4Q34A

Crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
321
Chain Sequence
ERVLMVDEQGSFAVGGTVLVDSLGHTFHGDHAYVFYQKPVGARKYPLVFAHGVGQFSKTWETTPDGREGFQNIFLRRRFCVYLVDQPRRGNAGRGTESVTISPAFDEEVWFNRFRVGIWPDYFEGVQFKRDKETLDQYFRQMTPTIGTTDFEVYSDAYAALFDKIGPGVFITHSQGGPVGWNTLLKTRNIKAIASYEPGGAVPFPEGQLPEEAKFITLSKKMEGIEVPMSVFMEYTKVPIVIYYGDNLPETDERPELYEWTRRLRLMKIWAKMLNDQGGDVTVIHLPEVGLHGNTHFPMSDLNNIEVADLLSEWLHTKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative esterase (BDI_1566) from Parabacteroides distasonis ATCC 8503 at 1.60 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Hydrolase
molecule keywords Uncharacterized protein
total genus 99
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q34A00
1L7AA 4KE9A 4N5IX 3IUJA 5AI4A 4JNCA 1XRQA 3H19A 2WIJA 2VAVA 4WJLA 4YX9A 1FJ2A 5KWIA 1W4LA 3HZOA 1GQSA 3R3VA 3O4JA 3QH4A 4HZGA 4AO7A 1QOZA 1BRTA 4UHDA 3G9XA 3IUNA 3ANTA 2CMFA 1QFMA 2RHWA 4GEGA 1ZD3A 3PUHA 3W06A 4ZI5A 2C4HA 1IUPA 1QIGA 2WFZA 5EHNA 3CCBA 1P0IA 4PSCA 4CG3A 2HA3A 2XUQA 4KACA 1UK8A 3L1HA 4X6UA 5AI8A 1MX1A 4G1FA 1MPXA 5HKBA 1AQLA 5AOBA 1K8QA 3AIMA 5ALGA 3OTQA 1FFAA 3PICA 3KDAA 2WIKA 4CIBA 4Y2UA 1GKKA 4WDRA 5ALXA 1LNSA 3RKSA 4C6HA 1H2XA 4BTLA 4H7FA 5AKXA 3G8YA 1A8SA 2AJ8A 4I3FA 4FBLA 4EY4A 3H2HA 5FOQA 2QVBA 3AUKA 3QPAA 4I4CA 2ECFA 1VE6A 3BIXA 5AM2A 2G5PA 3WK6A 2V97A 2ZYHA 4BRSA 3EQ7A 4ZV7A 5JD6A 3IIIA 3DL7A 3B3QA 1WM1A 4F60A 4MQLA 1QO7A 2HA7A 3T4UA 3L1JA 5ALOA 5K3FB 1YAJA 4A5SA 1ZJ4A 1DINA 1CUEA 2J3QA 1HQDA 2YH2A 3WKCA 1LBTA 4EZIA 4KE8A 1XRLA 2H7CA 4UBLA 3KD2A 3QZUA 2VF2A 4X91A 5AM1A 1XQWA 2K2QB 3FOBA 3ESBA 1DWOA 1JKMA 1TAHA 1U8EA 2C0QA 2WJ4A 3DD5A 3WIBA 4UBIA 2PM8A 4A16A 4OU4A 5CT6A 2OXEA 2QJWA 2XUIA 3RLIA 4MWTA 4J0IA 5A2GA 1CUSA 3PF9A 4EBBA 3HRHA 2WTMA 1W75A 5BOVA 3OOSA 3BXPA 1G42A 2GYVA 5KBYA 2VJDA 3O4IA 3R3XA 5J3JA 5AKKA 1EI9A 3BF8A 4L0CA 3C5WP 4WY8A 1E8NA 4JYMA 1CR6A 5HQ3B 4B81A 3R3WA 4X00A 5ALHA 1CLEA 4FKBA 4B6GA 3A2MA 3AZPA 4X95A 4F0JA 3DEAA 5AK6A 4QWMA 3WK8A 1J2EA 3DDUA 3KOOA 2VTVA 2XUGA 4J0CA 3LIPA 4DMCA 1UOQA 5LP1A 3C6XA 3G0IA 5C8XA 5ALEA 1MAAA 2BUAA 4WFJA 3VXKA 3FCYA 1CUYA 4E15A 4GHWA 5ALMA 4NS4A 1X70A 1XRNA 4BCBA 4DNOA 2XQKA 3QPDA 4B9AA 4QDXA 4WCVA 3DJYA 3DLTA 5ALWA 5ISMA 5EFZA 1Q84A 5T4EA 2XE4A 4QLOA 3G9UA 3WK9A 5ALJA 4ZXFA 5K3FA 4U2GA 1M33A 2CKMA 5AKLA 4UBNA 3O9MA 1QIKA 2WU3A 4GI1A 3DOHA 2J4CA 1HDEA 1X2BA 4OB7A 1GGVA 5AI5A 1VOTA 3ZWQA 1WB4A 2XMGA 1EK1A 1OILA 1CUCA 3H2KA 1JMYA 1LLFA 5ALRA 4MEBA 3AINA 2I03A 1AC5A 5AI9A 4P9NA 4U2EA 4PF1A 5JZ9A 1EH5A 1XLVA 1USWA 2WSLA 1ORWA 1XQVA 3W05A 1EDDA 1AURA 5LKAA 4FWBA 4DMHA 5A7GA 4E14A 4UFOA 2GZSA 3F8SA 2PUHA 4FFVA 4OPMA 3DNMA 4C01A 1ZI6A 3I6MA 4XJVA 1D07A 3UUFA 3STYA 3EQ8A 1I6WA 2PSEA 2WHPA 4ROTA 4OUKX 1XZAA 1HL7A 1SCKA 5DYTA 3JW8A 3M83A 3MVEA 4AO6A 5JADA 1QTIA 4U2CA 3FCXA 5CH5A 4X90A 1MAHA 4CG2A 1XLUA 1C7JA 1LZKA 2Z8XA 3VJMA 5JZSA 3F97A 1IMJA 4YK7A 5D7BA 4HS9A 2J3DA 2PU7A 2BFNA 3WKBA 3C6BA 4QE3A 4B0PA 5HZGA 4FLFA 5I8PA 2I3ZA 2PKYX 2WUEA 4AXBA 5CURA 5CW2A 2YXPX 3A2NA 3KWFA 2JGLA 4ETWA 5LZ9A 1K63A 3DS8A 2OGTA 3VISA 4NMWA 1ZD5A 5DNUA 1GKLA 1IUOA 2QJRA 4FMPA 4FBMA 3PFCA 1MO2A 2BGNA 3A70A 4DYHA 1XZJA 3AIKA 3D0KA 4JYPA 1CQZA 2OQVA 1E89A 4ITVA 3G0DA 4YASA 2RONA 3RARA 3BL8A 1XZDA 4KE7A 3BF7A 2VJBA 3KWJA 2JGIA 4UBJA 4BCCA 4QA9A 3JWEA 3HLKA 2YASA 3DKKA 2Z5GA 3Q8WA 1W6RA 2IX9A 2I3DA 2XQIA 2OCIA 5EI5A 5ALTA 4C89A 1QO9A 4H7DA 2PSHA 3C87A 3F67A 4IH1A 2XMQA 1XRMA 1ZD4A 1J07A 4UHHA 4W63A 3I2KA 2XUDA 3GZJA 5IVDA 2UZ0A 5HFNA 1WHSA 5E4TA 5FPPA 3WWPA 3C5VA 3R40A 4M0EA 1N5MA 1E8MA 4Z49A 1CV2A 1JMKC 1J06A 3JYHA 5EHXA 4BTVA 2Y1KA 1JJBA 5JAHA 4GLBA 1Q0ZA 5AKYA 2I78A 3PDCA 3ZLUA 5FV4A 1F0NA 3IULA 2DHEA 4XWGA 1JJFA 4QNNA 3O95A 2R11A 3FVTA 5CH3A 5CT8A 5AIAA 3HABA 2EDCA 5FP0A 4DNPA 5FRDA 4OSEA 4BE9A 2IITA 1QE3A 4CFSA 4AZ3A 4AX4A 4CCYB 4A23A 1YS1X 4BB0A 2HU7A 5AM5A 2QMQA 4X71A 5EGNA 2WHQA 1ISPA 4DSZA 4L3WA 5DYWA 3E1GA 2DR0A 4EB0A 4BATA 5JAPA 5DWDA 4X7BA 4I19A 3C8DA 5K3CA 1FFBA 2R8BA 3C6YA 3UMJA 4C88A 1EXWA 1XZFA 4UFPA 5DLPA 3QBJA 1F6WA 2LIPA 2XUFA 4X93A 3NOXA 2XLCA 1ODTC 2ROQA 2CJPA 1A8UA 2XB6A 1LPSA 2JGEA 4CIAA 1E5TA 1XROA 2GBGA 1YS2X 2ZJ6A 1L7QA 2DQYA 3P2MA 4RE6A 2O7RA 1XQXA 4K6HA 1MT3A 5CXUA 3WYDA 3DQZA 1XRRA 5K3BA 1TRHA 4XX1A 1Y7HA 4PV7A 2O2HA 4EY8A 2BJHA 2HU5A 2JGFA 5AKIA 2W22A 2WIGA 4AZ0A 3AIOA 4DMFA 5I7UA 5K3EA 2AJCA 1LPAB 5AM3A 1XZIA 3WYNA 2QRUA 3WQHA 1HKHA 2XQGA 4X6YA 1YCDA 1QTRA 1TKRA 1R3DA 3WKEA 1Z68A 5DNWA 4QDTA 1JU4A 3FAKA 1UT6A 4BDTA 3I28A 1LPMA 4KYVA 2C5GA 1BE0A 5AO9A 3RK4A 4MJ3A 1IUNA 2Z3WA 1WPRA 2VJAA 3V48A 5CBKA 5CTAA 2ZYSA 1XZMA 4G8BA 1ZI9A 1CUJA 3YASA 1PFQA 2H1IA 3VDXA 2WIFA 3QMWA 3C43A 2RAUA 4B82A 2X8BA 1MNAA 3VVMA 1EX9A 4BCDA 3D3NA 1XZGA 2DHCA 3WWEA 1AUOA 5HK8A 1W52X 3FBWA 3M81A 4MXDA 4B83A 1YASA 2G5TA 3QPCA 1DT5A 2VT6A 3WA7A 1TQHA 3D7RA 5DNVA 4BYMA 3ESCA 2C7BA 2XUAA 1ETHA 5DTIA 1KU0A 1EA5A 2RI6A 4W1SA 3FVRA 1FSSA 1XZHA 5ALQA 5IVIA 3AILA 4C4XA 4ZV9A 1O6FA 2QM0A 1ODCA 3WMRA 4DGQA 3CCCA 1GXSA 1E8DA 1OCEA 2HA6A 2PU5A 4GBGA 3I1YA 5C8ZA 3A2LA 1CVLA 2WHRA 1BN7A 2CUTA 4AO8A 1QLWA 5HK9A 4BP9A 4B85A 1CUXA 1UFOA 