4Q2JA

A novel structure-based mechanism for dna-binding of satb1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
169
Chain Sequence
b'GPGSGTMLPVFCVVEHKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein SATB1
publication title Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 38
structure length 169
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4q2jA02
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4q2jA01
4Q2JA 3NZLA 3TUOA 2L1PA
chains in the Genus database with same CATH superfamily
5D3IB 3M9LA 1IGCA 3ZPXA 4ER0A 2AXVA 2JVLA 2G1EA 1D5ZC 2PW9A 3U2SC 4A6QA 2DYBA 3PRMB 4EKGA 1WJ6A 4RFBA 2LRUA 5BYRA 1WRDB 1UD7A 1PGAA 3DM5A 1WRIA 2RGFA 5LXIB 1I35A 5IAAC 4BOZB 1L4ZB 1SXTA 1KM7A 1SSNA 3CROL 3FILA 3PTFC 2TSSA 2BBCA 2DWQA 3AEDB 3U4EG 3IHPC 1WWTA 3B1LX 1DW9A 3WAOA 3BWUD 4NJ7A 4X4CA 3UFDA 3GBFA 3FYAA 2GMIC 3MC0B 2I1JA 4XDDA 3RNBC 4GN1A 3RMKC 2K8HA 1A5RA 2VZKD 4HJGE 2B5AA 4Z5DA 2DYMA 2FIFA 2DZIA 2XIUA 3L0WB 2IVGA 1V5OA 2CHZA 3A4SC 1N60A 2MRPA 5IOIA 4RF1A 5LNK1 3PRZA 3B7HA 2J7WA 2LYJA 2FJRA 2O6VD 1WH8A 3DOWA 5G2NA 4W9FA 3ZRCA 4Z5HA 3I3TB 1K52A 4XYCA 4HCPB 1MFQC 2LXAA 5CHVC 3G5GA 3CWIA 4DK5A 1C4PA 1WXQA 1WXMA 4Y42A 3ZXVA 4JQDA 2DZJA 4DWFA 2HCSA 1ZZ8A 1YJIA 4B9KA 1YN3A 1I7HA 4A8XC 3VXWA 4WWMA 1E7UA 2ZW1A 1WE6A 2FCNA 3DDCB 4IWQA 3KZ3A 4E71A 2KDFB 4KGTA 2IGHA 4XZ4A 2BYVE 1XCQL 3NY5A 4LCDE 3M95A 2L83A 3FKYA 2DAJA 1LM8B 3APCA 2ZEQA 2EELA 3DPDA 4E3CA 4O8BA 3RUIB 4ITKA 2BYFA 3P63A 4PT5A 4OVUA 3ZDMC 2PKOA 4W9DA 1Z5SB 3OMTA 3KUZA 4CHKA 1T0RC 3Q8AA 1T5XD 2YVCA 4EE2A 4ER6A 3DBLI 3Q3FA 5HHDG 5I4DA 2JYTA 3H1UA 2W54A 2LGSA 3D32A 1DGJA 1E8XA 1CMXB 3GP7A 2L1PA 1JMLA 1GB4A 3T3NA 1Y7YA 1FD6A 2PXUA 2AX5A 5BMHA 3AE5B 3IT6B 4MSQB 2N9KA 4DHJB 1YIWA 1K53A 4W9KA 2UYZB 1HE8A 4J3OD 2C7MB 2ICPA 3T8MA 1QZXA 3EC8A 3KVFB 2QC8A 3W9CB 4JCYA 4IM3A 2WDRB 2MHJA 4PYZA 1YN4A 1WR6E 4MJSB 2LNMA 2M17A 4FULA 1QZEA 1TS5A 4PU3C 2QJLA 2KNBA 3U7ZA 3A9YA 2OOBB 1WX7A 3R09A 2WXRA 4L1BA 2EWTA 1SQ8A 5DPTA 2KTRB 2BNMA 2PXKA 4JWSC 1L5PA 3GUUA 3E56A 1L4DB 3ZHIA 4A9AA 2KJHB 5LXHA 3V6CB 2D3GA 4IVZA 3MP9A 4DDGD 2GBJA 4HXDA 2PJHA 3AE6B 4C80A 1AARA 3P2BA 3AH7A 3VRBB 2WNMA 4HPPA 4MJSA 2LVQA 4LNNA 4JLCA 4AQ7A 2HJ8A 1PNRA 1GC6A 1LGRA 2RDGA 4YSXB 1HQ1A 1Y8RC 2ZCCA 4ER5A 4KGSA 1FRDA 3DVGY 2D3AA 3AXCA 4MELA 4I6TA 2DYOA 2KTRA 3ZHMA 3NXHA 1J7CA 1HF0A 1WJNA 2KDEB 4EZJA 1FM0D 3TEXA 2K22A 1E90A 1RAXA 1HTOA 4MGIE 4IC7B 2V3NA 1I4QA 4REZA 1ZXIA 3QYXA 2Z59B 3RI7C 4OZCA 2VH2A 1ZKHA 2FE8A 4NAMA 2G4SA 1B1ZA 1GT0C 4GGQA 4M0WB 2V3PA 2HCNA 1MG4A 3KUDB 4URKA 3LDZE 5J17A 1SE2A 3F51A 1VZ7A 1N62A 3O65B 4DHJD 1PGBA 2FUHB 2KFKB 1R4NB 3VTVA 5L83A 2NBUA 2LYLA 1I4PA 1KLVA 1QKZA 3WALA 5J18A 1YX6B 1F0ZA 4FLHA 1SJED 3QCAA 1YQ3B 5BMGA 4Z5CA 4IUMB 2I2YA 3ZNZB 1RZRA 2W9NA 1VD2A 4BAXA 4DBGA 5HG2A 4KSKC 1BT0A 4N58A 4GHJA 1JQ4A 3OAWA 2MXDA 1VPWA 1V8CA 2K1FA 1UZXB 1UXCA 2NPTB 1NBFC 1XCTL 3GZNB 1BXTA 2KWVB 1FIQA 3AI5A 4M0WA 3TUOA 2PXPA 2MQJA 3PLVA 5IP4D 3GS2A 2RSUA 2LZ6A 1ZS4A 3TBLD 1WGHA 5GAGi 5DSXA 2N1VA 3MJWA 1K8RB 2MP2B 2KFKA 1JFSA 1E8ZA 4BOSC 4HRAA 3PPAA 3ZLZA 1T0QC 1E3OC 3RNGC 4FJVB 4FHJA 4YARA 4XE0A 3WAPA 2ONQA 3MHSD 2WXNA 4G0NB 2K25A 1NVID 4WVLA 1TT5B 1D3ZA 4NNJB 2NPTA 5LLIA 4II2B 3KWLA 4NDWA 2KT7A 2WDVB 3EUSA 1VJKA 2KEIA 1TIFA 3KYCD 1ZUGA 3M63B 1J0GA 4MGKE 3LFPA 1C4CA 1ZGUB 1S3SG 3KYDD 3P4PB 2JU6X 4XC2A 3SFDB 1NW3A 2AWIA 4JCXA 4TQ0A 5DTQA 3V62A 4J1WA 2PUGA 4RGNA 1GPXA 1WGDA 1EWYC 1KLGD 1RZRD 3LXFA 3HHMA 1OQQA 3WA0A 2WXPA 2KYWA 5DTMA 1JWBD 3VFKA 1OSLA 4KX6B 3MC9A 3APDA 3I63C 2IO2B 1NEKB 2L76A 3IG3A 4K7SA 3ABVB 2JXXA 3N32A 2WXIA 5EE9A 3P4QB 2IVQA 3LJ3A 4W9LA 3PE5A 4NY0A 1HEZE 2INCC 1V86A 2MA9B 2INDC 3R3MA 4FXCA 4TUUA 1UWXA 3M62B 5DTRA 3KQ4A 3OQOA 2L0FA 1WYGA 1L6VA 3VRAB 2KMMA 3C8YA 5GAHi 2EF8A 2MWSB 1FEHA 1HQRD 3NS1A 4IDIA 3R2IA 3QC8B 1MHXA 3ENEA 3SR4A 3UWPA 1GAQB 1C79A 1NI3A 1SE9A 1UNSA 1WFYA 2DX5B 3B0AA 1LQCA 2KC2A 3TMPB 4MGYE 3RNFC 2V3CC 4LNIA 3AEAB 2OJRA 4MCXA 5JZEB 4GXBA 4ER3A 3QA8A 3JVZX 4F7ZA 3QOXA 3OJ3A 3PZ7A 2LCVA 1SBBB 5BMIA 2RDHA 1UBQA 2AXUA 3PXPA 3Q69A 1U4AA 4CYEA 3RZZA 3LYYA 3A9XA 1ADRA 3L17A 4A90A 4EZKA 3ZGZA 4OBMA 3RNEC 2LGXA 3BZDB 5C3JB 4OVZA 5D6JB 1RZSA 1YX5B 1TY0A 1YN5A 2LGDA 1ZZ6A 1FFUA 2KLGA 3QOWA 2KVRA 3ALBA 1QQAA 1P98A 3SX0A 1T0YA 3VTUA 1WM3A 4MGZE 2C60A 4X57B 1T0SC 4A55A 4AOFA 3IVFA 1RFKA 4XWWA 4KSLC 2X38A 2YEPB 4TV3A 1EF1A 1YMHE 4DXGA 2J7QB 1DULA 1Q1OA 2KVZA 1R4MB 4GIVA 1J19A 2OR1L 4OW0A 1F77A 2XNAC 2LHEA 3IBEA 2XJ3A 2JCGA 3DHHC 4UDUC 3AE2B 4N6EB 2NBVB 3TCAA 1L1MA 2IO1B 4RMAA 3Q8FA 1WM2A 1XLOA 2PPHA 2BPSA 3DBHI 1MVKA 3EHVA 1TBEA 3KUCB 1WGKA 5EE1A 4IW0A 2XCJA 3OJ4B 4ARCA 2L49A 1WYWB 1ZOYB 3VHTC 1YSEA 2KAJA 5HI1A 4LNKA 4ZHOA 3L4PA 4LTUA 1YQ4B 1Y56A 2BT6A 1WSPA 4A3PA 5CTRC 2IDYA 2ACZB 4N59A 3H7PB 3N1YC 2LEKA 2ZW0A 2W82A 4WWNA 4PU7A 1WZ3A 5JHBA 2FUG1 4ANXA 2KTFA 3SCGA 4M01A 2PMVA 1XXGA 2PXLA 2AWTA 4ZRJA 5JH5C 2L1AA 2H89B 1OQRA 2LGYA 1S1QB 2MSED 3UQAA 3GZDA 3CF6E 2IGGA 4ZRKA 1VLBA 2LLVA 4AJYB 3JXCL 4ANWA 2BYTA 2R1JL 4P1CC 3Q8BA 1I4GA 1YQBA 4A3OA 5HFYA 4TSSA 2NTTA 2V0GA 3TELA 1JH9A 1CQVA 3SU8X 1PUTA 1POUA 2LYRA 3QF3A 1E8WA 2RD0A 2LMCA 2KFJA 4G11A 4ICUA 5GXGB 2KWCA 4AWJA 4IKGA 1HZ6A 2WXJA 1NERA 1V6EA 4NZLB 2G9HD 4W9HA 3R8BA 2R61A 5H8YE 3UIPB 1E9MA 3UINB 1EF5A 3RPFC 2Y5BB 2EKEC 2DBYA 4PYUA 2BS3B 3OG5A 4I6LB 2LVPA 4MH8A 4K3CA 5IO9A 3ETRA 1UELA 1JFTA 4EK9A 3RNAC 1JRPA 2Q5WD 4C7YA 2Y5CA 1RPEL 2KK8A 3JXDL 3TEYA 4ZOHC 5IKCM 2LLWA 2K8BA 1XLQA 4WJPA 3ZIMA 2K6QA 2KZ8A 4US8A 1N61A 1ENFA 3TEPA 2IY1B 4W9JA 1FNWA 2C7HA 3ZW3A 4D2KA 4IA8A 1KRHA 3GE3C 1Y9QA 5IA7A 2AYOB 2L3ZA 4MSMB 3N9YC 2BF8B 4BKTA 1FNUA 4DDID 2KDMA 2L8JA 1SB3C 3Q8EA 4ZRIA 4RH6A 2W3RA 1TS4A 2QMTA 2KLCA 2LHDA 4YTNB 1GOZA 2ICTA 2LYPA 2Y5PA 4GSWA 1ZE3D 2JRHA 3NRZA 3PS6A 3AEBB 3H5TA 2XK5B 4IWPA 4AUQC 1NYQA 2AUWA 2O38A 3NJTA 2LI5A 2EMSA 3N3KB 2NVUI 1SJHD 2CR5A 3M3JA 2OJWA 