1QT9A 4A90A 2IGDA 4YSZB 5EE1A 3SR6A 1B1ZA 1ENFA 1FRRA 1E10A 2WU2B 3SFEB 4RGNA 4ER6A 3W9CB 3P4PB 2CJNA 3AH7A 2W82A 4O1NA 2AQ2B 2JSVX 4EZIA 3AE3B 4WAFA 5FR3A 3AE2B 2J42A 2YBDA 4WURA 1PGBA 1SSNA 5BMHA 3V3XA 1QILA 1NW3A 2N9LA 2I2YA 4IDIA 1NI3A 4C7YA 2L52A 3BK1A 2KDMA 2ONQA 4OZCA 1TKEA 1F2RI 3FC4A 1E0ZA 4OVZA 1JWSD 3N9YC 1IGDA 1YN5A 3KLSX 2MH7A 1NEKB 1K52A 1C4PA 1XXGA 3ABVB 4TSSA 1DOYA 1UWMA 3QOXA 3NUHB 2GI9A 4NJCA 3ZGZA 4DE9A 1PFDA 2WNMA 3VQIA 5AUIA 4YWGG 5D3DA 3MJ5A 1FRDA 1V1PB 2IDYA 1AW7A 1PGAA 1FFUA 2Y3AA 1C77A 1CJEA 2QMTA 2WXJA 4HKZE 2L1AA 4KGRA 1GPXA 2E3TA 1L4DB 4ZRPA 4L2YA 4HJGE 4YSXB 2V3PA 2V4IB 5G5GA 3P4SB 2PLPA 1C78A 3TUOA 2WXOA 2BBCA 3VRAB 2PKOA 1VDVA 2VEOA 3G0TA 1J7CA 4RH6A 2WXQA 2DYOA 2WS3B 3AM9A 4JWSC 4XDCA 1KF6B 3IXSA 2CJOA 4ITKA 3TEZA 3HUIA 2XN9C 2G9HD 2KMMA 2J7UA 5BYRA 3NZ3A 3B9JA 3TEWA 1PGXA 3OWQA 1WXQA 4EK9A 1FIQA 2DWQA 4ER5A 3VWSA 3A9ZA 1JCKB 1VZ7A 2H88B 2LHDA 2N0SB 3NS1A 1TKGA 2LLVA 1TY2A 2HCSA 1IGCA 2Q5WD 2BYTA 3NVZA 4RGMA 3ZPXA 1XLNA 3NVYA 4LK0M 1R7SA 2QEJC 3DWMA 5EE3A 1B9RA 1JRPA 1KH0A 5C3JB 1TS4A 3LB8C 1WYGA 4A6QA 2K3UA 1STEA 3AE8B 4RFBA 4KKJA 4R3DA 1DOXA 2N7JA 2XNAC 3IAS1 2PMVA 1L0YB 3U2SC 4HRSA 3Q69A 2DLBA 2NMQA 2WXHA 1HQRD 2IGGA 4YTNB 1QQRA 1ET9A 2N9KA 5DSXA 2BT6A 1KLUD 2W3SA 2D5GA 4ZOHC 3ZJUA 5C2TB 1ZE3D 4XWTA 3NRZA 3MHZA 1QOAA 3PZ8A 1YQ3B 3NROA 3B2FA 4US9A 4ARIA 1I4GA 3NVVA 1JW9D 1HZ5A 3H8HA 1YQ4B 3Q8FA 2BB5A 2IJ0A 3AEGB 1HXYD 3W5UB 1QOGA 3HRDD 4KGSA 5EE9A 2KQ4X 4WQMA 4OZAA 4NZLB 2WXPA 4B0EA 4Q2JA 1VRAB 4MACA 3NZLA 3B2GA 4ZHPA 1PDXA 4GDLB 4RNAA 3A9XA 1HEZE 1SEBD 4LLGM 3MC0B 1JMLA 2FE8A 4P6VF 4EE2A 1TS5A 1UWXA 1QLBB 3BYTB 3KWVA 1OQQA 1FEHA 1RYJA 4JX1C 1I4PA 2HDEA 4L1BA 2AQ3B 3V05A 1F0ZA 2BS3B 5BYQA 4ZHOA 1SE4A 4WIPA 3U7ZA 3VR9B 3MP9A 4J3OD 5H8YE 1Q10A 4DXGA 3W2DA 2W54A 1XLOA 3TEXA 5LNK1 1ZXIA 2WXFA 1E6EB 2JXTA 1D5MC 2MEKA 3GP7A 2EKIA 5FK9C 1E9MA 3ME5A 2BS4B 1JQ4A 2PIAA 1BMLC 3U52E 2ZW1A 4OBMA 4US8A 2G1EA 4XDDA 3SX0A 5BYSA 3AEBB 3R09A 2FUG1 3AECB 4C56C 1EU3A 1P7FA 1ZOYB 4RGOS 2QILA 4OHJA 4YT0B 3AB5A 1TY0A 3OKZA 1FO4A 5TSSA 2AX5A 1I4RA 1WSPA 1VR9A 1SE3A 1L6VA 4PT5A 4KX6B 3P4QB 5BMIA 3AEDB 2J52A 2QIEB 4TMAB 5HHDG 3MEJA 1D5XC 3T3OA 3R2IA 2WDRB 1XF5L 2JU6X 1Y56A 1TYGB 1ZDXA 2B76B 2LEKA 4ZRQA 3NXHA 3Q8BA 2LMCA 3GZDA 2Y5PA 1ZUD2 1T3QA 3RFZB 2LJIA 2W3RA 3BVZA 3IT4B 4ZYSA 1PYWD 1SE2A 2NTSA 1YJIA 2PTLA 3AE4B 3AV8A 1TS3A 2RDHA 1ESFA 2LFIA 5JXVA 3UWPA 1A70A 3TEYA 1DGJA 1XO3A 4ER0A 4FXCA 2L1PA 2JYEA 2TSSA 3CIRB 4YTPB 1L0VB 1IBXB 3Q8CA 1XLPA 2DYMA 1OFFA 3ETRA 2J4XA 2X38A 3SEBA 3IAM1 5JUWA 2YEPF 3T3NA 1K51A 2RMMA 3O13A 5DTQA 2JWUA 3P1MA 1QOBA 2KN4A 1XCTL 1KTKA 4HROA 1XLQA 2WXKA 1ZDVA 5HI1A 1FCLA 1C9FA 3RPFC 3QOWA 1JWBD 1EWCA 4ER3A 4A8XC 3GB1A 4M0WA 1XCQL 4LTUA 4EKIA 5G5HA 1KFYB 2VZKB 4EKGA 2WDQB 3GS2A 3BK2A 4YXDB 1LO5D 1SB3C 4WWMA 3SFDB 4GLSC 3A9YA 1JWAD 1TJEA 1VZ8A 3FILA 4IOIE 3BYYB 5DT2A 1TKYA 2V0GA 1D6EC 1ZXHA 1GB4A 1D4BA 3W5VB 4USAA 3Q8AA 2K9XA 1N5WA 5GXGB 1TZOA 1KRHA 4D2KA 3PZ7A 1C4AA 1AWDA 1GOZA 1E7PB 1EU4A 3E56A 3BVGA 2V3NA 4WVLA 5DRTA 1RFKA 2J7WA 1F2RC 2SAKA 3KWLA 1C76A 3EGRA 2ON8A 4DXFA 1C79A 2BS2B 4TQ0A 2KAJA 2L83A 5DRYA 4H2AA 2WXIA 1HZ6A 1MI0A 4WH4A 4RF1A 2ACZB 1QOFA 2WXNA 3VR8B 1I4XA 3ZYYX 4N6EB 3WCQA 2NTTA 2ICIA 3AMZA 4JE3B 1QF6A 3QFIA 1VZ6A 3MFGA 3PO0A 2WDVB 3C8YA 1I4QA 2L32A 3P4RB 3TSSA 3EA6A 2M19A 3EUB2 1IUEA 1JALA 1YN4A 2WXGA 2MJDA 3AE5B 1U2ZA 1ROEA 1UUPA 3W1SA 3I9V1 2JQRB 1J7AA 2JX5A 5D3IB 4ER7A 3HVZA 4B0MA 4A9AA 1JWMD 1UGJA 4XWWA 5AUKA 3I57A 2KWDA 2BW2A 2HCNA 2ZW0A 1WWTA 3GUUA 1FCCC 1EM7A 1N60A 1SIJA 2K22A 3NVWA 4JWUC 2WU5B 2ODRD 3Q8EA 1CK1A 2I38A 4KKIA 2AQ1B 4C7ZA 5T8IA 2MJEA 2WXMA 3TELA 2W55A 4OW0A 1I4HA 2XXQA 2GRIA 4YTMB 4A55A 1FMAD 1HA5A 2PVGC 1SBBB 1UNSA 2INPE 4OZBA 2WXRA 1M4VA 3AN1A 2CU3A 4DQOC 1FXAA 3AEEB 1K50A 2YEPB 1F77A 1NYQA 1RWSA 1YN3A 1L5PA 1MHHE 2Z8LA 1VJKA 3CWIA 1BUIC 2JZPA 2JYTA 1N63A 3FILB 4AS1A 1ZP0B 1V97A 1PUTA 4P16A 1SJED 3LYYA 3P63A 1WGKA 1CZPA 1SXTA 2H89B 2LHEA 2PVOD 3GZDC 4TQ1A 2WQYB 4GDKB 3ZJVA 1DYQA 2PW9A 3U4EG 3BVMA 1GB1A 2MJ3A 1ET6A 5FKAC 1T5XD 5BMGA 