4Q2JA

A novel structure-based mechanism for dna-binding of satb1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
169
Chain Sequence
GPGSGTMLPVFCVVEHKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein SATB1
publication title Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 38
structure length 169
sequence length 178
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16534 ULD Ubiquitin-like oligomerisation domain of SATB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4q2jA02
3.10.20.710 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4q2jA01
4Q2JA 3TUOA 3NZLA 2L1PA
chains in the Genus database with same CATH superfamily
3BD1A 2JZ3B 4PK1A 1XD3B 3WIMA 2MQJA 3ZPXA 2PXEA 1TY2A 3TELA 1L0VB 3VVWB 1CQTA 2WXRA 5CHVC 3IFWB 4PT5A 4II3B 5H8YE 2Y5CA 2KJRA 2WXMA 2QC8A 1IYFA 4LNKA 5JH5C 2JRHA 2IGGA 2KFJA 4KDIC 3DHHC 1WJ4A 2LRWA 3ZW3A 2RDHA 5IN7A 2NVUI 4IM2A 4WJOA 2XJ3A 3H6NA 4AQ7A 3SX0A 3KVFB 1CMXB 3BZDB 5BMHA 2LGYA 3NHEB 4X4EA 1WM2A 1ZZ6A 2FCNA 2OFYA 4HJKA 2K1FA 4ZYNA 2J53A 1PQSA 4RNAA 1E9MA 3GOEA 1V9JA 3HM6X 2KEJA 3SCGA 1S1QB 3QHTA 4W9EA 3L13A 2B5AA 3U3WA 3VK0A 1EFAA 4W9DA 1YN5A 4DDID 2CJNA 2QILA 1B0NA 2EMTA 3ZTCA 4ZRJA 1T3QA 1RZRD 2GBNA 2E3TA 3Q6BA 2LJIA 3CLCA 2A4ZA 2FBWB 1V2YA 3N20C 4I6NB 3BDNA 4WWPA 1AWDA 4REZA 1V1PA 4OZCA 3SDLC 2INDC 1QP7A 4GDKA 3FC4A 2EKEC 5AZHA 3SD5A 1E0ZA 1WMHB 2GMIC 3AE5B 1RYJA 5JUWA 1Y8RC 4I8TA 2KACA 3ZUNA 2IO1B 3VFKA 4W9HA 5LLIA 2YBDA 4M0WA 1ISNA 4YSYB 1XCQL 2H8RA 2K39A 4X4CA 1I42A 3GP7A 3NS8A 4KKIA 2I38A 4B95A 2M0XA 2MP2A 1ZAYA 1WXQA 3NUHB 1CJEA 4MM3A 4XYCA 1BDIA 1C76A 3PREA 3SFEB 4WQMA 5T8IA 4KGSA 1MFQC 3WALA 3GN5B 3I57A 1HF0A 1E5WA 2LLVA 1TS3A 2OJRA 5L95C 4E71A 3P4SB 4CQNA 1TZ1A 3NZUA 1C4AA 4WWNA 1TS5A 4PU8A 4CYEA 3BIID 1X57A 1XWRA 2NTTA 2LYQA 1PRVA 4ZYSA 1ROEA 1DW9A 1JMLA 1TKGA 2LGIA 2WDRB 2FCSA 3M9LA 1TZOA 2FUHB 1Y7YA 1FPYA 2JT4B 4F7ZA 2FAZA 2XXAA 3AEBB 2KQSA 2HCNA 4XWTA 1UBIA 1ZUGA 2AEHA 4PU7A 1SIJA 2K8CA 3V6CB 3ECIA 1BDHA 3RZWC 3VUXA 5EDSA 5FR3A 3KJXA 3RZFA 2J0JA 1XF5L 4ER6A 2IJ0A 3HUIA 3RNCC 2PVOD 3MTNB 1GB4A 1UXCA 3AEGB 5CHFA 4OVVA 2GZUA 3ZHIA 3QWGA 2PXTA 3B9JA 5E6PA 2M56B 4E74A 2OHFA 1JRUA 4YSZB 3X23A 3HIZA 2BYFA 1JH9A 3ZRCA 3IXSA 2KJHB 1V8CA 1YN3A 2LXAA 3AE3B 1C79A 3NZ3A 4C4VB 3L10B 2LVPA 2WXHA 1EF5A 4GB9A 3R3MA 2JPHA 3A33B 2JVCA 2BGFA 2CU1A 2N9LA 5HHDG 2K9XA 1GUAB 2L0FA 1UWXA 2KXJA 2PVGC 1QPZA 2JQRB 5BO4B 5GAGi 1SQ8A 2YLMA 4RH6A 3H7PA 2Z0DB 2MH7A 2PUAA 1ENFA 1LXDA 3BVGA 3RN9C 1C3TA 4JWSC 2K22A 1QT9A 2DYBA 1R63A 2KTRB 1WYWB 4MGKE 1VR9A 4FLHA 1CZPA 3N1XC 1XT9B 4OB4A 5DCNA 1ZZ9A 2BNOA 4HCNB 3LB8C 4ARIA 4FBJB 1FFVA 1GG3A 4US9A 5LXIB 1CJGA 4MSQB 5EE0A 3C8YA 1EWYC 3T9LA 1GJZA 3PE5A 2BKRB 2D3AA 3DQVA 2I2YA 3GBFA 4HXDA 1WZ0A 4BFRA 4EEWA 2DZKA 2IU7A 3AE8B 4HDOA 2N9PC 3IAS1 2MW5A 2TSSA 1R7SA 1YSEA 1ZS4A 4HPPA 1QQAA 1WJNA 3GUUA 2MJDA 4FJZA 3W1YA 3CECA 1NYRA 1P7FA 2WX0A 1V49A 2QSDA 2LUEA 4MT5A 3H7SA 2N9EB 1YX5B 1L6UA 3NVYA 2LGDA 4ER5A 2PXFA 2RR9A 4WWOA 2XN9C 2K25A 4FXCA 1LLIA 4P1CC 2ZNVB 3L16A 2JXTA 4IC7B 2M4NA 4EFOA 3AE4B 1OTRB 3UQAA 4BKSD 2C60A 4URKA 4GLSC 2VEOA 3OAWA 3X0WA 3IG3A 3PO0A 2IY1B 5L83A 1WE6A 2PEAA 1F77A 2XEWA 1GB1A 2QEJC 1KLGD 2N7EA 1UWMA 1PGBA 1TS2A 5D3IB 4MSMB 4B6WA 4M01A 3AN1A 3OG5A 1JWBD 2Y3AA 3GB1A 3CMMB 5H92C 3H5TA 4GMVA 4KV2A 4IG7B 4IVZA 2IVGA 4I6UA 3JXDL 3AEDB 2DHZA 3TBLD 1QQRA 1XQQA 2W55A 2BQQA 3WA0A 3SR4A 2KC1A 1RZRA 3APFA 3C19A 1FXTB 2QCZA 3I63C 4A9AA 2LXCA 2D3CA 1MHHE 1PYWD 3P4PB 4BOSC 1WE7A 2XI8A 1ZDVA 3ZHMA 3AU5A 3W5VB 3Q3JA 1F2RC 3N3KB 4J6IA 3L17A 3ZJVA 2HD5B 2KQ4X 1KLVA 3PZDA 1VDVA 2O2VA 4YTNB 3AB5A 1N62A 2ICTA 3V3XA 3NS1A 3ZGZA 1SE9A 3NROA 3H1UA 2IBIB 3KH0A 5D3DA 1LCCA 4N6EB 5DRYA 4BOZB 4TSSA 4LDTD 4IA8A 4HJGE 2DX5B 1KFYB 1P1AA 4RFBA 4EE2A 4ER7A 4P7IA 2Z8LA 3VUYA 2KWDA 1GPXA 2N4FA 4GN1A 3PHXB 4XZ4A 2LYPA 1HEZE 1TJEA 1J7AA 2XXPA 2AQ1B 4HROA 3GE3C 1E7PB 2LGXA 4WQOB 3DM5A 1T0YA 4BKTA 2FFHA 1IBXA 1YMHE 2KWUB 1F2RI 1YOVB 4YG7B 4NDWA 1UD7A 1JFSA 3PRMB 3RNBC 5GAHi 1GC6A 3ZNID 5EE9A 2WWZA 2W9NA 1TKYA 3H9DA 5HFYA 5JHAA 2LVQA 5GMVA 1A5RA 1I4XA 2L52A 4K1RB 4IWPA 1RWSA 3PXPA 1IGDA 5EE1A 3V61A 2OEDA 4ER3A 1DOXA 1KTKA 5EE3A 2G4DB 3SEBA 5DPWA 3A9KA 1XLOA 3QIJA 2MLBA 2MJEA 3ETRA 2XK5A 1JWSD 4MJSA 5K98B 1NBFC 4N58A 1J7BA 2PPHA 1NI3A 1QILA 3ONSA 4G3XB 3RNGC 3VXWA 1HZ5A 3W1SA 2ASQA 3LXFA 4GHJA 3DPDA 1XXGA 4IM0A 3CF6E 4ANVA 1T0RC 5D7GA 5JZEB 3RI7C 3D32A 4KIKB 3GZDC 4DE9A 1I4RA 3RUIB 5JXVA 2LGSA 1PDXA 4IKGA 2KT7A 2WX1A 2RD0A 4K7SA 3RULA 5IKCM 1AN8A 5KHOA 3ABVB 1AARA 2CKHB 4M00A 4JCXA 2KFKA 5IOIA 5BMIA 4LK0M 1QZEA 3AXCA 2INCC 2M19A 3ZDTA 2WNMA 2MJ3A 3H8HA 3PT2B 2LYRA 1JFTA 4OBMA 3AULA 2KWCA 5CHWA 4X57B 3OMTA 1STEA 2LLWA 1VLBA 1SBBB 3APDA 2AL3A 4X4FA 3G0TA 3R66C 3GS2A 4GSWA 1Y56A 1UELA 3UIPB 2ZPYA 3IT6B 1A70A 2FCQA 1YJ1A 2CSFA 2J4XA 2ICIA 4MELA 3SR6A 1V81A 2KN5A 4J3OD 3ZQ4A 3U8ZA 1HQ1A 3NZLA 2O4AA 2MWSB 1LGRA 2WS3B 2KD0A 3N1YC 1OQYA 2KDBA 3JXCL 3AH7A 4BZAA 1QOBA 1WM3A 2K8HA 2VH2A 1NEQA 3EUSA 2KLGA 1E8XA 3AMZA 4GOCA 1K51A 1IUEA 2IVBA 3V6EB 4R3DA 4M8NA 4NPNA 2VZKD 1OSLA 3MC9A 2WXOA 4NY0A 2JRIB 2L1PA 2LYSA 4WJQA 1SE4A 3PZ7A 4BAXA 2ACZB 2D2QA 4LNIA 1PGAA 4MGIE 2NBVB 4USAA 5C23A 4ANXA 3MC8A 4A6QA 2KDMA 4QAYA 4YARA 1J7CA 5MPOA 1QF6A 2BS4B 1Q5WB 5GXGB 2K8BA 4W9LA 3U2SC 3FILB 3B7HA 1LCDA 3Q3MC 4K7UA 4BKSA 3ZKCA 2WP9B 2PXUA 2KHWB 2DLBA 2J0MA 2IDYA 3MJWA 4TUUA 4GU2A 2CJOA 2JXXA 3RNAC 3OLMD 4YSXB 1WGRA 3N1ZC 2IO2B 1F52A 3P63A 2WGSA 4G0NB 5IA7A 3EA6A 2MEZA 4A20A 1WMHA 2V1YA 2V9HA 1Z2MA 1RM6C 3A4SC 3TFLA 2PPXA 1N60A 4ICVA 2AUWA 2N9XA 2KQ7A 4RM8A 2ZW0A 3P1MA 4NAWB 1XEEA 1LO5D 4K3CA 2KO3A 4AJWA 2FIFA 4DDGD 3OQMA 3DBHB 5C2TB 2ZNVC 2NS5A 3SU8X 5G55A 1IPGA 1FNWA 4FADA 1B9RA 1ZZBA 3CWIA 4ZHPA 4JIOU 3BVZA 4DQOC 1P0RA 2WXJA 3R7RA 3O13A 3RCZA 1D6EC 3QYXA 2Y5PA 2KVRA 5BMGA 4HKQA 1WX7A 1K50A 3VRAB 1WRIA 2A5UA 2CHXA 3RNFC 4PS7A 3A9JA 1E8WA 3O9XA 4YL8A 