2MJDA 4F8CB 1ZAYA 4RGOS 2HD5B 3NHEB 2M1MA 1WJUA 4I6PA 4DXFA 1IGDA 1V97A 2SAKA 1IYFA 1YJ1A 1LFDA 2PUEA 3P1MA 3OP9A 1U2ZA 1TKEA 3RZFA 4XX5A 2V3SA 3V3XA 2XK5A 5AEKB 2PPXA 5DRYA 4QAYA 1MJDA 2XEWA 1ZZBA 1PQSA 4GMVA 2KOXA 4HPMB 1JWMD 2XBBC 3BVMA 1LXDA 2PE5A 3BIID 4I8TA 4I6NB 3OQNA 3DNVB 4B0MA 2C7NB 3BINA 1PDXA 3BK1A 1WXSA 1CK1A 2INNE 1AN8A 2G3QB 3BDNA 1M94A 2R63A 1KOTA 3PRPB 1SE4A 4MDKE 3N1ZC 4HKZE 3DWMA 1LMB3 2MBHA 4BZAA 4HDOA 3NOBA 2VH1A 5D3DA 3W1SC 1I4HA 4FADA 1L2NA 4ACFA 2Z8LA 3JXBC 4JL9A 4BFRA 2LVOA 2AL3A 4YG4A 1L7YA 2ASQA 2KN5A 2BWES 2UU7A 3NVYA 2VRRB 3AULA 2N7JA 2JF5A 3SCHA 2XSDC 3W5VB 4EZLA 2PVGC 1F52A 1BUIC 2JQEA 3N30A 5EE3A 1ZP0B 2FFHA 1XEEA 2JT4B 3DVGX 1IBXB 3TJPA 3GN5B 2MBOA 2EMTA 2GB1A 3Q6BA 3D1NI 2WXQA 4YTPB 1E8YA 2RDBC 3ZJUA 5T8IA 3TRBA 1MFWA 4HWIB 1V49A 5AZFA 1D6EC 4K7UA 3UF8A 3HM3A 2BKRB 5D2MB 3KW5B 4R3DA 3UGBB 1RIOA 5AZHA 3QWZB 3AE1B 3MEJA 1WETA 2LYQA 1BDIA 4LLGM 2J53A 2PE9A 4PS7A 4PU8A 3EGRA 1SEBD 4K81A 2KEJA 1EU3A 1TTNA 3KLSX 3NVZA 4AJWA 2VEOA 1IBXA 3GN5A 4ICVA 3Q2AC 4M00A 2LJIA 4X4DA 3TSSA 4YL8A 1N5WA 3DBRI 1YD8U 1TZOA 3FC4A 3HIZA 3A1QB 4RCOA 2YLMA 2FCQA 1BDHA 4WQMA 3TFLA 2QHOA 2ZJDA 2BNNA 1Q0WB 3BYYB 2N4FA 4EOYA 4ZYSA 4WIPA 4B95A 4OHJA 1C9FA 3QQ6A 3OLMD 4HLEA 3RYTA 1PFDA 1FXTB 2N9XA 2D11A 3ECIA 3QJZA 4HEA1 3ZTDA 3O9XA 2BNOA 3DBLB 3MFGA 3MJ5A 3PREA 3VTWA 2WS3B 1SE3A 3S8QA 4HKQA 2KX3A 1PRAA 1UGMA 4MH0E 1ISNA 5FR3A 4EUTA 4IWOA 3A1QA 3HM6X 4ER7A 1ET6A 1FPYA 3TIXA 4ZHPA 2PXBA 1ZZ9A 1J8CA 2SEBD 1FCLA 4A20A 4ZYNA 3SD5A 3L16A 4FN2A 4KIKA 2V4LA 1XT9B 2R2QA 1M4VA 2A6CA 2KX0A 1T3QA 1KFYB 2JUOA 2CJOA 3AMZA 3PSEB 2DAFA 2DHZA 1JRUA 2WDQB 4HJKA 2LJ5A 4DE9A 4C7ZA 4Z59A 1VCBA 3DHIC 4XDCA 4XWTA 4HVBA 1F1HA 4WWPA 5AUIA 4YG7B 4CQNA 3VK0A 1PERL 3JYUA 5DPWA 3R1FA 1XQQA 1WXAA 1RFAA 1WZ0A 1Q10A 3W2DA 1HXYD 1JWUD 2D07B 1BMLC 2KMAA 1B9RA 1TGZB 4GOCA 5KHOA 1ZDXA 4EFOA 4GU2A 5J2RA 4W9IA 3B2FA 2D3CA 5D7GA 4DE8A 2IPKD 3RN9C 2JSVX 4W9EA 3QK0A 2N0SB 1WY8A 1OFFA 2QCZA 1AWDA 5BO4B 3ZTCA 2IVBA 2PE6B 4FJYA 3TEZA 3QWGA 2X8XX 4NQKE 2PUDA 3NZSA 2WYQA 3G7DA 2J7UA 3H8HA 5DRTA 2PXTA 2D3BA 4ARIA 1QOAA 2M4NA 2D5VA 4LDTD 2PUFA 3T3OA 4PS8A 2KMCA 1FXAA 2B3AA 1YOVB 3GE8C 3VUYA 3U3WA 3Q3NC 1F2RI 4YG1A 4YSZB 4LK0M 1E5WA 4K7WA 3VR9B 2FBWB 4P16A 2D2QA 3ZJVA 3ZNID 4GLSC 1WX8A 3NG0A 3U52E 4YT0B 3NVVA 2IY0B 2B76B 2HTHA 1H8CA 1QOBA 1MG8A 1NYRA 2NBWB 4H2AA 3I9V1 2WXFA 3MTNB 1ET9A 1MI0A 3V61A 4MT5A 3QARA 4YXDB 1IPGA 4N9F4 2JZZA 2WU2B 1X57A 3FYMA 2I38A 3Q14C 2GBKA 3TEWA 3F6WA 4F1SA 2WU5B 3BVGA 3QHTA 1ZDVA 3UIOB 5EDSA 1P0RA 1ZXHA 3PZDA 3W5UB 3DVNU 5TR5A 1I4RA 1LLIA 4P6VF 1HTQA 3B08A 2OHFA 2GZUA 3PHXB 1C78A 2BGFA 4YTMB 2A5UA 3A9ZA 3P42A 1ROEA 1KH0A 4S0RA 5G55A 2KJRA 2CHXA 4KZCA 3AEGB 2CROA 3U7DA 4GDLB 5GMVA 4BKGA 2IU7A 1TS2A 3W1YA 4DHZB 2BQQA 1DYQA 2CHWA 1RM6C 3FAHA 3APFA 4RF0A 1F9JA 2JZ3B 1XF5L 2YBDA 2MW5A 2L32A 1WIZA 1QP0A 2MX2A 1I4XA 2MH7A 2NMQA 1RWSA 3AV8A 3UI3A 3NZ3A 3AU4A 2XN9C 1V1PB 4GDLA 2IUOA 1WGRA 3U30A 2LUEA 3HVZA 2H88B 1FCCC 2D10A 3I57A 4LJPB 2FIDA 2RMMA 3PT2B 1WGGA 2QDFA 4FN3A 4EEWA 3QFIA 5CHWA 5A7LA 4X4HA 2LASA 2RPQA 3NS8A 4G3XB 1TZ1A 4YWGG 5C23A 1P7EA 3NUHB 2AQ3B 2K39A 2AW6A 2Z0EB 2J0JA 3VUXA 3GZCA 5JUWA 4KDIC 1KF6B 2D5GA 2L7RA 4FHKA 1PRUA 4JWUC 5MPOA 1O4XA 1V1PA 3PV1A 1ZZ7A 3X0WA 1N63A 1RLFA 3OQMA 2BS4B 3C19A 2RPVA 3QX1A 2XXPA 2EKIA 3RULA 3L10B 2I1KA 3IAM1 4FJZA 2M8SA 4ASWC 1EFAA 3VDZA 2GOWA 2MJEA 3AN1A 3K9PB 3DVNV 2IZVB 2KQ4X 4USAA 1IUEA 2HDEA 4M8MA 2PEAA 2KD0A 2GLSA 4Q2JA 2BTEA 1WH3A 2MCNB 1ZPSA 1JALA 3RFZB 1J7BA 3K9OB 3R66C 4NPNA 4NAWB 5DPRA 4IM0A 2KN4A 2KWUB 1QLBB 1RYJA 1EO6A 4BBNF 4C56C 2Z0DB 4FA6A 3JSVB 3VH4B 1SF0A 1LO5D 3PO0A 3H6NA 2CU1A 2ZPYA 3IAS1 3RNCC 1UBIA 1K50A 1NENB 5DT2A 2HTME 1V5TA 3SHQA 2WGSA 4KDLB 4NAWA 2INPE 1WJ4A 4FBJB 1UUPA 1H4RA 1JWSD 5AZGA 1WX9A 3RZWC 2HE7A 4L2YA 2NR2A 4OZAA 3LISA 4I6RA 3E9SA 3JSVA 3DBHB 5DPSA 3ZKJC 4WAAA 3OKZA 3RD2A 3Q8CA 3AECB 3UQBA 4JIOU 2LUMA 2BWFA 4K3BA 3V6EB 1QP7A 2AEHA 3SDLC 2MBBB 1SGHA 3DBSA 4RGMA 2ZCBA 2ZNVB 1V9JA 1X1MA 2FCMA 3KXAA 2PXFA 1R69A 5KHQA 2BB6A 1E6EB 1XO3A 3HVDA 3N1XC 2FNJB 4CO7A 1OEYA 3EFCA 1MPEA 4GB9A 4TKNA 3TL5A 2WXHA 3ZO5B 2KEKA 1TY2A 2WUSR 5JHAA 3NZUA 5E6PA 1FFVA 4X4EA 5CHFA 1C77A 3VQIA 4JE3B 2WQYB 1DOIA 2K5PA 4JQWC 5H92C 3SFEB 2JQRB 3AM9A 3BVZA 3L13A 3NZLA 2IJ0A 4O1NA 2L00B 3A9JB 5G5HA 4DHZE 1UF0A 1GB1A 3F52A 2AL6A 1ZW7A 1R7SA 2WXGA 4HK2A 2LYSA 3CECA 1FMAD 3PLUA 1CJGA 2MBQA 1JWAD 2C5LC 2W3SA 4US9A 3OWQA 2LWPA 3ZKCA 2KPJA 3DCGA 2N9EB 2CU3A 2NTSA 2ZVNA 1I42A 2DENB 2CSFA 2K0PA 3H7SA 1QOFA 3IT4B 2WHIA 1JW9D 5FR6A 5G5GA 4ZDVA 1HZ5A 4B6WA 4J6IA 2N7EA 3CMMB 1C1YB 1TKGA 3A9JA 4HRSA 4JGHB 2MLBA 4F8DA 2L05A 2UWQA 2W55A 2KQSA 3WCQA 2KO3A 4WJQA 1C4AA 5IN7A 1QF6A 1D4BA 1KTKA 2CS4A 3VR8B 1IC8A 1Z2MA 3AEFB 3L08A 4ANUA 3MLFA 2PXVA 2E6XA 4RM9A 1B0NA 2CKHB 3MHZA 2ODRD 3DWGC 5BYSA 1XLNA 2CJNA 2KJ6A 3QAQA 1PGXA 4LNFA 2C9WB 1MHHE 3ZVVA 1AYFA 2NS5A 4OB4A 1R4NI 2MBEA 3A33B 3ONSA 3BK2A 1FO4A 3A9KB 2KKCA 2M56B 4ZRPA 2N7DA 4EKIA 2N1WA 2J42A 3WIMA 3HK0A 2QEJC 1L0VB 1V81A 1WMHB 1GG3A 2IBIB 3V05A 2KQ7A 4MM3B 4I6UA 2PUCA 3EA6A 1TKYA 1GUAB 2PUAA 3KL4A 1Q5WB 1DOXA 2GI9A 3GZNI 2O2VB 3L1PA 2QILA 4RNAA 4C4VB 2L0TA 2KC1A 2LXCA 2REXA 4ANVA 1E0ZA 1FRRA 1AW7A 3I5JC 5FKAC 2PIAA 4WQOB 2GBNA 3PZ8A 4II3B 3VH3B 4TMAB 2GBMA 1ZVVA 4KGRA 3VUWA 5HKHA 2LRWA 2LFIA 1JROA 3A9KA 3IVPA 2OEDA 3AE4B 3R2TA 2G45B 1PYWD 1L6UA 2MQKA 1WMHA 2WDTB 3AE7B 1T6BX 4MM3A 1N5XA 2JPHA 4PU4C 4G50A 2AXZA 2O2VA 4X4IA 4C4VA 1VDVA 4KIKB 2GRLA 2JVCA 2M0AA 4MCTA 2V4IB 4EQZA 3B9JA 4LDTB 1EM7A 3SEBA 4ZRQA 3Q3JA 2KACA 2JWZA 3Q3MC 3ZQ4A 4FBIA 3X23A 4IOIE 1F2RC 3GZDC 1ACCA 3VWSA 2J52A 4PS3A 2KDBA 2PVOD 1WI0A 2IO0B 2BVCA 2BJCA 3MC8A 1JCKB 3BY4B 4AP4C 3QIJA 5L95C 1G6JA 5BYQA 2IV1A 1RRBA 4P1BC 1TS3A 4MEMA 2PXDA 4S17A 1VRAB 2PTLA 2V9HA 1P9DU 5E6OA 3EFUA 4TQ1A 5C2TB 2XXQA 3U8ZA 3A4RA 1STEA 3URYA 4IWRA 4BVUC 1YJJA 