4MM3B 1YMHE 1SF0A 3AE9B 4RGTA 2K5PA 2R61A 2RPVA 2K0PA 2IGHA 1NVID 1FNWA 1AYFA 2Y5CA 3R2TA 3TFLA 1V8CA 2MXDA 1VLBA 4L23A 3KQ4A 1MHXA 1N61A 4C80A 3LXFA 2M56B 2WLBA 4EQZA 3AE6B 4YSYB 1K53A 2M0AA 2QSDA 5I4DA 3PE5A 1TS2A 2KACA 5MPOA 1CQVA 4MT5A 1FFVA 4IKGA 2HFZA 3R8BA 3HVDA 3AEFB 1V1OA 1SJHD 3VRBB 2IPKD 1JROA 4HRAA 1QKZA 2RDGA 5H92C 3SR4A 3P42A 1N5XA 1FNVA 1MPEA 4NAMA 5HFYA 2J53A 4N58A 2INNE 1OQRA 5DTMA 2OEDA 4ARCA 2E6XA 2VZKD 3M9LA 2LLWA 3E9SA 3DWGC 1FXIA 3URYA 1L0XB 3GZCA 5D7GA 1P7EA 1BXTA 2LUMA 1J7BA 2FBWB 3IT6B 3FAHA 1IBXA 1YNTE 2EELA 2XXPA 1V1PA 1FNUA 1KLGD 2LGIA 3AE1B 4JPSA 2HTME 5E6JA 5EE0A 2SEBD 2GB1A 4KGTA 1GAQB 4XE0A 1I7HA 1WRIA 1FD6A 1YJJA 1T6BX 2WXLA 1AN8A 1C4CA 5HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZL A;  4Q2J A;  3TUO A;  2L1P A; 
#chains in the Genus database with same CATH topology
 3J9C A;  1HF0 A;  3TL5 A;  1DUL A;  1RM6 C;  3IG3 A;  1RRB A;  2IO3 B;  1ZPS A;  2XI8 A;  2M0X A;  4YAR A;  3BZD B;  3L4P A;  3RCZ A;  1WXV A;  4N9F 4;  1JWU D;  3VTV A;  3JXD L;  2C7N B;  1WX8 A;  3UQA A;  4REZ A;  4LNN A;  2IO0 B;  3TEP A;  3DVG Y;  4DE8 A;  5IN7 A;  2AEH A;  2M4H A;  1V5T A;  4LJO B;  2DBY A;  4UDU C;  5EDS A;  3LQX A;  1L6U A;  3R1F A;  3UIN B;  4YSZ B;  5EE1 A;  2JXX A;  2KMA A;  4PYZ A;  4TV3 A;  1XT9 B;  3Q2A C;  4EZJ A;  2CJN A;  3AH7 A;  3BIN A;  2OOB B;  4EKU A;  1I42 A;  5E6O A;  1WE6 A;  1EFA A;  1PGB A;  2N9L A;  4IDI A;  2L52 A;  2ONQ A;  2ICT A;  1E0Z A;  4OVZ A;  4Z59 A;  3DBH I;  4NQL B;  1IGD A;  3KLS X;  4YG4 A;  2MWS B;  1XXG A;  1GUA B;  4TSS A;  2Z0D B;  3NUH B;  2GRM A;  3I5J C;  3ZIM A;  3VQI A;  4YWG G;  4GGQ A;  5D3D A;  1V1P B;  1FFU A;  3HM3 A;  3WAP A;  2WXJ A;  4KGR A;  3IVP A;  3IFW B;  4HJG E;  4YSX B;  1DW9 A;  3RN9 C;  3ZNI D;  4KZC A;  2PUB A;  1TTN A;  3G0T A;  4NNJ B;  1SQ8 A;  2R2Q A;  2DYO A;  1UZX B;  4ANV A;  2WYQ A;  4ITK A;  3TEZ A;  1E7V A;  1ZVV A;  2G45 B;  2KLG A;  4Z5D A;  2J7U A;  5GAG i;  1SE9 A;  5BYR A;  3NZ3 A;  2EWT A;  3OJ4 B;  3OWQ A;  5LLI A;  3OQM A;  2CU1 A;  2O2V A;  1RZR D;  3VH4 B;  1M94 A;  3NS1 A;  2HCS A;  3A1Q A;  2BNN A;  2BYT A;  2GBJ A;  2D3A A;  1UGM A;  2MRP A;  1XLN A;  4QAY A;  2RSU A;  5C3J B;  2K3U A;  1STE A;  3AE8 B;  5LXH A;  2N7J A;  3ZXV A;  3U2S C;  1VPW A;  2DLB A;  2IV1 A;  2NMQ A;  3CST A;  2WWZ A;  4G50 A;  4K3C A;  1HQR D;  3I63 C;  2JRH A;  4A3P A;  3ZJU A;  3PZD A;  5C2T B;  4KVG B;  5A7L A;  2FCQ A;  4US9 A;  4HWI B;  2I1J A;  1HZ5 A;  1EO6 A;  1L7Y A;  2KNB A;  2UYZ B;  2PUE A;  3AEG B;  1HXY D;  2KEI A;  4AP4 C;  1QOG A;  3B1L X;  3SHQ A;  4NZL B;  2JF5 A;  4Q2J A;  2KFK B;  2LGX A;  1VRA B;  2MBB B;  3NZL A;  3HK0 A;  1ZZ8 A;  4MAC A;  4W9H A;  4ZHP A;  2ZCB A;  3L10 B;  5AZG A;  2NPT B;  3P2B A;  3OQN A;  4EE2 A;  3KW5 B;  2CS4 A;  1JFS A;  1UWX A;  3IHP C;  3N1Y C;  4GXB A;  3BYT B;  1OQQ A;  3GOE A;  2BS3 B;  2JT4 B;  5H8Y E;  1Q10 A;  2W54 A;  1OSL A;  4J1W A;  3WAL A;  2MEK A;  5IO9 A;  1E9M A;  4GDL A;  1O4X A;  3U52 E;  1GC6 A;  3MHS D;  2FUG 1;  3AEC B;  4DHZ E;  1P7F A;  5CHV C;  4DHZ B;  4OHJ A;  3AB5 A;  1TY0 A;  1VR9 A;  3OQO A;  4MCT A;  4PT5 A;  2NR2 A;  5BMI A;  3MEJ A;  1D5X C;  2JVL A;  1PRV A;  5E6P A;  3N1Z C;  4Z5C A;  1JWL A;  1TYG B;  1R4N B;  4B9K A;  3CSF A;  3GZD A;  2EF8 A;  1RIO A;  3APC A;  3RFZ B;  2PXP A;  1SE2 A;  2XEW A;  1YJI A;  2PTL A;  2B3A A;  3L16 A;  2RDH A;  1GG3 A;  3WIM A;  2GRL A;  2OFY A;  1DGJ A;  1XO3 A;  2K39 A;  4ZRI A;  1IBX B;  1XLP A;  2DYM A;  5C23 A;  3ETR A;  3SEB A;  3IAM 1;  5JUW A;  3O13 A;  4I6N B;  3RT3 B;  4ZDV A;  4HRO A;  2L7R A;  1FCL A;  1JWB D;  1EWC A;  4A8X C;  1XCQ L;  3RNG C;  4EKG A;  2HJ8 A;  2QHO A;  4M0W B;  4WWM A;  4CO7 A;  4IA8 A;  3FIL A;  3ZDM C;  3BYY B;  2M1M A;  4XX5 A;  3TJP A;  1N5W A;  1TZO A;  2O6V A;  3RUL A;  2LWP A;  5TR5 A;  1GOZ A;  3GZN B;  2V3N A;  1WGH A;  1JH9 A;  2Z59 B;  2J7W A;  1F2R C;  1V6E A;  3KWL A;  1C76 A;  3IBE A;  3M95 A;  1RPE L;  1HZ6 A;  1UH6 A;  4X4C A;  4NQK E;  1GNU A;  4FLH A;  4BOS C;  