2X5XA 3G02A 4DIUA 1XQYA 3QM1A 3EQ9A 2ZYRA 3H0CA 5JARA 5ALNA 1CUVA 2O7VA 1UKAA 3QITA 4B80A 1CUUA 4X6XA 4K6KA 5JANA 5AKJA 3FLBA 2HIHA 4LXIA 3WKDA 1J1IA 3HJUA 2JBWA 5E4JA 1UK6A 2PSJA 5AOAA 1THTA 2VJCA 1T2NA 2EEPA 1VXOA 3STVA 3ZLVA 2FJ0A 4ARAA 3O4HA 5ALYA 1AGYA 4OYLA 1R4ZA 1H22A 1CUHA 2D5LA 2WLSA 1H2WA 5LZ5A 5AOCA 2WIDA 5HF6A 1CUDA 1K5PA 1G4HA 3CXUA 2AXEA 1FFDA 3LIIA 4HXFB 1E66A 2HRQA 1LPOA 3HI4A 2XUKA 2PPLA 5EHQA 3I2JA 4Y2VA 5CRIA 4ARBA 1LGYA 2PBLA 2ZVDA 1TIBA 2ZYIA 3HSSA 3OM8A 1VA5A 2Y2VA 2ZJFA 1KEZA 4BAGA 4K6GA 4Y9SA 2RGUA 4RNCA 1A7UA 1A8QA 3H2IA 4UHBA 3PF8A 1QIEA 5AH0A 4HTAA 5LIPA 4OU5A 5LZ2A 5FDFA 2VQ6A 1YR2A 1N1MA 4IH9A 3VJLA 2WFLB 1EVQA 4PNZA 3W9BA 5AKHA 4YPVA 2ONCA 4EY5A 1F0PA 3FYUA 4RGYA 1ACJA 2JGKA 2WG1A 4EHBA 3B12A 4FDMA 1GPLA 1L7RA 2OQIA 4E11A 1AMNA 1DQZA 1MTZA 3SX4A 5KREA 4IHAA 4N5HX 1R9MA 2WG0A 1CPYA 1K4YA 1JI3A 4AB1A 3HEAA 2QUAA 1FFEA 4OB8A 2JF0A 5C7YA 4U2DA 4OD0A 2RIPA 2QKYA 2C0PA 5LZ8A 1QZ3A 2HM7A 4WFKA 4DSAA 5EHZA 5HF9A 4PQEA 3WI7A 3PFBA 6YASA 1JT2A 1E3QA 2HHAA 3A6ZA 1GPNA 3DCNA 1DTEA 5AKZA 2WQZA 3C45A 1LBSA 3LP5A 4QDOA 1CUAA 4H7HA 4HRYA 1XZCA 5H3HA 1MN6A 4KAFA 2QZPA 3TEJA 4H7JA 5BWCA 4QWWA 1ORVA 4NZZA 3G0GA 4Q3KA 1CUFA 5IVHA 3IUMA 5C8VA 1TCAA 2XT0A 4AN1A 3O9VA 4Q05A 2C5FA 5ALVA 1IZ8A 3SC2A 4EA6A 3F98A 3MUNA 4S0XA 4BVLA 2IIVA 4J0HA 5AJHA 3V9AA 3C8HA 1UK7A 1CQWA 2VEOA 4QDZA 2BUBA 2HU8A 3AFIA 1ZGBA 1IZ7A 1H2ZA 2OG1A 3V1NA 2XQJA 3BJMA 3K9BA 4UFNA 4B0OA 1MJ5A 1EDBA 1XFDA 2WKWA 3D2BA 1BEZA 2WJ6A 4DTCA 4OB6A 4WFIA 1NU6A 2G63A 4GECA 1RP1A 3S2ZA 5JD5A 1A88A 1BN6A 3NWOA 5A7FA 2QT9A 1QJ4A 4C4YA 5DYYA 1THGA 1YSCA 3STWA 4Y2YA 1Y37A 2DSNA 1ZOIA 3I2GA 1CRLA 2H7YA 2W6CX 2GBFA 3L1IA 4F5ZA 4FOLA 1YB7A 2WJ3A 4B7ZA 2BCEA 3U0VA 1YAHA 2XMSA 5HFAA 4PSDA 1BEEA 2O2GA 4H7EA 4Y2TA 4LIPD 1ZJ5A 2NW6A 5A6VA 4UUQA 2GYWA 4GXNA 5K3AA 1R9NA 3KSRA 5HQ3A 5T4FA 2WILA 1QIHA 1LPNA 3PE6A 2AJDA 2B20A 4D9JA 2O2IA 1UK9A 3MGAA 3H1AA 4Y2SA 4UHCA 3TRDA 4W1RA 1F8UA 1XZEA 2HRRA 4J03A 4KRXA 5SYMA 3BDIA 3K6KA 1SFRA 4ZRDA 3HACA 3VKFA 5ALIA 5BV7A 4JEIA 1XLWA 2V96A 3T52A 4JH0A 5CH8A 3WL5A 3Q0TA 4ZREA 2ORYA 1NX9A 4H35A 2WM2A 1YB6A 4G4GA 3F96A 3I6YA 1B41A 3QYJA 1ZIXA 1CIJA 2ZJ7A 4KR0A 3OPMA 4UHFA 4J3JA 2OLEA 1ODSA 3AZOA 1GT6A 3CN9A 1ZGCA 2QOEA 4Q1VA 5FXMA 1TCCA 3AJAA 4U2BA 3UUEA 4ZGBA 3R3ZA 3R0VA 2OPHA 5FLKA 2JEYA 3ZV7A 1WPXA 3G9TA 3R3UA 2H7XA 3IUQA 1U65A 5FKJA 1UXOA 2XQFA 1IVYA 3N2ZB 4P93A 3H1BA 2OCLA 4W1QA 3K2IA 1P0PA 4LXHA 5BWBA 2DHDA 1ZIYA 4HAIA 1N8SA 2HA4A 4RPCA 4UHEA 1WOMA 4F21A 5DJ5A 1U4NA 3HXKA 1T4MA 1UZAA 3OC0A 1DX6A 3I6ZA 4FTWA 2XMZA 2DQZA 3BJRA 1QFSA 5AKEA 5AI6A 4P92A 3I2HA 2C58A 2EDAA 1C7IA 1YA8A 4K5QA 1DT3A 5LKRA 2PL5A 3V1KA 2AJBA 3WWDA 3GA7A 1H23A 3WJ1A 5JATA 1JFRA 4G9GA 4X92A 3IB3A 5ALFA 1MX9A 2CEKA 5K3DA 3WZMA 5JYCA 2V98A 4Y7DA 4BRZA 5D3KA 5ESRA 4AMYA 5AP9A 3HYSA 2B4KA 1QGED 4HVTA 4EY7A 5A7HA 1RYYA 3GELA 3F9CA 4JUIA 4DMKA 3H17A 2XUPA 1LZLA 2VATA 5AIBA 3I1IA 2GBCA 2HDWA 5A62A 5ALSA 4KAAA 4X3CA 5JAUA 1VKHA 2WHPB 3FLAA 1XZBA 2QXUA 4M0MA 4BVJA 1G5FA 4FHZA 2YYSA 1HBJA 1BS9A 1KU6A 2QS9A 3FYUC 4PW0A 5CXXA 3H2GA 3D2AA 1CUBA 5E4YA 3SK0A 3D2CA 1Q83A 2CB9A 3FNBA 5JD4A 5JAOA 1BCSA 4CG1A 2WU4A 3LCRA 3HC7A 1ZD2P 4H18A 3H2JA 2Y2UA 7YASA 4NVRA 5CT5A 5IKXA 2BGRA 5ALKA 1CEXA 2V9ZA 1O6GA 3SWWA 4KRYA 3D59A 3C70A 1P0QA 5FUMA 1X2EA 2XUOA 3BIWA 3IVMA 4QDUA 1JJIA 5CMLA 4E46A 3WWOA 1QIJA 1H2YA 4BZZA 5EIEA 4PO3X 2PX6A 4B84A 1ZI8A 4KEAA 2PSDA 1ACLA 4L72A 3FYUB 4L9AA 3D5EA 5HCUA 3W04A 2G4LA 1PJAA 4DLNA 1S8OA 3M82A 2ZSHA 3E0XA 3U1TA 2QXTA 5K5EA 3LLCA 3E4DA 1TK3A 2WTNA 4G8CA 4BBZA 5SYNA 2QUBA 1OXMA 3WL8A 2OCKA 3G0BA 4BAUA 4IH4A 3ICVA 4HRXA 4O08A 3ANSA 4MQMA 4N8EA 4MYSA 5EIAA 2RHTA 4M0FA 5ALPA 4UBOA 2XMCA 3ESAA 4OYYA 3EBLA 4WY5A 3WLAA 4Q82A 1ZICA 2ZSIA 1EB8A 1W1IA 1EHYA 3E3AA 4EY6A 1XKLA 4Y2QA 2XMDA 1LPPA 1QIFA 4LKOA 5LLSA 2XUJA 3MUOA 3GROA 3BE8A 3BDVA 3I2IA 4H77A 4LYEA 4Y2JA 5F4ZA 4LYDA 3STXA 4FNMA 5D3ZA 3LS2A 2HA5A 3EF3A 1SCIA 4BAZA 3PI6A 3BWXA 2JIDA 3FYTA 4LHEA 1C4XA 3WK4A 2X76A 5AK4A 5LYYA 2HFJA 4BZWA 4K2AA 2HA2A 3WK5A 1W76A 2OGSA 2PVSA 2WUFA 3H04A 1R50A 5HF5A 1JU3A 1WB5A 3S8YA 1P0MA 1WB6A 2B61A 1UKCA 4KAJA 1VXRA 2BKLA 3X3HA 3FSGD 5CT4A 2XUHA 2P8SA 4BC0A 4XIIA 1DWPA 3IDAA 4G4JA 1WCYA 1CUWA 3N0TA 3GUUA 4CCWA 1R88A 4ZWNA 3C6ZA 1LPBB 1BU8A 2PSFA 1EVEA 4W9RA 1SOMA 4XVCA 3WKAA 4BC1A 4GDMA 4KJXA 1CUGA 2CZQA 3QVMA 1DX4A 4HXGA 1EINA 3WIOA 2E3JA 3GFFA 4CCYA 5YASA 2WUDA 2Z3ZA 2OAGA 2OCGA 4KE6A 4GW3A 4BVKA 3W2TA 1DWQA 3NUZA 4TGLA 5ALDA 1BROA 3AZQA 5AM0A 3CN7A 5HF8A 5I9IA 5HKAA 1QIDA 4HXEB 1R1DA 3G9ZA 1MU0A 4J7AA 1DQYA 4UBMA 1FFCA 5AK3A 2JGMA 4FLEA 3ED1A 3NGMA 2WG2A 3STTA 4DNQA 3STUA 3DL4A 4J0JA 1UOPA 3VVLA 1HPLA 3TJMA 4X97A 2Q0XA 5T4BA 2B9VA 3ILSA 5AI0A 5JALA 5E2IA 2Y6UA 5FPQA 2D0DA 3O4GA 2Y6VA 1XZKA 1QIMA 3R41A 4FFWA 3ZI7A 2HL6A 4BE4A 4U2FA 1VZ2A 5AICA 3M3DA 4FLMA 4GWLA 2FUKA 3IURA 4UBKA 4AN0A 3KXPA 1NU8A 3R3YA 4PSUA 2JEZA 1AZWA 1CUZA 1GQRA 4G5XA 4C87A 2CBGA 4H7IA 5D6OA 3WK7A 3QMMA 3DOIA 2WFMA 4MWSA 2JGJA 3I2FA 1MX5A 4OCZA 1VJ5A 2VSQA 4MEAA 4TPKA 1VA4A 1UOOA 3B5EA 3WL6A 1BCRA 1RWQA 5JIBA 1AKNA 1DU4A 4IQ4A 3H18A 