3Q2AC 1WX8A 1FO4A 2AX5A 4LNNA 2HFZA 4NQKE 1UUPA 4HEA1 1HE8A 2BNNA 2WDQB 4S0RA 2L00B 1XLQA 5LNK1 1H8CA 4M8MA 3TCAA 1WY8A 1K52A 2GRLA 1WGHA 2L05A 1T6BX 1MFWA 2L0TA 4PS8A 2CR5A 3HHMA 3UGBB 4GGQA 1ADRA 2BB6A 2K5PA 1SXTA 2GRIA 3EHVA 1WXAA 1F0ZA 4WWMA 1RLFA 1XLNA 4ZRPA 2HSGA 2GB1A 1F1HA 3QQ8B 1VZ6A 3PHWB 2PE9A 2JVLA 2MRPA 4FHKA 2V0GA 5DTRA 4JPSA 1C1YB 3AE1B 3JXBC 3AE2B 4NJCA 4DHJD 4LNOA 5J18A 2X38A 2LJ5A 4NJ6A 2LRUA 2WXIA 3KUDB 3PV1A 3PS6A 5D2MB 1ZDXA 3GE8C 4YT0B 2M4HA 3DHIC 4DXGA 1MJDA 2HE7A 2XXQA 4MH8A 3PVLA 1YJIA 3Q69A 1WJ6A 3OQNA 1FCCC 1U4AA 2MA9B 1PRAA 4N9F4 1V1PB 5I4DA 1L7YA 2D5GA 2WQYB 2DAFA 4GDKB 3O65B 3T8MA 2JWUA 4FBIA 3ZTDA 1D3ZA 1EF1A 2JYTA 2LD9A 1SE3A 3P42A 3Q8CA 4RGTA 4EZJA 1RPEL 2BT6A 1KH0A 2PE5A 2DYMA 5FK9C 2IV1A 4M0WB 4W9KA 1FNVA 1WGGA 2JYEA 1QKZA 2XIUA 5G2NA 2PUEA 1UF0A 4JQWC 2PIAA 5BYQA 4MEMA 3I9V1 2LZ6A 1PGXA 1ZKHA 2MP2B 3EFUA 2BWES 1DWKA 4ZRQA 2QDFA 1TY0A 2Z0EB 5CX3A 1UZXB 2DZIA 3NY5A 3R2TA 2H88B 4OW0A 4X4GA 3ZRFA 2PUGA 2O38A 3OJ3A 1XCTL 5G5HA 4F1SA 4X4BA 1WWTA 2WIUB 2IO0B 3R8BA 4S17A 2ZCBA 3TSSA 1SE2A 4XDDA 4ITKA 2MXDA 3ZYYX 5C1ZA 2C7HA 2XNAC 5DPRA 3WAOA 4EZIA 2HJ1A 3GZNB 2DBYA 4JLCA 1WXSA 2G1EA 2EBYA 4G50A 2BS2B 4HVBA 1ZPSA 4FN3A 1P7EA 1MHXA 4PS3A 2WU2B 1VPWA 4W9JA 3B08A 4ZOHC 1HTOA 2C9WB 2D3GA 4RGNA 1WIAA 3UIOB 4MACA 2QIEB 2ZPNA 1I4QA 3L4PA 5D6JB 1N61A 3R7QA 3DBSA 3E9SA 1C78A 3A1QA 1PUTA 3VTUA 3QQ6A 2J52A 1SEBD 1DYQA 1WJUA 1L4ZB 2X8XX 3W1SC 1FEHA 4HK2A 3RPFC 4P1BC 4US8A 4XE0A 4CO7A 2N1VA 3W5UB 2KLCA 1QOGA 5A7LA 2WHIA 3TIXA 1N5WA 2BPSA 3JSVA 2RDGA 1LM8B 2V3CC 3RNEC 2WU5B 3B2GA 4IWOA 4OVUA 2WYQA 4EKGA 2WXNA 4ANWA 5AZGA 3AI5A 4TMAB 2BS3B 2IY0B 3L0WB 2BNMA 3DWGC 1SF0A 1ZZ7A 2ON8A 1I7HA 3B1LX 4BVUC 1OGWA 3U7ZA 4RGOS 1E7VA 3PRZA 3V60A 3OWQA 3SCFA 1JWAD 2WXKA 1V97A 1BXTA 5HG2A 3FYAA 2I1KA 4MGZE 4RMAA 2GBKA 3EGRA 5JHBA 4CHKA 1S3SG 2ZVNA 5DPTA 3BK1A 3BYYB 1ZOYB 3PTFC 4TQ1A 1ZE3D 4WAFA 1PRUA 2R63A 1D5MC 3A9ZA 4DE8A 2V4LA 5AZFA 4XGAB 4A3OA 2R1JL 2ZJDA 1DOIA 2KX0A 1K8RB 1WH3A 3NVWA 4KDLB 3BINA 3MFGA 4Z59A 3M95A 3RYTA 4FN2A 1JWLA 4WVLA 3VTVA 3VTWA 3DBRB 2J7WA 1WGDA 1FFUA 1ZZCA 2DAJA 4JE3B 1UH6A 4IM3A 4B0MA 3L54A 2B76B 1FRDA 4X4HA 1QZXA 1JROA 1ET9A 1AU7A 3RFZB 4YTPB 4HRSA 5DRTA 1BMLC 4LTUA 3OQOA 4HKZE 4EZKA 2K6QA 4YTMB 2NBWB 3G5GA 4GIVA 2KKCA 3ZNZB 4BBNF 4C80A 1Q0WB 2BVCA 2N9KA 3AECB 2XSDC 4AOFA 1UTXA 1R4NB 1XLPA 2C5LC 2KEKA 1WH6A 3J9CA 3KWLA 1U2ZA 2LEKA 2AYOB 3DBHI 2BTEA 2XBBC 3LJ3A 4YBAA 2PXBA 3IT4B 1KRHA 4OVZA 1R4MB 1WGYA 2HCSA 1TIFA 4Z5DA 4A3PA 2KVZA 2PXPA 3DNVB 2W54A 2MQKA 2LUMA 2AQ2B 3JYUA 4LCDE 4MCTA 1UNSA 2KOXA 1P3QU 3HRDD 1MI0A 1LQCA 2INPE 2MHJA 3A9XA 3KQ4A 1OQRA 2MEKA 3QK0A 4L1BA 3NXHA 2L83A 2LFIA 2EWTA 2L7RA 2AWIA 3Q3OC 4JL9A 2O2VB 4A90A 2KX3A 2KWVB 2MBBB 1JCKB 1VCBA 4OZAA 2PXDA 3JW0X 3WANA 4G11A 2WXPA 1D4BA 2BB5A 1IC8A 1VD2A 3FKYA 4GDLA 2NPTA 2BYEA 4AP4C 4P16A 3M63B 3VWSA 3QF3A 1WR6E 1NEKB 2BKFA 1L2NA 3SCHA 2N7JA 1MG4A 1WIZA 3BVMA 4DBGA 2KDFB 3UINB 1L0YB 3HVDA 2KK8A 3BYTB 1RAXA 4DXFA 4A8XC 3ML8A 3IHPC 3VUWA 2RGFA 4HLEA 5HI1A 3LYYA 4GXBA 1N63A 4K81A 4NJ7A 2LYJA 1CK1A 3DHGC 2PE6B 1E6EB 1X1MA 2DWQA 2RPQA 3ZJTA 1R69A 1NYQA 1D5XC 2R61A 3VRBB 3A9KB 3ZXRA 3EFCA 2LASA 2XK5B 4MJSB 2O6VB 2DZJA 1P98A 4C7ZA 4FJYA 1GT0C 2V4IB 1WF9A 2REXA 1TS4A 3N9YC 4Z58A 2HTHA 1KOTA 2LHDA 2A6CA 2G9HD 2IGHA 2PUBA 2D11A 1SSNA 3N30A 1SGHA 4HDQA 4YWGG 3CSTA 4LNFA 1JW9D 1T5XD 1K53A 3TUOA 4E3CA 3IVPA 4RM9A 3DVGX 2W3RA 2PW9A 4ANUA 2EMSA 3VH4B 3PPAA 1RIOA 1EO6A 4K7WA 1P9DU 4BKGA 4MDKE 3TJPA 1LFDA 4FA6A 2KFKB 1LMB3 3Q8EA 1SIFA 4C7YA 4XDCA 1KLUD 2CHZA 2W3SA 5CTRC 5TR5A 1WETA 3QX1A 2AWTA 2AXVA 3KUZA 2JUOA 2D5VA 1VRAB 4Z5HA 1UBQA 2ZEQA 1DOYA 4M02A 2J7UA 1V1OA 1H4RA 2KAJA 1PERL 2HJ8A 3HVZA 4WJNA 2MSED 3ZLZA 4L2YA 4AS1A 3QOWA 2HTME 1BT0A 1YJJA 4DHZB 3OKZA 2KMMA 2UWQA 3DBLB 4LJPB 2KZRA 1L0XB 3FAHA 5BYSA 3GZNI 1EM7A 3SHQA 3ZDMC 3TRBA 1E8ZA 1ZZ8A 5IO9A 3AV8A 4MH0E 1EWCA 4ZDVA 2AQ3B 4W9CA 1X2LA 2J42A 4OZBA 1HTQA 1WFYA 2HINA 1WXVA 1YX6B 1N5XA 1TT5B 2M1MA 1V80A 4PYUA 4B0EA 4F8DA 2FUG1 2YVCA 5FKAC 2M0AA 3FMYA 4AUQC 4RGMA 2SEBD 2MBOA 3F52A 3W2DA 2GBJA 2EKIA 3UI3A 3GN5A 3A4RA 1ZXIA 3Q8FA 4KZCA 1OEYA 2PKOA 1KF6B 2LMCA 4NNJB 3PLUA 2FCMA 1YNTE 3U7DA 4JX1C 1PFDA 4HWIB 2MBHA 2PJHA 5AEKB 3QARA 3GZDA 1L4DB 2R2OA 4XX5A 1AW7A 2GBMA 1VJKA 3BY4B 4KSLC 2KC2A 4XWWA 3F6WA 3URYA 1HXYD 3AEAB 4II2B 2NMQA 3I3TB 5DPSA 4KX6B 3R1FA 2E6XA 1MPEA 1MVKA 3NJTA 3IBEA 5J2RA 1FXIA 1OCTC 1FD6A 1V5TA 1C77A 3TEYA 1JQ4A 2BYVE 2GOWA 1SB3C 4W9GA 1RFAA 3TEXA 1QOFA 1LQBA 1IGCA 2UU7A 4XC2A 5AUKA 3MC0B 3PLVA 3UF8A 1KJTA 3NDBB 3RZZA 4BBNC 3FYMA 2WXFA 3JVZX 1IP9A 3IVFA 1HA5A 1NDDA 3AE6B 2WUSR 4NQLB 4RF1A 1VZ8A 2L49A 4C4VA 1FCLA 1WH8A 4TQ0A 5DTMA 1J0GA 3NOBA 2KMCA 2L8JA 2IVQA 1F9JA 2QJLA 2L32A 2D10A 3OJ4B 3KYCD 3DVNU 1QLBB 2V3SA 4W9IA 3DBRI 4J1WA 3MHZA 1Q1OA 3U4EG 4ARCA 4DWFA 2KEIA 1ZW7A 2B3AA 2KTRA 3WCQA 1RFKA 3V05A 2PMVA 4LDTB 4H2AA 1SJED 4MGYE 2RPVA 3A9JB 3HZIB 1D5ZC 2D07B 4O8BA 4HRAA 1AYFA 5G5GA 1WXMA 3VQIA 3DOWA 2OJWA 2KDEB 4Q2JA 1BUIC 5DSXA 1YQ3B 1DGJA 2O6VD 4ASWC 3VAWA 3ZNGC 3QWZB 3MJ5A 2AXZA 1R4NI 1V6EA 4C00A 3P2BA 3IAM1 2JZPA 1QP0A 2LYLA 2YEPB 3M3JA 2ODRD 3AE9B 2R2QA 4KGRA 1J8CA 1EU4A 2DENB 2L3ZA 3D1NI 4MM3B 3TEZA 3Q3NC 2ZZPB 2SAKA 2YEPF 1ESFA 1R4MI 3APCA 3RT3B 3EECA 3BS3A 3MLFA 2JSVX 2GRMA 4EKIA 2Y5BB 3UWPA 4ZHOA 1OQQA 1TKEA 4HPLB 4KZ0A 3S8QA 3VR8B 1FIQA 1NERA 4PU3C 3L08A 1YQBA 4X4DA 4N59A 5FR6A 4DK5A 3ZKJC 3Q14C 3KYDD 2J7QB 1YQ4B 1FNUA 2KYWA 2N1WA 3F51A 1ZPQA 1I4HA 4DXAB 1V86A 4JQDA 1L6VA 3T3OA 1O4XA 1HZ6A 3QFIA 3AEFB 1L5PA 1L1MA 3LDZE 2I1JA 4LJOB 3VH3B 1VZ7A 1UXDA 1ZXHA 3L1PA 1RZSA 3P4RB 4KVGB 2WDTB 2N0SB 3TL5A 4IUMB 3R09A 3NRZA 4EQZA 3PRPB 3C0RB 4O1NA 2JQEA 3QOXA 5E6NA 2LI5A 1HQRD 1KM7A 1CQVA 3QJZA 1ZVVA 3QC8B 2MBEA 1JALA 2LVOA 3U52E 3DVGY 2KDIA 3RD2A 3NVVA 3Q8BA 2LCVA 1C4PA 2ZW1A 3EC8A 5J17A 4WH4A 2GBRA 3TEWA 4YG4A 4ZRIA 4L23A 2KNBA 1POUA 4X4IA 