3ALB A;  4RF1 A;  2ACZ B;  3ZYY X;  1ZGU B;  1OTR B;  3L0W B;  3WCQ A;  1LMB 3;  4JE3 B;  3QFI A;  3MFG A;  3PO0 A;  5IP4 D;  5IKC M;  3EUB 2;  2LD9 A;  3PRP B;  1YX5 B;  1WJ6 A;  3ML9 A;  4IC7 B;  4O8B A;  2MJD A;  5K98 B;  1U2Z A;  1ROE A;  1UUP A;  2KQS A;  3I9V 1;  2JQR B;  3QK0 A;  2BWE S;  3VK0 A;  2RR9 A;  3H7S A;  4A9A A;  1UGJ A;  1QQA A;  1QB2 A;  3U8Z A;  1A5R A;  2BW2 A;  1E3O C;  1WWT A;  1FCC C;  2IO2 B;  1N60 A;  4L1B A;  4C7Z A;  3LFP A;  3DVG X;  3DVN U;  2NS5 A;  1ZZ9 A;  1UF0 A;  1SBB B;  5FR6 A;  2WXR A;  1RLF A;  1WYW B;  3AN1 A;  2XCJ A;  2EMS A;  4G0N B;  3HIZ A;  1YN3 A;  3A4S C;  1WF9 A;  1ZZ7 A;  2JZ3 B;  2JYT A;  2WDT B;  3A9K A;  4P16 A;  4NJ7 A;  3T9L A;  3BD1 A;  4GSW A;  4W9D A;  1T0S C;  3ZJV A;  2O49 A;  2PW9 A;  3U4E G;  1GB1 A;  1DWK A;  3U3W A;  4K1R B;  1T5X D;  2KD0 A;  2XBB C;  2FID A;  4MM3 B;  4Z58 A;  2LYP A;  4RGT A;  3Q6B A;  3EFC A;  2K0P A;  2PIJ A;  1QP7 A;  2Y5C A;  3R2T A;  4L23 A;  1NI2 A;  4MGK E;  1N61 A;  1H4R A;  3DPD A;  5DPR A;  4IG7 B;  4MT5 A;  4IKG A;  1WXM A;  3AEF B;  1J8C A;  4WWO A;  2KEJ A;  2IPK D;  3SCH A;  1QKZ A;  3SR4 A;  1FNV A;  1MPE A;  1CQT A;  1OQR A;  1LQC A;  1YSE A;  1LQB A;  2CHZ A;  4IW0 A;  1XWR A;  3D32 A;  3URY A;  5D7G A;  3VTU A;  2FBW B;  2LRW A;  3IT6 B;  1HTO A;  2ZPN A;  1YNT E;  2EEL A;  2XXP A;  3AE1 B;  4GB9 A;  5E6J A;  3KUC B;  2KKC A;  4BKG A;  1V81 A;  1WRI A;  2DX5 B;  3OMT A;  5HG2 A;  2WP9 B;  2L76 A;  4N59 A;  1U4A A;  3AE7 B;  1NYR A;  3V61 A;  3PLU A;  1K8R B;  2BB6 A;  5DTR A;  4OVU A;  3UI3 A;  1WRD B;  3PHX B;  4K7U A;  5KHO A;  2INC C;  2EKE C;  2HTH A;  4RCO A;  2IYD B;  2XK5 B;  2OHF A;  3BWU D;  1DOI A;  4HDO A;  4MH8 A;  4HKQ A;  2LGD A;  2WGS A;  4F8D A;  2IGD A;  2PJH A;  3SR6 A;  2MSE D;  1FRR A;  1D3Z A;  3JSV B;  2WU2 B;  4ER6 A;  2UWQ A;  4EZI A;  3AE3 B;  1NDD A;  2HD5 B;  2YBD A;  4WUR A;  2GOW A;  5BMH A;  4NPN A;  3V3X A;  2OR1 L;  1Q1O A;  1NI3 A;  3BK1 A;  2KDM A;  3QX1 A;  1F2R I;  3FC4 A;  1NER A;  3ENE A;  1JWS D;  3L17 A;  4E74 A;  1YJ1 A;  1MFW A;  3ABV B;  3ECI A;  1DOY A;  1R4M B;  1KM7 A;  3QOX A;  1G6J A;  3GN5 B;  4EZL A;  3MJ5 A;  1FRD A;  1CMX B;  2J0K A;  2KJR A;  1AW7 A;  3QQ8 B;  3DDC B;  3H7P A;  3VUX A;  2FCN A;  1WGR A;  2AYO B;  4A3O A;  3QWZ B;  1MJD A;  2E3T A;  4X4D A;  4ZRP A;  4W9L A;  2V4I B;  3P4S B;  4C4V A;  2PLP A;  2L0T A;  3V62 A;  1R63 A;  2BBC A;  2Y5B B;  2LCV A;  1VDV A;  2QC8 A;  3WA0 A;  1J7C A;  2RDB C;  2LUE A;  4P7I A;  2WXQ A;  3AM9 A;  4JWS C;  3L08 A;  1E90 A;  4XDC A;  2MBQ A;  3ZRF A;  3ZRC A;  2IU7 A;  3GZN I;  3B9J A;  2KXJ A;  4EK9 A;  1FIQ A;  4GIV A;  2LYQ A;  2N7D A;  4JGH B;  3DNV B;  2DNF A;  2LHD A;  3MJW A;  2N0S B;  1LCC A;  2AWI A;  3NVZ A;  3NVY A;  3VUW A;  4DWF A;  4LNK A;  4LK0 M;  1R7S A;  2QEJ C;  4YL8 A;  1I35 A;  1B9R A;  1KH0 A;  2KO3 A;  3H9D A;  1B0N A;  1DOX A;  2AXZ A;  3NG0 A;  2PMV A;  1L0Y B;  3Q69 A;  4YTN B;  4PU4 C;  2BT6 A;  2W3S A;  4ANX A;  3QA8 A;  1YOV B;  1ZE3 D;  2HIN A;  3QCA A;  1QOA A;  3NRO A;  4Y42 A;  3NJT A;  1JW9 D;  4MM3 A;  4X4I A;  1YQ4 B;  3H7P B;  3VXW A;  2NBW B;  3Q3F A;  2BB5 A;  2QCZ A;  3ZHM A;  2CR5 A;  5EE9 A;  3ZLZ A;  4M8N A;  2AXU A;  2WXP A;  4B0E A;  4DBG A;  4BVU C;  1PDX A;  4FBJ B;  3A9X A;  3EEC A;  4MGY E;  4NAW A;  3C19 A;  1JML A;  2FE8 A;  1TS5 A;  2I1K A;  4HDQ A;  1OCT C;  1RYJ A;  1FEH A;  4JX1 C;  1I4P A;  3NZS A;  3VHT C;  5J2R A;  4ZHO A;  2L8J A;  4WIP A;  1QP0 A;  1LGR A;  2CHX A;  2LRU A;  3U7Z A;  4J3O D;  4DXG A;  3GE8 C;  3W2D A;  1ZXI A;  2WUS R;  2L49 A;  1WI0 A;  1BDI A;  2MQJ A;  1E7U A;  5FK9 C;  2KC1 A;  2KTF A;  5AZF A;  2BS4 B;  1JQ4 A;  2PIA A;  5HKH A;  2KN5 A;  4OBM A;  2G1E A;  4XDD A;  1TT5 B;  2FJR A;  3MC8 A;  2DAF A;  3BS3 A;  5BYS A;  3LIS A;  1UTX A;  4C56 C;  1EU3 A;  1P9D U;  2NVU I;  4YT0 B;  3FMY A;  5D6J B;  5TSS A;  1I4R A;  1WSP A;  2XK5 A;  3UQB A;  1FPY A;  3VDZ A;  4TMA B;  3FYA A;  2LVQ A;  2V3C C;  3R2I A;  2WDR B;  3VH3 B;  4K81 A;  