3PHWB 1N6ZA 2L52A 3ML8A 1GJZA 2G4DB 1X2LA 3CSFA 4J1XA 3G0TA 1UH6A 4WJOA 5K98B 3DQVA 1AU7A 3BS3A 2WX1A 3WAMA 2M0XA 1E7PB 1QQRA 2N9PC 2IO3B 2IGDA 2JY6A 2BS2B 2WLBA 2GRMA 1L0YB 1CJEA 2EBYA 3OWEB 1E10A 2DZMA 4BKSA 3VVWB 1YNTE 1K51A 3AE3B 1WH6A 2KANA 1SIFA 1V80A 1WR1A 4KV2A 3QQ8B 3AEEB 2N9LA 3B2GA 2DZKA 4X4FA 2J0KA 3DBRB 1DOYA 4WURA 3IXSA 2V1YA 1C3TA 3AU5A 2MEKA 1WXVA 3SR6A 5D94A 3AE8B 1P1AA 4Z58A 3P4SB 1UWMA 5E6NA 3NVWA 2ON8A 3PGEA 3FMYA 1A70A 1L0XB 1C76A 2JYEA 2L8NA 3R7QA 1R4MI 4LJOB 2JX5A 2MP2A 4HROA 3ZRFA 2BW2A 3CLCA 2FAZA 2J4XA 1ZUD2 1GNUA 4X4BA 4LNOA 1SIJA 1VZ8A 2O49A 1QPZA 3LB8C 4PK1A 4WAFA 3GB1A 3KH0A 2PXEA 3IFWB 3RT3B 5JXVA 1E7VA 3CIRB 2ZNVC 2WXKA 2XXAA 3V60A 4E74A 1PRVA 4EZIA 4BBNC 1NDDA 2LYKA 2DLBA 2QIEB 2JWUA 3ZXRA 3ZYYX 4MACA 4BKSD 2YEPF 4W9CA 3ZNGC 2BKFA 2KHWB 3LQXA 2K6DB 1UXDA 4AS1A 4YSYB 2NCNA 2K8CA 3ZJTA 1WE7A 3BD1A 2ICIA 2R2OA 4M8NA 1KJTA 1P3QU 2AQ1B 1XWRA 2WWZA 2XI8A 4L23A 2HSGA 3P4RB 1CZPA 3HZIB 1FXIA 2GRIA 4X4GA 2ZZPB 3HRDD 2M19A 4YBAA 5CX3A 4OZBA 4JPSA 3L54A 2MEZA 3AE9B 1IP9A 1V1OA 4RM8A 5FK9C 3S2AA 3W1SA 1D5MC 1LCCA 1EWCA 1S7EA 3ML9A 4KKJA 1TJEA 1R63A 2DNFA 4GQMA 1D5XC 2A4ZA 4WJNA 1QQBA 1OQYA 2MJ3A 3GOEA 5TSSA 1KLUD 4DQOC 1NEQA 3CSTA 2K3UA 4KKIA 3AB5A 1JWLA 3ZUNA 1J7AA 2WIUB 1FNVA 3H9DA 2PLPA 1ESFA 3EUB2 1OCTC 1TYGB 2HJ1A 3JW0X 2PXQA 1LQBA 4P7IA 4M02A 2M4HA 4NJCA 4WH4A 5EE0A 2J0MA 2K9XA 1UTXA 1HA5A 4W9GA 3EECA 3R7RA 4K1RB 3PVLA 2GBRA 2KXJA 1QT9A 2OFYA 4RGTA 3RCZA 3N20C 2BYEA 4C00A 3C0RB 3DHGC 2LGIA 2WXOA 3BYTB 4B0EA 5C1ZA 2QSDA 3ME5A 2WXMA 2ZPNA 4NJ6A 3SCFA 3HUIA 1QP4A 1VZ6A 4IM2A 3NROA 2WX0A 1OTRB 1CQTA 1OEYJ 2Y3AA 2H8RA 4IG7B 3ZNHB 3KJXA 4JX1C 2JXTA 4WWOA 2PIJA 2VZKB 2KWDA 3ZDTA 2KZRA 1NI2A 2AQ2B 2JRIB 1UGJA 2ZVOA 1WF9A 4HPLB 3O13A 2O6VB 2E3TA 3VAWA 2JZPA 3Q3OC 3J9CA 1VR9A 3KWVA 1ZZCA 2WXLA 1XD3B 1QB2A 4GDKB 2RR9A 1QILA 4KVGB 3WANA 4NQLB 2O4AA 1WGYA 3T9LA 1EU4A 2HFZA 1ZPQA 2WP9B 1XLPA 4HDQA 1V2YA 2PUBA 1OGWA 2FCSA 3H7PA 2BB5A 4XGAB 4KZ0A 2LD9A 1P7FA 2O6VA 4HCNB 4OVVA 5AUKA 1DWKA 3NDBB 3FILB 1QOGA 5DCNA 1EUVB 5E6JA 1GC7A 4GDKA 2IYDB 1WIAA 2HINA 4EKUA 2KDIA 1LCDA 4DXAB
chains in the Genus database with same CATH topology
1MHHE 5D3IB 3M9LA 1IGCA 1FFUA 3QOWA 3ZPXA 1AYFA 4ER0A 2G1EA 3SX0A 1D5ZC 2PW9A 3U2SC 4A6QA 4EKGA 4A55A 5AUIA 4RFBA 3BK2A 5BYRA 1RFKA 1FO4A 4XWWA 4CQNA 2M56B 2X38A 2YEPB 4ZRPA 1PGAA 4EKIA 1WRIA 1YMHE 2J42A 4DXGA 1Q10A 3W2DA 1L4ZB 1SXTA 2QEJC 1HXYD 1JWUD 1SSNA 1L0VB 1BMLC 3V05A 3FILA 4MM3B 3EA6A 1TKYA 1B9RA 4OW0A 1DOXA 1F77A 2TSSA 2XNAC 2BBCA 2DWQA 2GI9A 3AEDB 2LHEA 1ZDXA 3U4EG 1WWTA 2QILA 3B2FA 4RNAA 5D7GA 4DE8A 2IPKD 4UDUC 3AE2B 3BWUD 1FRRA 1AW7A 2JSVX 1E0ZA 4N6EB 2N0SB 5FKAC 2PIAA 3MC0B 3PZ8A 3Q8FA 1OFFA 4XDDA 1AWDA 4TMAB 4KGRA 2VZKD 4HJGE 2DYMA 1XLOA 1MVKA 2LFIA 3TEZA 1JROA 1WGKA 5EE1A 3H8HA 2J7UA 2OEDA 5DRTA 3AE4B 3R2TA 1QOAA 1N60A 4ARCA 4ARIA 4RF1A 5LNK1 1PYWD 3T3OA 1L6UA 2J7WA 1ZOYB 2KAJA 5HI1A 1FXAA 3AE7B 1K52A 1T6BX 1N5XA 3L4PA 4ZHOA 4LTUA 1YQ4B 1Y56A 2BT6A 3CWIA 1WSPA 1C4PA 1WXQA 1F2RI 2IDYA 4YSZB 1VDVA 4LK0M 2ACZB 4N59A 2FBWB 4P16A 2M0AA 3VR9B 2LEKA 2ZW0A 2V4IB 2W82A 4EQZA 3B9JA 1EM7A 3SEBA 3ZJVA 4GLSC 2HCSA 1YJIA 2FUG1 4ZRQA 3U52E 1YN3A 2KACA 1I7HA 4YT0B 4A8XC 4WWMA 3NVVA 2B76B 2PMVA 2ZW1A 1XXGA 3ZQ4A 4IOIE 1QOBA 1NYRA 2H89B 1F2RC 1OQRA 2L1AA 4KGTA 2IGHA 4H2AA 3I9V1 3GZDC 1XCQL 3GZDA 1ACCA 3VWSA 2WXFA 2J52A 2IGGA 1VLBA 2LLVA 2PVOD 1ET9A 1MI0A 4MT5A 2BYTA 4YXDB 2L83A 3Q8BA 1I4GA 5HFYA 1JCKB 4TSSA 2NTTA 2V0GA 3TELA 2WU2B 2EELA 5BYQA 1CQVA 2I38A 1PUTA 4ITKA 3P63A 3TEWA 4PT5A 1TS3A 2PKOA 2WU5B 2LMCA 3BVGA 1VRAB 1ZDVA 2PTLA 5GXGB 3Q8AA 1T5XD 4TQ1A 5C2TB 4EE2A 2XXQA 1HZ6A 4ER6A 2WXJA 1ZXHA 4IKGA 3W5UB 4NZLB 5HHDG 5I4DA 2JYTA 1STEA 1I4RA 4P6VF 2G9HD 3URYA 3R8BA 2OHFA 2W54A 1DGJA 1YJJA 2R61A 5H8YE 1E9MA 3GP7A 1C78A 4YTMB 3P42A 3A9ZA 2L1PA 1JMLA 1ROEA 2L52A 3RPFC 1KH0A 1GB4A 3T3NA 2DBYA 1FD6A 2BS3B 2AX5A 3AEGB 5BMHA 3AE5B 3IT6B 4MH8A 2N9KA 4GDLB 3G0TA 1K53A 1TS2A 3ETRA 4J3OD 4EK9A 1JRPA 2Q5WD 4C7YA 1DYQA 1E7PB 1QQRA 1RM6C 3FAHA 2Y5CA 2IGDA 2BS2B 2WLBA 3TEYA 1L0YB 1CJEA 3OWEB 4RF0A 3W9CB 1E10A 4ZOHC 2LLWA 1XLQA 1K51A 1YNTE 2WDRB 3AE3B 4US8A 1YN4A 1N61A 2LNMA 1XF5L 1ENFA 3TEPA 2YBDA 1TS5A 1FNWA 2L32A 2QJLA 4D2KA 3U7ZA 3A9YA 1I4XA 1KRHA 3AEEB 2MH7A 3R09A 2NMQA 1RWSA 2N9LA 2WXRA 3AV8A 4L1BA 3NZ3A 3UI3A 3B2GA 3N9YC 1FNUA 2XN9C 2KDMA 1V1PB 1DOYA 4WURA 1SB3C 3IXSA 3Q8EA 1L5PA 4JWSC 3GUUA 3E56A 1L4DB 4RH6A 4A9AA 3HVZA 2W3RA 2MEKA 1TS4A 2QMTA 3SR6A 2H88B 2LHDA 4YTNB 1FCCC 3AE8B 1GOZA 3I57A 3P4SB 3MP9A 1UWMA 3NVWA 2ON8A 2RMMA 1A70A 1L0XB 2Y5PA 3QFIA 1C76A 3AE6B 2JYEA 1ZE3D 3NRZA 3AEBB 4C80A 2JX5A 3AH7A 4HROA 3VRBB 2BW2A 1NYQA 2WNMA 4YWGG 1P7EA 3NUHB 2AQ3B 1SJHD 1ZUD2 2J4XA 4AQ7A 2RDGA 1SIJA 1VZ8A 4YSXB 3GZCA 4ER5A 4KGSA 5JUWA 2MJDA 1KF6B 1FRDA 2D5GA 4RGOS 3LB8C 4JWUC 4WAFA 5MPOA 3GB1A 1V1PA 2DYOA 3NXHA 1J7CA 5JXVA 4DXFA 1IGDA 3CIRB 1N63A 1FM0D 1V97A 2SAKA 2WXKA 3TEXA 2K22A 2BS4B 4EZIA 2RPVA 2XXPA 1TKEA 1U2ZA 2EKIA 3P1MA 3IAM1 2V3NA 3V3XA 1I4QA 4REZA 1ZXIA 2DLBA 2QIEB 5DRYA 2MJEA 3AN1A 2JWUA 4OZCA 3ZYYX 4MACA 2KQ4X 2FE8A 2YEPF 4NAMA 1IUEA 2HDEA 4USAA 4AS1A 1B1ZA 4YSYB 4Q2JA 1JWMD 2BTEA 3ZJTA 3BVMA 1ZPSA 1JALA 3RFZB 3BIID 1J7BA 2ICIA 2V3PA 2HCNA 2AQ1B 4L23A 4NAWB 4B0MA 1PDXA 3BK1A 1SE2A 1CK1A 1CZPA 1QLBB 1VZ7A 1N62A 2INNE 2KN4A 3P4RB 1FXIA 1AN8A 1RYJA 1PGBA 2GRIA 4C56C 3HRDD 2M19A 1I4PA 1SE4A 1QKZA 4OZBA 4HKZE 1F0ZA 3DWMA 4JPSA 1SJED 1SF0A 3AE9B 1YQ3B 1V1OA 1LO5D 5BMGA 2I2YA 5D3DA 5FK9C 1I4HA 3PO0A 3W1SA 1D5MC 1EWCA 4KKJA 5HG2A 3IAS1 1JQ4A 4N58A 1TJEA 2Z8LA 2MXDA 1V8CA 1K50A 1D5XC 1NENB 5DT2A 2HTME 1XCTL 2MJ3A 1BXTA 4M0WA 1FIQA 3TUOA 3NVYA 3GS2A 5TSSA 2INPE 2N7JA 3W5VB 1KLUD 1UUPA 2PVGC 4DQOC 5DSXA 1JWSD 2K3UA 1BUIC 4KKIA 3AB5A 4L2YA 4OZAA 4HRAA 1J7AA 3E9SA 5EE3A 1FNVA 2PLPA 1ZP0B 3OKZA 4XE0A 1ESFA 3EUB2 2ONQA 1TYGB 1XEEA 3Q8CA 1IBXB 2WXNA 