2PXKA 2CS4A 2VRRB 2XCJA 3H7PB 1ZUD2 1J19A 3ALBA 1UGJA 2M8SA 2PTLA 1ZGUB 2INNE 1EU3A 1PNRA 4JGHB 2NBUA 2MBQA 3PGEA 2ZCCA 2KJ6A 2IUOA 1JWUD 4AWJA 1SJHD 5E6OA 1OEYJ 1TTNA 5BYRA 2O49A 4I6TA 4NZLB 3ZIMA 2PUDA 2BJCA 4WJPA 2JWZA 1GNUA 4TV3A 2V3NA 3MEJA 2VH1A 1E7UA 1UGMA 3I5JC 5D94A 1RRBA 2VZKB 3QAQA 1YD8U 3P4QB 2WXGA 5LXHA 5C3JB 2Q5WD 4IOIE 1TBEA 5IP4D 3B2FA 2W82A 4UDUC 3ZO5B 1JWMD 2RDBC 4RCOA 3WAMA 1QB2A 3Q8AA 2J0KA 1FMAD 3NVZA 2JCGA 2DNFA 4FJVB 4AJYB 4LLGM 3KL4A 3A1QB 3VR9B 3U30A 2PXQA 2WLBA 4YG1A 3TMPB 4C56C 4W9FA 4JWUC 3MP9A 4PU4C 3VDZA 1NVID 2C7MB 2H89B 3KUCB 4YXDB 1FM0D 1B1ZA 3QCAA 1E10A 4I6RA 2WXLA 3CSFA 4Y42A 2G4SA 1TGZB 2K6DB 4P6VF 3WAPA 2KMAA 4KGTA 3JSVB 3OP9A 3ENEA 1C9FA 2CU3A 2NTSA 4ER0A 1MG8A 3KZ3A 2AL6A 2DYOA 2OR1L 3DBLI 3V62A 2IO3B 2OOBB 2BBCA 5DTQA 2IZVB 1V5OA 2K3UA 4F8CB 3Q3FA 2KPJA 2FE8A 4KIKA 4A55A 2LHEA 1M4VA 2GLSA 2KZ8A 3DCGA 1WRDB 4NAMA 2MX2A 3DWMA 3RMKC 2DZMA 3KLSX 2PXLA 3BWUD 5TSSA 4IDIA 1G6JA 2JU6X 2RMMA 1WSPA 2RSUA 1GAQB 1XO3A 3NZSA 4MCXA 4FHJA 2BYTA 4Z5CA 3ML9A 4PYZA 2NCNA 1ET6A 4WURA 2EELA 3GZCA 2Z59B 1T0SC 3SFDB 2FIDA 2N7DA 2QMTA 3AEEB 1T0QC 1N6ZA 2BF8B 3HK0A 2PUCA 1ZP0B 3N32A 4EUTA 2FJRA 1I4PA 2JZZA 4HPMB 3AM9A 2FNJB 2G45B 2CHWA 2WXQA 2D3BA 2M17A 4IW0A 5E6JA 1S7EA 4D2KA 2O6VA 3AE7B 1FXAA 4JCYA 1WI0A 2MCNB 4EZLA 1WYGA 4EOYA 1NW3A 2PUFA 3PSEB 1QOAA 3KWVA 4WAAA 2LWPA 1GOZA 1EUVB 4RF0A 3OWEB 2JF5A 3UQBA 3AU4A 3R2IA 2L76A 4IWQA 1IBXB 1E90A 1NENB 1OFFA 2QHOA 2V3PA 3LQXA 3TEPA 4J1XA 3HM3A 4TKNA 2JY6A 3DVNV 5DT2A 1C4CA 2BW2A 4DHJB 1JRPA 4DHZE 1YN4A 2AXUA 4WIPA 4OHJA 1QP4A 4KKJA 3DDCB 2PIJA 4ZRKA 2L8NA 3K9OB 4EK9A 1WGKA 3FILA 2ZVOA 4I6PA 3CIRB 4KSKC 3BK2A 1WZ3A 2G3QB 1Y9QA 2IPKD 5IAAC 1DULA 3T3NA 3UFDA 3ZVVA 3QA8A 3S2AA 1WX9A 2C7NB 1E3OC 4IWRA 2GI9A 2L1AA 1ACCA 3KXAA 2BWFA 1YIWA 5AUIA 3ZXVA 3M62B 3KW5B 2K0PA 3W9CB 2WDVB 4B9KA 1TYGB 2PLPA 1NI2A 4I6LB 4NAWA 3A9YA 3NG0A 2ONQA 2LYKA 2IGDA 4ACFA 1I4GA 1Z5SB 4GDLB 2KN4A 2NPTB 2UYZB 2ICPA 5KHQA 2CROA 2LNMA 3ZNHB 3E56A 4FULA 3LISA 4K3BA 2KTFA 3ME5A 1Q10A 2JX5A 3B0AA 1QQBA 1I35A 3PZ8A 3ZJUA 3EUB2 1E8YA 2KANA 2EF8A 3K9PB 3MHSD 1WR1A 4GQMA 3VHTC 1FRRA 4ICUA 5HKHA 3LFPA 1M94A 2HDEA 4HCPB 2PXVA 3G7DA 1GC7A 2NR2A 2IYDB 3CROL 2AW6A 4EKUA
chains in the Genus database with same CATH topology
1N5WA 2MJEA 3MHZA 2RDGA 3ETRA 3U4EG 3ZPXA 1JWSD 1TY2A 4ARCA 3TELA 4N58A 1J7BA 1L0VB 1RFKA 3WCQA 1NI3A 2WU5B 2WXRA 3B2GA 3V05A 2PMVA 4PT5A 1QILA 4H2AA 1SJED 4EKGA 2RPVA 2WXNA 1D5ZC 4HRAA 4TMAB 2BS3B 1AYFA 1HZ5A 5H8YE 2Y5CA 5G5GA 3VQIA 3W1SA 2WXMA 3LXFA 2IGGA 3DWGC 1SF0A 1XXGA 2ON8A 1I7HA 4Q2JA 1BUIC 3U7ZA 4RGOS 5DSXA 1YQ3B 2RDHA 1DGJA 5D7GA 3GZDC 4DE9A 1I4RA 3OWQA 1JWAD 3MJ5A 2WXKA 5JXVA 1V97A 1BXTA 5HG2A 4AQ7A 3SX0A 1PDXA 4IKGA 3BZDB 3IAM1 2JZPA 5BMHA 1AN8A 2YEPB 3EGRA 2ODRD 3AE9B 3ABVB 4KGRA 5BMIA 4LK0M 3BK1A 3BYYB 1ZOYB 2J53A 4TQ1A 1EU4A 1ZE3D 4MM3B 4RNAA 4WAFA 2M19A 3TEZA 1E9MA 2WNMA 1D5MC 3A9ZA 4DE8A 2MJ3A 2SAKA 2YEPF 1ESFA 1DOIA 3H8HA 4OBMA 2JSVX 4EKIA 3NVWA 3MFGA 3UWPA 1STEA 2LLWA 1VLBA 1SBBB 1YN5A 4ZHOA 1OQQA 1TKEA 2CJNA 3VR8B 3G0TA 2QILA 1FIQA 4WVLA 3GS2A 1T3QA 4N59A 1Y56A 2E3TA 2LJIA 2J7WA 1FFUA 3IT6B 1A70A 2FBWB 2J4XA 2ICIA 4JE3B 1YQ4B 3SR6A 1FNUA 4B0MA 2B76B 1AWDA 1FRDA 1I4HA 1V1PA 4REZA 1JROA 4J3OD 4OZCA 3ZQ4A 1ET9A 3RFZB 4YTPB 3NZLA 3FC4A 4HRSA 5DRTA 1E0ZA 1BMLC 1L6VA 1RYJA 2WS3B 3AE5B 4LTUA 3T3OA 5JUWA 4HKZE 1HZ6A 3QFIA 4YTMB 2KACA 3AEFB 1L5PA 4C80A 3AH7A 2YBDA 1QOBA 2N9KA 3AECB 4M0WA 4YSYB 1VZ7A 1XCQL 3AMZA 1ZXHA 1K51A 1XLPA 1IUEA 3P4RB 3J9CA 3KWLA 1U2ZA 2N0SB 2LEKA 3R09A 3NRZA 3GP7A 4EQZA 2BTEA 4KKIA 2I38A 4R3DA 4O1NA 3QOXA 2VZKD 3IT4B 1HQRD 1KRHA 2WXOA 1WXQA 3NUHB 1CJEA 1CQVA 4OVZA 1C76A 2L1PA 3SFEB 4WQMA 2HCSA 5T8IA 1JALA 1SE4A 3PZ7A 2ACZB 3U52E 4KGSA 2W54A 3I57A 1PGAA 4USAA 3NVVA 2LUMA 2AQ2B 3Q8BA 2LLVA 1C4PA 1TS3A 1UNSA 4A6QA 2KDMA 3HRDD 2ZW1A 5MPOA 1J7CA 1MI0A 2INPE 4WH4A 1QF6A 3P4SB 3A9XA 3TEWA 4CQNA 4L23A 2BS4B 3KQ4A 1C4AA 1TS5A 1OQRA 5GXGB 3U2SC 2MEKA 3FILB 3BIID 1ZUD2 2WP9B 4L1BA 3NXHA 2NTTA 1UGJA 2DLBA 2L83A 2IDYA 2LFIA 2INNE 2PTLA 1EU3A 4ZYSA 1ROEA 1JMLA 1TKGA 2CJOA 2LGIA 2WDRB 4YSXB 3M9LA 1TZOA 4A90A 1JWUD 3P63A 1SJHD 3AEBB 1JCKB 3EA6A 4OZAA 5BYRA 2HCNA 4XWTA 4NZLB 1RM6C 1SIJA 1D4BA 2WXPA 2BB5A 3TFLA 1N60A 5FR3A 1XF5L 2V3NA 4ER6A 3MEJA 2ZW0A 4P16A 3P1MA 2IJ0A 4NAWB 3HUIA 1XEEA 2PVOD 2VZKB 3VWSA 1LO5D 3AEGB 1GB4A 3P4QB 2WXGA 1NEKB 5C3JB 2N7JA 2Q5WD 4IOIE 5C2TB 3B9JA 3B2FA 3BVMA 2M56B 2W82A 2OHFA 4YSZB 4UDUC 1JWMD 4RCOA 1L0YB 3HVDA 3Q8AA 1FMAD 3NVZA 4LLGM 1FNWA 3IXSA 3VR9B 1B9RA 1V8CA 3CWIA 2WLBA 1YN3A 3BYTB 4ZHPA 4C56C 3AE3B 3BVZA 1C79A 3NZ3A 4DXFA 4A8XC 4JWUC 2WXHA 3MP9A 4DQOC 1NVID 2H89B 2WXJA 5HI1A 4YXDB 1FM0D 3LYYA 1B1ZA 3O13A 1E10A 2N9LA 5HHDG 1D6EC 1N63A 2K9XA 2Y5PA 5BMGA 2PVGC 1UWXA 4HKQA 1CK1A 1K50A 2WXLA 3VRAB 1WRIA 1E6EB 2JQRB 4P6VF 2DWQA 3ZJTA 1NYQA 4RH6A 1D5XC 2R61A 4KGTA 3VRBB 2MH7A 1ENFA 2CU3A 2NTSA 4ER0A 3BVGA 1C9FA 4JWSC 2DYOA 2K22A 1QT9A 4C7ZA 1FO4A 2AX5A 2HFZA 2V4IB 1VR9A 1UUPA 4HEA1 1TS4A 2BBCA 3N9YC 5DTQA 1CZPA 2K3UA 2WDQB 2LHDA 1XLQA 2G9HD 5LNK1 2IGHA 2FE8A 1SSNA 4A55A 2LHEA 4YWGG 3LB8C 1JW9D 1M4VA 1K53A 1T5XD 3TUOA 4ARIA 1FFVA 1K52A 4US9A 1T6BX 5EE0A 3C8YA 1EWYC 2W3RA 4NAMA 2PW9A 3DWMA 3PE5A 2BB6A 3KLSX 2K5PA 1SXTA 2GRIA 2I2YA 3BWUD 5TSSA 4IDIA 1F0ZA 2JU6X 2RMMA 1WSPA 4WWMA 1XLNA 4ZRPA 3Q8EA 1GAQB 2GB1A 1XO3A 4C7YA 4XDCA 1KLUD 2W3SA 1VZ6A 3AE8B 2BYTA 3IAS1 1ET6A 2TSSA 4WURA 2EELA 1R7SA 3GZCA 2V0GA 3GUUA 5DTRA 2MJDA 4JPSA 3SFDB 2QMTA 3AE1B 1VRAB 1NYRA 3AEEB 1P7FA 4NJCA 3AE2B 2QSDA 1DOYA 2J7UA 1V1OA 1ZP0B 2KAJA 4MT5A 3HVZA 1I4PA 2X38A 1L6UA 4L2YA 2WXIA 3NVYA 3AM9A 4AS1A 3QOWA 4ER5A 2WXQA 1ZDXA 4YT0B 2M4HA 2HTME 4DXGA 1YJJA 2XXQA 4MH8A 2XN9C 1YJIA 5E6JA 4D2KA 3OKZA 2KMMA 3Q69A 1FXAA 1FCCC 3AE7B 4FXCA 2JXTA 1L0XB 3FAHA 5BYSA 3AE4B 1EM7A 1V1PB 5I4DA 2D5GA 4GLSC 2WQYB 2VEOA 1WYGA 4GDKB 3PO0A 2JWUA 