1Y7IA 2HA0A 2XDWA 4AQDA 2FX5A 1TCBA 5EIHA 4Y2RA 1B6GA 4Q34A 3OURA 4DNFA 3V1LA 4X85A 1G66A 3FWHA 3OG9A 4UPDA 1XRPA 3D4LA 1Q0RA 2QR5A 4BP8A 4Y2PA 4J0KA 1GZ7A 4EUSA 3O0DA 4G9EA 2Z8ZA 1HLGA 2XLBA 4DM7A 5CT9A 1EB9A 1N5RA 3WJ2A 5DTJA 2DCMA 3WWCA 4J0GA 4X94A 2AJLI 4P08A 4G8DA 2GZRA 2HFKA 1PV1A 4W1PA 1XKTA 3VJKA 1MNQA 1U2EA 2DFPA 1CUIA 3ZPXA 4FNGA 5AKGA 3IBTA 4Y2XA 4V2IA 4TVKA 2ES4A 1UKBA 4AMZA 2QTBA 4QLAA 1GPKA 3G0CA 3IA2A 3ZLTA 1YA4A 1XZLA 5JZBA 5C81A 5IVKA 3ICWA 1SC9A 3FLEA 3EIOA 2VA9A 5AK5A 4H0CA 2XMRA 5LZ4A 3DYIA 2WUGA 3WA6A 5AM4A 3WL7A 4J0DA 2XI4A 1QIIA 2ACEA 3TGLA 2H9YA 4CI9A 2GBIA 1SCQA 4QEKA 2OAEA 2PUJA 1EDEA 3WZLA 2ACKA 5T4HA 3GBSA 1VLQA 4N8DA 2XMBA 2VAXA 3DKRA 4N8SA 5A71A 5ALZA 3ESDA 1UWCA 4H7KA 4QZVA 5KWJA 4G4IA 3W9UA 3FSGA 5ALLA 2GYUA 3RM3A 4B9EA 2FJPA 1QONA 2WFLA 2HADA 2BUCA 5LZ7A 3PUIA 1AX9A 3V1MA 5AHXA 4MYDA 1K6EA 2BAGA 5JASA 2J4FA 4RE5A 4C4ZA 4INZA 4WDQA 1WHTA 4Q3OA 1VZ3A 5ALUA 4Q3LA 4LXGA 4BDSA 3G7NA 3QMVA 1CFJA 5IH7A 4IO0A 1EK2A 1VE7A 3DYVA 2OGZA 2VT7A
chains in the Genus database with same CATH superfamily
2OORA 3GLTA 1FUYB 5AI4A 2CBZA 2AH5A 2PXAA 1I3MA 2KHZA 2ECQA 3DHYA 4JBXA 4L4ZA 2XE8A 4L8VA 3WBKA 1XJQA 2G9ZA 3HXOA 2BDEA 4HN2A 4UVEA 3VH1A 4IDDA 3QKUA 3D5QA 4QOSA 2VAVA 1KTVA 1PX2A 4JFAA 4OJKA 4RY9A 3T0FA 1NYRA 1W4LA 2F4VB 2V4ZA 3HZOA 2E18A 4R1OA 4MCJA 4CZ2A 3B6JA 4I1VA 2WF6A 2OXRA 3ZN2A 3TNDA 4UU7A 5ECDA 1EFLA 3EWNA 5BRNA 2ZSBA 4HDSB 4M7OA 2OZPA 1DOHA 4C6SA 3ZI4A 1O8BA 2YIDA 2C04A 1Z5GA 2GPBA 4E31A 4AK9A 1T2DA 1VLJA 3HXTA 3L5OA 2Q2WA 4GXTA 1ZM3A 3ZBQA 1X9GA 4IGAA 1JFFA 2GPYA 2I65A 3OZBA 1M67A 1S2IA 2I2WA 4BVGA 3QU4A 4KQ1A 5DM2A 1CRZA 3AKEA 4BNGA 2VUHB 3WDSA 1KK3A 1TLTA 1ZVVA 1YZGA 2L19A 2G4CA 3NDPA 2IODA 4MYHA 4RA9B 4FPXA 5JXIA 1JEYB 3GH3A 5KTSA 1T2VA 3A1UA 3G2PA 3W06A 4ZI5A 3EA4A 4JROA 1HTTA 4E88A 1JAZA 2ID7A 4OHWA 2FQ1A 3QNWA 2QTFA 3LT5A 2WI8A 2AFIA 1KVSA 1UEIA 4H6WA 3VOTA 3ZE1B 1O5OA 1D2EA 3KZKA 3P0FA 3HV0A 5GJCA 5K8JB 3FPLA 2DLNA 3IIJA 3ZIAA 1U1EA 2IEDA 3KT0A 4WCFA 1NG9A 1SRQA 1V7CA 1YS7A 4H1TA 4DR3B 1IN1A 4LYHA 1UK8A 4PC3A 5DLEA 2V5VA 3L1HA 2JC3A 2QZZA 3Q11A 5L3QA 1MX1A 1MPXA 4TMTA 3TG2A 3UAOA 2WWWA 1M1YA 1GPAA 2VIIA 2I3BA 4NFHA 3NFRA 2RBKA 1EQ2A 3KQMA 1AQNA 5AOBA 3RYHA 4YQFA 2REBA 3SKXA 4ABTA 3TIXB 1Q20A 3IOCA 4S1VA 5A4AA 2GTPA 3AIMA 1PEAA 1JI0A 4QUJA 3JYQA 3RYTC 4YI3A 3A6HA 4PICA 1HFWA 2BM8A 3HCFA 1JYSA 1OYOA 1QKJA 1T0IA 4H1HA 5C7LO 1UZUA 1MV5A 2V4UA 1NYQA 3WGJA 3MTQA 3OZWA 4RD1A 3UN1A 1OFTA 3R09A 5ILGA 2GPJA 5B7PA 3ZQJA 4A36A 3KUXA 4MGKR 3RKSA 2NVWA 2GCOA 4OKSA 4Y9DA 5J4HA 4ZYYA 1HA3A 2IYUA 3G8YA 2FI1A 1RWMA 5FLEX 3L7AA 2QL6A 2ENUA 4LGVA 2HKIA 3VZSA 4YECA 1N78A 4RUKA 4ZAXA 3BBLA 3H2HA 3MRVA 5FOQA 4EB6A 5A6SA 2Z4SA 1HE8B 1YBAA 1Z4LA 1YJBA 2HQRA 2P7HA 3DE5X 4NQZA 3MRSA 5FI5A 4B6JA 3QWAA 4I4CA 4O4IA 4OQLA 1ZM7A 2ECFA 3WGNA 3DLAA 1I94B 2QG4A 3VO9A 3O9ZA 4L6AA 3T5GA 5H02A 3D43A 1NF9A 5IYZF 4NDAA 3S55A 4BO4A 2AE2A 1C1DB 2ZTMA 3VOAA 5AM2A 3GLQA 2CL5A 2AUMA 1K6IA 2P2DA 2Q99A 3Q7SA 4ZOLA 3VYRB 2CFIA 3WK6A 1WDMA 1MC1A 2XY4A 5CM8B 5A5EA 1ZXLA 1CQPA 3EQ7A 2QP3A 3QVUA 2O52A 1UXKA 4DZTA 4ND4A 4NOJA 1L3IA 4HPWA 5EVCA 1MAVA 2BBOA 3RAEC 1TK2A 1G59A 4GYWA 4JUAA 1JDBB 3NH6A 4ND7A 1T9HA 4GX5A 4JEHA 4S12A 1N2BA 3L1JA 4I5IA 3P1JA 3ZKAA 4F1WA 1QU3A 3C3PA 1T3LA 1V6AA 2DWUA 2PWBA 4KQEA 4P4NA 1P9RA 3SHVA 4WECA 2CCJA 4G85A 2ST1A 1YAJA 2PG3A 3RJZA 4L57A 4DR2B 3UGTA 4MUNA 1WXXA 1A9TA 1ZJ4A 1QC5B 3H8SA 1BNCA 1DINA 3A1FA 1KRWA 1JPUA 1CUEA 2Y92A 2C00A 2YQ5A 3EH1A 3HDQA 3O7MA 1XTBA 1W87A 4K9NA 5AMXA 3L8GA 3NHLA 1ST2A 4KPFC 4KBGA 2DH6A 4PVDA 4B71A 1W0KD 2NPOA 5H1YA 4BFLA 1XRLA 5KNCA 5B58T 2VF2A 3A06A 5FBVB 1SOUA 2IXBA 3C98A 4FOPA 3OEYA 4PBTA 1D6JA 3MCVA 1FNMA 4JLBA 2K2QB 2YOHA 4M98A 3FOBA 4U9IS 3SS9X 2AUTA 1NJSA 5TF4A 1DGQA 3UMGA 1HQYE 3AUUA 4NCAA 2H0QA 3DD5A 2HW8A 4KI7A 4KHZA 2D0PB 3B1WA 5CNIA 4XIGS 4JI5B 2DPHA 3SDZA 3WYGA 3ZWKA 1SXJC 4AMVA 3LI2A 4MICA 4RTLA 4XYMA 1ATZA 1N2ZA 4CKYA 4MWTA 4MEJA 3JR3A 5DP2A 5JI3E 1O7JA 3MD9A 4YRJA 5LU8A 1FSGA 2Y0PA 2CHVA 4PHTA 5E7QA 5EL0A 5IN5A 1JZSA 5IHXA 1IJBA 1RIFA 3PF9A 4DMUB 1N9GA 1Z39A 3HL0A 5CHYA 4BASA 2ATEA 3FGNA 4NCXA 3IAXA 4BNMA 1W75A 4ZJPA 4N3NA 1BMDA 1ODKA 5AESA 5ULLA 3OOSA 1E77A 3JVIA 3BXPA 2Z57A 3L6OO 4M1MA 5F2OA 4HQLA 2RGNA 3WXMA 3SSAA 4PN3A 4Z4GA 1P0FA 2IY7A 1EI9A 3W8FA 3BF8A 4L0CA 4LZWA 3RYCA 4GZ6A 1P1CA 1YS6A 2ZBUA 1D8TA 2OMEA 5HQ3B 4Y3UA 4HYTA 1PV2A 4D9EA 1Z34A 3UPTA 4G0ZA 3VOBA 3HXQA 1JQBA 3H5NA 2X0NA 3HJAA 2WEKA 2WHXA 3CBGA 2QX9A 3EIUA 2ZUTA 4I3HA 4JYCA 4I1PA 1Z56C 5FAKA 3OZXA 2B1GA 4YP7A 5LXTA 4B6GA 3A2MA 2BCGY 4IJ6A 1P7CA 2RSLA 2WF5A 4IUBS 1WNTA 3AF4A 5CVVA 4EABA 4EL0A 5HKOA 4PONA 3L02A 4AUMA 1VJDA 5TEVA 5KNLA 2ZE5A 2ZR9A 4L5YA 2IDJA 2WJVA 4YQYA 1DP4A 1K5GA 1T13A 3ZTYA 1IH8A 3JQ6A 2W6IA 3PX7A 2D8AA 1A2QA 4F45A 2QMHA 1U11A 1GG8A 4HDNA 2JFUA 4QWMA 5AK6A 3RABA 3RROA 3WK8A 5AVTA 5JXHA 4YO7A 1OR8A 1OX6A 3FM9A 3GLSA 4KV9A 1J2EA 1TUIA 5HWSA 1KMHA 3CO0S 4IMRA 1XD2B 1NBOA 4IVQA 2RK4A 1JIQA 2H3HA 2W5UA 3GPBA 4O2AA 2NT3A 4CMCA 2JIZA 2C2WA 2IIQA 5FOUA 1HM5A 4YXFA 3LIPA 1RDFA 3VISA 2OP0A 2ID4A 4DMCA 5C35A 4BMVA 4M9ZA 3K9GA 