3AECB 1NVID 2LUMA 2GB1A 2M4HA 4NJCA 2WXQA 4YTPB 4WVLA 4WH4A 3ZJUA 5EE0A 4RGMA 5T8IA 2K9XA 1HA5A 3KWLA 2WDVB 1D6EC 1VJKA 1QT9A 2BB6A 4R3DA 4RGTA 1E6EB 1C4CA 1XO3A 3HVDA 3MEJA 1MPEA 3AE1B 4LLGM 2WXHA 2J53A 2LGIA 2JU6X 3P4PB 1TY2A 3EGRA 1SEBD 3SFDB 1EU3A 1NW3A 1FFVA 2WXOA 3BYTB 4TQ0A 5DTQA 3KLSX 3NVZA 4B0EA 1C77A 3VQIA 4JE3B 4RGNA 2VEOA 2QSDA 1GPXA 1IBXA 2WQYB 1EWYC 3ME5A 2WXMA 1KLGD 1DOIA 2K5PA 2LJIA 5H92C 3SFEB 3TSSA 3LXFA 1OQQA 3HUIA 2JQRB 1VZ6A 3NROA 1N5WA 2WXPA 3BVZA 3AM9A 3NZLA 5DTMA 1TZOA 3FC4A 1JWBD 2IJ0A 4KX6B 4O1NA 2Y3AA 4RCOA 5G5HA 4WQMA 3TFLA 4JX1C 2JXTA 1GB1A 2VZKB 1NEKB 1R7SA 2KWDA 2WXGA 3ABVB 3BYYB 2WXIA 5EE9A 1FMAD 4ZYSA 3P4QB 4WIPA 3PE5A 4OHJA 1JWAD 1HEZE 2W3SA 2AQ2B 4US9A 1C9FA 3OWQA 1UGJA 1PFDA 4FXCA 1UWXA 2CU3A 2NTSA 3O13A 2E3TA 5DTRA 3KQ4A 4HEA1 2K0PA 3MFGA 1WYGA 2JZPA 3MJ5A 1L6VA 1VR9A 3J9CA 2WS3B 3VRAB 1QOFA 1SE3A 2KMMA 3IT4B 3C8YA 3KWVA 1JW9D 2WXLA 4HKQA 5G5GA 4GDKB 1HZ5A 1FEHA 1HQRD 3NS1A 4IDIA 3R2IA 1QILA 1MHXA 3SR4A 3UWPA 1GAQB 1C79A 1NI3A 1UNSA 5FR3A 1TKGA 1EU4A 2HFZA 4HRSA 4ER7A 1ET6A 4ZHPA 2WP9B 1XLPA 3AEAB 2SEBD 1FCLA 2W55A 4ER3A 3WCQA 2BB5A 1M4VA 1C4AA 1QF6A 1D4BA 3QOXA 3PZ7A 1KTKA 1SBBB 3VR8B 5BMIA 1T3QA 2RDHA 1P7FA 3AEFB 3Q69A 1KFYB 5AUKA 2E6XA 3MHZA 2ODRD 3LYYA 2CJOA 3AMZA 3A9XA 1QOGA 3FILB 4A90A 5E6JA 3ZGZA 3DWGC 5BYSA 1XLNA 4OBMA 2CJNA 3BZDB 5C3JB 2WDQB 4OVZA 4DE9A 1PGXA 4C7ZA 1TY0A 1YN5A 4XDCA 4XWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2J A;  3NZL A;  3TUO A;  2L1P A; 
#chains in the Genus database with same CATH topology
 5D3I B;  3M9L A;  1IGC A;  3ZPX A;  4ER0 A;  2AXV A;  2JVL A;  2G1E A;  1D5Z C;  2PW9 A;  3U2S C;  4A6Q A;  2DYB A;  3PRM B;  4EKG A;  1WJ6 A;  4RFB A;  2LRU A;  5BYR A;  1WRD B;  1UD7 A;  1PGA A;  3DM5 A;  1WRI A;  2RGF A;  5LXI B;  1I35 A;  5IAA C;  4BOZ B;  1L4Z B;  1SXT A;  1KM7 A;  1SSN A;  3CRO L;  3FIL A;  3PTF C;  2TSS A;  2BBC A;  2DWQ A;  3AED B;  3U4E G;  3IHP C;  1WWT A;  3B1L X;  1DW9 A;  3WAO A;  3BWU D;  4NJ7 A;  4X4C A;  3UFD A;  3GBF A;  3FYA A;  2GMI C;  3MC0 B;  2I1J A;  4XDD A;  3RNB C;  4GN1 A;  3RMK C;  2K8H A;  1A5R A;  2VZK D;  4HJG E;  2B5A A;  4Z5D A;  2DYM A;  2FIF A;  2DZI A;  2XIU A;  3L0W B;  2IVG A;  1V5O A;  2CHZ A;  3A4S C;  1N60 A;  2MRP A;  5IOI A;  4RF1 A;  5LNK 1;  3PRZ A;  3B7H A;  2J7W A;  2LYJ A;  2FJR A;  2O6V D;  1WH8 A;  3DOW A;  5G2N A;  4W9F A;  3ZRC A;  4Z5H A;  3I3T B;  1K52 A;  4XYC A;  4HCP B;  1MFQ C;  2LXA A;  5CHV C;  3G5G A;  3CWI A;  4DK5 A;  1C4P A;  1WXQ A;  1WXM A;  4Y42 A;  3ZXV A;  4JQD A;  2DZJ A;  4DWF A;  2HCS A;  1ZZ8 A;  1YJI A;  4B9K A;  1YN3 A;  1I7H A;  4A8X C;  3VXW A;  4WWM A;  1E7U A;  2ZW1 A;  1WE6 A;  2FCN A;  3DDC B;  4IWQ A;  3KZ3 A;  4E71 A;  2KDF B;  4KGT A;  2IGH A;  4XZ4 A;  2BYV E;  1XCQ L;  3NY5 A;  4LCD E;  3M95 A;  2L83 A;  3FKY A;  2DAJ A;  1LM8 B;  3APC A;  2ZEQ A;  2EEL A;  3DPD A;  4E3C A;  4O8B A;  3RUI B;  4ITK A;  2BYF A;  3P63 A;  4PT5 A;  4OVU A;  3ZDM C;  2PKO A;  4W9D A;  1Z5S B;  3OMT A;  3KUZ A;  4CHK A;  1T0R C;  3Q8A A;  1T5X D;  2YVC A;  4EE2 A;  4ER6 A;  3DBL I;  3Q3F A;  5HHD G;  5I4D A;  2JYT A;  3H1U A;  2W54 A;  2LGS A;  3D32 A;  1DGJ A;  1E8X A;  1CMX B;  3GP7 A;  2L1P A;  1JML A;  1GB4 A;  3T3N A;  1Y7Y A;  1FD6 A;  2PXU A;  2AX5 A;  5BMH A;  3AE5 B;  3IT6 B;  4MSQ B;  2N9K A;  4DHJ B;  1YIW A;  1K53 A;  4W9K A;  2UYZ B;  1HE8 A;  4J3O D;  2C7M B;  2ICP A;  3T8M A;  1QZX A;  3EC8 A;  3KVF B;  2QC8 A;  3W9C B;  4JCY A;  4IM3 A;  2WDR B;  2MHJ A;  4PYZ A;  1YN4 A;  1WR6 E;  4MJS B;  2LNM A;  2M17 A;  4FUL A;  1QZE A;  1TS5 A;  4PU3 C;  2QJL A;  2KNB A;  3U7Z A;  3A9Y A;  2OOB B;  1WX7 A;  3R09 A;  2WXR A;  4L1B A;  2EWT A;  1SQ8 A;  5DPT A;  2KTR B;  2BNM A;  2PXK A;  4JWS C;  1L5P A;  3GUU A;  3E56 A;  1L4D B;  3ZHI A;  4A9A A;  2KJH B;  5LXH A;  3V6C B;  2D3G A;  4IVZ A;  3MP9 A;  4DDG D;  2GBJ A;  4HXD A;  2PJH A;  3AE6 B;  4C80 A;  1AAR A;  3P2B A;  3AH7 A;  3VRB B;  2WNM A;  4HPP A;  4MJS A;  2LVQ A;  4LNN A;  4JLC A;  4AQ7 A;  2HJ8 A;  1PNR A;  1GC6 A;  1LGR A;  2RDG A;  4YSX B;  1HQ1 A;  1Y8R C;  2ZCC A;  4ER5 A;  4KGS A;  1FRD A;  3DVG Y;  2D3A A;  3AXC A;  4MEL A;  4I6T A;  2DYO A;  2KTR A;  3ZHM A;  3NXH A;  1J7C A;  1HF0 A;  1WJN A;  2KDE B;  4EZJ A;  1FM0 D;  3TEX A;  2K22 A;  1E90 A;  1RAX A;  1HTO A;  4MGI E;  4IC7 B;  2V3N A;  1I4Q A;  4REZ A;  1ZXI A;  3QYX A;  2Z59 B;  3RI7 C;  4OZC A;  2VH2 A;  1ZKH A;  2FE8 A;  4NAM A;  2G4S A;  1B1Z A;  1GT0 C;  4GGQ A;  4M0W B;  2V3P A;  2HCN A;  1MG4 A;  3KUD B;  4URK A;  3LDZ E;  5J17 A;  1SE2 A;  3F51 A;  1VZ7 A;  1N62 A;  3O65 B;  4DHJ D;  1PGB A;  2FUH B;  2KFK B;  1R4N B;  3VTV A;  5L83 A;  2NBU A;  2LYL A;  1I4P A;  1KLV A;  1QKZ A;  3WAL A;  5J18 A;  1YX6 B;  1F0Z A;  4FLH A;  1SJE D;  3QCA A;  1YQ3 B;  5BMG A;  4Z5C A;  4IUM B;  2I2Y A;  3ZNZ B;  1RZR A;  2W9N A;  1VD2 A;  4BAX A;  4DBG A;  5HG2 A;  4KSK C;  1BT0 A;  4N58 A;  4GHJ A;  1JQ4 A;  3OAW A;  2MXD A;  1VPW A;  1V8C A;  2K1F A;  1UZX B;  1UXC A;  2NPT B;  1NBF C;  1XCT L;  3GZN B;  1BXT A;  2KWV B;  1FIQ A;  3AI5 A;  4M0W A;  3TUO A;  2PXP A;  2MQJ A;  3PLV A;  5IP4 D;  3GS2 A;  2RSU A;  2LZ6 A;  1ZS4 A;  3TBL D;  1WGH A;  5GAG i;  5DSX A;  2N1V A;  3MJW A;  1K8R B;  2MP2 B;  2KFK A;  1JFS A;  1E8Z A;  4BOS C;  4HRA A;  3PPA A;  3ZLZ A;  1T0Q C;  1E3O C;  3RNG C;  4FJV B;  4FHJ A;  4YAR A;  4XE0 A;  3WAP A;  2ONQ A;  3MHS D;  2WXN A;  4G0N B;  2K25 A;  1NVI D;  4WVL A;  1TT5 B;  1D3Z A;  4NNJ B;  2NPT A;  5LLI A;  4II2 B;  3KWL A;  4NDW A;  2KT7 A;  2WDV B;  3EUS A;  1VJK A;  2KEI A;  1TIF A;  3KYC D;  1ZUG A;  3M63 B;  1J0G A;  4MGK E;  3LFP A;  1C4C A;  1ZGU B;  1S3S G;  3KYD D;  3P4P B;  2JU6 X;  4XC2 A;  3SFD B;  1NW3 A;  2AWI A;  4JCX A;  4TQ0 A;  5DTQ A;  3V62 A;  