1F77A 1GB1A 1NW3A 1QOAA 3AV8A 2JYTA 2QEJC 1EWCA 1KLGD 3KWVA 2AQ3B 1SE3A 1UWMA 2J42A 3P42A 1GOZA 4OZBA 3Q8CA 1PGBA 4RGTA 3OWEB 4RF0A 1TS2A 2BT6A 1KH0A 5D3IB 2DYMA 5FK9C 3AN1A 1N5XA 3R2IA 1FNVA 2JYEA 1IBXB 1JWBD 1NENB 1QKZA 1OFFA 2Y3AA 3GB1A 4B0EA 2V3PA 5H92C 2FUG1 5FKAC 2M0AA 2PIAA 3TEPA 4RGMA 3AEDB 5BYQA 2SEBD 3I9V1 1QQRA 1PGXA 3W2DA 2EKIA 2W55A 3UI3A 3SR4A 5DT2A 1ZXIA 3Q8FA 4A9AA 2PKOA 4ZRQA 1C4CA 1MHHE 1PYWD 1KF6B 2BW2A 1TY0A 2LMCA 3P4PB 1JRPA 1YN4A 4WIPA 1ZDVA 1YNTE 4KKJA 4OHJA 3R2TA 1PFDA 4JX1C 2H88B 4OW0A 4EK9A 1WGKA 3FILA 5G5HA 1XCTL 3GZDA 3CIRB 3W5VB 1L4DB 3BK2A 1F2RC 1WWTA 2IPKD 3R8BA 1AW7A 3ZJVA 1VJKA 3TSSA 4XWWA 2KQ4X 1SE2A 3URYA 1VDVA 4XDDA 4YTNB 3T3NA 3AB5A 1HXYD 3AEAB 1N62A 4ITKA 3V3XA 2MXDA 3NS1A 3ZYYX 2NMQA 3ZGZA 2XNAC 3NROA 4KX6B 2GI9A 5D3DA 2E6XA 2L1AA 4EZIA 1ACCA 4N6EB 5DRYA 2DBYA 4TSSA 1MPEA 2G1EA 1MVKA 1FXIA 2BS2B 1FD6A 4HJGE 1KFYB 1C77A 1ZPSA 5AUIA 4RFBA 1P7EA 3TEYA 1JQ4A 4EE2A 4ER7A 1MHXA 2K0PA 2Z8LA 2WDVB 3W9CB 1TYGB 2PLPA 1SB3C 3A9YA 1GPXA 2KWDA 3TEXA 2WU2B 2ONQA 1QOFA 2IGDA 1I4GA 4GDLB 1HEZE 1TJEA 4ZOHC 1J7AA 2KN4A 2XXPA 1IGCA 2AQ1B 4HROA 5AUKA 3MC0B 1E7PB 4RGNA 2LNMA 3E56A 4MACA 2QIEB 1IBXA 1I4QA 1F2RI 1YMHE 3ME5A 1Q10A 2JX5A 2WXFA 3L4PA 1N61A 1HA5A 1C78A 3E9SA 3AE6B 3PZ8A 3ZJUA 5EE9A 1PUTA 4RF1A 3EUB2 1TKYA 5HFYA 2J52A 1SEBD 1DYQA 1VZ8A 1L4ZB 1FCLA 1FRRA 1I4XA 2L52A 4TQ0A 5DTMA 2HDEA 1RWSA 1FEHA 3RPFC 1IGDA 5EE1A 4US8A 2QJLA 2L32A 4XE0A 2OEDA 3W5UB 4ER3A 1QOGA 1DOXA 1KTKA 1QLBB 5EE3A 3SEBA 1XLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2J A;  3TUO A;  3NZL A;  2L1P A; 
#chains in the Genus database with same CATH topology
 3BD1 A;  2JZ3 B;  4PK1 A;  1XD3 B;  3WIM A;  2MQJ A;  3ZPX A;  2PXE A;  1TY2 A;  3TEL A;  1L0V B;  3VVW B;  1CQT A;  2WXR A;  5CHV C;  3IFW B;  4PT5 A;  4II3 B;  5H8Y E;  2Y5C A;  2KJR A;  2WXM A;  2QC8 A;  1IYF A;  4LNK A;  5JH5 C;  2JRH A;  2IGG A;  2KFJ A;  4KDI C;  3DHH C;  1WJ4 A;  2LRW A;  3ZW3 A;  2RDH A;  5IN7 A;  2NVU I;  4IM2 A;  4WJO A;  2XJ3 A;  3H6N A;  4AQ7 A;  3SX0 A;  3KVF B;  1CMX B;  3BZD B;  5BMH A;  2LGY A;  3NHE B;  4X4E A;  1WM2 A;  1ZZ6 A;  2FCN A;  2OFY A;  4HJK A;  2K1F A;  4ZYN A;  2J53 A;  1PQS A;  4RNA A;  1E9M A;  3GOE A;  1V9J A;  3HM6 X;  2KEJ A;  3SCG A;  1S1Q B;  3QHT A;  4W9E A;  3L13 A;  2B5A A;  3U3W A;  3VK0 A;  1EFA A;  4W9D A;  1YN5 A;  4DDI D;  2CJN A;  2QIL A;  1B0N A;  2EMT A;  3ZTC A;  4ZRJ A;  1T3Q A;  1RZR D;  2GBN A;  2E3T A;  3Q6B A;  2LJI A;  3CLC A;  2A4Z A;  2FBW B;  1V2Y A;  3N20 C;  4I6N B;  3BDN A;  4WWP A;  1AWD A;  4REZ A;  1V1P A;  4OZC A;  3SDL C;  2IND C;  1QP7 A;  4GDK A;  3FC4 A;  2EKE C;  5AZH A;  3SD5 A;  1E0Z A;  1WMH B;  2GMI C;  3AE5 B;  1RYJ A;  5JUW A;  1Y8R C;  4I8T A;  2KAC A;  3ZUN A;  2IO1 B;  3VFK A;  4W9H A;  5LLI A;  2YBD A;  4M0W A;  1ISN A;  4YSY B;  1XCQ L;  2H8R A;  2K39 A;  4X4C A;  1I42 A;  3GP7 A;  3NS8 A;  4KKI A;  2I38 A;  4B95 A;  2M0X A;  2MP2 A;  1ZAY A;  1WXQ A;  3NUH B;  1CJE A;  4MM3 A;  4XYC A;  1BDI A;  1C76 A;  3PRE A;  3SFE B;  4WQM A;  5T8I A;  4KGS A;  1MFQ C;  3WAL A;  3GN5 B;  3I57 A;  1HF0 A;  1E5W A;  2LLV A;  1TS3 A;  2OJR A;  5L95 C;  4E71 A;  3P4S B;  4CQN A;  1TZ1 A;  3NZU A;  1C4A A;  4WWN A;  1TS5 A;  4PU8 A;  4CYE A;  3BII D;  1X57 A;  1XWR A;  2NTT A;  2LYQ A;  1PRV A;  4ZYS A;  1ROE A;  1DW9 A;  1JML A;  1TKG A;  2LGI A;  2WDR B;  2FCS A;  3M9L A;  1TZO A;  2FUH B;  1Y7Y A;  1FPY A;  2JT4 B;  4F7Z A;  2FAZ A;  2XXA A;  3AEB B;  2KQS A;  2HCN A;  4XWT A;  1UBI A;  1ZUG A;  2AEH A;  4PU7 A;  1SIJ A;  2K8C A;  3V6C B;  3ECI A;  1BDH A;  3RZW C;  3VUX A;  5EDS A;  5FR3 A;  3KJX A;  3RZF A;  2J0J A;  1XF5 L;  4ER6 A;  2IJ0 A;  3HUI A;  3RNC C;  2PVO D;  3MTN B;  1GB4 A;  1UXC A;  3AEG B;  5CHF A;  4OVV A;  2GZU A;  3ZHI A;  3QWG A;  2PXT A;  3B9J A;  5E6P A;  2M56 B;  4E74 A;  2OHF A;  1JRU A;  4YSZ B;  3X23 A;  3HIZ A;  2BYF A;  1JH9 A;  3ZRC A;  3IXS A;  2KJH B;  1V8C A;  1YN3 A;  2LXA A;  3AE3 B;  1C79 A;  3NZ3 A;  4C4V B;  3L10 B;  2LVP A;  2WXH A;  1EF5 A;  4GB9 A;  3R3M A;  2JPH A;  3A33 B;  2JVC A;  2BGF A;  2CU1 A;  2N9L A;  5HHD G;  2K9X A;  1GUA B;  2L0F A;  1UWX A;  2KXJ A;  2PVG C;  1QPZ A;  2JQR B;  5BO4 B;  5GAG i;  1SQ8 A;  2YLM A;  4RH6 A;  3H7P A;  2Z0D B;  2MH7 A;  2PUA A;  1ENF A;  1LXD A;  3BVG A;  3RN9 C;  1C3T A;  4JWS C;  2K22 A;  1QT9 A;  2DYB A;  1R63 A;  2KTR B;  1WYW B;  4MGK E;  1VR9 A;  4FLH A;  1CZP A;  3N1X C;  1XT9 B;  4OB4 A;  5DCN A;  1ZZ9 A;  2BNO A;  4HCN B;  3LB8 C;  4ARI A;  4FBJ B;  1FFV A;  1GG3 A;  4US9 A;  5LXI B;  1CJG A;  4MSQ B;  5EE0 A;  3C8Y A;  1EWY C;  3T9L A;  1GJZ A;  3PE5 A;  2BKR B;  2D3A A;  3DQV A;  2I2Y A;  3GBF A;  4HXD A;  1WZ0 A;  4BFR A;  4EEW A;  2DZK A;  2IU7 A;  3AE8 B;  4HDO A;  2N9P C;  3IAS 1;  2MW5 A;  2TSS A;  1R7S A;  1YSE A;  1ZS4 A;  4HPP A;  1QQA A;  1WJN A;  3GUU A;  2MJD A;  4FJZ A;  3W1Y A;  3CEC A;  1NYR A;  1P7F A;  2WX0 A;  1V49 A;  2QSD A;  2LUE A;  4MT5 A;  3H7S A;  2N9E B;  1YX5 B;  1L6U A;  3NVY A;  2LGD A;  4ER5 A;  2PXF A;  2RR9 A;  4WWO A;  2XN9 C;  2K25 A;  4FXC A;  1LLI A;  4P1C C;  2ZNV B;  3L16 A;  2JXT A;  4IC7 B;  2M4N A;  4EFO A;  3AE4 B;  1OTR B;  3UQA A;  4BKS D;  2C60 A;  4URK A;  4GLS C;  2VEO A;  3OAW A;  3X0W A;  3IG3 A;  3PO0 A;  2IY1 B;  5L83 A;  1WE6 A;  2PEA A;  1F77 A;  2XEW A;  1GB1 A;  2QEJ C;  1KLG D;  2N7E A;  1UWM A;  1PGB A;  1TS2 A;  5D3I B;  4MSM B;  4B6W A;  4M01 A;  3AN1 A;  3OG5 A;  1JWB D;  2Y3A A;  3GB1 A;  3CMM B;  5H92 C;  3H5T A;  4GMV A;  4KV2 A;  4IG7 B;  4IVZ A;  2IVG A;  4I6U A;  3JXD L;  3AED B;  2DHZ A;  3TBL D;  1QQR A;  1XQQ A;  2W55 A;  2BQQ A;  3WA0 A;  3SR4 A;  2KC1 A;  1RZR A;  3APF A;  3C19 A;  1FXT B;  2QCZ A;  3I63 C;  4A9A A;  2LXC A;  2D3C A;  1MHH E;  1PYW D;  3P4P B;  4BOS C;  1WE7 A;  2XI8 