4EX6A 3E7PA 1NASA 3C6XA 3G0IA 4LRTB 2VTEA 5C8XA 3ZCSA 4V1CB 2X2FA 1OC4A 1ZC4A 2WC1A 4UVHA 3F49S 3A4MA 4EDFA 1VPDA 1WP4A 1NFFA 4XASA 3QVVA 1J9EA 1XTUA 1YL6A 3GWGA 4DW8A 1K0UA 4I4TA 4Q16A 1UPFA 4MX8A 4E15A 4B6SA 2HUPA 6CHYA 1JDBC 1GG9A 1P7WA 1X70A 1I1OA 2DFKB 3M5CA 3BERA 5DF1A 3AY7A 1C3OB 2OB1A 1XRNA 2IUTA 3GG9A 3MJVA 3OESA 5EIFA 1EBBA 1CKEA 1E0KA 3G49A 1TO1E 4MLZA 1S3FA 2P68A 3TOXA 5LNK1 3VKUA 3B1JA 2X9QA 4GR9A 4B9AA 5B2FA 1Y98A 2EFHB 1DKMA 3SQMA 4RD6A 3LT2A 3HNPA 3OPYA 5EFZA 2DJIA 3CISA 3IXLA 4HGQA 4P7BA 2B37A 1MB2A 1SEPA 4IUCS 1X1BA 2XE4A 2FQXA 4G07A 3D6VA 5H80A 3W1EA 4I6EA 5C80A 4QLOA 3MD0A 4B48A 4EF5A 4O4HA 3TVDA 2Y1CA 5J40A 4QO7A 4QREA 4QTXA 2ONZA 4A1OA 1D2CA 4KMMA 5K3FA 1HLDA 3QYPA 4FK8A 3CF6R 4UBNA 4XAQA 2ZS8A 4R1SA 5NULA 2CEAA 5GZ6A 1AG9A 2O5CA 1B15A 4MVJD 2CGEA 3O75A 3HJCA 2PKCA 1F14A 1X2BA 3CONA 1T3HA 3I09A 3O94A 4GZ5A 3ROZA 1HDGO 3FF4A 4GE0A 3ROXA 1BDIA 4DHEA 4OB7A 1X42A 3ZKWA 1GGVA 3RBAA 4XDYA 1SQ0A 1QYRA 1KO8A 2AEFA 2VDRB 1WB4A 3GRUA 1W9HA 2C4WA 3NLLA 2XMGA 1J21A 1P1KA 1KVRA 2J3MA 1FIUA 1CUCA 1XMXA 3H2KA 1VB3A 2VF7A 4QYXA 1KDZA 4CMHA 1DELA 1UBLS 4IRMA 3G13A 1Y1SA 2H4XA 4ZCQA 2X0FA 4CL3A 4ZZIA 1ZA2A 2I03A 1OYWA 2H31A 1YUMA 1NHGA 4XB6B 3THYB 3R23A 5BMVB 1I6MA 5L3VA 2G76A 1E2DA 4MITA 4QJ3A 4YT4A 1I7NA 1RI5A 4P9NA 1V71A 3NRBA 4U2EA 2WMNB 3FUXA 5SZHB 3RYIB 5JZ9A 2JHAA 1XLVA 4NCIA 3WGVA 1USWA 2WSLA 1YFZA 1WNFA 1ZZEA 5JCJD 2KYRA 4Q37A 1C9YA 1FRFS 1ZNYA 3N2IA 2IW1A 4G41A 5F21A 3W05A 5FWDA 3AM1A 1OSNA 4G23A 5CD9A 4FWBA 2PR7A 4HDKB 3V7YA 4DMHA 3ZU2A 3LUCA 1IJFA 3D6UA 4PPNA 4DEXA 5KQLA 2XRMA 4NFLA 4GC5A 3S1AB 3FR8A 3A9UA 2WJPA 4NEGA 3LSYA 3AV3A 3EVAA 4S1NA 3U3JA 3KJEA 3FE2A 4NBKA 5T3YA 3DOJA 1P80A 3HPQA 1YD7A 5DWVA 1ES9A 5E9WA 1E9RA 3UUFA 3V1UA 1H3FA 5KX5B 4MDEA 1NE2A 2BEWB 1VECA 4R2MA 3STYA 2OBLA 5IANA 1L7NA 1I6WA 5LUBA 4X24A 1RWVA 2CD9A 3S1AA 4E6EA 3L82B 3SR3A 4DLZA 2J3KA 3V4ZA 4R4JA 4RJKA 4BO1A 3TFOA 1AOXA 1ZX1A 3NFYA 4P5PA 4RY2A 4BDTA 1E61A 2ZYWX 3ONWA 2BEUB 4IKEA 2QM7A 4V0KA 4XGIA 1XZAA 5BN4A 4C4RA 1SCKA 5LDDC 5F7JA 4ZAFA 3HKCA 3MJDA 1D0VA 1RW4A 2G9UA 2PMEA 1U8FO 4NCNA 1F38A 3M83A 4HLUC 4OBBA 1K3TA 3VVBA 4MJ7A 1O2DA 4X90A 4DNXA 2G71A 4FMCF 3SDBA 3H5RA 3HZZA 5BR4A 1M34E 1XU7A 2FVXA 4RZ3A 5CB6A 3EXIA 3NRJA 1T29A 1JKJA 1W34A 2WWXA 3V2HA 1E3EA 4JXJA 2YWCA 3QKRB 1OGJA 1A9YA 4P58A 4PG5A 2WU0A 4P2GA 3ZD9A 3ZDYB 5KU7A 2Z8XA 1S7CA 1VYTA 4E1BA 1VCHA 1VHQA 5IXSA 3PJFA 2NP6A 1Z33A 5F23A 1Z5ZA 4KWEA 1KP9A 1ZN8A 3DM9B 5I7EA 3ZIUA 1W59A 5E6SA 1ISGA 2J3DA 3AGPA 1DAOA 3VR2A 2VHZA 4O25A 1OGIA 1Y4DE 3WKBA 1TZKA 2J6IA 5TR9A 5K9ZA 1RABA 3QWFA 1A5TA 2JDID 4KFRA 4HFNA 1XU9A 4V3BA 3A6FA 4FLFA 2D3WA 5I8PA 2IJGX 5D51S 4XVRA 4NG5A 2ZLBA 1WO8A 2WUEA 4YJGA 5LQAA 3M4NA 4UCFA 1DIOB 2H5EA 3EGCA 4N5DA 4OXRA 3I04A 2XTMA 1WZCA 4D43A 4URXR 4W8HA 4NU5A 5JFOA 1P3JA 1B23P 2WBLC 3A2NA 5AVVA 2UUCB 4F3TA 4R8LA 3LMKA 4O4HB 3FPKA 3RS8A 1T91A 3K20A 1E18A 1CYDA 4JOQA 4ZTBA 2FRVA 5LUAA 4RETA 4OGKA 1F8FA 2A0WA 7MDHA 1HDZA 3K0CC 5I9NA 1M7HA 2NXNA 2ZW9A 2OGTA 4Y2GA 5KVQA 1R5NA 1XTTA 4LJ4A 1YBMA 2EZUA 3A14A 4P35A 5FBWB 2H4WA 1ZD5A 4BZPA 3AUAA 1QYVA 2VDQB 3IJ5A 2NU6A 1L7BA 3T4UA 5DNUA 5H8WA 3TH5A 3WYAA 4D3FA 1I33A 3LUJA 3RJMA 3PGLA 5JCXA 4QSMA 2CL7X 1E1RA 1TZMA 1LD3A 2QNRA 3JQRA 3S2IA 1X7ZB 4REOA 3DMPA 5K3OA 1KDOA 1XELA 3PFCA 1MO2A 1GZ4A 2BGNA 3FBGA 2CYCA 4P0QB 3ZDXB 4R0MA 2C2OA 1NVKA 3D0KA 1WD5A 2ETVA 1E99A 2WA2A 1U2TA 2OQVA 4IOLA 1LTKA 3VMFA 1JPVA 3G0DA 3BE4A 4R7TA 2X7HA 3DKVA 3IV6A 2DWCA 4YASA 5ECYA 1MRZA 3AFMA 3FPGA 2SNIE 4BNDB 3M9XA 1XZDA 1NJFA 1G98A 2WTUA 3SF8B 2X22A 5C2JB 2JGIA 4UBJA 1F06A 3GOQA 3PGA1 2I67A 5BWNA 4GYKA 3QXSA 3EXFB 1DIAA 1Y4ZA 3IAS6 3SHFA 3NTXA 1XCJA 4DLSA 1K97A 3JS5A 5TGDA 2O14A 3LHIA 3DL0A 3Q8WA 1QRTA 4HDMB 1W6RA 4U7PB 1F8YA 3C3YA 4EPWA 1II8A 1TD9A 2G9QA 2RMKA 5EI5A 5JWOA 1QO9A 1BSVA 1YK1A 3FCOA 2B9EA 3F67A 4DA0A 4DSTA 1JG1A 1ESCA 4P80A 4Q01A 1W19A 3AR4A 3KP1A 3QX8A 3VJRA 4IH1A 2XMQA 1C80A 3SBXA 3TPFA 4Q9KA 2HN9A 5CYOA 2D7JA 4Z86A 2FDXA 2WJJA 1U7TA 1XHFA 3QI2A 3K70B 3BDAA 1UMDB 1SEVA 2IVFA 4O4JF 4BQFA 4UHHA 2JASA 5AW5A 5CEEA 3IKMB 4YHHB 4NX2A 4FHCA 3UENA 2AEMA 3A9CA 4W63A 3NBAA 5A4MS 2EQBA 3I2KA 3HO6A 4ZU1X 2NV6A 3LQFA 1KJYA 3GZJA 5KKCA 4FYPA 1O6ZA 4WKPA 2VWPA 4Z9XA 2E7ZA 1W36D 4PGHA 4UPEA 1XEWY 1YFJA 5A3JA 3RLFA 2R4QA 3WWPA 4YUYA 3MWFA 1WMBA 4HT3B 4N0DA 4QGAA 3C5VA 3ID6C 4ZD6A 1NN1A 1V47A 3RSQA 7ABPA 2J30A 1Z18A 2AOTB 3ANLA 3CMMA 3L0DA 1IQRA 4QBIA 2NSJA 1QWSA 3EDMA 1MGOA 4W9NA 4C0JA 4M0PA 5CDGA 3LY5A 3PS9A 4Z49A 4ND1A 4JENA 1P0CA 2C98A 1J06A 1N2CB 2D0OB 2H17A 1MAUA 3IQEA 2C7PA 1P74A 2FQQA 2QG6A 1ATIA 4CF4A 1CZOA 5HZMA 1JJBA 2CXRA 2XT9A 3TQTA 3WG9A 3WAKA 5JAHA 4OH7A 3WTCA 2OHVA 1OWPA 2BGGA 1SXJD 1ZW1A 5JO9A 4G36A 2G1AA 1OZHA 3IELA 4JV5B 3MLEA 1J0DA 3E15A 3ZLUA 1UMDA 2GZ2A 1WQ1R 3X1ZA 3KU4A 4MUJA 2GJ4A 1IDOA 4OHMA 5E8RA 2GCIA 1FQKA 4Q19A 1Y42X 4QNNA 3CVVA 3IUPA 2XBLA 3HBLA 3NONA 2ODEA 5CH3A 5AIAA 4UAGA 5LQMA 2EDCA 3TQHA 3OQIB 4QJ5A 3OIUA 4C4TA 5FRDA 4BWVA 3ZCXA 5CLQA 3BAFA 2YV2A 4PN7A 3UPDA 2IITA 1XAGA 3FCAA 4M0KA 4CFSA 1FS4A 3GGSA 3OQJA 3F7OA 3PVZA 3W7AA 5KTOA 4Q3EA 2WWVD 