4M8M A;  2B76 B;  2LEK A;  4ZRQ A;  5IA7 A;  3F6W A;  2PXE A;  1T3Q A;  3BVZ A;  2NPT A;  2W3R A;  1L1M A;  5JH5 C;  4LJP B;  3ZVV A;  3SCF A;  1PYW D;  4XGA B;  3AV8 A;  1IP9 A;  3UF8 A;  5AEK B;  2LFI A;  5JXV A;  3UWP A;  3DBS A;  1A70 A;  3TEY A;  1UBQ A;  4IM2 A;  2L1P A;  2TSS A;  3JW0 X;  2BPS A;  2PXF A;  4DDG D;  1L0V B;  3ONS A;  2AW6 A;  4ICU A;  3T3N A;  1LM8 B;  2RMM A;  4IWP A;  2JWU A;  2L8N A;  4RMA A;  1ZDV A;  2DZK A;  5HI1 A;  3RPF C;  2KWC A;  4M0W A;  2BGF A;  4JLC A;  1KFY B;  2WDQ B;  3BK2 A;  1LO5 D;  3CMM B;  1OQY A;  4GLS C;  3VAW A;  3A9Y A;  3HM6 X;  4F8C B;  5L83 A;  2LXC A;  1VZ8 A;  3Q3J A;  4IOI E;  1LXD A;  1TKY A;  2L00 B;  1D6E C;  1ZXH A;  3PXP A;  1GB4 A;  1D4B A;  3F51 A;  2N7E A;  3W5V B;  1F1H A;  4AJW A;  3N32 A;  2K9X A;  2KLC A;  3RNE C;  2O38 A;  3E56 A;  4WJP A;  1RFK A;  1X2L A;  3X0W A;  2SAK A;  3IVF A;  5DCN A;  2MHJ A;  1C79 A;  1C1Y B;  4DHJ B;  2BWF A;  3GBF A;  2ZJD A;  4H2A A;  4GMV A;  2WXI A;  4S0R A;  1MI0 A;  2WXN A;  1Q0W B;  2LYS A;  1I4X A;  1S7E A;  1N6Z A;  2FAZ A;  2IO1 B;  2NTT A;  3U7D A;  3G7D A;  1VZ6 A;  3A9K B;  5CHF A;  3RYT A;  3ZTC A;  4HLE A;  3KUD B;  4B6W A;  3PSE B;  2LYL A;  2PXB A;  3B08 A;  3JSV A;  2N9P C;  3OLM D;  3HVZ A;  1JWM D;  4HPP A;  4XWW A;  4ANU A;  1SIJ A;  4JWU C;  5DPT A;  2ODR D;  3Q8E A;  5G2N A;  2KZ8 A;  2KWU B;  3TEL A;  2W55 A;  4OW0 A;  4XZ4 A;  1I4H A;  3FYM A;  2ICP A;  2XXQ A;  4B95 A;  2KX3 A;  1FMA D;  2PVG C;  1UNS A;  1KOT A;  4FUL A;  3CEC A;  1K50 A;  2YEP B;  5KHQ A;  2HJ1 A;  3UFD A;  4K7S A;  3AU5 A;  2M4N A;  4X57 B;  2CHW A;  4GU2 A;  4AS1 A;  2N1W A;  1V97 A;  1PUT A;  2BVC A;  1WGK A;  1SXT A;  4FBI A;  3KZ3 A;  2H89 B;  2N9X A;  3V6E B;  3ZNG C;  2WQY B;  2XSD C;  4GDK B;  1PRU A;  1DYQ A;  3V60 A;  3BVM A;  1Y8R C;  1UXD A;  2MJ3 A;  1V5O A;  3NY5 A;  3R7R A;  5DPW A;  2J0J A;  3RUI B;  4KDL B;  4LDT D;  4NJ6 A;  3D1N I;  2KVR A;  1SF0 A;  3AE9 B;  3K9O B;  1T0R C;  2BYF A;  2PXU A;  2BNO A;  3Q14 C;  1NVI D;  1FNW A;  2WX0 A;  1V8C A;  1VLB A;  4DK5 A;  1MG4 A;  2BQQ A;  3WAN A;  2WLB A;  3N20 C;  1K53 A;  4I6R A;  2M0A A;  1J0G A;  5I4D A;  3TIX A;  3DHG C;  5MPO A;  3R8B A;  2HFZ A;  1JRO A;  4URK A;  2Z0E B;  2JY6 A;  5H92 C;  1WFY A;  1ZKH A;  3DCG A;  3U30 A;  4FHJ A;  3DM5 A;  2C9W B;  4I6L B;  5DTM A;  2N1V A;  4C4V B;  1L0X B;  3GZC A;  1ZUG A;  2LUM A;  1ISN A;  1J7B A;  1ADR A;  1IBX A;  4TUU A;  4II3 B;  4FA6 A;  3NS8 A;  3GN5 A;  4JPS A;  1XD3 B;  4MCX A;  3DBL B;  4BKS D;  3N3K B;  4XE0 A;  1I7H A;  2JZZ A;  1YJJ A;  1T6B X;  1C4C A;  4TQ0 A;  4MEM A;  2LNM A;  3PRZ A;  2KJH B;  2QJL A;  2BTE A;  1IC8 A;  1EUV B;  4F7Z A;  1MVK A;  1V86 A;  4YG1 A;  3S2A A;  2RGF A;  1L4Z B;  3NDB B;  2OJW A;  4ZRK A;  1ACC A;  4GN1 A;  4NAW B;  4FJV B;  2BKR B;  4JCX A;  2KHW B;  2JCG A;  3ZJT A;  2KOX A;  3R7Q A;  4DXA B;  1ZAY A;  3ZUN A;  1FM0 D;  1WX9 A;  1AAR A;  1ENF A;  1E10 A;  1UXC A;  1XQQ A;  3SFE B;  3X23 A;  3O9X A;  1WGD A;  3P4P B;  2W82 A;  5G55 A;  3KL4 A;  4WAF A;  1TZ1 A;  2J42 A;  3HZI B;  4WWN A;  3O65 B;  1OGW A;  3PHW B;  2V3S A;  4ICV A;  1YN5 A;  3KVF B;  4PU8 A;  4J1X A;  1K52 A;  3M3J A;  4S17 A;  2D5V A;  2KFJ A;  5IOI A;  1UWM A;  2GI9 A;  3ZGZ A;  1PFD A;  3KH0 A;  5AUI A;  1SIF A;  1PGA A;  2Y3A A;  1C77 A;  1WR1 A;  4HKZ E;  2HE7 A;  3RZW C;  2V1Y A;  1RZR A;  1L4D B;  4HK2 A;  4RM8 A;  4L2Y A;  3AXC A;  1IYF A;  5G5G A;  3W1S C;  1C78 A;  3TUO A;  2MEZ A;  4OVV A;  1KJT A;  2JVC A;  2PKO A;  2EBY A;  4IM0 A;  3H1U A;  4RH6 A;  4BAX A;  3PV1 A;  2WS3 B;  4GHJ A;  3RNA C;  1KF6 B;  3H6N A;  3HUI A;  2XN9 C;  2G9H D;  4G11 A;  3UGB B;  3R66 C;  3EC8 A;  4BBN F;  4KV2 A;  3V6C B;  1WXQ A;  4ER5 A;  3VWS A;  2O2V B;  3B7H A;  1JCK B;  2PUA A;  2D3G A;  2H88 B;  3QWG A;  2GBN A;  4W9E A;  1TKG A;  3N1X C;  3ZHI A;  4LNI A;  4W9C A;  2D10 A;  4DDI D;  2BNM A;  4JQW C;  2GBR A;  5EE3 A;  2ZPY A;  1TS4 A;  3LB8 C;  4ASW C;  4RFB A;  2DZI A;  2NCN A;  2XNA C;  3PGE