4Q34A

Crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
321
Chain Sequence
ERVLMVDEQGSFAVGGTVLVDSLGHTFHGDHAYVFYQKPVGARKYPLVFAHGVGQFSKTWETTPDGREGFQNIFLRRRFCVYLVDQPRRGNAGRGTESVTISPAFDEEVWFNRFRVGIWPDYFEGVQFKRDKETLDQYFRQMTPTIGTTDFEVYSDAYAALFDKIGPGVFITHSQGGPVGWNTLLKTRNIKAIASYEPGGAVPFPEGQLPEEAKFITLSKKMEGIEVPMSVFMEYTKVPIVIYYGDNLPETDERPELYEWTRRLRLMKIWAKMLNDQGGDVTVIHLPEVGLHGNTHFPMSDLNNIEVADLLSEWLHTKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative esterase (BDI_1566) from Parabacteroides distasonis ATCC 8503 at 1.60 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Hydrolase
molecule keywords Uncharacterized protein
total genus 99
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q34A00
2XMCA 4IH9A 1GT6A 2B20A 4UBNA 5EI5A 1AUOA 4QDXA 5AM3A 1CUXA 3P2MA 2V98A 3ESCA 1VLQA 4PSDA 3VVMA 5FRDA 5AKZA 3KDAA 3ZLVA 3W05A 5AI4A 5C81A 1LPSA 3GA7A 2OXEA 2NW6A 3SC2A 1J1IA 4J3JA 1UT6A 2JGMA 4NS4A 5HCUA 1A8QA 3OC0A 1PV1A 4X3CA 1ZIYA 3HSSA 2RI6A 2HL6A 4CFSA 5FP0A 3PE6A 4QA9A 4L72A 4CG1A 4U2BA 4UFNA 3V1MA 5JARA 5KREA 3A2NA 5KWIA 3A2MA 1BROA 5LP1A 3HZOA 1TCAA 4CG3A 3QBJA 4Y2RA 3FVRA 5FV4A 4RGYA 4Y2TA 3D3NA 4BZZA 1YA4A 3PFBA 4P08A 4C87A 5EHZA 3OOSA 5ALTA 1R3DA 5JADA 1R88A 3VXKA 4INZA 4BYMA 1CUEA 5F4ZA 4Y2UA 3W06A 4FWBA 2XMRA 2ZJ6A 4JYMA 5ALQA 4QWMA 5CT4A 1MTZA 2PKYX 4FFVA 2HA4A 4CCYA 1USWA 1ETHA 2VATA 2R11A 2OGZA 2HU7A 4KYVA 1R50A 5LZ2A 2DSNA 1TRHA 2E3JA 1TK3A 1LGYA 5H3HA 2OQVA 4WFJA 1A8UA 1R9MA 4DGQA 5AI5A 2G5TA 5CH8A 3ANTA 4K6KA 4X93A 2I3ZA 1LBTA 2PPLA 5I7UA 2WFLB 1GZ7A 2VJDA 2XUJA 2BUAA 1ZJ4A 2XUIA 2ECFA 5AI8A 1IMJA 2PX6A 4GEGA 4ARAA 4RE6A 3PFCA 1ODTC 4HXGA 3OURA 3N2ZB 4Y2VA 1XRRA 3DEAA 5EHNA 1XLWA 4OYLA 2XUKA 4Y2JA 2O7RA 2FUKA 4N8SA 1UK8A 4GHWA 1LPOA 4FTWA 3BDIA 2ZYHA 2HFKA 2WM2A 3F67A 1MAAA 1YASA 1CUIA 4BZWA 3AIOA 2QS9A 