2IEIA 4R3UC 1RRVA 1JW9B 2ZIXA 4D9IA 5TQ0A 4HZIA 1U7XA 1P81A 4HQOA 5JFTA 4A23A 3ON5A 2O3JA 3H0KA 3HB7A 1N7IA 2BHLA 1OXBB 3LPLA 1DV1A 4UM8B 1GN9A 5G0TA 2EBUA 2QM8A 1TO6A 1ZK2A 3D7NA 3LZCA 4LRUA 1JZTA 1MUUA 1H85A 3KV3O 1RIIA 3GRAA 4H60A 2A1TR 4V2UA 4AJEA 4IDPA 3WFJA 3B70A 2DR0A 2HV9A 1ZBQA 1G9XA 5AJVB 1MG0A 4PZ9A 1PQPA 3PQ8A 2RHCA 3FWKA 4PIVA 4UOEA 1YACA 1Y81A 4IXDA 3FXAA 5A04A 8AT1A 4CEIB 2E5WA 2R44A 2YFKA 1EX7A 1XTPA 2RBGA 2ZQ5A 3BD9A 2LP4Y 3TQRA 2X5JO 5EIBC 3L4EA 2R8BA 1OI7A 4Q3CA 4Z51A 3GEGA 4TMVA 2NU6B 2IOYA 4ZARA 2FF7A 1P6XA 1W0JA 3PUWA 2ZANA 2BTQB 5DLPA 4MAFA 1F6WA 5CIYA 3UJ7A 3FLMA 4OVKA 4QEDA 1T1JA 3AUTA 1SC6A 3NOXA 4RLQA 4MMXB 1GNVA 3E9ZA 1LI7A 4OM8A 2ROQA 1RVV1 2CJPA 4W82A 1WETA 4DMGA 1L8AA 2HSWA 1JHZA 3PUJA 4Q47A 4LOHA 3OP1A 4RKQA 1C4WA 1MORA 3WLQA 2JGEA 1IC6A 2WIBA 1E5TA 1XROA 5EXDA 3HYCA 5EY5B 3A4LA 3WGGA 1YU9A 2PA3A 3TAXA 4YTEA 3AEYA 1WCWA 3P2MA 5JNSA 2Z2YA 4DF3A 4E32A 3ZQ4A 1P4GA 4YAOA 3CIFA 4DCUA 1P29A 3L7BA 3RS2A 4ZICA 2Q07A 4KN9S 4B40A 1SO8A 3PPWA 4I9NA 3GLFA 2A4MA 3JQ8B 4D4KA 1EJ6A 1QVAA 1ZVQA 3LKDA 4RH0A 3BD8A 5EJAA 4K6HA 1V2HE 1MJHA 4KPUA 5CXUA 1UR5A 2EFDB 3ONDA 1E2NA 3D4NA 2GO7A 3DQZA 3H75A 4JB0A 2FFRA 4M76B 3LCMA 2BHSA 1QK3A 1KXZA 1XNRB 3MGBA 3UV3A 1DBWA 3CEHA 4X7PA 2XKKA 3GLUA 2WPDD 1Y7HA 1K8RA 1T3ZA 3FZQA 3DLBA 3PC2A 1GTL1 4EY8A 4EYSA 3NTQA 4Y9TA 1NI5A 2RB4A 1G3UA 3AVOA 4LJYA 3TSZA 2W42A 3JPWA 2JGFA 4ND2A 5GJVC 2F9FA 2B3TA 5B37A 4K8OA 4PLTA 5EUMA 3AIOA 5EJ8A 5I7UA 3O91A 1LPAB 4UQLA 3ST7A 3UWKA 2ZSKA 5LXTB 3LC1O 1FTGA 1NP3A 1ZZGA 2KBEA 1E3SA 1LRJA 4KK3A 1LDYA 4X6YA 4BO8A 1YCDA 5C53B 5EERA 3E23A 4F9GA 3KHTA 3VC1A 3BGWA 1R3DA 2NV2B 2BRUC 3IE2A 4TMXA 4O1HA 2FF5A 4U0KA 3A1EA 2R6HA 4TV8F 1NVBA 1S3SA 4FQ8A 1RMQA 1AQJA 2D3TA 2I55A 3FAKA 3L4JA 4ZVSA 4FSXA 3EXEB 3S2EA 5I7WA 3O8OA 2C5GA 1BE0A 4TTVA 2Z8YA 4PC7A 5AO9A 4EX7A 3ZD6A 4QIHA 1RQLA 3JAWB 2H29A 3RK4A 3RTDA 1UPUA 4EFNA 6AT1A 2Z3WA 3LP6A 3JYPA 1WG8A 3RVOA 2C9DA 2VJAA 3TZ6A 4BJ6A 2C2ZA 2DQKA 2C61A 4MCHA 2JW5A 1V3QE 1XZMA 3DFZA 2ESRA 1MQAA 2YVQA 3PQ5A 3I05A 4KZPA 4DL9A 2EGHA 2WD7B 4G24A 1RJWA 1J0AA 5MFPA 5AVYA 3IDZA 4K1XA 2H2GA 4BX8A 4WADA 3P0RA 5JS7A 2QTGA 2WIFA 3QMWA 1HSZA 3M3HA 1UJ4A 2KQUA 2YXDA 3QBTA 4Z9YA 1YHNA 3HY6A 3OJCA 4K9SA 4EZEA 3CWQA 3TTXA 1PP4A 3CJQA 1QB7A 1MNAA 3TFWA 2MOKA 2NV0A 3VVMA 3B85A 3W90A 4DARA 5A3QA 1DRKA 4F5YA 1Z38A 3D3NA 3D3QA 4FYYA 1XZGA 4A6XA 1BFUA 5ELMA 1Y7TA 4NENA 2Y0CA 2ZRHA 3R7DA 1ZUNA 1NQWA 3GNQA 2WTAA 4MXDA 2R84A 3RC8A 2J41A 4RHXA 3N3AC 4MR7B 5F2KA 3TQFA 1UMBB 1YOVB 4RJ2A 4RVDA 1X7ZA 4WZBA 3ZXYA 3L9WA 1KORA 3D7RA 1NOJA 1ADGA 1WMDA 2BZGA 3BGSA 1POWA 4R1MA 1VJCA 2VUSA 4BYMA 1BKYA 3ESCA 4LV8B 4L2IB 4CQMD 4CTOA 3NKVA 1I10A 3TN7A 3PWTA 2N9UA 4YAUA 1ZD1A 1VCNA 1KU0A 2X3FA 2ZTSA 4EVIA 1WMEA 3BOSA 3EQ2A 2RFLA 5F5LA 1KMMA 2IRWA 5DHPA 1WA5A 3OFKA 4WLVA 3FVRA 5DIZA 4MKHA 4XX0B 3DGEC 2UUAB 3HCRA 4LWOA 4IQFA 1FSSA 3N5KA 4A8HA 5B3JC 4WOKA 2G9RA 3RJTA 3AILA 2GGSA 5AOVA 1O95A 5EP1A 5FHQA 1X1RA 1OHHA 1JRLA 4B3BA 2VWQA 3N8HA 4N82A 3CCCA 3OZFA 4D99A 1M6EX 1D04A 3OZUA 3RC1A 5C8ZA 2FCAA 2NO0A 3GUVA 1IVNA 5DZSA 3P9YA 2F3PA 3O2SB 2O4CA 4WHMA 1DRWA 2WV7A 2IU6A 4I6GA 3VYWA 3F6BX 1X0VA 2Y93A 1M2GA 2JFFA 4N6NA 4RTMA 1S2MA 4OQQA 1NMSA 1O9HA 1XNGA 1XP8A 1QLWA 2OD9A 5DN6A 2Q7DA 3RNOA 3TTVA 3ICCA 4D6YA 4DR6B 1KWGA 3FZGA 2VL7A 2AVNA 2GRJA 4MWDA 3OJ0A 4TLEA 2X5XA 4D9HA 4XR9A 3E84A 3ONVA 3PV0A 5CFOA 4NZ9A 5LJLA 3HGTA 5FL3A 3AR9A 1RHMA 4JR1A 4DIUA 2GA8A 2BKAA 5EYPB 1JKJB 1ZRHA 4MI9A 2ZYRA 1CJCA 2HC9A 3CLSC 3ILHA 3H0CA 2D2XA 1NNLA 3BQNB 5ALNA 1CUVA 3OEHD 1N4DA 2O8VA 1UKAA 3QVSA 5IJWA 3AHCA 1C1HA 3SHOA 1DV2A 1Y89A 1B2LA 3DZHA 2BSAA 2QORA 2Z9DA 1EHIA 4KUEA 3MWYW 3MOGA 2XZOA 1BAPA 4R01A 5DOVA 4LVUA 3DZBA 3SHQA 3T06B 4CL2A 1FTQA 3C5HA 4K87A 4U3JA 5AT1A 3WIVA 5JH7F 3PSHA 3BILA 1CU1A 4X20A 3E5MA 1G64A 4ZALA 4DJFC 5KYXB 5JANA 1DQNA 2H4FA 1Z5UA 1OZAA 1PW7A 4LXIA 1QP7A 3ZHTA 1J1IA 1TQ2A 2PMDA 3O8QA 4XEHA 3QU2A 3TWOA 4BO2A 4CT0A 4YUWA 1V6SA 1G3QA 5KDDA 3MFYA 2BRUA 1XLTC 4B34A 4KNYA 4CIWA 1Y3FE 3B20A 3OETA 1Q3TA 1XI2A 1LDGA 3OQPA 1S89A 2XB8A 3DWFA 3R2JA 5EWMB 4ZA2A 2FZCA 4PFJA 2W2NA 2DPYA 5JW6A 4R8SA 1KZ1A 3STVA 1ZRMA 1RYHA 2K7FA 3O4HA 3UAWA 1IXZA 1ZH2A 4HNUA 3ZDCA 1ND6A 1R4AA 3M6VA 2HK7A 3G2LA 2QLLA 1RRMA 4X60A 1E2EA 1A71A 1QYDA 3QX9A 1H22A 2H8GA 1CUHA 2ZCUA 3PCXA 4FT2A 4HB3A 4B17A 1KZYC 1X87A 4CNBA 3RTBA 3FFBA 2CL6X 5KPDA 2ZR7A 2PZMA 4KC0A 4C4AA 4NATA 4NNOA 1H2WA 1Q0QA 2C2BA 4LZPA 3W2FA 4A91A 4LHXA 2APJA 2I8CA 1IEQA 3A31A 3NHAA 3R8XA 1CUDA 4PGFA 3VPHA 4TWAA 4DGSA 2PJUA 5JRJA 1F8XA 1ZUIA 1WIWA 1FFDA 4UQPA 5FUXA 2W11A 4FGLA 4HXFB 4FGKA 3CKMA 4RD3A 5HRAA 3BWBA 2PXHA 2Q0QA 2WT4A 2VQSA 3KKMA 4KQJA 1YA6A 3BK7A 3O2JA 3EDOA 3FNRA 4G5HA 4HOYA 3OLZA 5TARA 2HWKA 3NHFA 3UMCA 1BE1A 2PPLA 4UMVA 4BHTA 3HWX1 4MJLA 4TMKA 2BBSA 2GJKA 4M87A 3TFQA 3SVLA 4K9MA 4ARBA 2H63A 3P9SA 2LTAA 3C4VA 3IAHA 3QWBA 1C30A 1P5ZB 3D8RA 4LJSA 3GP5A 2ZVDA 2CLLB 3V6LA 4GVLA 3TW8B 4ZO4A 2D7DA 2JIPA 1AHHA 4GH5A 5HE8A 3L0ZA 4MKIA 4BJ1A 3RVNA 4BN5A 2ZJFA 4NBVA 1GPDG 1WR8A 5PGMA 1R9JA 4LCBA 1H5NA 1VI2A 4RD2A 1JIKA 3ROEA 3TLAA 3I32A 3U3RA 5BVGB 