4J1W A;  2PUG A;  4RGN A;  1GPX A;  1WGD A;  1EWY C;  1KLG D;  1RZR D;  3LXF A;  3HHM A;  1OQQ A;  3WA0 A;  2WXP A;  2KYW A;  5DTM A;  1JWB D;  3VFK A;  1OSL A;  4KX6 B;  3MC9 A;  3APD A;  3I63 C;  2IO2 B;  1NEK B;  2L76 A;  3IG3 A;  4K7S A;  3ABV B;  2JXX A;  3N32 A;  2WXI A;  5EE9 A;  3P4Q B;  2IVQ A;  3LJ3 A;  4W9L A;  3PE5 A;  4NY0 A;  1HEZ E;  2INC C;  1V86 A;  2MA9 B;  2IND C;  3R3M A;  4FXC A;  4TUU A;  1UWX A;  3M62 B;  5DTR A;  3KQ4 A;  3OQO A;  2L0F A;  1WYG A;  1L6V A;  3VRA B;  2KMM A;  3C8Y A;  5GAH i;  2EF8 A;  2MWS B;  1FEH A;  1HQR D;  3NS1 A;  4IDI A;  3R2I A;  3QC8 B;  1MHX A;  3ENE A;  3SR4 A;  3UWP A;  1GAQ B;  1C79 A;  1NI3 A;  1SE9 A;  1UNS A;  1WFY A;  2DX5 B;  3B0A A;  1LQC A;  2KC2 A;  3TMP B;  4MGY E;  3RNF C;  2V3C C;  4LNI A;  3AEA B;  2OJR A;  4MCX A;  5JZE B;  4GXB A;  4ER3 A;  3QA8 A;  3JVZ X;  4F7Z A;  3QOX A;  3OJ3 A;  3PZ7 A;  2LCV A;  1SBB B;  5BMI A;  2RDH A;  1UBQ A;  2AXU A;  3PXP A;  3Q69 A;  1U4A A;  4CYE A;  3RZZ A;  3LYY A;  3A9X A;  1ADR A;  3L17 A;  4A90 A;  4EZK A;  3ZGZ A;  4OBM A;  3RNE C;  2LGX A;  3BZD B;  5C3J B;  4OVZ A;  5D6J B;  1RZS A;  1YX5 B;  1TY0 A;  1YN5 A;  2LGD A;  1ZZ6 A;  1FFU A;  2KLG A;  3QOW A;  2KVR A;  3ALB A;  1QQA A;  1P98 A;  3SX0 A;  1T0Y A;  3VTU A;  1WM3 A;  4MGZ E;  2C60 A;  4X57 B;  1T0S C;  4A55 A;  4AOF A;  3IVF A;  1RFK A;  4XWW A;  4KSL C;  2X38 A;  2YEP B;  4TV3 A;  1EF1 A;  1YMH E;  4DXG A;  2J7Q B;  1DUL A;  1Q1O A;  2KVZ A;  1R4M B;  4GIV A;  1J19 A;  2OR1 L;  4OW0 A;  1F77 A;  2XNA C;  2LHE A;  3IBE A;  2XJ3 A;  2JCG A;  3DHH C;  4UDU C;  3AE2 B;  4N6E B;  2NBV B;  3TCA A;  1L1M A;  2IO1 B;  4RMA A;  3Q8F A;  1WM2 A;  1XLO A;  2PPH A;  2BPS A;  3DBH I;  1MVK A;  3EHV A;  1TBE A;  3KUC B;  1WGK A;  5EE1 A;  4IW0 A;  2XCJ A;  3OJ4 B;  4ARC A;  2L49 A;  1WYW B;  1ZOY B;  3VHT C;  1YSE A;  2KAJ A;  5HI1 A;  4LNK A;  4ZHO A;  3L4P A;  4LTU A;  1YQ4 B;  1Y56 A;  2BT6 A;  1WSP A;  4A3P A;  5CTR C;  2IDY A;  2ACZ B;  4N59 A;  3H7P B;  3N1Y C;  2LEK A;  2ZW0 A;  2W82 A;  4WWN A;  4PU7 A;  1WZ3 A;  5JHB A;  2FUG 1;  4ANX A;  2KTF A;  3SCG A;  4M01 A;  2PMV A;  1XXG A;  2PXL A;  2AWT A;  4ZRJ A;  5JH5 C;  2L1A A;  2H89 B;  1OQR A;  2LGY A;  1S1Q B;  2MSE D;  3UQA A;  3GZD A;  3CF6 E;  2IGG A;  4ZRK A;  1VLB A;  2LLV A;  4AJY B;  3JXC L;  4ANW A;  2BYT A;  2R1J L;  4P1C C;  3Q8B A;  1I4G A;  1YQB A;  4A3O A;  5HFY A;  4TSS A;  2NTT A;  2V0G A;  3TEL A;  1JH9 A;  1CQV A;  3SU8 X;  1PUT A;  1POU A;  2LYR A;  3QF3 A;  1E8W A;  2RD0 A;  2LMC A;  2KFJ A;  4G11 A;  4ICU A;  5GXG B;  2KWC A;  4AWJ A;  4IKG A;  1HZ6 A;  2WXJ A;  1NER A;  1V6E A;  4NZL B;  2G9H D;  4W9H A;  3R8B A;  2R61 A;  5H8Y E;  3UIP B;  1E9M A;  3UIN B;  1EF5 A;  3RPF C;  2Y5B B;  2EKE C;  2DBY A;  4PYU A;  2BS3 B;  3OG5 A;  4I6L B;  2LVP A;  4MH8 A;  4K3C A;  5IO9 A;  3ETR A;  1UEL A;  1JFT A;  4EK9 A;  3RNA C;  1JRP A;  2Q5W D;  4C7Y A;  2Y5C A;  1RPE L;  2KK8 A;  3JXD L;  3TEY A;  4ZOH C;  5IKC M;  2LLW A;  2K8B A;  1XLQ A;  4WJP A;  3ZIM A;  2K6Q A;  2KZ8 A;  4US8 A;  1N61 A;  1ENF A;  3TEP A;  2IY1 B;  4W9J A;  1FNW A;  2C7H A;  3ZW3 A;  4D2K A;  4IA8 A;  1KRH A;  3GE3 C;  1Y9Q A;  5IA7 A;  2AYO B;  2L3Z A;  4MSM B;  3N9Y C;  2BF8 B;  4BKT A;  1FNU A;  4DDI D;  2KDM A;  2L8J A;  1SB3 C;  3Q8E A;  4ZRI A;  4RH6 A;  2W3R A;  1TS4 A;  2QMT A;  2KLC A;  2LHD A;  4YTN B;  1GOZ A;  2ICT A;  2LYP A;  2Y5P A;  4GSW A;  1ZE3 D;  2JRH A;  3NRZ A;  3PS6 A;  3AEB B;  3H5T A;  2XK5 B;  4IWP A;  4AUQ C;  1NYQ A;  2AUW A;  2O38 A;  3NJT A;  2LI5 A;  2EMS A;  3N3K B;  2NVU I;  1SJH D;  2CR5 A;  3M3J A;  2OJW A;  2MJD A;  4F8C B;  1ZAY A;  4RGO S;  2HD5 B;  3NHE B;  2M1M A;  1WJU A;  4I6P A;  4DXF A;  1IGD A;  1V97 A;  2SAK A;  1IYF A;  1YJ1 A;  1LFD A;  2PUE A;  3P1M A;  3OP9 A;  1U2Z A;  1TKE A;  3RZF A;  4XX5 A;  2V3S A;  3V3X A;  2XK5 A;  5AEK B;  2PPX A;  5DRY A;  4QAY A;  1MJD A;  2XEW A;  1ZZB A;  1PQS A;  4GMV A;  2KOX A;  4HPM B;  1JWM D;  2XBB C;  3BVM A;  1LXD A;  2PE5 A;  3BII D;  4I8T A;  4I6N B;  3OQN A;  3DNV B;  4B0M A;  2C7N B;  3BIN A;  1PDX A;  3BK1 A;  1WXS A;  1CK1 A;  2INN E;  1AN8 A;  2G3Q B;  3BDN A;  1M94 A;  2R63 A;  1KOT A;  3PRP B;  1SE4 A;  4MDK E;  3N1Z C;  4HKZ E;  3DWM A;  1LMB 3;  2MBH A;  4BZA A;  4HDO A;  3NOB A;  2VH1 A;  5D3D A;  3W1S C;  1I4H A;  4FAD A;  1L2N A;  4ACF A;  2Z8L A;  3JXB C;  4JL9 A;  4BFR A;  2LVO A;  2AL3 A;  4YG4 A;  1L7Y A;  2ASQ A;  2KN5 A;  2BWE S;  2UU7 A;  3NVY A;  2VRR B;  3AUL A;  2N7J A;  2JF5 A;  3SCH A;  2XSD C;  3W5V B;  4EZL A;  2PVG C;  1F52 A;  1BUI C;  2JQE A;  3N30 A;  5EE3 A;  1ZP0 B;  2FFH A;  1XEE A;  2JT4 B;  3DVG X;  1IBX B;  3TJP A;  3GN5 B;  2MBO A;  2EMT A;  2GB1 A;  3Q6B A;  3D1N I;  2WXQ A;  4YTP B;  1E8Y A;  2RDB C;  3ZJU A;  5T8I A;  3TRB A;  1MFW A;  4HWI B;  1V49 A;  5AZF A;  1D6E C;  4K7U A;  3UF8 A;  3HM3 A;  2BKR B;  5D2M B;  3KW5 B;  4R3D A;  3UGB B;  1RIO A;  5AZH A;  3QWZ B;  3AE1 B;  3MEJ A;  1WET A;  2LYQ A;  1BDI A;  4LLG M;  2J53 A;  2PE9 A;  4PS7 A;  4PU8 A;  3EGR A;  1SEB D;  4K81 A;  2KEJ A;  1EU3 A;  1TTN A;  3KLS X;  3NVZ A;  4AJW A;  2VEO A;  1IBX A;  3GN5 A;  4ICV A;  3Q2A C;  4M00 A;  2LJI A;  4X4D A;  3TSS A;  4YL8 A;  1N5W A;  3DBR I;  1YD8 U;  1TZO A;  3FC4 A;  3HIZ A;  3A1Q B;  4RCO A;  2YLM A;  2FCQ A;  1BDH A;  4WQM A;  3TFL A;  2QHO A;  2ZJD A;  2BNN A;  1Q0W B;  3BYY B;  2N4F A;  4EOY A;  4ZYS A;  4WIP A;  4B95 A;  4OHJ A;  1C9F A;  3QQ6 A;  3OLM D;  4HLE A;  3RYT A;  1PFD A;  1FXT B;  2N9X A;  2D11 A;  3ECI A;  3QJZ A;  4HEA 1;  3ZTD A;  3O9X A;  2BNO A;  3DBL B;  3MFG A;  3MJ5 A;  3PRE A;  3VTW A;  2WS3 B;  1SE3 A;  3S8Q A;  4HKQ A;  2KX3 A;  1PRA A;  1UGM A;  4MH0 E;  1ISN A;  5FR3 A;  4EUT A;  4IWO A;  3A1Q A;  3HM6 X;  4ER7 