A;  1WH3 A;  5L95 C;  4HRS A;  2WXH A;  2IGG A;  4ZYN A;  1QQR A;  1ET9 A;  2N9K A;  2MX2 A;  1KLU D;  1R4N I;  2KTR B;  2MLB A;  1P3Q U;  3PZ8 A;  3PRE A;  5E6N A;  2LI5 A;  2AXV A;  4Z5H A;  1I4G A;  3H8H A;  4AOF A;  2IJ0 A;  1WJU A;  2K6Q A;  2V9H A;  4KGS A;  1TBE A;  3DHI C;  4X4F A;  4OZA A;  2BJC A;  2KJ6 A;  4II2 B;  3B2G A;  4GDL B;  5CTR C;  1WY8 A;  1RZS A;  4HXD A;  1SEB D;  4LLG M;  3MC0 B;  2VRR B;  4P6V F;  5JZE B;  4BKS A;  4LDT B;  1EF5 A;  4I8T A;  1QLB B;  3KWV A;  2NBU A;  2AQ3 B;  2G4D B;  3V05 A;  1SE4 A;  4DHJ D;  2ZVN A;  3VR9 B;  3MP9 A;  4FHK A;  3TEX A;  4EUT A;  5LNK 1;  2WXF A;  1BDH A;  2ZNV C;  1D5M C;  4FJZ A;  3DOW A;  3ME5 A;  4EFO A;  1BML C;  4KSL C;  2ZW1 A;  4US8 A;  4PS7 A;  3SX0 A;  2KFK A;  3ZDT A;  2FFH A;  3ZXR A;  4PU7 A;  1ZOY B;  2QIL A;  3M62 B;  4GQM A;  3OKZ A;  3C0R B;  3KYC D;  3SU8 X;  1FO4 A;  3OG5 A;  4KX6 B;  3MTN B;  3CRO L;  3AED B;  2J52 A;  2O6V B;  3T3O A;  3APD A;  3RNF C;  2JU6 X;  2KDF B;  1ZW7 A;  3RNC C;  3Q3N C;  3NXH A;  2LMC A;  1WXS A;  1ZZC A;  4KSK C;  3IT4 B;  1E8Y A;  4JCY A;  1YD8 U;  3PLV A;  2G3Q B;  3R3M A;  1S1Q B;  2NTS A;  5IAA C;  3AE4 B;  1TS3 A;  1ESF A;  3RMK C;  4WJN A;  5D2M B;  2JWZ A;  4FXC A;  4E3C A;  3L13 A;  4YTP B;  2MBH A;  4CHK A;  2RPQ A;  1OFF A;  1P0R A;  1E5W A;  2YEP F;  3VUY A;  5DTQ A;  5DPS A;  3P1M A;  2BYE A;  1KTK A;  3OJ3 A;  1XLQ A;  2WXK A;  4X4G A;  3OAW A;  2IVG A;  1C9F A;  3QOW A;  3FKY A;  3Q3M C;  4MJS B;  2PUD A;  4ER3 A;  2DAJ A;  5G5H A;  4EKI A;  2VZK B;  3GS2 A;  2AUW A;  1YIW A;  2O6V D;  4W9I A;  1JWA D;  1TJE A;  4BOZ B;  2KX0 A;  5DT2 A;  2V0G A;  4USA A;  1LLI A;  2QDF A;  2J7Q B;  3Q8A A;  4G3X B;  2UU7 A;  4MSQ B;  1C4A A;  1AWD A;  4IWQ A;  1EU4 A;  3BVG A;  1R69 A;  2LVP A;  2KPJ A;  5JHB A;  2AWT A;  3EGR A;  4M02 A;  4DXF A;  2REX A;  2PE6 B;  2L83 A;  5DRY A;  1LFD A;  2DZM A;  4WH4 A;  4EZK A;  1WH8 A;  4EOY A;  1QOF A;  2N9E B;  1RFA A;  4N6E B;  2ICI A;  1X57 A;  3EFU A;  1VD2 A;  2NBV B;  3C8Y A;  2L32 A;  2YVC A;  3P4R B;  3TSS A;  3VFK A;  2M19 A;  3A4R A;  5CHW A;  2MBO A;  1MFQ C;  2V4L A;  3AE5 B;  4WJO A;  1L2N A;  4ER7 A;  3QAR A;  4ACF A;  2JRI B;  3AI5 A;  4I6U A;  3I57 A;  3M63 B;  4LNF A;  2ZW0 A;  1EM7 A;  3NVW A;  3PVL A;  1CK1 A;  4C00 A;  4KKI A;  2AQ1 B;  2O4A A;  1OEY J;  5T8I A;  3PPA A;  3DVN V;  2KZR A;  2WXM A;  2GRI A;  4YTM B;  1HA5 A;  3KJX A;  1M4V A;  4YG7 B;  2HSG A;  4DQO C;  3T8M A;  3AEE B;  3DBH B;  4RM9 A;  2FCM A;  1L5P A;  2K8C A;  1PQS A;  1MHH E;  1VJK A;  3A9J A;  1N63 A;  3FIL B;  1ZP0 B;  2LVO A;  3QQ6 A;  3LYY A;  3KXA A;  1Q5W B;  2LHE A;  3DBR B;  3GZD C;  2R1J L;  3TRB A;  2PE5 A;  3JXC L;  3RD2 A;  5JHA A;  1VCB A;  1ET6 A;  5BMG A;  4I6P A;  2LJ5 A;  2R61 A;  2RPV A;  1V2Y A;  2MW5 A;  1YX6 B;  2IGH A;  4AWJ A;  1V80 A;  2MXD A;  1MHX A;  4F1S A;  2KQ7 A;  4C80 A;  1UBI A;  3LXF A;  2M56 B;  3AE6 B;  4EQZ A;  4YSY B;  2PXL A;  1TS2 A;  1Y9Q A;  1FFV A;  3ZKJ C;  1WR6 E;  3HVD A;  1Z5S B;  3RI7 C;  3VRB B;  3GE3 C;  1E8X A;  2RDG A;  3QYX A;  5HFY A;  4NAM A;  4MSM B;  4PS8 A;  2INN E;  2OED A;  2E6X A;  2KDB A;  3E9S A;  2LYJ A;  3DWG C;  1FXI A;  2D07 B;  1P7E A;  4NY0 A;  3VVW B;  1BXT A;  3NHE B;  4PS3 A;  3UIO B;  3FAH A;  2K8B A;  1V1P A;  2ZCC A;  2KTR A;  4K3B A;  1KLG D;  2LGI A;  2HTM E;  3RZF A;  3ZW3 A;  4PU3 C;  4KGT A;  1GAQ B;  3LJ3 A;  3JXB C;  2MCN B;  1OEY A;  2WXL A;  2IND C;  1ZPQ A;  3HHM A;  2C5L C;  2A5U A;  3L54 A;  1D5Z C;  4AQ7 A;  4LNO A;  3ZO5 B;  1EWY C;  3ZQ4 A;  1X1M A;  3PT2 B;  4CQN A;  1E8Z A;  1N62 A;  2IVQ A;  4IVZ A;  3AEA B;  3BII D;  3OWE B;  1LCD A;  1WMH A;  2GBK A;  2PPH A;  4RF0 A;  1NEN B;  4HEA 1;  1P1A A;  1XEE A;  3TBL D;  2D2Q A;  3SDL C;  4A90 A;  1QT9 A;  5CX3 A;  5AZH A;  4KDI C;  1B1Z A;  1WJN A;  1QQB A;  1GJZ A;  4RGN A;  3W9C B;  2KMC A;  4O1N A;  2EMT A;  2AQ2 B;  2JSV X;  5FR3 A;  5GAH i;  3AE2 B;  2PEA A;  2W9N A;  2KK8 A;  3CF6 E;  1SSN A;  1QIL A;  4W9F A;  1NW3 A;  2I2Y