1RXVA 1GRQA 3WR5A 3WLTA 4HQ0A 1IM8A 3W6NA 1XDWA 3T3PB 4J6FA 1JBQA 3JQGB 4CTKA 3WLKX 5LWQA 2Q6OA 3CZQA 1CE8B 3VC2A 1IHUA 4DRXB 4HLCA 1T2AA 1TRKA 2JLZA 3F71A 1HORA 5BRAA 1WPGA 4ZVPA 1EGQA 1WAMA 2OCDA 2FG6C 4HTAA 4LHWA 2Q8QA 1ZUD1 4YACA 5KSOA 3HHPA 5JVDF 1ECJA 1P2UA 1Y4AE 4ON9A 4QXOA 1JG3A 1LSUA 3GNSA 2WFLB 1QQ5A 1EVQA 1CE8A 3DHWC 5G3ZA 4DRXA 5AW3A 1VSTA 4PNZA 4JDPA 5IJAA 5AKHA 3FOCA 5LM3A 3FYUA 2B5OA 2JGKA 2XCQA 4GOMD 1AZLA 3ASYA 4UTZA 4BO5A 5B7QA 2IWHA 5BYJA 4A4DA 4ODIA 3B12A 4FDMA 1OXKB 5EFOA 1A9SA 5K0LA 3V33A 2OAP1 1F6BA 1Q7GA 2BI4A 2PRJA 3HI6A 4LSWA 4EJSC 3REQA 1SPBS 3RNLA 4H31A 1H8EA 2Q1XA 3OECA 2HV8A 1QP0A 1GCAA 1SUPA 3AQ4A 2GPSA 2M9MA 4N5HX 1R5OA 1WQ4A 3BWMA 4HFJA 4M49A 2A58A 2VUTA 4JKYA 2JGNA 2VS1A 2V6JA 1WXGA 3GD5A 4N4AA 5FPSA 1TUEA 5L3ZA 3AF2A 3I39X 4OGLA 2J0SA 2H9AA 3OI7A 4RMGA 5TQ0B 4HQNA 2MINA 5FI1B 1KJ8A 3JZFA 1OW3B 1CSEE 4E2WA 1K98A 2CK3A 3ETHA 2ZUCA 1TMOA 2VG8A 1XWWA 4KKXB 3BA6A 1W48A 5UKDA 4M54A 4EIWA 4WFKA 4DSAA 3KB8A 3D8TA 3OPXA 3PB3A 3PXAA 4L4XA 1W7AA 3WDKA 1E2UA 3D0QA 4PQEA 5HF9A 3UGJA 1FP4B 3MQ2A 3EULA 3WI7A 2R8EA 1D6SA 1BU5A 1MJGM 4GPAA 6YASA 4RZHA 5IK2D 4FS8A 1X8XA 1Z0SA 221PA 4EAQA 1VRVA 4QRDA 1TQ6A 5F98A 4G1EB 4PYKA 5F73A 4IUDS 3ZZMA 2RB5A 2I4NA 1K88A 1TGYA 3DCNA 4HWOA 1M6VA 3V4SA 4ZHQB 3PEYA 1AK2A 4NZNA 1ZL0A 3ANYB 5KDLA 4AKIA 3C45A 1LBSA 5J63A 1DARA 1HNWB 4WKNA 4JY7A 1Z12A 4LI0A 2C2MA 3TL6A 5KNCH 1A9XA 4H7HA 5HOEA 1Q6YA 3K6JA 4HRYA 3IJRA 4J16C 1OBVA 1YWGO 5U9CA 3KC2A 4LJRA 4PIPA 3G2HA 5DV9A 3TMAA 1JFLA 1XDGA 1TA9A 4UQOA 3VHXA 5E9JA 1TYZA 1Z62A 4X20B 3GI1A 3H2SA 3TEJA 4YRIA 3DMRA 2P2LA 3KFLA 3C97A 3JRXA 2VCHA 3E9NA 1OIWA 4QBGB 5KSPA 4A10A 1T6XA 1WUHS 2ODWA 3K96A 1WULS 4WV3A 5CYFA 5BWCA 2VBFA 4Q1FA 4QWWA 4DIBA 3FMPB 3JX9A 1WKCA 3G0GA 4DLTA 1O89A 1PGNA 5AW8A 4LUCA 3EG5A 4D8UA 4P3NA 3T9FA 1CUFA 2IZ6A 4JCOA 2ZBDA 2AI1A 3HR7A 3IUMA 4RM2A 4I9HA 2OP1A 3P5SA 2XT0A 4Z2AA 4TRRA 4AN1A 4Q05A 4FW9A 5J5CA 2OFXA 2AI3A 4RH3A 1Q21A 4LXUA 3KVOA 3OIFA 4EI7A 3SC2A 4JLNA 4OH1A 4RW0A 3DKIA 3OT1A 3Q1KA 4P4TA 4URFA 4U2KA 3U4QB 2Q8NA 2C5BA 2WYWA 1QMPA 3F98A 3QPUA 1ZESA 3P9NA 4MH0R 2R3SA 1WXWA 2WJAA 3CV3A 4BEWA 1T34A 2VI5A 1XF9A 1PE0A 3KWLA 5IKOA 5L7TA 3UMSA 1WXHA 2PX2A 3JQEA 2QZJA 5AJHA 4DZZA 3PC4A 3KB6A 3ZQUA 4L76A 2XVZA 3C8HA 3C16C 1RQ2A 3VTZA 5EE5B 5FWXB 4QDZA 2EKZA 2O9JA 4IV8A 2BUBA 2JAUA 2XTAA 3N7UA 2YJNA 1GO2A 2FW8A 1XSEA 5FWNA 7AT1A 1GAEO 3EISA 1ZGBA 1J25A 3VU0A 1B73A 4YAGA 3ZWMA 1EESA 2HPZA 1NOIA 1PSWA 3K9BA 1MO3A 3M1YA 2ZYAA 4I2NA 4YCJA 2PV0A 5BRJA 4EVRA 3S70A 1JWLA 1MJ5A 1UKZA 2YMPA 1XTZA 4HPJB 1J97A 4DTCA 1C9KA 4JLOA 4OB6A 1LA2A 1FTNA 1L4HA 4UU8A 1Q16A 2G63A 4GECA 2B99A 5TX7A 4FMBB 3Q6IA 1RP1A 3DWGA 1JEDA 1QPBA 3FDJA 3UVEA 1Q7RA 1A88A 4RA6B 3H1EA 2QN6A 4CL0A 1BN6A 1XMVA 2KB0A 2PT5A 3RUPA 4ESEA 4HVCA 1OKKD 4YCSA 2E48A 2QT9A 5EKXA 1L8OA 1U31A 1VLZA 4JKOA 2CXNA 4LOIA 1A04A 2PUWA 3MTJA 3RTEA 4C3UA 1LVUA 4I1OA 1NBEA 1CS0B 2WABA 3KBBA 3FUCA 2CJWA 2IEYA 3H9QA 4FU0A 4RPJA 3STWA 4Y2YA 5KU1A 1N6KA 1OX4B 2PS1A 1OBOA 3U7HB 4CEJB 3MIIA 1XJWA 3I2GA 1O6CA 1XKQA 4MP8A 4NU0A 1CRLA 2RHBA 6PFKA 2O2EA 4OYLA 2W6CX 4QUKA 3VQTA 2XYRA 3USES 4XCQA 1REQA 2OSVA 3VNBA 2ZE8A 1XPJA 4V0ME 1UANA 1O9BA 4IFIA 4PXSA 4F4UA 4RMNA 3M70A 3QOWA 1FFYA 2BCEA 1QQAA 4NH0A 1OFIA 4QASA 4NJMB 1YAHA 4RK6A 5HFAA 2EJBA 1GSHA 1LLCA 3TNFA 2E4YA 4C0XA 5TV2A 4PLPA 1ZNWA 4DEVA 1EDZA 4U8GA 1KO1A 4TWBA 2IP4A 1VBNA 2P41A 4H7EA 4QBTA 1FZTA 4Y2TA 2HJGA 3A6EA 5FA5A 1E69A 2CCKA 1GCIA 3A8TA 4MV0A 4XQEA 1IRIA 2NW6A 4UTVA 4ZYZA 2GYWA 1W47A 1OI4A 2R8OA 1ESDA 1D1TA 1G1AA 3GT3A 1PR2A 3L0BA 3VH2A 1NVGA 5K3AA 1YS9A 1EVZA 1ML4A 1VFPA 1HE3A 4GBMA 3UCXA 2FUG1 4YRGA 2QSZA 4RGQA 2ZK7A 2B20A 2Z04A 3U7JA 1LU9A 3X1KA 4D9JA 1U6IA 3JQ7A 2JZCA 4YDQA 3GQBB 3CPSA 3E18A 2JH9A 3GARA 5A4JA 4JL8A 3C7KA 2FG7C 3SIRA 4EZBA 3EDYA 2J0UB 5HJEA 1CX9B 4RDCA 3GA0A 1S01A 3CX4A 3EPLA 1UWLA 4S3MA 4BKQA 3ZWBA 1E92A 2HRRA 1RJ9B 3EW7A 3IHLA 4HH3C 4J03A 1RLUA 3OE4A 4E5VA 1XMJA 4F3YA 1J39A 2CMHA 4D26A 4RIGA 1SCUB 4QFCA 4WINA 1ULSA 2FR1A 2PLWA 3K6KA 2O8FA 1DLIA 2JLQA 3KHSA 3L6DA 4ZEMA 3CLSD 2Q27A 4D8TA 3AFHA 4JEIA 2E85A 5JCOA 1PR4A 1NXPA 1XLWA 4DV7B 3A6GA 3DO5A 3IT0A 5THQA 3UBMA 1IPHA 1OH8A 1BX0A 2FZVA 1IWBB 1FK8A 3JQGA 4MPPA 3Q0TA 1M76A 2XA1A 1KQGA 1A27A 1NLZA 3TPCA 2OK8A 3TUIC 5I48A 2VUIB 3KZVA 3P94A 2XX3A 3MJ4A 5CFNA 1GZ5A 1YB6A 5C4GB 4G4GA 2XYGA 4M1OA 2PD6A 3F96A 3TR0A 2QUKA 3M6AA 2WQ7A 4ALMA 4Z6KA 3QYJA 2AKYA 4J7CA 4RZ2A 1CIJA 1R18A 2ZJ7A 4KR0A 1N8NA 1T4CA 4K28A 2WOOA 4UEJA 4UHFA 4DC0A 3JQ8A 3VR5A 3W5AA 4J3JA 4PQFA 2EJWA 2NX2A 5JJLA 1ODSA 2B0JA 4R0VA 2IF0A 2X5NA 2YV1A 1GT6A 4XOIA 2ZIUB 1ZGCA 2IHYA 2HO4A 3KPJA 3RT9A 3FYCA 1W0JD 3R77A 4EYGA 3HA2A 4PX5A 2YWJA 1A5ZA 3HSKA 5FXMA 3D0OA 1GTRA 4PLGA 3GJQA 1CRPA 3MT9A 1K06A 3RIEA 1DFIA 3T3GA 3UUEA 1XA4A 1AKYA 2AFHE 2XA2A 2YNMC 3R3ZA 4QHTA 4X41A 3B9PA 2FSGA 3R0VA 5CLGA 5HUJA 2Q1TA 2GWHA 4P4LA 4F8JA 2HHHB 3ZV7A 4JHLA 1V1RB 4MQEA 5KYUB 3G9TA 3ZGNA 2IPLA 3H2BA 2H7XA 2XXAA 4DDVA 3GGCA 5C4MA 3PWSA 5FKJA 5JD3A 4YJ2B 1UXOA 1NF8A 1P2DA 4KIFA 1NW8A 1R66A 2YJ5A 3E6AA 4AMGA 3OQOA 4BEVA 4YV7A 1TE2A 4NYJQ 5CPBA 