1XRLA 1H2ZA 1YB6A 3DCNA 1BE0A 5JAHA 2WFZA 5ALEA 1E5TA 4Y2PA 2BUBA 5IVDA 3IULA 3N0TA 1UKCA 4QWWA 2Z8ZA 1VZ2A 3HJUA 3W04A 4FNMA 1W52X 4CI9A 1R9NA 3DJYA 5ALPA 2WTNA 2EEPA 4FFWA 2QZPA 3QMVA 3WWPA 4UHEA 4ITVA 2BCEA 1XKTA 4UHBA 3NUZA 4U2FA 4B9AA 3GBSA 1DWQA 3DL7A 4J0JA 5K3FB 1L7RA 4Y2SA 2Z3ZA 1CUYA 5LKAA 4IO0A 1SCQA 4MQMA 4H7HA 2Y6UA 3ZLUA 4AO8A 3I1YA 5ALLA 3F97A 2ORYA 2DR0A 5ALFA 2C0QA 3DOHA 1EINA 5HZGA 2QTBA 3AIMA 4BE4A 2XE4A 1L7AA 3M83A 1ZOIA 4AB1A 4OU4A 3H04A 4UBIA 1QLWA 1VE7A 2WFMA 1KEZA 3ICVA 5DNUA 7YASA 4ZREA 3I2GA 4UBMA 2XMBA 4G8CA 2DQZA 3C6ZA 1J06A 4W1PA 1CUUA 2CJPA 1XKLA 3G0GA 2B9VA 2DCMA 3JYHA 1OILA 3Q0TA 3H2GA 5D3KA 3GUUA 4X92A 4GW3A 2XQJA 3BWXA 2OG1A 5EGNA 1UK6A 2K2QB 4QDOA 1XRQA 2WIKA 3FCYA 2PUHA 1XZCA 4G5XA 4ZRDA 5HFAA 4KACA 2GYWA 4H35A 2OGTA 3TGLA 4Y2XA 4S0XA 4C4YA 3TJMA 3EQ8A 4RE5A 1W1IA 5E4JA 3R3YA 1XZHA 2O2IA 3IUQA 1EX9A 4I4CA 4PSCA 1QFMA 4IQ4A 4AMYA 2VF2A 5CURA 3LIIA 2PSFA 1BU8A 5EFZA 4F5ZA 3H2HA 3O9MA 1T2NA 2D5LA 3WZLA 1XROA 2XT0A 3I28A 2HA2A 3QYJA 5A7HA 4C4XA 2AJCA 4KJXA 4ARBA 1D07A 3VVLA 2I03A 4C01A 1CEXA 4OB7A 1XQVA 2QRUA 4BCDA 2QOEA 2J3DA 1HDEA 3IDAA 5AICA 3BL8A 4K6HA 5ALXA 1GPKA 5HF5A 5ISMA 2RHWA 3R41A 3R3VA 3AUKA 2H7CA 5AOCA 4CIBA 4B80A 4EY5A 3FNBA 3C45A 3DOIA 4H7JA 4OU5A 2WJ4A 2XUGA 5T4FA 2WILA 3DKRA 3A2LA 4H77A 5JAOA 4Q1VA 5HK9A 4BVKA 2XMQA 1LPMA 4KE6A 3G02A 3IVMA 1ZGBA 1TIBA 4FLMA 3VJMA 2CB9A 4BP9A 3M82A 4UBLA 3QZUA 1H2WA 2Z5GA 4BAZA 3DL4A 3W2TA 5A71A 4G4JA 3W9BA 2WFLA 1WPXA 1Y7IA 1P0PA 3PF8A 2QMQA 2AJLI 3V1NA 4J0KA 3BXPA 5EHQA 1N8SA 1XQXA 5IH7A 5AM1A 1ZI6A 2ACEA 1CUCA 4BCBA 2WUFA 2OPHA 5AM5A 2C4HA 4F60A 2X8BA 4UHFA 1LNSA 4PV7A 4HVTA 3C43A 5ALSA 4PW0A 5LYYA 5K3BA 3WWEA 3RM3A 2H9YA 1FFEA 4V2IA 2QVBA 1FJ2A 5CBKA 4U2EA 3UUFA 4BE9A 3EF3A 2RIPA 1QJ4A 2QR5A 1CUDA 1RP1A 2PM8A 3FCXA 1EH5A 1DX4A 3CN7A 