A;  3EUS A;  4X4B A;  4C7Y A;  4OZC A;  2FUH B;  1TKE A;  1WGG A;  3N9Y C;  2ASQ A;  4FN2 A;  3TCA A;  2MH7 A;  1NEK B;  1QZE A;  1C4P A;  3TMP B;  2FNJ B;  4WJQ A;  4P1C C;  4NJC A;  1H8C A;  4DE9 A;  2PUF A;  3A1Q B;  2WNM A;  2C60 A;  4HJK A;  4AJY B;  2LGY A;  3OP9 A;  2WHI A;  2IDY A;  2LYR A;  1YQB A;  1CJE A;  2QMT A;  4XC2 A;  2L1A A;  5J18 A;  1GPX A;  2XIU A;  1JRU A;  3NZU A;  2XJ3 A;  1NEQ A;  1KLV A;  2C7M B;  3APF A;  2FIF A;  2V3P A;  4PK1 A;  3KYD D;  4BZA A;  2MP2 B;  2WXO A;  3L1P A;  3VRA B;  1CJG A;  2VEO A;  5J17 A;  1BT0 A;  4WWP A;  3EHV A;  2J0M A;  3IXS A;  2CJO A;  2G4S A;  2PUG A;  2KMM A;  3BDN A;  1Y7Y A;  1EF1 A;  1F9J A;  3TEW A;  3RZZ A;  3S8Q A;  1PGX A;  4JL9 A;  2DWQ A;  2JQE A;  2KT7 A;  1ZZB A;  3A9Z A;  1VZ7 A;  4JIO U;  3QHT A;  4HCP B;  2LLV A;  4X4E A;  1TY2 A;  2WIU B;  1IGC A;  2Q5W D;  1E8W A;  4RGM A;  3ZPX A;  2PUC A;  3DWM A;  1JRP A;  3WAO A;  2BYV E;  1WYG A;  4A6Q A;  4KKJ A;  4R3D A;  3IAS 1;  3RNB C;  1Z2M A;  1HE8 A;  5DSX A;  2ZZP B;  2D5G A;  2D3B A;  4ZOH C;  4EEW A;  1V9J A;  4XWT A;  2VH2 A;  3NRZ A;  2LXA A;  1R4M I;  2IUO A;  3MHZ A;  1WIA A;  1YQ3 B;  2GMI C;  3B2F A;  1ZZ6 A;  4ARI A;  3H5T A;  3N30 A;  3NVV A;  2PXK A;  1PER L;  3Q8F A;  1UD7 A;  2L05 A;  3W5U B;  2M17 A;  3HRD D;  2IBI B;  2KQ4 X;  4YBA A;  1WM2 A;  4WQM A;  1J19 A;  3PTF C;  4PYU A;  2LAS A;  2KDI A;  2KAN A;  2L0F A;  4FJY A;  3BY4 B;  4RNA A;  2A4Z A;  2DHZ A;  3WAM A;  1HEZ E;  3DBR I;  2X8X X;  4W9G A;  2B5A A;  4X4H A;  2HDE A;  1F0Z A;  2K1F A;  5BYQ A;  1HTQ A;  4MEL A;  3DBL I;  3JVZ X;  1XLO A;  1E6E B;  2JXT A;  2GZU A;  5GMV A;  2AL6 A;  4BFR A;  3GP7 A;  4IWR A;  2EKI A;  2YLM A;  2ZVO A;  3QC8 B;  2GBM A;  1GC7 A;  4OB4 A;  4CYE A;  3AEB B;  3R09 A;  1WGY A;  1JFT A;  1PNR A;  4M01 A;  2PPX A;  3VTW A;  3ZTD A;  4RGO S;  4HVB A;  4GDK A;  3A33 B;  3NOB A;  4P1B C;  2AX5 A;  1SE3 A;  1L6V A;  2IY1 B;  4IUM B;  3P4Q B;  1AU7 A;  2QIE B;  5HHD G;  1WIZ A;  2KVZ A;  2WX1 A;  3Q3O C;  1T0Y A;  1XF5 L;  1Y56 A;  2LZ6 A;  1ZDX A;  3Q8B A;  1WZ0 A;  1RAX A;  2Y5P A;  1ZUD 2;  1MG8 A;  2LJI A;  2BF8 B;  3W1Y A;  4ZYS A;  1WH6 A;  4ANW A;  2LYK A;  3ZNH B;  3QJZ A;  4I6T A;  4ER0 A;  2JYE A;  3CIR B;  3JYU A;  4WQO B;  3Q8C A;  2KYW A;  1HQ1 A;  2K25 A;  1POU A;  2J4X A;  2X38 A;  4FN3 A;  4E71 A;  4MGI E;  1K51 A;  3QIJ A;  4J6I A;  1QOB A;  2KN4 A;  1XCT L;  4W9J A;  3GB1 A;  4LTU A;  2IVB A;  1TIF A;  4HPL B;  3B0A A;  5LXI B;  4YXD B;  2MP2 A;  1SB3 C;  3SFD B;  3I3T B;  2AL3 A;  2CRO A;  2DYB A;  1C3T A;  4WAA A;  3F52 A;  4NDW A;  5GXG B;  1KRH A;  4D2K A;  3PZ7 A;  3SCG A;  2IY0 B;  1E7P B;  4GOC A;  2FCS A;  2A6C A;  4WVL A;  1QP4 A;  5DRT A;  2K6D B;  2DEN B;  3ML8 A;  4M00 A;  2ON8 A;  5BO4 B;  4KIK A;  2BS2 B;  2KAJ A;  2PXQ A;  4XYC A;  3VR8 B;  1SGH A;  1WJ4 A;  2D11 A;  4BBN C;  3AMZ A;  2JPH A;  1QF6 A;  3CLC A;  2KEK A;  1WE7 A;  2WDV B;  1P98 A;  1I4Q A;  3EA6 A;  3PRM B;  1IUE A;  3A9J B;  1JAL A;  2R2O A;  1YN4 A;  2WXG A;  3W1S A;  3SD5 A;  1J7A A;  2JX5 A;  5D3I B;  1WET A;  4B0M A;  5AUK A;  2MBE A;  3PS6 A;  2KWD A;  2HCN A;  2K22 A;  2KDE B;  3GUU A;  1WX7 A;  2N4F A;  2JUO A;  2WU5 B;  1FXT B;  2KC2 A;  2I38 A;  1WM3 A;  4KIK B;  2MJE A;  3QAQ A;  2BKF A;  2PXV A;  4A55 A;  1WMH B;  1QZX A;  1WXA A;  2INP E;  4OZB A;  2CU3 A;  3AU4 A;  1FXA A;  3MLF A;  3QF3 A;  1F77 A;  1NYQ A;  1RWS A;  4A20 A;  2PE9 A;  4HPM B;  2Z8L A;  3CWI A;  4W9K A;  1BUI C;  4ZRJ A;  2JZP A;  4TKN A;  3DQV A;  2MQK A;  2CSF A;  4K7W A;  1SJE D;  1IPG A;  3P63 A;  1CZP A;  5D94 A;  2XXA A;  4IM3 A;  2H8R A;  3UIP B;  2PVO D;  4TQ1 A;  3G5G A;  3DHH C;  1ZS4 A;  3LDZ E;  1GT0 C;  4MDK E;  2GLS A;  5FKA C;  4FAD A;  4AUQ C;  1YMH E;  2C7H A;  3ZNZ B;  2K5P A;  1QPZ A;  2MA9 B;  1AYF A;  3TFL A;  3MC9 A;  1UEL A;  3KQ4 A;  1F52 A;  4BKT A;  2QSD A;  4MH0 E;  2PXD A;  1T0Q C;  3PE5 A;  3ZKC A;  1V49 A;  2KAC A;  2R63 A;  1CQV A;  2CKH B;  1V1O A;  2KWV B;  1SJH D;  1WZ3 A;  2ZEQ A;  4IWO A;  4HRA A;  2ZNV B;  1N5X A;  3AUL A;  3P42 A;  4KZ0 A;  2J53 A;  1S3S G;  4MJS A;  4N58 A;  2D3C A;  4HCN B;  5C1Z A;  4ARC A;  2VZK D;  3M9L A;  2LLW A;  4JQD A;  4LCD E;  2IZV B;  1PRA A;  2RD0 A;  1TGZ B;  2K8H A;  2PXT A;  2LGS A;  3KUZ A;  2VH1 A;  1FNU A;  4MGZ E;  5EE0 A;  2OJR A;  2DZJ A;  3K9P B;  2SEB D;  2GB1 A;  2L3Z A;  1NBF C;  1FD6 A;  1AN8 A;  2M8S A; 