2UYOA 1KYVA 3TVYA 5EJ5A 2FG5A 1SK8A 2I99A 1A5AB 4TLBA 4P93A 3U31A 4B5LA 3H1BA 1BXGB 4JT4A 1CNEA 1G6HA 1V95A 3MMXA 2WSSA 4NLLA 4YGYA 3UGQA 4C0SA 1E6MA 4DV1B 3E03A 2CNWA 1EUZA 4RS3A 3VZBA 1KOGA 3KTFA 1U0LA 1IE3A 1ZWKA 3D3EA 3MCTA 5DM4A 1ZIYA 2PH1A 3SYLA 4DDKA 2WPDA 4Q1EA 1K89A 1UC8A 4ARZB 2ZJAA 3HBFA 1F3OA 4PYRA 4BLOA 4C2BA 4EJSA 3CWCA 5CVEA 5CEFA 4RPCA 1GEGA 4W5HA 2P9FA 1R0ZA 3HJGA 4YC7A 2JL1A 3EOBI 4R41A 3LECA 3OC0A 5TXGA 3AP3A 3G85A 3RI3A 4B7AA 1YI1A 3OPNA 4LSMA 2XE6A 1LRKA 2R8ZA 3I6ZA 1VPLA 3R7SA 1VYHA 2XTJA 4OIFA 2RH9B 2DQZA 3KX2A 3B1KA 1P1JA 3RV4A 2GKGA 6ADHA 1ZLXA 5EMHA 1BGVA 1DEXA 1DKQA 1I2DA 2PJZA 2GFIA 4CLHA 2IDMA 4QARA 1KSGA 3ZHCA 2YCLA 3RSOA 2A3RA 2A8YA 4DZRA 1C7IA 1ZK1A 4E08A 4K5QA 4G84A 4IIDA 5IABA 2WW8A 1I7QB 1PJCA 3V1KA 8ABPA 3T7CA 5M2QA 4KO1S 2AJBA 4INJA 5AR1A 4WVLA 4U6SA 2OB2A 1DQPA 2JI9A 3WWDA 4A0GA 1VSBA 1UPBA 5KYYB 3KQOA 3HB9A 2R6ZA 2PK3A 2OHXA 3AU9A 1CJMA 2CBXA 2DBRA 4RV4A 5TQ2A 3U7QB 2E87A 4ZU3A 4NBWA 1YVDA 3HGMA 3Q3IA 3SSNA 4IYRA 2YRXA 3WZMA 4TLMB 4RTNA 1N3LA 4DANA 1VL6A 1VBFA 2C4UA 3VAZA 2AD1A 2VCEA 2FLVA 2ZPTX 4Y1FA 5LA6F 4S1OA 2VDVE 2GEJA 4U7DA 3HMKA 5GM2A 4KSBA 1TYAE 4AYTA 1PK7A 3LT4A 5AP9A 5DISB 1QHEA 3HYSA 2B4KA 4EW1A 5CBPA 1T4DA 1L4EA 1LY1A 1QGED 1GYRA 4DWWA 4LXYA 4HVTA 4RPLA 3ZJ5A 2RGGA 1I4DD 2WT9A 1UC4B 1RYYA 3K2BA 3GLIA 1EP2B 1OV4A 3NBKA 1ICIA 1KR2A 5DNEA 3F9CA 4LW8A 4TX1A 1SHZA 2Z6AA 3H17A 3ZV6A 3OQBA 1ML3A 4J1TA 4PYIA 4ZT4A 3D6HA 4Y2HA 4MRPA 1AMOA 3RUCA 5E95A 3I61A 2WKRA 1JE0A 4NU6A 4MKRA 1RU3A 4E5YA 2BBWA 1PR3A 2HDWA 2O7QA 3B7WA 4NCBA 2H92A 1CNFA 4N41A 3RODA 4C1NA 1U9CA 1NVDA 2PTHA 4FT4A 3U49A 2GRUA 2HJHA 3R4CA 4I81A 4JLSA 4TMWA 4E2FA 1BXKA 1AT1A 1R0LA 1E60A 1Y5IA 3PUYA 4X1IA 3KFXA 3B52X 2AIRA 1YXMA 4PPFA 3K72B 4Z9AA 1AKQA 2FPIB 2WHPB 3D6TB 4JAVC 1WUIS 2D1SA 3S1LA 1XZBA 5K6AA 2B5WA 3D81A 3QEMA 1JB1A 3ZBUA 4ENWA 4AKGA 1G5FA 1AHIA 4J3NA 1ISIA 2C7VA 1G5HA 4XYLA 1XJ0A 3LUBA 4QHYA 2Y0BA 2WKQA 2YTZA 4OQDA 4XD7A 1AXGA 3MWJA 3P71T 3DNPA 3V8BA 3RQSA 4FR2A 1BS9A 1YMVA 4E1VA 4PU0A 5L4LA 1XALA 1QYWA 2VDOB 4HLDA 3SJZA 4QHSA 4MV5A 4JITA 2VP0A 1O97D 3UT0A 2WMYA 4B6QA 2FEMA 5KOHB 3AB3A 3NPMA 4PR3A 4Q9NA 3IP3A 3PNQA 4N47A 4N7BA 1C9MA 1JALA 4G5QA 1KZ6A 2IIBA 1TA0A 4EK9A 1MOPA 1IIBA 2HH9A 3D2CA 1Q83A 1UC9A 1HE5A 3FNBA 4E51A 5CITA 2UZ4A 2EAUA 2JCGA 2XNHA 1WLYA 3DEZA 2VZLA 1UDRA 4WNIA 3KQPA 4KN8A 4LNUB 3A6LA 5DN6D 3H3FA 1S4MA 2HIAA 2IE8A 1LNQA 1CYEA 3W5IA 3HC7A 3ROKA 1GITA 1NPTO 2CVQA 3NHUA 3OH8A 1E2IA 2GX6A 3DFMA 4JU8A 4QUGA 4X3PA 4ARZA 3K0FA 1UMCA 4MGEA 4DOMA 3D3JA 4H18A 3V7UA 1T36A 3ZE7A 3H2JA 3T5BA 3WIDA 4P0TA 2EG5A 2AZXA 3BA1A 4M4SA 3FH0A 5MGBA 1XMOB 4RIEA 3H86A 3EVCA 5ERXA 3FFAA 1UDBA 3HJTA 3CINA 1U2RA 3KVYA 4JJFA 4LC1A 3CRNA 3WQRA 3C85A 4A1FA 4A9AA 1SUBA 2ZG6A 4AJ9A 5KCZA 3NBUA 5J2TF 3L4BC 2YY6A 4K9OA 1GT91 1YRAA 3JQFA 5ALKA 5I9MA 4YJHB 4ARSA 5MHTA 1IZ9A 1X8LA 4ZO8A 3VR6A 3TLZA 3TAUA 2OM6A 1IQPA 4ITUA 2EX1A 5TT1A 4LF6B 1C9EA 1EVIA 2KSQA 3R5FA 4H27A 4KRYA 2G5CA 3D59A 2FOXA 1P0QA 1G2PA 3F9IA 3IPAA 4PPQA 4YAFA 2M6SA 2GPAA 5FUMA 5JU6A 4OLBA 1KDRA 4G1VA 3SJ7A 3I45A 2NO1A 4JELA 3W3AH 1KEKA 1AY0A 1QIJA 2C1ZA 3ZNNA 1JDPA 3I5AA 1ONOA 1ORIA 4KOEC 4ZQGA 4A6PA 5JBQA 1F48A 4DKXA 5EIEA 4BXOA 1PFKA 3AUJB 1J00A 2XD4A 1OB2A 1PZEA 1XL1A 4Q9DA 1KFJB 4RZSA 3WISA 1E2GA 3OTIA 4HUQA 2SKDA 4I4NA 1ZMTA 4LRXA 4W4TA 2B8JA 1OLSB 4QICA 1PZNA 2J7KA 5HCUA 2JCXA 4G9BA 3W04A 1YIOA 3UWSA 1Z2AA 2PQ6A 3LPMA 4NOMA 1C7ZA 3W9YA 4EMUA 4RV5A 1O4WA 4J9VA 4M8NE 3FPEA 4NC9A 4TKVB 2GYYA 1E4OA 1QYIA 3PFNA 1Z82A 3WGYA 3CW8X 2EEZA 3CF0A 4BX2A 3LUDA 1F20A 2PX0A 3E0XA 3V8RA 4B4WA 1V8ZA 3CHYA 3LBAA 3QVOA 1W88B 2IYSA 3DQQA 4GGOA 5GOZA 3WB2A 3WGMA 1GTJ1 1AS0A 5H9WA 3R7AA 5FPKA 2XHZA 1YE3A 4KH0A 2XSZA 1YIDA 2BF7A 2V58A 4BBZA 3CYFA 3IFSA 5K8TA 3GRPA 3O90A 1E63A 1EX6A 1DI0A 4CHGA 1RXSA 1GPMA 5DBGA 3X2FA 1ZIPA 1T4GA 1J22A 3ZY4A 5JCOC 4QECA 3OFNA 1T8PA 2KLBA 3MXTA 4R51A 2HPAA 2GJAA 4V0MA 1E9SA 2ZSAA 1N2HA 2X6RA 4CMAA 5G0SA 4O08A 3HP7A 5FPTA 3IPRA 2BH9A 4MQMA 1IUKA 4N8EA 5EIAA 2VSFA 2IUYA 4ENSA 3LOUA 2V74B 4F6RB 1HQCA 3ESAA 3GLHE 2C92A 3SMQA 4LZLA 3R5TA 4GOJA 3NUQA 3ACDA 2MYUA 4WY5A 3WLAA 4C5BA 2LKDA 1XQ1A 3KQHA 4HNRA 3ITKA 1M8GA 1WDLA 2JFYA 2VJPA 4AZSA 4EECA 5IJ9B 3PEUA 2BGJA 1SG6A 1Z47A 2ZSIA 2HMTA 2EJVA 3VPDA 5E6UA 4NHOA 2RBEA 3RYFA 4DMLA 3GLGE 3OVMA 3LPCA 4MUFA 4IIJB 1UP4A 2AXNA 2GAOA 2WSYB 3EOAI 1XKLA 4B2YA 4RK5A 3NEJA 1V7PC 3D7SA 4XA8A 1Z5VA 2V0NA 3CJRA 5HE9A 3E9EA 1EZ1A 5KS2A 4WLUA 4JT9A 2JGAA 1X14A 2I6GA 2J59A 5EWJA 3LY8A 3MUOA 3GROA 5DIFA 1Q12A 4LOKA 3G2MA 2NO5A 3KAQA 4XVHA 4OG2A 4Q3NA 1BIFA 4ZO6A 1JP7A 3ANXA 2ZIFA 4CKEA 4LRSB 1LQTA 1DO0A 1RE1A 3BWVA 4ZZ2A 4W5JA 1K0FA 4B8YA 2ZSDA 4GP9A 1RLMA 2IPMA 3ZGOA 2XAAA 1VBMA 3QLUA 3CPHA 2IS2A 3COPA 4YJ2F 1H0SA 4IIYA 3NT5A 5EZSA 3WK4A 1SAYA 5AK4A 5KYWA 4Y1RA 5LYYA 4NPCA 4K2AA 2QROA 2H85A 4CG0A 4BQQA 5JZOA 2Q2QA 3N39C 3KEFA 2PBRA 3M34A 1F7UA 2I8AA 1KAGA 3IBYA 4AMBA 1Q2UA 2O05A 2LUOA 5LYJB 1BHO1 1KO7A 3GEMA 2BEVA 2QYOA 3BD7A 3FMIA 3OJXA 1EE1A 2F1JA 1ZQ1A 1TYCA 1OU0A 1TM4E 4N0EA 4EMBA 3N7AA 2AEJA 4G89A 1UKCA 3GXBA 4MS4B 4EGSA 3EPRA 2NYUA 3H4MA 