A;  1ZDV A;  3ZHM A;  3AU5 A;  3W5V B;  3Q3J A;  1F2R C;  3N3K B;  4J6I A;  3L17 A;  3ZJV A;  2HD5 B;  2KQ4 X;  1KLV A;  3PZD A;  1VDV A;  2O2V A;  4YTN B;  3AB5 A;  1N62 A;  2ICT A;  3V3X A;  3NS1 A;  3ZGZ A;  1SE9 A;  3NRO A;  3H1U A;  2IBI B;  3KH0 A;  5D3D A;  1LCC A;  4N6E B;  5DRY A;  4BOZ B;  4TSS A;  4LDT D;  4IA8 A;  4HJG E;  2DX5 B;  1KFY B;  1P1A A;  4RFB A;  4EE2 A;  4ER7 A;  4P7I A;  2Z8L A;  3VUY A;  2KWD A;  1GPX A;  2N4F A;  4GN1 A;  3PHX B;  4XZ4 A;  2LYP A;  1HEZ E;  1TJE A;  1J7A A;  2XXP A;  2AQ1 B;  4HRO A;  3GE3 C;  1E7P B;  2LGX A;  4WQO B;  3DM5 A;  1T0Y A;  4BKT A;  2FFH A;  1IBX A;  1YMH E;  2KWU B;  1F2R I;  1YOV B;  4YG7 B;  4NDW A;  1UD7 A;  1JFS A;  3PRM B;  3RNB C;  5GAH i;  1GC6 A;  3ZNI D;  5EE9 A;  2WWZ A;  2W9N A;  1TKY A;  3H9D A;  5HFY A;  5JHA A;  2LVQ A;  5GMV A;  1A5R A;  1I4X A;  2L52 A;  4K1R B;  4IWP A;  1RWS A;  3PXP A;  1IGD A;  5EE1 A;  3V61 A;  2OED A;  4ER3 A;  1DOX A;  1KTK A;  5EE3 A;  2G4D B;  3SEB A;  5DPW A;  3A9K A;  1XLO A;  3QIJ A;  2MLB A;  2MJE A;  3ETR A;  2XK5 A;  1JWS D;  4MJS A;  5K98 B;  1NBF C;  4N58 A;  1J7B A;  2PPH A;  1NI3 A;  1QIL A;  3ONS A;  4G3X B;  3RNG C;  3VXW A;  1HZ5 A;  3W1S A;  2ASQ A;  3LXF A;  4GHJ A;  3DPD A;  1XXG A;  4IM0 A;  3CF6 E;  4ANV A;  1T0R C;  5D7G A;  5JZE B;  3RI7 C;  3D32 A;  4KIK B;  3GZD C;  4DE9 A;  1I4R A;  3RUI B;  5JXV A;  2LGS A;  1PDX A;  4IKG A;  2KT7 A;  2WX1 A;  2RD0 A;  4K7S A;  3RUL A;  5IKC M;  1AN8 A;  5KHO A;  3ABV B;  1AAR A;  2CKH B;  4M00 A;  4JCX A;  2KFK A;  5IOI A;  5BMI A;  4LK0 M;  1QZE A;  3AXC A;  2INC C;  2M19 A;  3ZDT A;  2WNM A;  2MJ3 A;  3H8H A;  3PT2 B;  2LYR A;  1JFT A;  4OBM A;  3AUL A;  2KWC A;  5CHW A;  4X57 B;  3OMT A;  1STE A;  2LLW A;  1VLB A;  1SBB B;  3APD A;  2AL3 A;  4X4F A;  3G0T A;  3R66 C;  3GS2 A;  4GSW A;  1Y56 A;  1UEL A;  3UIP B;  2ZPY A;  3IT6 B;  1A70 A;  2FCQ A;  1YJ1 A;  2CSF A;  2J4X A;  2ICI A;  4MEL A;  3SR6 A;  1V81 A;  2KN5 A;  4J3O D;  3ZQ4 A;  3U8Z A;  1HQ1 A;  3NZL A;  2O4A A;  2MWS B;  1LGR A;  2WS3 B;  2KD0 A;  3N1Y C;  1OQY A;  2KDB A;  3JXC L;  3AH7 A;  4BZA A;  1QOB A;  1WM3 A;  2K8H A;  2VH2 A;  1NEQ A;  3EUS A;  2KLG A;  1E8X A;  3AMZ A;  4GOC A;  1K51 A;  1IUE A;  2IVB A;  3V6E B;  4R3D A;  4M8N A;  4NPN A;  2VZK D;  1OSL A;  3MC9 A;  2WXO A;  4NY0 A;  2JRI B;  2L1P A;  2LYS A;  4WJQ A;  1SE4 A;  3PZ7 A;  4BAX A;  2ACZ B;  2D2Q A;  4LNI A;  1PGA A;  4MGI E;  2NBV B;  4USA A;  5C23 A;  4ANX A;  3MC8 A;  4A6Q A;  2KDM A;  4QAY A;  4YAR A;  1J7C A;  5MPO A;  1QF6 A;  2BS4 B;  1Q5W B;  5GXG B;  2K8B A;  4W9L A;  3U2S C;  3FIL B;  3B7H A;  1LCD A;  3Q3M C;  4K7U A;  4BKS A;  3ZKC A;  2WP9 B;  2PXU A;  2KHW B;  2DLB A;  2J0M A;  2IDY A;  3MJW A;  4TUU A;  4GU2 A;  2CJO A;  2JXX A;  3RNA C;  3OLM D;  4YSX B;  1WGR A;  3N1Z C;  2IO2 B;  1F52 A;  3P63 A;  2WGS A;  4G0N B;  5IA7 A;  3EA6 A;  2MEZ A;  4A20 A;  1WMH A;  2V1Y A;  2V9H A;  1Z2M A;  1RM6 C;  3A4S C;  3TFL A;  2PPX A;  1N60 A;  4ICV A;  2AUW A;  2N9X A;  2KQ7 A;  4RM8 A;  2ZW0 A;  3P1M A;  4NAW B;  1XEE A;  1LO5 D;  4K3C A;  2KO3 A;  4AJW A;  2FIF A;  4DDG D;  3OQM A;  3DBH B;  5C2T B;  2ZNV C;  2NS5 A;  3SU8 X;  5G55 A;  1IPG A;  1FNW A;  4FAD A;  1B9R A;  1ZZB A;  3CWI A;  4ZHP A;  4JIO U;  3BVZ A;  4DQO C;  1P0R A;  2WXJ A;  3R7R A;  3O13 A;  3RCZ A;  1D6E C;  3QYX A;  2Y5P A;  2KVR A;  5BMG A;  4HKQ A;  1WX7 A;  1K50 A;  3VRA B;  1WRI A;  2A5U A;  2CHX A;  3RNF C;  4PS7 A;  3A9J A;  1E8W A;  3O9X A;  4YL8 A;  3Q2A C;  1WX8 A;  1FO4 A;  2AX5 A;  4LNN A;  2HFZ A;  4NQK E;  1UUP A;  4HEA 1;  1HE8 A;  2BNN A;  2WDQ B;  4S0R A;  2L00 B;  1XLQ A;  5LNK 1;  1H8C A;  4M8M A;  3TCA A;  1WY8 A;  1K52 A;  2GRL A;  1WGH A;  2L05 A;  1T6B X;  1MFW A;  2L0T A;  4PS8 A;  2CR5 A;  3HHM A;  3UGB B;  4GGQ A;  1ADR A;  2BB6 A;  2K5P A;  1SXT A;  2GRI A;  3EHV A;  1WXA A;  1F0Z A;  4WWM A;  1RLF A;  1XLN A;  4ZRP A;  2HSG A;  2GB1 A;  1F1H A;  3QQ8 B;  1VZ6 A;  3PHW B;  2PE9 A;  2JVL A;  2MRP A;  4FHK A;  2V0G A;  5DTR A;  4JPS A;  1C1Y B;  3AE1 B;  3JXB C;  3AE2 B;  4NJC A;  4DHJ D;  4LNO A;  5J18 A;  2X38 A;  2LJ5 A;  4NJ6 A;  2LRU A;  2WXI A;  3KUD B;  3PV1 A;  3PS6 A;  5D2M B;  1ZDX A;  3GE8 C;  4YT0 B;  2M4H A;  3DHI C;  4DXG A;  1MJD A;  2HE7 A;  2XXQ A;  4MH8 A;  3PVL A;  1YJI A;  3Q69 A;  1WJ6 A;  3OQN A;  1FCC C;  1U4A A;  2MA9 B;  1PRA A;  4N9F 4;  1V1P B;  5I4D A;  1L7Y A;  2D5G A;  2WQY B;  2DAF A;  4GDK B;  3O65 B;  3T8M A;  2JWU A;  4FBI A;  3ZTD A;  1D3Z A;  1EF1 A;  2JYT A;  2LD9 A;  1SE3 A;  3P42 A;  3Q8C A;  4RGT A;  4EZJ A;  1RPE L;  2BT6 A;  1KH0 A;  2PE5 A;  2DYM A;  5FK9 C;  2IV1 A;  4M0W B;  4W9K A;  1FNV A;  1WGG A;  2JYE A;  1QKZ A;  2XIU A;  5G2N A;  2PUE A;  1UF0 A;  4JQW C;  2PIA A;  5BYQ A;  4MEM A;  3I9V 1;  2LZ6 A;  1PGX A;  1ZKH A;  2MP2 B;  3EFU A;  2BWE S;  1DWK A;  4ZRQ A;  2QDF A;  1TY0 A;  2Z0E B;  5CX3 A;  1UZX B;  2DZI A;  3NY5 A;  3R2T A;  2H88 B;  4OW0 A;  4X4G A;  3ZRF A;  2PUG A;  2O38 A;  3OJ3 A;  1XCT L;  5G5H A;  4F1S A;  4X4B A;  1WWT A;  2WIU B;  2IO0 B;  3R8B A;  4S17 A;  2ZCB A;  3TSS A;  1SE2 A;  4XDD A;  4ITK A;  2MXD A;  3ZYY X;  5C1Z A;  2C7H A;  2XNA C;  5DPR A;  3WAO A;  4EZI A;  2HJ1 A;  3GZN B;  2DBY A;  4JLC A;  1WXS A;  2G1E A;  2EBY A;  4G50 A;  2BS2 B;  4HVB A;  1ZPS A;  4FN3 A;  1P7E A;  1MHX A;  4PS3 A;  2WU2 B;  1VPW A;  4W9J A;  3B08 A;  4ZOH C;  1HTO A;  2C9W B;  2D3G A;  4RGN A;  1WIA A;  3UIO B;  4MAC A;  2QIE B;  2ZPN A;  1I4Q A;  3L4P A;  5D6J B;  1N61 A;  3R7Q A;  3DBS A;  3E9S A;  1C78 A;  3A1Q A;  1PUT A;  3VTU A;  3QQ6 A;  2J52 A;  1SEB D;  1DYQ A;  1WJU A;  1L4Z B;  2X8X X;  3W1S C;  1FEH A;  4HK2 A;  3RPF C;  4P1B C;  4US8 A;  4XE0 A;  4CO7 A;  2N1V A;  3W5U B;  2KLC A;  1QOG A;  5A7L A;  2WHI A;  3TIX