A;  1ET6 A;  1FPY A;  3TIX A;  4ZHP A;  2PXB A;  1ZZ9 A;  1J8C A;  2SEB D;  1FCL A;  4A20 A;  4ZYN A;  3SD5 A;  3L16 A;  4FN2 A;  4KIK A;  2V4L A;  1XT9 B;  2R2Q A;  1M4V A;  2A6C A;  2KX0 A;  1T3Q A;  1KFY B;  2JUO A;  2CJO A;  3AMZ A;  3PSE B;  2DAF A;  2DHZ A;  1JRU A;  2WDQ B;  4HJK A;  2LJ5 A;  4DE9 A;  4C7Z A;  4Z59 A;  1VCB A;  3DHI C;  4XDC A;  4XWT A;  4HVB A;  1F1H A;  4WWP A;  5AUI A;  4YG7 B;  4CQN A;  3VK0 A;  1PER L;  3JYU A;  5DPW A;  3R1F A;  1XQQ A;  1WXA A;  1RFA A;  1WZ0 A;  1Q10 A;  3W2D A;  1HXY D;  1JWU D;  2D07 B;  1BML C;  2KMA A;  1B9R A;  1TGZ B;  4GOC A;  5KHO A;  1ZDX A;  4EFO A;  4GU2 A;  5J2R A;  4W9I A;  3B2F A;  2D3C A;  5D7G A;  4DE8 A;  2IPK D;  3RN9 C;  2JSV X;  4W9E A;  3QK0 A;  2N0S B;  1WY8 A;  1OFF A;  2QCZ A;  1AWD A;  5BO4 B;  3ZTC A;  2IVB A;  2PE6 B;  4FJY A;  3TEZ A;  3QWG A;  2X8X X;  4NQK E;  2PUD A;  3NZS A;  2WYQ A;  3G7D A;  2J7U A;  3H8H A;  5DRT A;  2PXT A;  2D3B A;  4ARI A;  1QOA A;  2M4N A;  2D5V A;  4LDT D;  2PUF A;  3T3O A;  4PS8 A;  2KMC A;  1FXA A;  2B3A A;  1YOV B;  3GE8 C;  3VUY A;  3U3W A;  3Q3N C;  1F2R I;  4YG1 A;  4YSZ B;  4LK0 M;  1E5W A;  4K7W A;  3VR9 B;  2FBW B;  4P16 A;  2D2Q A;  3ZJV A;  3ZNI D;  4GLS C;  1WX8 A;  3NG0 A;  3U52 E;  4YT0 B;  3NVV A;  2IY0 B;  2B76 B;  2HTH A;  1H8C A;  1QOB A;  1MG8 A;  1NYR A;  2NBW B;  4H2A A;  3I9V 1;  2WXF A;  3MTN B;  1ET9 A;  1MI0 A;  3V61 A;  4MT5 A;  3QAR A;  4YXD B;  1IPG A;  4N9F 4;  2JZZ A;  2WU2 B;  1X57 A;  3FYM A;  2I38 A;  3Q14 C;  2GBK A;  3TEW A;  3F6W A;  4F1S A;  2WU5 B;  3BVG A;  3QHT A;  1ZDV A;  3UIO B;  5EDS A;  1P0R A;  1ZXH A;  3PZD A;  3W5U B;  3DVN U;  5TR5 A;  1I4R A;  1LLI A;  4P6V F;  1HTQ A;  3B08 A;  2OHF A;  2GZU A;  3PHX B;  1C78 A;  2BGF A;  4YTM B;  2A5U A;  3A9Z A;  3P42 A;  1ROE A;  1KH0 A;  4S0R A;  5G55 A;  2KJR A;  2CHX A;  4KZC A;  3AEG B;  2CRO A;  3U7D A;  4GDL B;  5GMV A;  4BKG A;  2IU7 A;  1TS2 A;  3W1Y A;  4DHZ B;  2BQQ A;  1DYQ A;  2CHW A;  1RM6 C;  3FAH A;  3APF A;  4RF0 A;  1F9J A;  2JZ3 B;  1XF5 L;  2YBD A;  2MW5 A;  2L32 A;  1WIZ A;  1QP0 A;  2MX2 A;  1I4X A;  2MH7 A;  2NMQ A;  1RWS A;  3AV8 A;  3UI3 A;  3NZ3 A;  3AU4 A;  2XN9 C;  1V1P B;  4GDL A;  2IUO A;  1WGR A;  3U30 A;  2LUE A;  3HVZ A;  2H88 B;  1FCC C;  2D10 A;  3I57 A;  4LJP B;  2FID A;  2RMM A;  3PT2 B;  1WGG A;  2QDF A;  4FN3 A;  4EEW A;  3QFI A;  5CHW A;  5A7L A;  4X4H A;  2LAS A;  2RPQ A;  3NS8 A;  4G3X B;  1TZ1 A;  4YWG G;  5C23 A;  1P7E A;  3NUH B;  2AQ3 B;  2K39 A;  2AW6 A;  2Z0E B;  2J0J A;  3VUX A;  3GZC A;  5JUW A;  4KDI C;  1KF6 B;  2D5G A;  2L7R A;  4FHK A;  1PRU A;  4JWU C;  5MPO A;  1O4X A;  1V1P A;  3PV1 A;  1ZZ7 A;  3X0W A;  1N63 A;  1RLF A;  3OQM A;  2BS4 B;  3C19 A;  2RPV A;  3QX1 A;  2XXP A;  2EKI A;  3RUL A;  3L10 B;  2I1K A;  3IAM 1;  4FJZ A;  2M8S A;  4ASW C;  1EFA A;  3VDZ A;  2GOW A;  2MJE A;  3AN1 A;  3K9P B;  3DVN V;  2IZV B;  2KQ4 X;  4USA A;  1IUE A;  2HDE A;  4M8M A;  2PEA A;  2KD0 A;  2GLS A;  4Q2J A;  2BTE A;  1WH3 A;  2MCN B;  1ZPS A;  1JAL A;  3RFZ B;  1J7B A;  3K9O B;  3R66 C;  4NPN A;  4NAW B;  5DPR A;  4IM0 A;  2KN4 A;  2KWU B;  1QLB B;  1RYJ A;  1EO6 A;  4BBN F;  4C56 C;  2Z0D B;  4FA6 A;  3JSV B;  3VH4 B;  1SF0 A;  1LO5 D;  3PO0 A;  3H6N A;  2CU1 A;  2ZPY A;  3IAS 1;  3RNC C;  1UBI A;  1K50 A;  1NEN B;  5DT2 A;  2HTM E;  1V5T A;  3SHQ A;  2WGS A;  4KDL B;  4NAW A;  2INP E;  1WJ4 A;  4FBJ B;  1UUP A;  1H4R A;  1JWS D;  5AZG A;  1WX9 A;  3RZW C;  2HE7 A;  4L2Y A;  2NR2 A;  4OZA A;  3LIS A;  4I6R A;  3E9S A;  3JSV A;  3DBH B;  5DPS A;  3ZKJ C;  4WAA A;  3OKZ A;  3RD2 A;  3Q8C A;  3AEC B;  3UQB A;  4JIO U;  2LUM A;  2BWF A;  4K3B A;  3V6E B;  1QP7 A;  2AEH A;  3SDL C;  2MBB B;  1SGH A;  3DBS A;  4RGM A;  2ZCB A;  2ZNV B;  1V9J A;  1X1M A;  2FCM A;  3KXA A;  2PXF A;  1R69 A;  5KHQ A;  2BB6 A;  1E6E B;  1XO3 A;  3HVD A;  3N1X C;  2FNJ B;  4CO7 A;  1OEY A;  3EFC A;  1MPE A;  4GB9 A;  4TKN A;  3TL5 A;  2WXH A;  3ZO5 B;  2KEK A;  1TY2 A;  2WUS R;  5JHA A;  3NZU A;  5E6P A;  1FFV A;  4X4E A;  5CHF A;  1C77 A;  3VQI A;  4JE3 B;  2WQY B;  1DOI A;  2K5P A;  4JQW C;  5H92 C;  3SFE B;  2JQR B;  3AM9 A;  3BVZ A;  3L13 A;  3NZL A;  2IJ0 A;  4O1N A;  2L00 B;  3A9J B;  5G5H A;  4DHZ E;  1UF0 A;  1GB1 A;  3F52 A;  2AL6 A;  1ZW7 A;  1R7S A;  2WXG A;  4HK2 A;  2LYS A;  3CEC A;  1FMA D;  3PLU A;  1CJG A;  2MBQ A;  1JWA D;  2C5L C;  2W3S A;  4US9 A;  3OWQ A;  2LWP A;  3ZKC A;  2KPJ A;  3DCG A;  2N9E B;  2CU3 A;  2NTS A;  2ZVN A;  1I42 A;  2DEN B;  2CSF A;  2K0P A;  3H7S A;  1QOF A;  3IT4 B;  2WHI A;  1JW9 D;  5FR6 A;  5G5G A;  4ZDV A;  1HZ5 A;  4B6W A;  4J6I A;  2N7E A;  3CMM B;  1C1Y B;  1TKG A;  3A9J A;  4HRS A;  4JGH B;  2MLB A;  4F8D A;  2L05 A;  2UWQ A;  2W55 A;  2KQS A;  3WCQ A;  2KO3 A;  4WJQ A;  1C4A A;  5IN7 A;  1QF6 A;  1D4B A;  1KTK A;  2CS4 A;  3VR8 B;  1IC8 A;  1Z2M A;  3AEF B;  3L08 A;  4ANU A;  3MLF A;  2PXV A;  2E6X A;  4RM9 A;  1B0N A;  2CKH B;  3MHZ A;  2ODR D;  3DWG C;  5BYS A;  1XLN A;  2CJN A;  2KJ6 A;  3QAQ A;  1PGX A;  4LNF A;  2C9W B;  1MHH E;  3ZVV A;  1AYF A;  2NS5 A;  4OB4 A;  1R4N I;  2MBE A;  3A33 B;  3ONS A;  3BK2 A;  1FO4 A;  3A9K B;  2KKC A;  2M56 B;  4ZRP A;  2N7D A;  4EKI A;  2N1W A;  2J42 A;  3WIM A;  3HK0 A;  2QEJ C;  1L0V B;  1V81 A;  1WMH B;  1GG3 A;  2IBI B;  3V05 A;  2KQ7 A;  4MM3 B;  4I6U A;  2PUC A;  3EA6 A;  1TKY A;  1GUA B;  2PUA A;  3KL4 A;  1Q5W B;  1DOX A;  2GI9 A;  3GZN I;  2O2V B;  3L1P A;  2QIL A;  4RNA A;  4C4V B;  2L0T A;  2KC1 A;  2LXC A;  2REX A;  4ANV A;  1E0Z A;  1FRR A;  1AW7 A;  3I5J C;  5FKA C;  2PIA A;  4WQO B;  2GBN A;  3PZ8 A;  4II3 B;  3VH3 B;  4TMA B;  2GBM A;  1ZVV A;  4KGR A;  3VUW A;  5HKH A;  2LRW A;  2LFI A;  1JRO A;  3A9K A;  3IVP A;  2OED A;  3AE4 B;  3R2T A;  2G45 B;  