#chains in the Genus database with same CATH homology
 2WP9 B;  3J9C A;  2LNM A;  4N59 A;  1D5Z C;  4AQ7 A;  2QJL A;  3AE7 B;  1NYR A;  1RM6 C;  1EWY C;  3ZQ4 A;  2BTE A;  1MVK A;  1ZPS A;  4CQN A;  2BB6 A;  1N62 A;  5DTR A;  1L4Z B;  3UI3 A;  3AEA B;  3BZD B;  3BII D;  1ACC A;  3OWE B;  3L4P A;  4RCO A;  4NAW B;  1JWU D;  4RF0 A;  1NEN B;  4HEA 1;  4REZ A;  3TEP A;  2OHF A;  3ZJT A;  3BWU D;  1XEE A;  1DOI A;  4DE8 A;  2M4H A;  4MH8 A;  4HKQ A;  2DBY A;  4UDU C;  1FM0 D;  1L6U A;  1QT9 A;  4A90 A;  2IGD A;  4YSZ B;  5EE1 A;  3SR6 A;  1B1Z A;  1ENF A;  1FRR A;  1E10 A;  2WU2 B;  3SFE B;  4RGN A;  4ER6 A;  3W9C B;  3P4P B;  2CJN A;  3AH7 A;  2W82 A;  4O1N A;  2AQ2 B;  2JSV X;  4EZI A;  3AE3 B;  4WAF A;  5FR3 A;  3AE2 B;  2J42 A;  2YBD A;  4WUR A;  1PGB A;  1SSN A;  5BMH A;  3V3X A;  1QIL A;  1NW3 A;  2N9L A;  2I2Y A;  4IDI A;  1NI3 A;  4C7Y A;  2L52 A;  3BK1 A;  2KDM A;  2ONQ A;  4OZC A;  1TKE A;  1F2R I;  3FC4 A;  1E0Z A;  4OVZ A;  1JWS D;  3N9Y C;  1IGD A;  1YN5 A;  3KLS X;  2MH7 A;  1NEK B;  1K52 A;  1C4P A;  1XXG A;  3ABV B;  4TSS A;  1DOY A;  1UWM A;  3QOX A;  3NUH B;  2GI9 A;  4NJC A;  3ZGZ A;  4DE9 A;  1PFD A;  2WNM A;  3VQI A;  5AUI A;  4YWG G;  5D3D A;  3MJ5 A;  1FRD A;  1V1P B;  2IDY A;  1AW7 A;  1PGA A;  1FFU A;  2Y3A A;  1C77 A;  1CJE A;  2QMT A;  2WXJ A;  4HKZ E;  2L1A A;  4KGR A;  1GPX A;  2E3T A;  1L4D B;  4ZRP A;  4L2Y A;  4HJG E;  4YSX B;  2V3P A;  2V4I B;  5G5G A;  3P4S B;  2PLP A;  1C78 A;  3TUO A;  2WXO A;  2BBC A;  3VRA B;  2PKO A;  1VDV A;  2VEO A;  3G0T A;  1J7C A;  4RH6 A;  2WXQ A;  2DYO A;  2WS3 B;  3AM9 A;  4JWS C;  4XDC A;  1KF6 B;  3IXS A;  2CJO A;  4ITK A;  3TEZ A;  3HUI A;  2XN9 C;  2G9H D;  2KMM A;  2J7U A;  5BYR A;  3NZ3 A;  3B9J A;  3TEW A;  1PGX A;  3OWQ A;  1WXQ A;  4EK9 A;  1FIQ A;  2DWQ A;  4ER5 A;  3VWS A;  3A9Z A;  1JCK B;  1VZ7 A;  2H88 B;  2LHD A;  2N0S B;  3NS1 A;  1TKG A;  2LLV A;  1TY2 A;  2HCS A;  1IGC A;  2Q5W D;  2BYT A;  3NVZ A;  4RGM A;  3ZPX A;  1XLN A;  3NVY A;  4LK0 M;  1R7S A;  2QEJ C;  3DWM A;  5EE3 A;  1B9R A;  1JRP A;  1KH0 A;  5C3J B;  1TS4 A;  3LB8 C;  1WYG A;  4A6Q A;  2K3U A;  1STE A;  3AE8 B;  4RFB A;  4KKJ A;  4R3D A;  1DOX A;  2N7J A;  2XNA C;  3IAS 1;  2PMV A;  1L0Y B;  3U2S C;  4HRS A;  3Q69 A;  2DLB A;  2NMQ A;  2WXH A;  1HQR D;  2IGG A;  4YTN B;  1QQR A;  1ET9 A;  2N9K A;  5DSX A;  2BT6 A;  1KLU D;  2W3S A;  2D5G A;  4ZOH C;  3ZJU A;  5C2T B;  1ZE3 D;  4XWT A;  3NRZ A;  3MHZ A;  1QOA A;  3PZ8 A;  1YQ3 B;  3NRO A;  3B2F A;  4US9 A;  4ARI A;  1I4G A;  3NVV A;  1JW9 D;  1HZ5 A;  3H8H A;  1YQ4 B;  3Q8F A;  2BB5 A;  2IJ0 A;  3AEG B;  1HXY D;  3W5U B;  1QOG A;  3HRD D;  4KGS A;  5EE9 A;  2KQ4 X;  4WQM A;  4OZA A;  4NZL B;  2WXP A;  4B0E A;  4Q2J A;  1VRA B;  4MAC A;  3NZL A;  3B2G A;  4ZHP A;  1PDX A;  4GDL B;  4RNA A;  3A9X A;  1HEZ E;  1SEB D;  4LLG M;  3MC0 B;  1JML A;  2FE8 A;  4P6V F;  4EE2 A;  1TS5 A;  1UWX A;  1QLB B;  3BYT B;  3KWV A;  1OQQ A;  1FEH A;  1RYJ A;  4JX1 C;  1I4P A;  2HDE A;  4L1B A;  2AQ3 B;  3V05 A;  1F0Z A;  2BS3 B;  5BYQ A;  4ZHO A;  1SE4 A;  4WIP A;  3U7Z A;  3VR9 B;  3MP9 A;  4J3O D;  5H8Y E;  1Q10 A;  4DXG A;  3W2D A;  2W54 A;  1XLO A;  3TEX A;  5LNK 1;  1ZXI A;  2WXF A;  1E6E B;  2JXT A;  1D5M C;  2MEK A;  3GP7 A;  2EKI A;  5FK9 C;  1E9M A;  3ME5 A;  2BS4 B;  1JQ4 A;  2PIA A;  1BML C;  3U52 E;  2ZW1 A;  4OBM A;  4US8 A;  2G1E A;  4XDD A;  3SX0 A;  5BYS A;  3AEB B;  3R09 A;  2FUG 1;  3AEC B;  4C56 C;  1EU3 A;  1P7F A;  1ZOY B;  4RGO S;  2QIL A;  4OHJ A;  4YT0 B;  3AB5 A;  1TY0 A;  3OKZ A;  1FO4 A;  5TSS A;  2AX5 A;  1I4R A;  1WSP A;  1VR9 A;  1SE3 