2BUCA 1BRTA 3RLIA 3AINA 3DQZA 4L0CA 4H18A 1FFDA 5ALOA 3IA2A 4HXEB 5JZSA 4B0OA 5ALDA 1BEEA 4DYHA 3WWOA 1LZKA 2PSEA 1RWQA 4FNGA 3D2CA 5AKXA 1O6GA 3FSGD 1EDDA 1XRMA 3WKDA 3KSRA 1CQZA 2XLCA 1JJBA 1H2YA 3V48A 3D7RA 5IVIA 2XDWA 4A23A 1EB9A 5ALZA 2WG1A 2FJPA 1HL7A 3DD5A 4W9RA 4Y7DA 5FPQA 1SOMA 4NMWA 1LPNA 2FX5A 4ZI5A 1UKAA 4L9AA 3O95A 5AKYA 3STTA 1VZ3A 4BC1A 3I6MA 5ALUA 5JD6A 5ALNA 2QXTA 5EIEA 4M0EA 3RK4A 3PUIA 2WIGA 2XMDA 1BEZA 4QEKA 1N1MA 5AM0A 3B12A 2C0PA 1XLUA 1XZMA 3GZJA 2QM0A 5KWJA 1VE6A 5CH5A 3H1BA 2JEYA 4U2DA 5DTJA 4C6HA 1WPRA 4BDTA 2H1IA 5J3JA 2PU7A 1N5RA 3HYSA 4DSZA 1C7IA 3I2FA 4B7ZA 1UWCA 1ISPA 5ALHA 2WIJA 1C4XA 3BF7A 3R3ZA 2BJHA 2C7BA 2DHEA 2B61A 3S8YA 1EHYA 3WMRA 5LKRA 4MYDA 5ALVA 2HM7A 4CCWA 4G4IA 3WKAA 1AC5A 3DYIA 4B9EA 3TRDA 4QE3A 2ES4A 1THTA 1VJ5A 3STUA 4EY8A 3TEJA 5I8PA 2XUOA 4Y2YA 2VT6A 3WL7A 1W4LA 3WA7A 5HQ3A 4CIAA 2HDWA 3I6ZA 4H0CA 4EBBA 3BE8A 3E0XA 1HKHA 3Q8WA 4LHEA 4H7EA 2CZQA 4P92A 4HTAA 1ZD2P 4P9NA 1R1DA 5AJHA 4U2GA 1EI9A 4FLEA 1QO7A 2J3QA 2Z8XA 5HF6A 3R3XA 4PNZA 4UUQA 2XUAA 4X6UA 1X2EA 1UKBA 5HQ3B 5CH3A 4EY4A 3BIWA 4G9GA 6YASA 4FBMA 1AURA 1QIHA 4JH0A 1CUJA 2ZJ7A 5HF8A 2HADA 3LLCA 2VTVA 2ZSHA 1CIJA 3STWA 4TVKA 3ZLTA 3G9ZA 3H17A 5T4HA 1UZAA 4A16A 1W6RA 4DLNA 3FWHA 5IVHA 4OUKX 2OCIA 3CN9A 3LS2A 1DT3A 4DMFA 1MNQA 2DFPA 2OCKA 4MQLA 2XMGA 4YK7A 4E46A 4J0DA 3D2BA 5FDFA 1XZDA 3DDUA 2R8BA 2CUTA 3C6YA 1JFRA 2YASA 1ORWA 3WK5A 3V9AA 3I2KA 2VA9A 2J4CA 4JUIA 4BVLA 5CXXA 3PUHA 4N5HX 5JYCA 3OTQA 2YH2A 2ZVDA 2WIFA 5BWBA 3MVEA 2BFNA 4WJLA 3DYVA 3WKEA 3HI4A 3LIPA 4EB0A 2WJ3A 1UOQA 1NU6A 4QLAA 4AMZA 3WIBA 5DNWA 1GPNA 4RPCA 2O2GA 4M0FA 1CFJA 5AI9A 1GGVA 4UFOA 3GELA 5K3EA 1GKLA 3ZWQA 3X3HA 4N8DA 5FKJA 3QH4A 3F8SA 4LIPD 1YCDA 1I6WA 2XMSA 4F0JA 1ZI8A 5LZ9A 4WY5A 3OPMA 1XZEA 3F98A 2WG2A 4DMCA 2QUAA 2X5XA 4JEIA 4UBOA 1CUSA 4C88A 