1PYW D;  1L6U A;  2MQK A;  1WMH A;  2WDT B;  3AE7 B;  1T6B X;  4MM3 A;  1N5X A;  2JPH A;  4PU4 C;  4G50 A;  2AXZ A;  2O2V A;  4X4I A;  4C4V A;  1VDV A;  4KIK B;  2GRL A;  2JVC A;  2M0A A;  4MCT A;  2V4I B;  4EQZ A;  3B9J A;  4LDT B;  1EM7 A;  3SEB A;  4ZRQ A;  3Q3J A;  2KAC A;  2JWZ A;  3Q3M C;  3ZQ4 A;  4FBI A;  3X23 A;  4IOI E;  1F2R C;  3GZD C;  1ACC A;  3VWS A;  2J52 A;  4PS3 A;  2KDB A;  2PVO D;  1WI0 A;  2IO0 B;  2BVC A;  2BJC A;  3MC8 A;  1JCK B;  3BY4 B;  4AP4 C;  3QIJ A;  5L95 C;  1G6J A;  5BYQ A;  2IV1 A;  1RRB A;  4P1B C;  1TS3 A;  4MEM A;  2PXD A;  4S17 A;  1VRA B;  2PTL A;  2V9H A;  1P9D U;  5E6O A;  3EFU A;  4TQ1 A;  5C2T B;  2XXQ A;  3U8Z A;  3A4R A;  1STE A;  3URY A;  4IWR A;  4BVU C;  1YJJ A;  3PHW B;  1N6Z A;  2L52 A;  3ML8 A;  1GJZ A;  2G4D B;  1X2L A;  3CSF A;  4J1X A;  3G0T A;  1UH6 A;  4WJO A;  5K98 B;  3DQV A;  1AU7 A;  3BS3 A;  2WX1 A;  3WAM A;  2M0X A;  1E7P B;  1QQR A;  2N9P C;  2IO3 B;  2IGD A;  2JY6 A;  2BS2 B;  2WLB A;  2GRM A;  1L0Y B;  1CJE A;  2EBY A;  3OWE B;  1E10 A;  2DZM A;  4BKS A;  3VVW B;  1YNT E;  1K51 A;  3AE3 B;  1WH6 A;  2KAN A;  1SIF A;  1V80 A;  1WR1 A;  4KV2 A;  3QQ8 B;  3AEE B;  2N9L A;  3B2G A;  2DZK A;  4X4F A;  2J0K A;  3DBR B;  1DOY A;  4WUR A;  3IXS A;  2V1Y A;  1C3T A;  3AU5 A;  2MEK A;  1WXV A;  3SR6 A;  5D94 A;  3AE8 B;  1P1A A;  4Z58 A;  3P4S B;  1UWM A;  5E6N A;  3NVW A;  2ON8 A;  3PGE A;  3FMY A;  1A70 A;  1L0X B;  1C76 A;  2JYE A;  2L8N A;  3R7Q A;  1R4M I;  4LJO B;  2JX5 A;  2MP2 A;  4HRO A;  3ZRF A;  2BW2 A;  3CLC A;  2FAZ A;  2J4X A;  1ZUD 2;  1GNU A;  4X4B A;  4LNO A;  1SIJ A;  1VZ8 A;  2O49 A;  1QPZ A;  3LB8 C;  4PK1 A;  4WAF A;  3GB1 A;  3KH0 A;  2PXE A;  3IFW B;  3RT3 B;  5JXV A;  1E7V A;  3CIR B;  2ZNV C;  2WXK A;  2XXA A;  3V60 A;  4E74 A;  1PRV A;  4EZI A;  4BBN C;  1NDD A;  2LYK A;  2DLB A;  2QIE B;  2JWU A;  3ZXR A;  3ZYY X;  4MAC A;  4BKS D;  2YEP F;  4W9C A;  3ZNG C;  2BKF A;  2KHW B;  3LQX A;  2K6D B;  1UXD A;  4AS1 A;  4YSY B;  2NCN A;  2K8C A;  3ZJT A;  1WE7 A;  3BD1 A;  2ICI A;  2R2O A;  4M8N A;  1KJT A;  1P3Q U;  2AQ1 B;  1XWR A;  2WWZ A;  2XI8 A;  4L23 A;  2HSG A;  3P4R B;  1CZP A;  3HZI B;  1FXI A;  2GRI A;  4X4G A;  2ZZP B;  3HRD D;  2M19 A;  4YBA A;  5CX3 A;  4OZB A;  4JPS A;  3L54 A;  2MEZ A;  3AE9 B;  1IP9 A;  1V1O A;  4RM8 A;  5FK9 C;  3S2A A;  3W1S A;  1D5M C;  1LCC A;  1EWC A;  1S7E A;  3ML9 A;  4KKJ A;  1TJE A;  1R63 A;  2DNF A;  4GQM A;  1D5X C;  2A4Z A;  4WJN A;  1QQB A;  1OQY A;  2MJ3 A;  3GOE A;  5TSS A;  1KLU D;  4DQO C;  1NEQ A;  3CST A;  2K3U A;  4KKI A;  3AB5 A;  1JWL A;  3ZUN A;  1J7A A;  2WIU B;  1FNV A;  3H9D A;  2PLP A;  1ESF A;  3EUB 2;  1OCT C;  1TYG B;  2HJ1 A;  3JW0 X;  2PXQ A;  1LQB A;  4P7I A;  4M02 A;  2M4H A;  4NJC A;  4WH4 A;  5EE0 A;  2J0M A;  2K9X A;  1UTX A;  1HA5 A;  4W9G A;  3EEC A;  3R7R A;  4K1R B;  3PVL A;  2GBR A;  2KXJ A;  1QT9 A;  2OFY A;  4RGT A;  3RCZ A;  3N20 C;  2BYE A;  4C00 A;  3C0R B;  3DHG C;  2LGI A;  2WXO A;  3BYT B;  4B0E A;  5C1Z A;  2QSD A;  3ME5 A;  2WXM A;  2ZPN A;  4NJ6 A;  3SCF A;  3HUI A;  1QP4 A;  1VZ6 A;  4IM2 A;  3NRO A;  2WX0 A;  1OTR B;  1CQT A;  1OEY J;  2Y3A A;  2H8R A;  4IG7 B;  3ZNH B;  3KJX A;  4JX1 C;  2JXT A;  4WWO A;  2PIJ A;  2VZK B;  2KWD A;  3ZDT A;  2KZR A;  1NI2 A;  2AQ2 B;  2JRI B;  1UGJ A;  2ZVO A;  1WF9 A;  4HPL B;  3O13 A;  2O6V B;  2E3T A;  3VAW A;  2JZP A;  3Q3O C;  3J9C A;  1VR9 A;  3KWV A;  1ZZC A;  2WXL A;  1XD3 B;  1QB2 A;  4GDK B;  2RR9 A;  1QIL A;  4KVG B;  3WAN A;  4NQL B;  2O4A A;  1WGY A;  3T9L A;  1EU4 A;  2HFZ A;  1ZPQ A;  2WP9 B;  1XLP A;  4HDQ A;  1V2Y A;  2PUB A;  1OGW A;  2FCS A;  3H7P A;  2BB5 A;  4XGA B;  4KZ0 A;  2LD9 A;  1P7F A;  2O6V A;  4HCN B;  4OVV A;  5AUK A;  1DWK A;  3NDB B;  3FIL B;  1QOG A;  5DCN A;  1EUV B;  5E6J A;  1GC7 A;  4GDK A;  2IYD B;  1WIA A;  2HIN A;  4EKU A;  2KDI A;  1LCD A;  4DXA B; 
#chains in the Genus database with same CATH homology
 1MHH E;  5D3I B;  3M9L A;  1IGC A;  1FFU A;  3QOW A;  3ZPX A;  1AYF A;  4ER0 A;  2G1E A;  3SX0 A;  1D5Z C;  2PW9 A;  3U2S C;  4A6Q A;  4EKG A;  4A55 A;  5AUI A;  4RFB A;  3BK2 A;  5BYR A;  1RFK A;  1FO4 A;  4XWW A;  4CQN A;  2M56 B;  2X38 A;  2YEP B;  4ZRP A;  1PGA A;  4EKI A;  1WRI A;  1YMH E;  2J42 A;  4DXG A;  1Q10 A;  3W2D A;  1L4Z B;  1SXT A;  2QEJ C;  1HXY D;  1JWU D;  1SSN A;  1L0V B;  1BML C;  3V05 A;  3FIL A;  4MM3 B;  3EA6 A;  1TKY A;  1B9R A;  4OW0 A;  1DOX A;  1F77 A;  2TSS A;  2XNA C;  2BBC A;  2DWQ A;  2GI9 A;  3AED B;  2LHE A;  1ZDX A;  3U4E G;  1WWT A;  2QIL A;  3B2F A;  4RNA A;  5D7G A;  4DE8 A;  2IPK D;  4UDU C;  3AE2 B;  3BWU D;  1FRR A;  1AW7 A;  2JSV X;  1E0Z A;  4N6E B;  2N0S B;  5FKA C;  2PIA A;  3MC0 B;  3PZ8 A;  3Q8F A;  1OFF A;  4XDD A;  1AWD A;  4TMA B;  4KGR A;  2VZK D;  4HJG E;  2DYM A;  1XLO A;  1MVK A;  2LFI A;  3TEZ A;  1JRO A;  1WGK A;  5EE1 A;  3H8H A;  2J7U A;  2OED A;  5DRT A;  3AE4 B;  3R2T A;  1QOA A;  1N60 A;  4ARC A;  4ARI A;  4RF1 A;  5LNK 1;  1PYW D;  3T3O A;  1L6U A;  2J7W A;  1ZOY B;  2KAJ A;  5HI1 A;  1FXA A;  3AE7 B;  1K52 A;  1T6B X;  1N5X A;  3L4P A;  4ZHO A;  4LTU A;  1YQ4 B;  1Y56 A;  2BT6 A;  3CWI A;  1WSP A;  1C4P A;  1WXQ A;  1F2R I;  2IDY A;  4YSZ B;  1VDV A;  4LK0 M;  2ACZ B;  4N59 A;  2FBW B;  4P16 A;  2M0A A;  3VR9 B;  2LEK A;  2ZW0 A;  2V4I B;  2W82 A;  4EQZ A;  3B9J A;  1EM7 A;  3SEB A;  3ZJV A;  4GLS C;  2HCS A;  1YJI A;  2FUG 1;  4ZRQ A;  3U52 E;  1YN3 A;  2KAC A;  1I7H A;  4YT0 B;  4A8X C;  4WWM A;  3NVV A;  2B76 B;  2PMV A;  2ZW1 A;  1XXG A;  3ZQ4 A;  4IOI E;  1QOB A;  1NYR A;  2H89 B;  1F2R C;  1OQR A;  2L1A A;  4KGT A;  2IGH A;  4H2A A;  3I9V 1;  3GZD C;  1XCQ L;  3GZD A;  1ACC A;  3VWS A;  2WXF A;  2J52 A;  2IGG A;  1VLB A;  2LLV A;  2PVO D;  1ET9 A;  1MI0 A;  