1JXQA 5T3UA 2UZAA 2ZCVA 1ODIA 1GNQA 1V48A 2JKZA 2QX6A 4ISCA 1N6HA 2P35A 4L5AA 3T9BA 4C7KA 1JLRA 1RM4A 4AWBA 2A0KA 2NO4A 3NQ41 4XTRA 3QF4B 2NU9B 4U9HS 4E5NA 1T26A 2IZ1A 3ANMA 3K5PA 1PJ3A 1B1CA 4L4YA 4W8GA 3FOAA 4TOIA 5EQFA 4X0EA 5BUQA 3K4HA 4M1WA 1QDLB 2YWFA 4RD4A 2NU8A 5FLXA 1R88A 2X4DA 3EZLA 4BJHB 1Z06A 3MHTA 3ICEA 2YJTD 3C6ZA 3DMFA 3JATA 4EO4A 5CX1A 4FFRA 2PSFA 1Y1TA 3BM5A 1BJRE 3FDIA 3FYDA 1P7YA 1R4NB 2H1CA 4V0QA 1YU6A 4PLVA 1M1ZA 2LE0A 5TMBA 3A25A 1EFPA 3EC2A 5CHEA 5DI9A 4HEQA 1OQAA 3WKAA 4YMLA 2W2MA 4TMYA 1Q19A 1Z6PA 4BC1A 1U7WA 3LF2A 4HP8A 4DB4A 2XADA 3SC2B 4CEHA 2TSYB 2CFCA 1CUGA 3AHEA 4K46A 5BNWA 2FZ5A 3V4PB 1SNYA 1EINA 1YS4A 1ZCFA 2XZLA 4Z53A 2D6FA 3BYZA 3CUEF 3N2NA 3BULA 4LFAB 3KUCA 2E3JA 2Z3VA 3A1NA 4CCYA 4AU1A 4FONA 1FPMA 3I6QA 4NAUA 2Z3ZA 4COKA 5D5QA 3TLYA 4YIHA 4I0WB 1TT5A 1URPA 3CFYA 2AG1A 5GGYA 1C7QA 1QGAA 2R68A 4JSTA 4KE6A 4MVJH 4BVKA 2BH2A 3LDFA 1SVUA 3W2TA 1C50A 3RHSA 4DYVA 5FIUA 3ZHBA 1I01A 4YMIA 2XVMA 1Z6AA 1AB5A 1BROA 3BFJA 4QOFA 2Y9PB 4CN9A 3R0ZA 3WBBA 4DY6A 4PZEA 1T24A 4ZDWA 5I7FA 1ZOLA 1KK2A 5IF9A 1J5PA 3LVQE 4ABYA 2ASVA 4B83A 2RH5A 2QRHA 3DTVA 4RX1A 4EW6A 5KVAA 1J2TA 3PPIA 3LGSA 4Y6LA 2ATVA 1MU0A 2V6MA 5DX8A 2GHTA 5JR3A 1RPNA 4URYR 4CM8B 1KEVA 4J7AA 3NDIA 4UBMA 1FFCA 3DBLB 3HYTA 4DR1B 2LR0A 1S02A 4L07A 1J0BA 2BFAA 1KI8A 1BX1A 3L3BA 3WFZA 1QO0D 3NOVA 3T12A 3DAHA 4FLEA 5FL7A 4OLFA 1JPNA 1PJTA 4DNQA 2G82A 3UMYA 3W3AD 2HYIC 3U44A 3DL4A 3GQVA 4MLPA 4E33A 1S1CA 5COBA 4K9KA 2J9FA 1HPLA 1LBHA 1KP3A 3PGKA 3QE2A 4ECAA 5HKKD 4F5EA 4RVHA 4TS1A 4B3FX 3L7NA 5JAMA 5T7BA 2V3VA 1F5NA 3E8XA 5B30A 4KRFA 2B9VA 3E3LA 1QANA 1L5ZA 1N57A 4FYMA 3QNUA 1FYVA 1HYGA 2QMOA 2NZXA 1B8PA 4KQ2A 1AGRA 2OBMA 3BREA 4PS1A 3PT9A 5FPQA 3PT5A 3PRHA 2D0DA 2DLDA 3IKJA 4FFPA 3UYLA 5HVNA 5E6UB 1UPXA 3QLVA 3DT9A 5DKFA 1BVRA 3EARA 4Y6QA 1QIMA 3R41A 1D1PA 1DJPA 1HNZB 1USIA 3FD8A 4XUCA 3SF8A 1E94E 1K4MA 3DDZX 4ARUA 4FQ7A 4PRZA 1G4UR 4OMFG 1DAEA 2RGBA 2DH5A 1M2JA 4ZCPA 4RVUA 2GD0A 1IN8A 1D4ZA 3WMFA 2FPGA 2OCBA 5EESA 4F2WA 4R16A 3U0BA 5EP4A 3J80A 5G4LA 4E6PA 5ER6A 4XQ0A 3WNBA 1NU8A 1W4AA 2MSEB 1B8OA 1U8TA 4J9UE 5JZVA 2WAOA 4KXVA 4COOA 1S7GA 1EP1B 4PSUA 3N53A 1AZWA 4XWWA 3QHQA 4LZOA 1NJ1A 4Q4HB 4HDCA 3P9KA 3U7IA 4BMXA 1QMGA 1YB4A 1KOFA 1T0UA 2CNOA 1E2HA 2I1WA 4DDMA 1JAXA 2XNDD 3I1JA 1YDWA 2R8XA 2JCVA 2ZB8A 3IQDB 3NV7A 1E9DA 1ZSNA 4GLFA 4H6VA 4C0BA 1DB3A 3PC8A 4WERA 3N2EA 1XPRA 2IZOA 1PT8A 5I4IA 4M8LA 1HO3A 1IY9A 1Q0SA 2MSDB 2R6CA 3KPYA 4W7IA 4XW2A 4DDWA 5EQDA 1QBGA 3IHWA 1K66A 1Z5WA 4EFDA 1G8HA 3RT1A 3W5DA 3L8EA 1VJ5A 3P97A 4NJOA 3T1QA 4DT1B 1GFWA 3HBAA 1PTKA 4AT1A 3W8DA 4MEAA 4H7PA 4TPKA 1AA9A 2QPLA 4MWZA 5D00A 2WF7A 5C5EA 4M46A 5E7MA 4ZV4A 2BIFA 1O1YA 3QXHA 1RWQA 4EW3A 1U4OA 1XDZA 3NX4A 5JIBA 2Q0SA 1SUFA 3VDNB 3SLGA 3DVLA 3LX8A 1AKNA 1G21E 1DTWB 1M1YB 4GWGA 4ZMRA 3JWPA 5ILQA 1I7DA 2OV2A 4O2RA 4QXAA 1ODFA 2E2WA 3OD1A 4GG1A 1KKUA 4E7OA 1UJNA 2I71A 2FX5A 1G7SA 1M2EA 1TLLA 2W6JA 3EBPA 2I6FA 5EIHA 3ZWYA 3D6FA 1TOAA 4RKFA 2EIXA 3TTTA 4GYYA 2EG9A 2I2AA 5EZQA 2HRBA 3VPBA 5HS6A 1SBHA 2W98A 5FLYA 4WRRA 2CMGA 5FAXA 1P44A 2O1SA 3NR2A 4CMJA 3Q3JB 5D01A 3U13A 1PZHA 3C4JA 3LFHA 2H4ZA 3LY9A 4RBNA 4X44A 2YUTA 3UJDA 2BJVA 1Q11A 3L6UA 4HSGA 3VV2A 4BL5A 5LLDA 2R1TA 5JDCA 3TIIA 5KNDH 1EFHA 2Y1LA 5KYGA 2Q9BA 3LXMA 2VF4X 3PHJA 4JHXA 1H1DA 3OCYA 1R6UA 3SQXA 3GY0A 1ZXXA 4LN1A 1L5NA 4FGJA 4E70A 1V9CA 2QR5A 1J99A 3PHIA 4JQOA 5IC6A 4Y30A 4Y2PA 3LDGA 1EK6A 3K9HA 1L6IA 1Z2EA 1GZ7A 3HKCB 1A98A 2VLBA 2FSSA 2D74A 4JLJA 2EZ4A 2BMDA 4BZXA 2Y0EA 3OEEA 4X91A 3NM4A 4H3KB 1U2QA 3KT3A 1R74A 1G5RA 1AKRA 3T35A 4DV3B 1ZH4A 1WZEA 5AJWA 2Z8ZA 3VDMA 1P39A 1Z5OA 2XLBA 4DM7A 3OZDA 3CLHA 3L06A 2BMAA 2XWQA 2J32A 1T2FA 3QEJA 2GM5A 5HMLA 3W5CA 3PJRA 4OHPA 3IC5A 2DM6A 3R6TA 1NNEA 1NAHA 2J5KA 1XIVA 1Q0PA 4NHEA 2OD2A 4US2R 2AV6A 1EWVA 2AJLI 4K40A 5G41A 1S2NA 2EFCB 2DOKA 2GZRA 3ZCPA 1XKTA 3H1TA 2R62A 4WVFA 5ED0A 4B3IA 3PUVA 1M8JA 2DFPA 1CUIA 4MUIA 5KOHA 4RV9A 3EFOA 4FNGA 3K0AB 1I9CA 1RBQA 1UT5A 3SE7A 1HGXA 4Y2XA 1FTSA 1FVOA 1L5WA 1Z35A 2ES4A 1G9TA 1UKBA 4C0LA 1XN4A 4CTNA 3FPAA 3ZW7A 2JCYA 3OAAA 4PO1A 4FI3C 1K7SN 1F51E 3IA2A 3MINA 1BJKA 4QTZA 5BR7A 1KKMA 2R48A 5C81A 2IYPA 1VLVA 3EZ2A 1U81A 2ZQYA 5KYNA 1UBFA 3FLEA 3ZU5A 4OF4A 2DB3A 3AL0C 2B1IA 1NC1A 2H3EA 5JJCA 2SBTA 3SC3A 3SICE 3O1HB 1VIYA 3QBVA 4YRBA 4E5DA 1XVIA 1E3MA 4QXRA 3D4PA 3OLCX 3ZG6A 2RGEA 1ZSYA 5TE9A 1NA5A 4DCVA 2ODAA 2P2CA 2W8ZA 1ZXBA 3IALA 2H1HA 3CNBA 4ZHSA 2ZIVB 2ZBRA 5H7XA 1PR0A 3MYRA 2YKGA 3X1YA 3VU8A 1RRGA 3DYIA 5PNTA 1FMCA 4UARA 4ZU6X 5EE0A 3PPVA 1W2GA 3FPJA 5EKUA 4BMZA 1E59A 4MV3A 1SXIA 1E5LA 4PGMA 1FS6A 4RAQA 2Q2NA 1CRWG 4ESOA 3BFPA 3G3EA 2V7TA 3U48A 5IASA 2XI4A 3KPVA 4RHFA 4PLZA 5KQPA 4DQ0A 2H9YA 3TGLA 5ESDA 1JR3E 4M22A 4BQNA 1F9AA 3ZOZA 2PUJA 1EDEA 3ELWA 3UJ3X 4CLDA 2FEPA 4P31A 2ACKA 5T4HA 3GBSA 2GPWA 5KVSA 1FU8A 1NZFA 1VJRA 4HN9A 3SVTA 2JHFA 4UUMA 3DMHA 3IRVA 3AX6A 1XHEA 1WSAA 3MWEA 2PGDA 3GJYA 3AK4A 3K0FB 3CX7A 3QU7A 3S2SA 1PL6A 1HL3A 2IV2X 2OFOA 3WWZA 4H7KA 4EHLA 4AECA 2VCYA 1OGYA 4QZVA 4M6WB 2G3YA 3RWBA 4L2IA 1MGPA 3V2IA 2NQ2C 3FFXA 1V5FA 2VQDA 3QXXA 3ZHRA