5A2GA 1K4YA 2JGIA 2CBGA 4DTCA 4MEAA 4BP8A 1EK2A 4U2CA 1VXRA 1A7UA 3LCRA 4JNCA 1IUNA 1BCRA 3ILSA 1DTEA 3PF9A 5E2IA 5DTIA 2HRQA 5AIBA 1VOTA 3HC7A 5JAUA 2WJ6A 3C70A 1AMNA 5AHXA 1OXMA 1WM1A 4FLFA 5LZ8A 2HA5A 4G8DA 4KAJA 2I78A 1HBJA 5CXUA 3EBLA 3G7NA 5IKXA 2HIHA 4BB0A 3FYUB 4XWGA 1GQSA 5D6OA 2EDCA 2WIDA 3G9XA 1UXOA 3MUNA 3I1IA 3ANSA 3BJMA 4Q05A 2G5PA 3O9VA 4AX4A 4K5QA 3ESDA 3H2IA 1Q0ZA 2JEZA 5JATA 4GBGA 5AOBA 2AXEA 2V9ZA 1MU0A 5ESRA 2JGFA 1WHSA 1QGED 1DX6A 5AKHA 4G8BA 1HPLA 1BCSA 1YS1X 4B6GA 4X94A 1E89A 2HU8A 4GI1A 4UHCA 2Q0XA 2Y2UA 4X85A 1TCCA 1DQYA 3HEAA 1OCEA 3ZI7A 1YAHA 1F8UA 3AZOA 1CUAA 1JU3A 3VKFA 1UK9A 3I2IA 5CT8A 1CVLA 2W22A 3G0BA 3IIIA 4DMHA 2ZYRA 4H7DA 1XZAA 3R3UA 1MNAA 2CMFA 1U4NA 1WB5A 4L3WA 2OCGA 4E15A 5A6VA 3VJKA 5K3CA 5JASA 2WHQA 1JJFA 2WKWA 3G9TA 3D2AA 4GDMA 2WHRA 2CKMA 2GYUA 4BCCA 4J0GA 5AM4A 1H22A 4LXHA 2LIPA 1JKMA 1YB7A 4TGLA 4DNPA 1P0MA 2C58A 5FPPA 1K63A 4OYYA 3QVMA 5DLPA 3ESBA 2ONCA 4EY7A 5AK5A 3BF8A 1B6GA 3MUOA 3B3QA 5ALIA 3WK9A 5CT9A 4DNFA 5DJ5A 3KWFA 1NU8A 3I6YA 1GPLA 2O7VA 3AZPA 1CUGA 5ALWA 2VAVA 1AGYA 4AN0A 2RGUA 2HU5A 1H2XA 1FFBA 5CT5A 1N5MA 3FYUA 5D3ZA 4DNQA 3EQ9A 3ZPXA 3K2IA 3B5EA 1RYYA 3O4IA 3UUEA 2XB6A 3DNMA 1IUOA 1KU6A 2GZSA 4RNCA 2AJ8A 2HFJA 3VDXA 1G42A 4KE8A 5C8XA 2IX9A 2PSDA 4I19A 1QO9A 5BV7A 3WL5A 5SYMA 3FLBA 1VKHA 5AKGA 4IHAA 1MN6A 4EA6A 5AM2A 1HQDA 3F96A 2B4KA 2OAGA 5JALA 3DS8A 1X2BA 3VJLA 1ZIXA 3G0IA 3KWJA 2UZ0A 3WYDA 1XRNA 2XUPA 4UBJA 5AKIA 3EIOA 4G4GA 2ZJFA 5JANA 2Y6VA 1BN6A 3AJAA 3KOOA 3A70A 4QDZA 2BAGA 1WHTA 3KD2A 1IVYA 1A88A 3FBWA 5AP9A 2ACKA 1QIGA 4DIUA 5HF9A 3O4JA 1ACLA 2PUJA 3WK6A 4LYDA 2HA6A 1XZLA 3R0VA 1SC9A 3FSGA 5ALKA 1JMKC 3ED1A 1QIEA 3EQ7A 5FLKA 1DWPA 4C89A 1CLEA 4WFKA 1XQYA 2PU5A 4BDSA 1NX9A 2BGNA 2Z3WA 3HXKA 4ZWNA 5HFNA 3E3AA 1JJIA 5AKLA 5ALGA 4C4ZA 5JD5A 3QM1A 3IUJA 