A;  1N5W A;  2BPS A;  3JSV A;  2RDG A;  1LM8 B;  2V3C C;  3RNE C;  2WU5 B;  3B2G A;  4IWO A;  4OVU A;  2WYQ A;  4EKG A;  2WXN A;  4ANW A;  5AZG A;  3AI5 A;  4TMA B;  2BS3 B;  2IY0 B;  3L0W B;  2BNM A;  3DWG C;  1SF0 A;  1ZZ7 A;  2ON8 A;  1I7H A;  3B1L X;  4BVU C;  1OGW A;  3U7Z A;  4RGO S;  1E7V A;  3PRZ A;  3V60 A;  3OWQ A;  3SCF A;  1JWA D;  2WXK A;  1V97 A;  1BXT A;  5HG2 A;  3FYA A;  2I1K A;  4MGZ E;  4RMA A;  2GBK A;  3EGR A;  5JHB A;  4CHK A;  1S3S G;  2ZVN A;  5DPT A;  3BK1 A;  3BYY B;  1ZOY B;  3PTF C;  4TQ1 A;  1ZE3 D;  4WAF A;  1PRU A;  2R63 A;  1D5M C;  3A9Z A;  4DE8 A;  2V4L A;  5AZF A;  4XGA B;  4A3O A;  2R1J L;  2ZJD A;  1DOI A;  2KX0 A;  1K8R B;  1WH3 A;  3NVW A;  4KDL B;  3BIN A;  3MFG A;  4Z59 A;  3M95 A;  3RYT A;  4FN2 A;  1JWL A;  4WVL A;  3VTV A;  3VTW A;  3DBR B;  2J7W A;  1WGD A;  1FFU A;  1ZZC A;  2DAJ A;  4JE3 B;  1UH6 A;  4IM3 A;  4B0M A;  3L54 A;  2B76 B;  1FRD A;  4X4H A;  1QZX A;  1JRO A;  1ET9 A;  1AU7 A;  3RFZ B;  4YTP B;  4HRS A;  5DRT A;  1BML C;  4LTU A;  3OQO A;  4HKZ E;  4EZK A;  2K6Q A;  4YTM B;  2NBW B;  3G5G A;  4GIV A;  2KKC A;  3ZNZ B;  4BBN F;  4C80 A;  1Q0W B;  2BVC A;  2N9K A;  3AEC B;  2XSD C;  4AOF A;  1UTX A;  1R4N B;  1XLP A;  2C5L C;  2KEK A;  1WH6 A;  3J9C A;  3KWL A;  1U2Z A;  2LEK A;  2AYO B;  3DBH I;  2BTE A;  2XBB C;  3LJ3 A;  4YBA A;  2PXB A;  3IT4 B;  1KRH A;  4OVZ A;  1R4M B;  1WGY A;  2HCS A;  1TIF A;  4Z5D A;  4A3P A;  2KVZ A;  2PXP A;  3DNV B;  2W54 A;  2MQK A;  2LUM A;  2AQ2 B;  3JYU A;  4LCD E;  4MCT A;  1UNS A;  2KOX A;  1P3Q U;  3HRD D;  1MI0 A;  1LQC A;  2INP E;  2MHJ A;  3A9X A;  3KQ4 A;  1OQR A;  2MEK A;  3QK0 A;  4L1B A;  3NXH A;  2L83 A;  2LFI A;  2EWT A;  2L7R A;  2AWI A;  3Q3O C;  4JL9 A;  2O2V B;  4A90 A;  2KX3 A;  2KWV B;  2MBB B;  1JCK B;  1VCB A;  4OZA A;  2PXD A;  3JW0 X;  3WAN A;  4G11 A;  2WXP A;  1D4B A;  2BB5 A;  1IC8 A;  1VD2 A;  3FKY A;  4GDL A;  2NPT A;  2BYE A;  4AP4 C;  4P16 A;  3M63 B;  3VWS A;  3QF3 A;  1WR6 E;  1NEK B;  2BKF A;  1L2N A;  3SCH A;  2N7J A;  1MG4 A;  1WIZ A;  3BVM A;  4DBG A;  2KDF B;  3UIN B;  1L0Y B;  3HVD A;  2KK8 A;  3BYT B;  1RAX A;  4DXF A;  4A8X C;  3ML8 A;  3IHP C;  3VUW A;  2RGF A;  4HLE A;  5HI1 A;  3LYY A;  4GXB A;  1N63 A;  4K81 A;  4NJ7 A;  2LYJ A;  1CK1 A;  3DHG C;  2PE6 B;  1E6E B;  1X1M A;  2DWQ A;  2RPQ A;  3ZJT A;  1R69 A;  1NYQ A;  1D5X C;  2R61 A;  3VRB B;  3A9K B;  3ZXR A;  3EFC A;  2LAS A;  2XK5 B;  4MJS B;  2O6V B;  2DZJ A;  1P98 A;  4C7Z A;  4FJY A;  1GT0 C;  2V4I B;  1WF9 A;  2REX A;  1TS4 A;  3N9Y C;  4Z58 A;  2HTH A;  1KOT A;  2LHD A;  2A6C A;  2G9H D;  2IGH A;  2PUB A;  2D11 A;  1SSN A;  3N30 A;  1SGH A;  4HDQ A;  4YWG G;  3CST A;  4LNF A;  1JW9 D;  1T5X D;  1K53 A;  3TUO A;  4E3C A;  3IVP A;  4RM9 A;  3DVG X;  2W3R A;  2PW9 A;  4ANU A;  2EMS A;  3VH4 B;  3PPA A;  1RIO A;  1EO6 A;  4K7W A;  1P9D U;  4BKG A;  4MDK E;  3TJP A;  1LFD A;  4FA6 A;  2KFK B;  1LMB 3;  3Q8E A;  1SIF A;  4C7Y A;  4XDC A;  1KLU D;  2CHZ A;  2W3S A;  5CTR C;  5TR5 A;  1WET A;  3QX1 A;  2AWT A;  2AXV A;  3KUZ A;  2JUO A;  2D5V A;  1VRA B;  4Z5H A;  1UBQ A;  2ZEQ A;  1DOY A;  4M02 A;  2J7U A;  1V1O A;  1H4R A;  2KAJ A;  1PER L;  2HJ8 A;  3HVZ A;  4WJN A;  2MSE D;  3ZLZ A;  4L2Y A;  4AS1 A;  3QOW A;  2HTM E;  1BT0 A;  1YJJ A;  4DHZ B;  3OKZ A;  2KMM A;  2UWQ A;  3DBL B;  4LJP B;  2KZR A;  1L0X B;  3FAH A;  5BYS A;  3GZN I;  1EM7 A;  3SHQ A;  3ZDM C;  3TRB A;  1E8Z A;  1ZZ8 A;  5IO9 A;  3AV8 A;  4MH0 E;  1EWC A;  4ZDV A;  2AQ3 B;  4W9C A;  1X2L A;  2J42 A;  4OZB A;  1HTQ A;  1WFY A;  2HIN A;  1WXV A;  1YX6 B;  1N5X A;  1TT5 B;  2M1M A;  1V80 A;  4PYU A;  4B0E A;  4F8D A;  2FUG 1;  2YVC A;  5FKA C;  2M0A A;  3FMY A;  4AUQ C;  4RGM A;  2SEB D;  2MBO A;  3F52 A;  3W2D A;  2GBJ A;  2EKI A;  3UI3 A;  3GN5 A;  3A4R A;  1ZXI A;  3Q8F A;  4KZC A;  1OEY A;  2PKO A;  1KF6 B;  2LMC A;  4NNJ B;  3PLU A;  2FCM A;  1YNT E;  3U7D A;  4JX1 C;  1PFD A;  4HWI B;  2MBH A;  2PJH A;  5AEK B;  3QAR A;  3GZD A;  1L4D B;  2R2O A;  4XX5 A;  1AW7 A;  2GBM A;  1VJK A;  3BY4 B;  4KSL C;  2KC2 A;  4XWW A;  3F6W A;  3URY A;  1HXY D;  3AEA B;  4II2 B;  2NMQ A;  3I3T B;  5DPS A;  4KX6 B;  3R1F A;  2E6X A;  1MPE A;  1MVK A;  3NJT A;  3IBE A;  5J2R A;  1FXI A;  1OCT C;  1FD6 A;  1V5T A;  1C77 A;  3TEY A;  1JQ4 A;  2BYV E;  2GOW A;  1SB3 C;  4W9G A;  1RFA A;  3TEX A;  1QOF A;  1LQB A;  1IGC A;  2UU7 A;  4XC2 A;  5AUK A;  3MC0 B;  3PLV A;  3UF8 A;  1KJT A;  3NDB B;  3RZZ A;  4BBN C;  3FYM A;  2WXF A;  3JVZ X;  1IP9 A;  3IVF A;  1HA5 A;  1NDD A;  3AE6 B;  2WUS R;  4NQL B;  4RF1 A;  1VZ8 A;  2L49 A;  4C4V A;  1FCL A;  1WH8 A;  4TQ0 A;  5DTM A;  1J0G A;  3NOB A;  2KMC A;  2L8J A;  2IVQ A;  1F9J A;  2QJL A;  2L32 A;  2D10 A;  3OJ4 B;  3KYC D;  3DVN U;  1QLB B;  2V3S A;  4W9I A;  3DBR I;  4J1W A;  3MHZ A;  1Q1O A;  3U4E G;  4ARC A;  4DWF A;  2KEI A;  1ZW7 A;  2B3A A;  2KTR A;  3WCQ A;  1RFK A;  3V05 A;  2PMV A;  4LDT B;  4H2A A;  1SJE D;  4MGY E;  2RPV A;  3A9J B;  3HZI B;  1D5Z C;  2D07 B;  4O8B A;  4HRA A;  1AYF A;  5G5G A;  1WXM A;  3VQI A;  3DOW A;  2OJW A;  2KDE B;  4Q2J A;  1BUI C;  5DSX A;  1YQ3 B;  1DGJ A;  2O6V D;  4ASW C;  3VAW A;  3ZNG C;  3QWZ B;  3MJ5 A;  2AXZ A;  1R4N I;  1V6E A;  4C00 A;  3P2B A;  3IAM 1;  2JZP A;  1QP0 A;  2LYL A;  2YEP B;  3M3J A;  2ODR D;  3AE9 B;  2R2Q A;  4KGR A;  1J8C A;  1EU4 A;  2DEN B;  2L3Z A;  3D1N I;  4MM3 B;  3TEZ A;  3Q3N C;  2ZZP B;  2SAK A;  2YEP F;  1ESF A;  1R4M I;  3APC A;  3RT3 B;  3EEC A;  3BS3 A;  3MLF A;  2JSV X;  2GRM A;  4EKI A;  2Y5B B;  3UWP A;  4ZHO A;  1OQQ A;  1TKE A;  4HPL B;  4KZ0 A;  3S8Q A;  3VR8 B;  1FIQ A;  1NER A;  4PU3 C;  3L08 A;  1YQB A;  4X4D A;  4N59 A;  5FR6 A;  4DK5 A;  3ZKJ C;  3Q14 C;  3KYD D;  2J7Q B;  1YQ4 B;  1FNU A;  2KYW A;  2N1W A;  3F51 A;  