A;  1L6V A;  4PT5 A;  4KX6 B;  3P4Q B;  5BMI A;  3AED B;  2J52 A;  2QIE B;  4TMA B;  5HHD G;  3MEJ A;  1D5X C;  3T3O A;  3R2I A;  2WDR B;  1XF5 L;  2JU6 X;  1Y56 A;  1TYG B;  1ZDX A;  2B76 B;  2LEK A;  4ZRQ A;  3NXH A;  3Q8B A;  2LMC A;  3GZD A;  2Y5P A;  1ZUD 2;  1T3Q A;  3RFZ B;  2LJI A;  2W3R A;  3BVZ A;  3IT4 B;  4ZYS A;  1PYW D;  1SE2 A;  2NTS A;  1YJI A;  2PTL A;  3AE4 B;  3AV8 A;  1TS3 A;  2RDH A;  1ESF A;  2LFI A;  5JXV A;  3UWP A;  1A70 A;  3TEY A;  1DGJ A;  1XO3 A;  4ER0 A;  4FXC A;  2L1P A;  2JYE A;  2TSS A;  3CIR B;  4YTP B;  1L0V B;  1IBX B;  3Q8C A;  1XLP A;  2DYM A;  1OFF A;  3ETR A;  2J4X A;  2X38 A;  3SEB A;  3IAM 1;  5JUW A;  2YEP F;  3T3N A;  1K51 A;  2RMM A;  3O13 A;  5DTQ A;  2JWU A;  3P1M A;  1QOB A;  2KN4 A;  1XCT L;  1KTK A;  4HRO A;  1XLQ A;  2WXK A;  1ZDV A;  5HI1 A;  1FCL A;  1C9F A;  3RPF C;  3QOW A;  1JWB D;  1EWC A;  4ER3 A;  4A8X C;  3GB1 A;  4M0W A;  1XCQ L;  4LTU A;  4EKI A;  5G5H A;  1KFY B;  2VZK B;  4EKG A;  2WDQ B;  3GS2 A;  3BK2 A;  4YXD B;  1LO5 D;  1SB3 C;  4WWM A;  3SFD B;  4GLS C;  3A9Y A;  1JWA D;  1TJE A;  1VZ8 A;  3FIL A;  4IOI E;  3BYY B;  5DT2 A;  1TKY A;  2V0G A;  1D6E C;  1ZXH A;  1GB4 A;  1D4B A;  3W5V B;  4USA A;  3Q8A A;  2K9X A;  1N5W A;  5GXG B;  1TZO A;  1KRH A;  4D2K A;  3PZ7 A;  1C4A A;  1AWD A;  1GOZ A;  1E7P B;  1EU4 A;  3E56 A;  3BVG A;  2V3N A;  4WVL A;  5DRT A;  1RFK A;  2J7W A;  1F2R C;  2SAK A;  3KWL A;  1C76 A;  3EGR A;  2ON8 A;  4DXF A;  1C79 A;  2BS2 B;  4TQ0 A;  2KAJ A;  2L83 A;  5DRY A;  4H2A A;  2WXI A;  1HZ6 A;  1MI0 A;  4WH4 A;  4RF1 A;  2ACZ B;  1QOF A;  2WXN A;  3VR8 B;  1I4X A;  3ZYY X;  4N6E B;  3WCQ A;  2NTT A;  2ICI A;  3AMZ A;  4JE3 B;  1QF6 A;  3QFI A;  1VZ6 A;  3MFG A;  3PO0 A;  2WDV B;  3C8Y A;  1I4Q A;  2L32 A;  3P4R B;  3TSS A;  3EA6 A;  2M19 A;  3EUB 2;  1IUE A;  1JAL A;  1YN4 A;  2WXG A;  2MJD A;  3AE5 B;  1U2Z A;  1ROE A;  1UUP A;  3W1S A;  3I9V 1;  2JQR B;  1J7A A;  2JX5 A;  5D3I B;  4ER7 A;  3HVZ A;  4B0M A;  4A9A A;  1JWM D;  1UGJ A;  4XWW A;  5AUK A;  3I57 A;  2KWD A;  2BW2 A;  2HCN A;  2ZW0 A;  1WWT A;  3GUU A;  1FCC C;  1EM7 A;  1N60 A;  1SIJ A;  2K22 A;  3NVW A;  4JWU C;  2WU5 B;  2ODR D;  3Q8E A;  1CK1 A;  2I38 A;  4KKI A;  2AQ1 B;  4C7Z A;  5T8I A;  2MJE A;  2WXM A;  3TEL A;  2W55 A;  4OW0 A;  1I4H A;  2XXQ A;  2GRI A;  4YTM B;  4A55 A;  1FMA D;  1HA5 A;  2PVG C;  1SBB B;  1UNS A;  2INP E;  4OZB A;  2WXR A;  1M4V A;  3AN1 A;  2CU3 A;  4DQO C;  1FXA A;  3AEE B;  1K50 A;  2YEP B;  1F77 A;  1NYQ A;  1RWS A;  1YN3 A;  1L5P A;  1MHH E;  2Z8L A;  1VJK A;  3CWI A;  1BUI C;  2JZP A;  2JYT A;  1N63 A;  3FIL B;  4AS1 A;  1ZP0 B;  1V97 A;  1PUT A;  4P16 A;  1SJE D;  3LYY A;  3P63 A;  1WGK A;  1CZP A;  1SXT A;  2H89 B;  2LHE A;  2PVO D;  3GZD C;  4TQ1 A;  2WQY B;  4GDK B;  3ZJV A;  1DYQ A;  2PW9 A;  3U4E G;  3BVM A;  1GB1 A;  2MJ3 A;  1ET6 A;  5FKA C;  1T5X D;  5BMG A;  4MM3 B;  1YMH E;  1SF0 A;  3AE9 B;  4RGT A;  2K5P A;  2R61 A;  2RPV A;  2K0P A;  2IGH A;  1NVI D;  1FNW A;  1AYF A;  2Y5C A;  3R2T A;  3TFL A;  1V8C A;  2MXD A;  1VLB A;  4L23 A;  3KQ4 A;  1MHX A;  1N61 A;  4C80 A;  3LXF A;  2M56 B;  2WLB A;  4EQZ A;  3AE6 B;  4YSY B;  1K53 A;  2M0A A;  2QSD A;  5I4D A;  3PE5 A;  1TS2 A;  2KAC A;  5MPO A;  1CQV A;  4MT5 A;  1FFV A;  4IKG A;  2HFZ A;  3R8B A;  3HVD A;  3AEF B;  1V1O A;  1SJH D;  3VRB B;  2IPK D;  1JRO A;  4HRA A;  1QKZ A;  2RDG A;  5H92 C;  3SR4 A;  3P42 A;  1N5X A;  1FNV A;  1MPE A;  4NAM A;  5HFY A;  2J53 A;  4N58 A;  2INN E;  1OQR A;  5DTM A;  2OED A;  4ARC A;  2E6X A;  2VZK D;  3M9L A;  2LLW A;  3E9S A;  3DWG C;  1FXI A;  3URY A;  1L0X B;  3GZC A;  5D7G A;  1P7E A;  1BXT A;  2LUM A;  1J7B A;  2FBW B;  3IT6 B;  3FAH A;  1IBX A;  1YNT E;  2EEL A;  2XXP A;  1V1P A;  1FNU A;  1KLG D;  2LGI A;  3AE1 B;  4JPS A;  2HTM E;  5E6J A;  5EE0 A;  2SEB D;  2GB1 A;  4KGT A;  1GAQ B;  4XE0 A;  1I7H A;  1WRI A;  1FD6 A;  1YJJ A;  1T6B X;  2WXL A;  1AN8 A;  1C4C A;  5HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...