1ZD3A 1CUVA 3CCCA 4Q34A 2VEOA 4Y2QA 2H7XA 1TAHA 3H19A 5A7GA 3GFFA 4MWTA 1LPBB 1UK7A 2XUFA 3C87A 3H2JA 1FSSA 3STVA 2Y1KA 4ZXFA 1JU4A 1THGA 3WWCA 1IZ7A 5D7BA 5LIPA 4G1FA 5E4TA 3C8HA 5JAPA 2J4FA 1ODSA 4HRXA 4HAIA 2WLSA 3R40A 2XUHA 1DT5A 2PSJA 4X95A 4ZGBA 5HK8A 1SCKA 4X6YA 1Q84A 4NZZA 1MX1A 4WCVA 3JWEA 5AKKA 3LP5A 5AK3A 3QITA 2IIVA 3WQHA 4CCYB 1CR6A 2DHDA 1CRLA 5K3AA 1IZ8A 2WHPB 4K2AA 4AN1A 3C6BA 4H7KA 2WUGA 5T4EA 3AILA 3WL6A 3SK0A 1ZICA 5C8ZA 4AO6A 5HKAA 5ALRA 2QKYA 5I9IA 3H0CA 2BKLA 3ICWA 5CRIA 2HA3A 1U2EA 3WL8A 1EB8A 5DNVA 3WJ2A 2GZRA 2WTMA 4H7IA 2H7YA 3I2HA 1QE3A 1EA5A 1QZ3A 3FLEA 4OD0A 1P0QA 4ETWA 4B82A 4XVCA 1ZD5A 1SCIA 3HABA 5CW2A 3IUNA 2O2HA 1BN7A 4W1SA 1ACJA 4W1RA 1TCBA 2VAXA 4B0PA 4BRSA 4NVRA 4MEBA 1E3QA 2VQ6A 2Y2VA 4X91A 1E8DA 1YR2A 4UHHA 3A6ZA 4X6XA 4AO7A 2ZSIA 1KU0A 1WCYA 4IH1A 5JD4A 1T4MA 1W76A 5FOQA 1UOPA 3JW8A 3WLAA 4OCZA 2JBWA 3O4GA 3WK8A 1XRPA 4LYEA 3G0DA 1ODCA 1CUHA 4QDTA 3I2JA 4O08A 3PICA 1MT3A 2HA0A 4QZVA 5CTAA 5AI6A 1QIMA 1DWOA 1H23A 5EIHA 2JGEA 4FOLA 5T4BA 1SFRA 3M3DA 3FYTA 5IVKA 4KRXA 5EHXA 1E8MA 2JIDA 4E11A 3V1LA 4N8EA 5KBYA 1XZBA 3GROA 4M0MA 5ALJA 4Q3KA 1GQRA 3WK4A 5SYNA 3UMJA 4OPMA 1E66A 2EDAA 4J0HA 1CUWA 3OM8A 4PO3X 1JMYA 3FVTA 1S8OA 2QT9A 1CUZA 2WQZA 3NOXA 4W63A 4OB6A 3AZQA 4XX1A 1F0NA 3E4DA 5A62A 2XQIA 5K5EA 3C5WP 3C8DA 3U0VA 4K6GA 1L7QA 1ORVA 1WB6A 4BAUA 4HZGA 1X70A 2ROQA 3IUMA 3QMWA 1ZJ5A 2ZYSA 4J0IA 5AOAA 1ZD4A 1XZKA 1K5PA 4H7FA 1LBSA 2WHPA 1XZIA 4BBZA 3V1KA 3NWOA 4KAAA 5ALMA 1QTRA 1XFDA 4B81A 1J2EA 4IH4A 1EDEA 2XUQA 3BDVA 3ZV7A 4GLBA 1TKRA 3D5EA 1PFQA 3L1HA 4YX9A 3QPDA 1VA4A 4OB8A 3IURA 3QPCA 5CMLA 1F6WA 1AQLA 1QIFA 2RONA 1LZLA 1YAJA 4N5IX 1ZI9A 3G8YA 2ZYIA 1R4ZA 4QLOA 4QNNA 4X71A 3T4UA 5AIAA 3WK7A 4A5SA 1XLVA 2IITA 4KE9A 3DLTA 3RARA 4AQDA 1QIJA 1MO2A 4BTLA 1QIDA 3VISA 2XMZA 4Y9SA 2VJBA 