1ZPQ A;  1I4H A;  4DXA B;  1V86 A;  4JQD A;  1L6V A;  3T3O A;  1O4X A;  1HZ6 A;  3QFI A;  3AEF B;  1L5P A;  1L1M A;  3LDZ E;  2I1J A;  4LJO B;  3VH3 B;  1VZ7 A;  1UXD A;  1ZXH A;  3L1P A;  1RZS A;  3P4R B;  4KVG B;  2WDT B;  2N0S B;  3TL5 A;  4IUM B;  3R09 A;  3NRZ A;  4EQZ A;  3PRP B;  3C0R B;  4O1N A;  2JQE A;  3QOX A;  5E6N A;  2LI5 A;  1HQR D;  1KM7 A;  1CQV A;  3QJZ A;  1ZVV A;  3QC8 B;  2MBE A;  1JAL A;  2LVO A;  3U52 E;  3DVG Y;  2KDI A;  3RD2 A;  3NVV A;  3Q8B A;  2LCV A;  1C4P A;  2ZW1 A;  3EC8 A;  5J17 A;  4WH4 A;  2GBR A;  3TEW A;  4YG4 A;  4ZRI A;  4L23 A;  2KNB A;  1POU A;  4X4I A;  2PXK A;  2CS4 A;  2VRR B;  2XCJ A;  3H7P B;  1ZUD 2;  1J19 A;  3ALB A;  1UGJ A;  2M8S A;  2PTL A;  1ZGU B;  2INN E;  1EU3 A;  1PNR A;  4JGH B;  2NBU A;  2MBQ A;  3PGE A;  2ZCC A;  2KJ6 A;  2IUO A;  1JWU D;  4AWJ A;  1SJH D;  5E6O A;  1OEY J;  1TTN A;  5BYR A;  2O49 A;  4I6T A;  4NZL B;  3ZIM A;  2PUD A;  2BJC A;  4WJP A;  2JWZ A;  1GNU A;  4TV3 A;  2V3N A;  3MEJ A;  2VH1 A;  1E7U A;  1UGM A;  3I5J C;  5D94 A;  1RRB A;  2VZK B;  3QAQ A;  1YD8 U;  3P4Q B;  2WXG A;  5LXH A;  5C3J B;  2Q5W D;  4IOI E;  1TBE A;  5IP4 D;  3B2F A;  2W82 A;  4UDU C;  3ZO5 B;  1JWM D;  2RDB C;  4RCO A;  3WAM A;  1QB2 A;  3Q8A A;  2J0K A;  1FMA D;  3NVZ A;  2JCG A;  2DNF A;  4FJV B;  4AJY B;  4LLG M;  3KL4 A;  3A1Q B;  3VR9 B;  3U30 A;  2PXQ A;  2WLB A;  4YG1 A;  3TMP B;  4C56 C;  4W9F A;  4JWU C;  3MP9 A;  4PU4 C;  3VDZ A;  1NVI D;  2C7M B;  2H89 B;  3KUC B;  4YXD B;  1FM0 D;  1B1Z A;  3QCA A;  1E10 A;  4I6R A;  2WXL A;  3CSF A;  4Y42 A;  2G4S A;  1TGZ B;  2K6D B;  4P6V F;  3WAP A;  2KMA A;  4KGT A;  3JSV B;  3OP9 A;  3ENE A;  1C9F A;  2CU3 A;  2NTS A;  4ER0 A;  1MG8 A;  3KZ3 A;  2AL6 A;  2DYO A;  2OR1 L;  3DBL I;  3V62 A;  2IO3 B;  2OOB B;  2BBC A;  5DTQ A;  2IZV B;  1V5O A;  2K3U A;  4F8C B;  3Q3F A;  2KPJ A;  2FE8 A;  4KIK A;  4A55 A;  2LHE A;  1M4V A;  2GLS A;  2KZ8 A;  3DCG A;  1WRD B;  4NAM A;  2MX2 A;  3DWM A;  3RMK C;  2DZM A;  3KLS X;  2PXL A;  3BWU D;  5TSS A;  4IDI A;  1G6J A;  2JU6 X;  2RMM A;  1WSP A;  2RSU A;  1GAQ B;  1XO3 A;  3NZS A;  4MCX A;  4FHJ A;  2BYT A;  4Z5C A;  3ML9 A;  4PYZ A;  2NCN A;  1ET6 A;  4WUR A;  2EEL A;  3GZC A;  2Z59 B;  1T0S C;  3SFD B;  2FID A;  2N7D A;  2QMT A;  3AEE B;  1T0Q C;  1N6Z A;  2BF8 B;  3HK0 A;  2PUC A;  1ZP0 B;  3N32 A;  4EUT A;  2FJR A;  1I4P A;  2JZZ A;  4HPM B;  3AM9 A;  2FNJ B;  2G45 B;  2CHW A;  2WXQ A;  2D3B A;  2M17 A;  4IW0 A;  5E6J A;  1S7E A;  4D2K A;  2O6V A;  3AE7 B;  1FXA A;  4JCY A;  1WI0 A;  2MCN B;  4EZL A;  1WYG A;  4EOY A;  1NW3 A;  2PUF A;  3PSE B;  1QOA A;  3KWV A;  4WAA A;  2LWP A;  1GOZ A;  1EUV B;  4RF0 A;  3OWE B;  2JF5 A;  3UQB A;  3AU4 A;  3R2I A;  2L76 A;  4IWQ A;  1IBX B;  1E90 A;  1NEN B;  1OFF A;  2QHO A;  2V3P A;  3LQX A;  3TEP A;  4J1X A;  3HM3 A;  4TKN A;  2JY6 A;  3DVN V;  5DT2 A;  1C4C A;  2BW2 A;  4DHJ B;  1JRP A;  4DHZ E;  1YN4 A;  2AXU A;  4WIP A;  4OHJ A;  1QP4 A;  4KKJ A;  3DDC B;  2PIJ A;  4ZRK A;  2L8N A;  3K9O B;  4EK9 A;  1WGK A;  3FIL A;  2ZVO A;  4I6P A;  3CIR B;  4KSK C;  3BK2 A;  1WZ3 A;  2G3Q B;  1Y9Q A;  2IPK D;  5IAA C;  1DUL A;  3T3N A;  3UFD A;  3ZVV A;  3QA8 A;  3S2A A;  1WX9 A;  2C7N B;  1E3O C;  4IWR A;  2GI9 A;  2L1A A;  1ACC A;  3KXA A;  2BWF A;  1YIW A;  5AUI A;  3ZXV A;  3M62 B;  3KW5 B;  2K0P A;  3W9C B;  2WDV B;  4B9K A;  1TYG B;  2PLP A;  1NI2 A;  4I6L B;  4NAW A;  3A9Y A;  3NG0 A;  2ONQ A;  2LYK A;  2IGD A;  4ACF A;  1I4G A;  1Z5S B;  4GDL B;  2KN4 A;  2NPT B;  2UYZ B;  2ICP A;  5KHQ A;  2CRO A;  2LNM A;  3ZNH B;  3E56 A;  4FUL A;  3LIS A;  4K3B A;  2KTF A;  3ME5 A;  1Q10 A;  2JX5 A;  3B0A A;  1QQB A;  1I35 A;  3PZ8 A;  3ZJU A;  3EUB 2;  1E8Y A;  2KAN A;  2EF8 A;  3K9P B;  3MHS D;  1WR1 A;  4GQM A;  3VHT C;  1FRR A;  4ICU A;  5HKH A;  3LFP A;  1M94 A;  2HDE A;  4HCP B;  2PXV A;  3G7D A;  1GC7 A;  2NR2 A;  2IYD B;  3CRO L;  2AW6 A;  4EKU A; 
#chains in the Genus database with same CATH homology
 1N5W A;  2MJE A;  3MHZ A;  2RDG A;  3ETR A;  3U4E G;  3ZPX A;  1JWS D;  1TY2 A;  4ARC A;  3TEL A;  4N58 A;  1J7B A;  1L0V B;  1RFK A;  3WCQ A;  1NI3 A;  2WU5 B;  2WXR A;  3B2G A;  3V05 A;  2PMV A;  4PT5 A;  1QIL A;  4H2A A;  1SJE D;  4EKG A;  2RPV A;  2WXN A;  1D5Z C;  4HRA A;  4TMA B;  2BS3 B;  1AYF A;  1HZ5 A;  5H8Y E;  2Y5C A;  5G5G A;  3VQI A;  3W1S A;  2WXM A;  3LXF A;  2IGG A;  3DWG C;  1SF0 A;  1XXG A;  2ON8 A;  1I7H A;  4Q2J A;  1BUI C;  3U7Z A;  4RGO S;  5DSX A;  1YQ3 B;  2RDH A;  1DGJ A;  5D7G A;  3GZD C;  4DE9 A;  1I4R A;  3OWQ A;  1JWA D;  3MJ5 A;  2WXK A;  5JXV A;  1V97 A;  1BXT A;  5HG2 A;  4AQ7 A;  3SX0 A;  1PDX A;  4IKG A;  3BZD B;  3IAM 1;  2JZP A;  5BMH A;  1AN8 A;  2YEP B;  3EGR A;  2ODR D;  3AE9 B;  3ABV B;  4KGR A;  5BMI A;  4LK0 M;  3BK1 A;  3BYY B;  1ZOY B;  2J53 A;  4TQ1 A;  1EU4 A;  1ZE3 D;  4MM3 B;  4RNA A;  4WAF A;  2M19 A;  3TEZ A;  1E9M A;  2WNM A;  1D5M C;  3A9Z A;  4DE8 A;  2MJ3 A;  2SAK A;  2YEP F;  1ESF A;  1DOI A;  3H8H A;  4OBM A;  2JSV X;  4EKI A;  3NVW A;  3MFG A;  3UWP A;  1STE A;  2LLW A;  1VLB A;  1SBB B;  1YN5 A;  4ZHO A;  1OQQ A;  1TKE A;  2CJN A;  3VR8 B;  3G0T A;  2QIL A;  1FIQ A;  4WVL A;  3GS2 A;  1T3Q A;  4N59 A;  1Y56 A;  2E3T A;  2LJI A;  2J7W A;  1FFU A;  3IT6 B;  1A70 A;  2FBW B;  2J4X A;  2ICI A;  4JE3 B;  1YQ4 B;  3SR6 A;  1FNU A;  4B0M A;  2B76 B;  1AWD A;  1FRD A;  1I4H A;  1V1P A;  4REZ A;  1JRO A;  4J3O D;  4OZC A;  3ZQ4 A;  1ET9 A;  3RFZ B;  4YTP B;  3NZL A;  3FC4 A;  4HRS A;  5DRT A;  1E0Z A;  1BML C;  1L6V A;  1RYJ A;  2WS3 B;  3AE5 B;  4LTU A;  3T3O A;  5JUW A;  4HKZ E;  1HZ6 A;  3QFI A;  4YTM B;  2KAC A;  3AEF B;  1L5P A;  4C80 A;  3AH7 A;  2YBD A;  1QOB A;  2N9K A;  3AEC B;  4M0W A;  4YSY B;  1VZ7 A;  1XCQ L;  3AMZ A;  1ZXH A;  1K51 A;  1XLP A;  