4MT5 A;  2BYT A;  4YXD B;  2L83 A;  3Q8B A;  1I4G A;  5HFY A;  1JCK B;  4TSS A;  2NTT A;  2V0G A;  3TEL A;  2WU2 B;  2EEL A;  5BYQ A;  1CQV A;  2I38 A;  1PUT A;  4ITK A;  3P63 A;  3TEW A;  4PT5 A;  1TS3 A;  2PKO A;  2WU5 B;  2LMC A;  3BVG A;  1VRA B;  1ZDV A;  2PTL A;  5GXG B;  3Q8A A;  1T5X D;  4TQ1 A;  5C2T B;  4EE2 A;  2XXQ A;  1HZ6 A;  4ER6 A;  2WXJ A;  1ZXH A;  4IKG A;  3W5U B;  4NZL B;  5HHD G;  5I4D A;  2JYT A;  1STE A;  1I4R A;  4P6V F;  2G9H D;  3URY A;  3R8B A;  2OHF A;  2W54 A;  1DGJ A;  1YJJ A;  2R61 A;  5H8Y E;  1E9M A;  3GP7 A;  1C78 A;  4YTM B;  3P42 A;  3A9Z A;  2L1P A;  1JML A;  1ROE A;  2L52 A;  3RPF C;  1KH0 A;  1GB4 A;  3T3N A;  2DBY A;  1FD6 A;  2BS3 B;  2AX5 A;  3AEG B;  5BMH A;  3AE5 B;  3IT6 B;  4MH8 A;  2N9K A;  4GDL B;  3G0T A;  1K53 A;  1TS2 A;  3ETR A;  4J3O D;  4EK9 A;  1JRP A;  2Q5W D;  4C7Y A;  1DYQ A;  1E7P B;  1QQR A;  1RM6 C;  3FAH A;  2Y5C A;  2IGD A;  2BS2 B;  2WLB A;  3TEY A;  1L0Y B;  1CJE A;  3OWE B;  4RF0 A;  3W9C B;  1E10 A;  4ZOH C;  2LLW A;  1XLQ A;  1K51 A;  1YNT E;  2WDR B;  3AE3 B;  4US8 A;  1YN4 A;  1N61 A;  2LNM A;  1XF5 L;  1ENF A;  3TEP A;  2YBD A;  1TS5 A;  1FNW A;  2L32 A;  2QJL A;  4D2K A;  3U7Z A;  3A9Y A;  1I4X A;  1KRH A;  3AEE B;  2MH7 A;  3R09 A;  2NMQ A;  1RWS A;  2N9L A;  2WXR A;  3AV8 A;  4L1B A;  3NZ3 A;  3UI3 A;  3B2G A;  3N9Y C;  1FNU A;  2XN9 C;  2KDM A;  1V1P B;  1DOY A;  4WUR A;  1SB3 C;  3IXS A;  3Q8E A;  1L5P A;  4JWS C;  3GUU A;  3E56 A;  1L4D B;  4RH6 A;  4A9A A;  3HVZ A;  2W3R A;  2MEK A;  1TS4 A;  2QMT A;  3SR6 A;  2H88 B;  2LHD A;  4YTN B;  1FCC C;  3AE8 B;  1GOZ A;  3I57 A;  3P4S B;  3MP9 A;  1UWM A;  3NVW A;  2ON8 A;  2RMM A;  1A70 A;  1L0X B;  2Y5P A;  3QFI A;  1C76 A;  3AE6 B;  2JYE A;  1ZE3 D;  3NRZ A;  3AEB B;  4C80 A;  2JX5 A;  3AH7 A;  4HRO A;  3VRB B;  2BW2 A;  1NYQ A;  2WNM A;  4YWG G;  1P7E A;  3NUH B;  2AQ3 B;  1SJH D;  1ZUD 2;  2J4X A;  4AQ7 A;  2RDG A;  1SIJ A;  1VZ8 A;  4YSX B;  3GZC A;  4ER5 A;  4KGS A;  5JUW A;  2MJD A;  1KF6 B;  1FRD A;  2D5G A;  4RGO S;  3LB8 C;  4JWU C;  4WAF A;  5MPO A;  3GB1 A;  1V1P A;  2DYO A;  3NXH A;  1J7C A;  5JXV A;  4DXF A;  1IGD A;  3CIR B;  1N63 A;  1FM0 D;  1V97 A;  2SAK A;  2WXK A;  3TEX A;  2K22 A;  2BS4 B;  4EZI A;  2RPV A;  2XXP A;  1TKE A;  1U2Z A;  2EKI A;  3P1M A;  3IAM 1;  2V3N A;  3V3X A;  1I4Q A;  4REZ A;  1ZXI A;  2DLB A;  2QIE B;  5DRY A;  2MJE A;  3AN1 A;  2JWU A;  4OZC A;  3ZYY X;  4MAC A;  2KQ4 X;  2FE8 A;  2YEP F;  4NAM A;  1IUE A;  2HDE A;  4USA A;  4AS1 A;  1B1Z A;  4YSY B;  4Q2J A;  1JWM D;  2BTE A;  3ZJT A;  3BVM A;  1ZPS A;  1JAL A;  3RFZ B;  3BII D;  1J7B A;  2ICI A;  2V3P A;  2HCN A;  2AQ1 B;  4L23 A;  4NAW B;  4B0M A;  1PDX A;  3BK1 A;  1SE2 A;  1CK1 A;  1CZP A;  1QLB B;  1VZ7 A;  1N62 A;  2INN E;  2KN4 A;  3P4R B;  1FXI A;  1AN8 A;  1RYJ A;  1PGB A;  2GRI A;  4C56 C;  3HRD D;  2M19 A;  1I4P A;  1SE4 A;  1QKZ A;  4OZB A;  4HKZ E;  1F0Z A;  3DWM A;  4JPS A;  1SJE D;  1SF0 A;  3AE9 B;  1YQ3 B;  1V1O A;  1LO5 D;  5BMG A;  2I2Y A;  5D3D A;  5FK9 C;  1I4H A;  3PO0 A;  3W1S A;  1D5M C;  1EWC A;  4KKJ A;  5HG2 A;  3IAS 1;  1JQ4 A;  4N58 A;  1TJE A;  2Z8L A;  2MXD A;  1V8C A;  1K50 A;  1D5X C;  1NEN B;  5DT2 A;  2HTM E;  1XCT L;  2MJ3 A;  1BXT A;  4M0W A;  1FIQ A;  3TUO A;  3NVY A;  3GS2 A;  5TSS A;  2INP E;  2N7J A;  3W5V B;  1KLU D;  1UUP A;  2PVG C;  4DQO C;  5DSX A;  1JWS D;  2K3U A;  1BUI C;  4KKI A;  3AB5 A;  4L2Y A;  4OZA A;  4HRA A;  1J7A A;  3E9S A;  5EE3 A;  1FNV A;  2PLP A;  1ZP0 B;  3OKZ A;  4XE0 A;  1ESF A;  3EUB 2;  2ONQ A;  1TYG B;  1XEE A;  3Q8C A;  1IBX B;  2WXN A;  3AEC B;  1NVI D;  2LUM A;  2GB1 A;  2M4H A;  4NJC A;  2WXQ A;  4YTP B;  4WVL A;  4WH4 A;  3ZJU A;  5EE0 A;  4RGM A;  5T8I A;  2K9X A;  1HA5 A;  3KWL A;  2WDV B;  1D6E C;  1VJK A;  1QT9 A;  2BB6 A;  4R3D A;  4RGT A;  1E6E B;  1C4C A;  1XO3 A;  3HVD A;  3MEJ A;  1MPE A;  3AE1 B;  4LLG M;  2WXH A;  2J53 A;  2LGI A;  2JU6 X;  3P4P B;  1TY2 A;  3EGR A;  1SEB D;  3SFD B;  1EU3 A;  1NW3 A;  1FFV A;  2WXO A;  3BYT B;  4TQ0 A;  5DTQ A;  3KLS X;  3NVZ A;  4B0E A;  1C77 A;  3VQI A;  4JE3 B;  4RGN A;  2VEO A;  2QSD A;  1GPX A;  1IBX A;  2WQY B;  1EWY C;  3ME5 A;  2WXM A;  1KLG D;  1DOI A;  2K5P A;  2LJI A;  5H92 C;  3SFE B;  3TSS A;  3LXF A;  1OQQ A;  3HUI A;  2JQR B;  1VZ6 A;  3NRO A;  1N5W A;  2WXP A;  3BVZ A;  3AM9 A;  3NZL A;  5DTM A;  1TZO A;  3FC4 A;  1JWB D;  2IJ0 A;  4KX6 B;  4O1N A;  2Y3A A;  4RCO A;  5G5H A;  4WQM A;  3TFL A;  4JX1 C;  2JXT A;  1GB1 A;  2VZK B;  1NEK B;  1R7S A;  2KWD A;  2WXG A;  3ABV B;  3BYY B;  2WXI A;  5EE9 A;  1FMA D;  4ZYS A;  3P4Q B;  4WIP A;  3PE5 A;  4OHJ A;  1JWA D;  1HEZ E;  2W3S A;  2AQ2 B;  4US9 A;  1C9F A;  3OWQ A;  1UGJ A;  1PFD A;  4FXC A;  1UWX A;  2CU3 A;  2NTS A;  3O13 A;  2E3T A;  5DTR A;  3KQ4 A;  4HEA 1;  2K0P A;  3MFG A;  1WYG A;  2JZP A;  3MJ5 A;  1L6V A;  1VR9 A;  3J9C A;  2WS3 B;  3VRA B;  1QOF A;  1SE3 A;  2KMM A;  3IT4 B;  3C8Y A;  3KWV A;  1JW9 D;  2WXL A;  4HKQ A;  5G5G A;  4GDK B;  1HZ5 A;  1FEH A;  1HQR D;  3NS1 A;  4IDI A;  3R2I A;  1QIL A;  1MHX A;  3SR4 A;  3UWP A;  1GAQ B;  1C79 A;  1NI3 A;  1UNS A;  5FR3 A;  1TKG A;  1EU4 A;  2HFZ A;  4HRS A;  4ER7 A;  1ET6 A;  4ZHP A;  2WP9 B;  1XLP A;  3AEA B;  2SEB D;  1FCL A;  2W55 A;  4ER3 A;  3WCQ A;  2BB5 A;  1M4V A;  1C4A A;  1QF6 A;  1D4B A;  3QOX A;  3PZ7 A;  1KTK A;  1SBB B;  3VR8 B;  5BMI A;  1T3Q A;  2RDH A;  1P7F A;  3AEF B;  3Q69 A;  1KFY B;  5AUK A;  2E6X A;  3MHZ A;  2ODR D;  3LYY A;  2CJO A;  3AMZ A;  3A9X A;  1QOG A;  3FIL B;  4A90 A;  5E6J A;  3ZGZ A;  3DWG C;  5BYS A;  1XLN A;  4OBM A;  2CJN A;  3BZD B;  5C3J B;  2WDQ B;  4OVZ A;  4DE9 A;  1PGX A;  4C7Z A;  1TY0 A;  1YN5 A;  4XDC A;  4XWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...