3U1TA 4EZIA 4KE7A 4PSUA 5JZ9A 4F21A 3WZMA 2DHCA 2WSLA 1E8NA 5BWCA 1K8QA 1EK1A 4J7AA 3AIKA 2OLEA 3O4HA 4GECA 1FFAA 5FUMA 5LZ5A 4J0CA 2VJAA 1CQWA 4FMPA 3SWWA 3IBTA 1UFOA 3NGMA 1DINA 3K6KA 1HLGA 2QJRA 4D9JA 1Q0RA 2YXPX 4EUSA 4EY6A 4TPKA 3QMMA 3D4LA 1JI3A 3FAKA 1EDBA 1J07A 1JT2A 2WU3A 5AKEA 1Q83A 3W9UA 2RHTA 4UFPA 4HRYA 3D0KA 2QXUA 3D59A 5FXMA 4Z49A 1YSCA 1VXOA 4DMKA 5LLSA 4OSEA 2GBFA 4YPVA 2GBGA 3FYUC 2VT7A 5AK4A 1M33A 2G63A 2VSQA 1G66A 1LPPA 1U8EA 5EIAA 1U65A 4WFIA 4BC0A 4BRZA 3QPAA 2AJBA 3WKBA 2W6CX 2OAEA 5JIBA 4QDUA 3STYA 1FFCA 1MPXA 4P93A 3G9UA 5DYYA 3G0CA 2GBIA 4E14A 3H2KA 4PQEA 3YASA 1YA8A 1XZGA 1GXSA 4X00A 2C5GA 3ESAA 4AZ0A 3R3WA 4XJVA 2YYSA 4WY8A 4YASA 5A7FA 4FDMA 4ROTA 4MYSA 3E1GA 1WB4A 2GYVA 2OGSA 4AZ3A 4HXFB 4PF1A 2OQIA 3F9CA 2XQFA 5K3DA 2X76A 3L1IA 1CUFA 1EXWA 2BGRA 3C6XA 1QOZA 3KXPA 4EHBA 4X90A 4X7BA 2P8SA 4MXDA 4Q82A 3WJ1A 1WOMA 2VJCA 5K3FA 5DYWA 3WA6A 4FKBA 3WYNA 1MJ5A 2WUDA 1TQHA 1AZWA 5JZBA 1LLFA 2JF0A 1C7JA 3FOBA 5AK6A 1B41A 5BOVA 1Y37A 3WIOA 5C7YA 3IB3A 1MAHA 4KEAA 5DWDA 3BJRA 5E4YA 4LXIA 2I3DA 1LPAB 1MX5A 2CEKA 4BATA 4MJ3A 2PSHA 4JYPA 1IUPA 2PBLA 3L1JA 2V96A 4DNOA 1CV2A 5LZ7A 2G4LA 3WI7A 1G5FA 1XZFA 1CUBA 5AH0A 4J03A 5AKJA 2FJ0A 4Q3OA 1O6FA 4MWSA 4Q3LA 4KRYA 2XLBA 1XQWA 3PI6A 4BVJA 3CXUA 4KAFA 2AJDA 3FLAA 4ZV9A 2PVSA 4UHDA 4HS9A 3DKKA 1K6EA 5LZ4A 1A8SA 1EVEA 5C8VA 4GXNA 2QUBA 4W1QA 1G4HA 2OCLA 1Y7HA 4KR0A 1EVQA 1CPYA 2RAUA 2XI4A 4FHZA 5DYTA 5AO9A 4B83A 2JGKA 3H18A 1BS9A 2GBCA 3STXA 3BIXA 3SX4A 1VA5A 3PDCA 1DQZA 4X97A 3T52A 2JGLA 4WDRA 2JGJA 2D0DA 4I3FA 3CCBA 1QTIA 1QONA 3RKSA 5HKBA 1W75A 3K9BA 1P0IA 3WWDA 3HACA 3OG9A 2HA7A 2XUDA 3C5VA 3O0DA 4XIIA 1DU4A 1Z68A 5AI0A 2QJWA 4ZV7A 5YASA 2C5FA 4GWLA 4UPDA 2DQYA 1QFSA 1GKKA 3HRHA 3WKCA 4CG2A 2WUEA 4FBLA 4DM7A 2V97A 4B84A 1XZJA 5ALYA 1QIIA 4LXGA 1AKNA 4BTVA 3S2ZA 4LKOA 2XQGA 1QIKA 4WDQA 1PJAA 2WG0A 4UBKA 3MGAA 3HLKA 5CT6A 1ZGCA 4AXBA 4BAGA 4B85A 2WU4A 1F0PA 3H1AA 4DSAA 1MX9A 1UOOA 3AFIA 2XQKA 2PL5A 1AX9A 2HRRA 1YS2X 3M81A 4G9EA 2HHAA