1IUE A;  3P4R B;  3J9C A;  3KWL A;  1U2Z A;  2N0S B;  2LEK A;  3R09 A;  3NRZ A;  3GP7 A;  4EQZ A;  2BTE A;  4KKI A;  2I38 A;  4R3D A;  4O1N A;  3QOX A;  2VZK D;  3IT4 B;  1HQR D;  1KRH A;  2WXO A;  1WXQ A;  3NUH B;  1CJE A;  1CQV A;  4OVZ A;  1C76 A;  2L1P A;  3SFE B;  4WQM A;  2HCS A;  5T8I A;  1JAL A;  1SE4 A;  3PZ7 A;  2ACZ B;  3U52 E;  4KGS A;  2W54 A;  3I57 A;  1PGA A;  4USA A;  3NVV A;  2LUM A;  2AQ2 B;  3Q8B A;  2LLV A;  1C4P A;  1TS3 A;  1UNS A;  4A6Q A;  2KDM A;  3HRD D;  2ZW1 A;  5MPO A;  1J7C A;  1MI0 A;  2INP E;  4WH4 A;  1QF6 A;  3P4S B;  3A9X A;  3TEW A;  4CQN A;  4L23 A;  2BS4 B;  3KQ4 A;  1C4A A;  1TS5 A;  1OQR A;  5GXG B;  3U2S C;  2MEK A;  3FIL B;  3BII D;  1ZUD 2;  2WP9 B;  4L1B A;  3NXH A;  2NTT A;  1UGJ A;  2DLB A;  2L83 A;  2IDY A;  2LFI A;  2INN E;  2PTL A;  1EU3 A;  4ZYS A;  1ROE A;  1JML A;  1TKG A;  2CJO A;  2LGI A;  2WDR B;  4YSX B;  3M9L A;  1TZO A;  4A90 A;  1JWU D;  3P63 A;  1SJH D;  3AEB B;  1JCK B;  3EA6 A;  4OZA A;  5BYR A;  2HCN A;  4XWT A;  4NZL B;  1RM6 C;  1SIJ A;  1D4B A;  2WXP A;  2BB5 A;  3TFL A;  1N60 A;  5FR3 A;  1XF5 L;  2V3N A;  4ER6 A;  3MEJ A;  2ZW0 A;  4P16 A;  3P1M A;  2IJ0 A;  4NAW B;  3HUI A;  1XEE A;  2PVO D;  2VZK B;  3VWS A;  1LO5 D;  3AEG B;  1GB4 A;  3P4Q B;  2WXG A;  1NEK B;  5C3J B;  2N7J A;  2Q5W D;  4IOI E;  5C2T B;  3B9J A;  3B2F A;  3BVM A;  2M56 B;  2W82 A;  2OHF A;  4YSZ B;  4UDU C;  1JWM D;  4RCO A;  1L0Y B;  3HVD A;  3Q8A A;  1FMA D;  3NVZ A;  4LLG M;  1FNW A;  3IXS A;  3VR9 B;  1B9R A;  1V8C A;  3CWI A;  2WLB A;  1YN3 A;  3BYT B;  4ZHP A;  4C56 C;  3AE3 B;  3BVZ A;  1C79 A;  3NZ3 A;  4DXF A;  4A8X C;  4JWU C;  2WXH A;  3MP9 A;  4DQO C;  1NVI D;  2H89 B;  2WXJ A;  5HI1 A;  4YXD B;  1FM0 D;  3LYY A;  1B1Z A;  3O13 A;  1E10 A;  2N9L A;  5HHD G;  1D6E C;  1N63 A;  2K9X A;  2Y5P A;  5BMG A;  2PVG C;  1UWX A;  4HKQ A;  1CK1 A;  1K50 A;  2WXL A;  3VRA B;  1WRI A;  1E6E B;  2JQR B;  4P6V F;  2DWQ A;  3ZJT A;  1NYQ A;  4RH6 A;  1D5X C;  2R61 A;  4KGT A;  3VRB B;  2MH7 A;  1ENF A;  2CU3 A;  2NTS A;  4ER0 A;  3BVG A;  1C9F A;  4JWS C;  2DYO A;  2K22 A;  1QT9 A;  4C7Z A;  1FO4 A;  2AX5 A;  2HFZ A;  2V4I B;  1VR9 A;  1UUP A;  4HEA 1;  1TS4 A;  2BBC A;  3N9Y C;  5DTQ A;  1CZP A;  2K3U A;  2WDQ B;  2LHD A;  1XLQ A;  2G9H D;  5LNK 1;  2IGH A;  2FE8 A;  1SSN A;  4A55 A;  2LHE A;  4YWG G;  3LB8 C;  1JW9 D;  1M4V A;  1K53 A;  1T5X D;  3TUO A;  4ARI A;  1FFV A;  1K52 A;  4US9 A;  1T6B X;  5EE0 A;  3C8Y A;  1EWY C;  2W3R A;  4NAM A;  2PW9 A;  3DWM A;  3PE5 A;  2BB6 A;  3KLS X;  2K5P A;  1SXT A;  2GRI A;  2I2Y A;  3BWU D;  5TSS A;  4IDI A;  1F0Z A;  2JU6 X;  2RMM A;  1WSP A;  4WWM A;  1XLN A;  4ZRP A;  3Q8E A;  1GAQ B;  2GB1 A;  1XO3 A;  4C7Y A;  4XDC A;  1KLU D;  2W3S A;  1VZ6 A;  3AE8 B;  2BYT A;  3IAS 1;  1ET6 A;  2TSS A;  4WUR A;  2EEL A;  1R7S A;  3GZC A;  2V0G A;  3GUU A;  5DTR A;  2MJD A;  4JPS A;  3SFD B;  2QMT A;  3AE1 B;  1VRA B;  1NYR A;  3AEE B;  1P7F A;  4NJC A;  3AE2 B;  2QSD A;  1DOY A;  2J7U A;  1V1O A;  1ZP0 B;  2KAJ A;  4MT5 A;  3HVZ A;  1I4P A;  2X38 A;  1L6U A;  4L2Y A;  2WXI A;  3NVY A;  3AM9 A;  4AS1 A;  3QOW A;  4ER5 A;  2WXQ A;  1ZDX A;  4YT0 B;  2M4H A;  2HTM E;  4DXG A;  1YJJ A;  2XXQ A;  4MH8 A;  2XN9 C;  1YJI A;  5E6J A;  4D2K A;  3OKZ A;  2KMM A;  3Q69 A;  1FXA A;  1FCC C;  3AE7 B;  4FXC A;  2JXT A;  1L0X B;  3FAH A;  5BYS A;  3AE4 B;  1EM7 A;  1V1P B;  5I4D A;  2D5G A;  4GLS C;  2WQY B;  2VEO A;  1WYG A;  4GDK B;  3PO0 A;  2JWU A;  1F77 A;  1GB1 A;  1NW3 A;  1QOA A;  3AV8 A;  2JYT A;  2QEJ C;  1EWC A;  1KLG D;  3KWV A;  2AQ3 B;  1SE3 A;  1UWM A;  2J42 A;  3P42 A;  1GOZ A;  4OZB A;  3Q8C A;  1PGB A;  4RGT A;  3OWE B;  4RF0 A;  1TS2 A;  2BT6 A;  1KH0 A;  5D3I B;  2DYM A;  5FK9 C;  3AN1 A;  1N5X A;  3R2I A;  1FNV A;  2JYE A;  1IBX B;  1JWB D;  1NEN B;  1QKZ A;  1OFF A;  2Y3A A;  3GB1 A;  4B0E A;  2V3P A;  5H92 C;  2FUG 1;  5FKA C;  2M0A A;  2PIA A;  3TEP A;  4RGM A;  3AED B;  5BYQ A;  2SEB D;  3I9V 1;  1QQR A;  1PGX A;  3W2D A;  2EKI A;  2W55 A;  3UI3 A;  3SR4 A;  5DT2 A;  1ZXI A;  3Q8F A;  4A9A A;  2PKO A;  4ZRQ A;  1C4C A;  1MHH E;  1PYW D;  1KF6 B;  2BW2 A;  1TY0 A;  2LMC A;  3P4P B;  1JRP A;  1YN4 A;  4WIP A;  1ZDV A;  1YNT E;  4KKJ A;  4OHJ A;  3R2T A;  1PFD A;  4JX1 C;  2H88 B;  4OW0 A;  4EK9 A;  1WGK A;  3FIL A;  5G5H A;  1XCT L;  3GZD A;  3CIR B;  3W5V B;  1L4D B;  3BK2 A;  1F2R C;  1WWT A;  2IPK D;  3R8B A;  1AW7 A;  3ZJV A;  1VJK A;  3TSS A;  4XWW A;  2KQ4 X;  1SE2 A;  3URY A;  1VDV A;  4XDD A;  4YTN B;  3T3N A;  3AB5 A;  1HXY D;  3AEA B;  1N62 A;  4ITK A;  3V3X A;  2MXD A;  3NS1 A;  3ZYY X;  2NMQ A;  3ZGZ A;  2XNA C;  3NRO A;  4KX6 B;  2GI9 A;  5D3D A;  2E6X A;  2L1A A;  4EZI A;  1ACC A;  4N6E B;  5DRY A;  2DBY A;  4TSS A;  1MPE A;  2G1E A;  1MVK A;  1FXI A;  2BS2 B;  1FD6 A;  4HJG E;  1KFY B;  1C77 A;  1ZPS A;  5AUI A;  4RFB A;  1P7E A;  3TEY A;  1JQ4 A;  4EE2 A;  4ER7 A;  1MHX A;  2K0P A;  2Z8L A;  2WDV B;  3W9C B;  1TYG B;  2PLP A;  1SB3 C;  3A9Y A;  1GPX A;  2KWD A;  3TEX A;  2WU2 B;  2ONQ A;  1QOF A;  2IGD A;  1I4G A;  4GDL B;  1HEZ E;  1TJE A;  4ZOH C;  1J7A A;  2KN4 A;  2XXP A;  1IGC A;  2AQ1 B;  4HRO A;  5AUK A;  3MC0 B;  1E7P B;  4RGN A;  2LNM A;  3E56 A;  4MAC A;  2QIE B;  1IBX A;  1I4Q A;  1F2R I;  1YMH E;  3ME5 A;  1Q10 A;  2JX5 A;  2WXF A;  3L4P A;  1N61 A;  1HA5 A;  1C78 A;  3E9S A;  3AE6 B;  3PZ8 A;  3ZJU A;  5EE9 A;  1PUT A;  4RF1 A;  3EUB 2;  1TKY A;  5HFY A;  2J52 A;  1SEB D;  1DYQ A;  1VZ8 A;  1L4Z B;  1FCL A;  1FRR A;  1I4X A;  2L52 A;  4TQ0 A;  5DTM A;  2HDE A;  1RWS A;  1FEH A;  3RPF C;  1IGD A;  5EE1 A;  4US8 A;  2QJL A;  2L32 A;  4XE0 A;  2OED A;  3W5U B;  4ER3 A;  1QOG A;  1DOX A;  1KTK A;  1QLB B;  5EE3 A;  3SEB A;  1XLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...