chains in the Genus database with same CATH superfamily
1J0CA 4L85A 3JAWB 3OESA 4EGCB 5ITSA 4IH9A 2B20A 5LU9A 1XDDA 2FCAA 5EUQB 4PHFA 1XWWA 2VRCA 3B1WA 5KTRA 3W2HA 1N6LA 4OHRA 3VDRA 1TPYA 2EFGA 3PLRA 4WA8A 1MBZA 1W4BA 1ZOLA 4HDKB 1TFRA 3I1FA 2J5RA 2NSYA 2P5SA 3PQ7A 3VPCA 1Z25A 4MRRA 1E1RD 5DXJA 3RV3A 3FFTA 2GO7A 4FOPA 3Q98A 4IS3A 4QDXA 2YRWA 4D3DA 2PA0A 4RF4A 2C42A 2VF4X 1RQPA 3CJTA 3NIBA 4IQFA 3MRVA 4KB5A 3UPTA 2DE0X 2DH6A 1L9KA 3RTCA 2V98A 3ESCA 1ABBA 1VLQA 1Q1QA 1X1TA 1L5QA 1LI5A 3ROMA 3V7UA 3HU1A 1DJNA 3OAAD 5BWNA 1OLSB 2KB0A 3JTMA 4Y0NA 1NMYA 3VVMA 1VSUA 5CFMA 5J58A 1DGQA 1MFPA 2Q99A 2P9GA 4XVUA 1A9TA 1S01A 2B35A 1YDMA 1DIRA 2GCNA 2P0AA 2VS1A 3IQHX 3QUCA 4B8WA 5BWMA 5AI4A 3WBJA 4UOZA 3GA7A 3ASYA 3CLRC 3ER9A 3AHIA 3TXXA 3PNLA 2Q6IA 3FW1A 1ESMA 1G8AA 1YVDA 3SJAA 4X1OA 2I4OA 3H1FA 3S2GA 4ZVOA 4DXAA 1BOFA 3HL0A 2FZKA 2XF2A 1SHLA 4A4DA 1J1IA 4A73A 1TEXA 4HAOA 2IUYA 5LOVA 1BFUA 3WBKA 2HZBA 2QHXA 3GP5A 5CYOA 4D42A 1AHHA 1PV1A 1TQ8A 2A4MA 1I2CA 2Q2VA 4JOCA 3WGMA 5JY1A 5LLTA 2JJQA 3OZXA 1GTJ1 1NUUA 3A14A 1D2EA 2HL6A 4CFSA 3GLFE 1ZJYA 2WWHA 1UP6A 1ZUD1 2QVYX 1YJBA 4RFSA 2FZLA 1ZD1A 2DC1A 3QPUA 3V1MA 1NYRA 2VCHA 4MVJH 1YULA 1PR6A 3DGEC 1J56A 5FL7D 5LP1A 3HZOA 2VT3A 1XHFA 3E58A 1OREA 1I4OA 1QO0D 2MYUA 2AFIE 3FVRA 2PK3A 4RGYA 2OVFA 2J0UA 2R5WA 4JQCA 3S55A 1G59A 4QUIA 1URPA 2OV2A 1MHTA 5DO9A 3PFBA 4A1OA 2QR2A 4C87A 4DXDA 2RH5A 1FW8A 3RSZA 2H2HA 1PWXA 3HKDB 4M9SA 2E5LB 3D3EA 3QHPA 5ALTA 1I2BA 4V0LA 3UB4A 1R3DA 4D8WA 1R88A 5DCWA 3K2QA 4FONA 3L4EA 3LKZA 3EUAA 2GHTA 1F51E 3RG8A 1CUEA 3RC1A 4R81A 3QBVA 1Y9ZA 4FYMA 4REOA 4BVFA 2R6GA 4MPJA 5F7JA 4JLSA 1QP7A 5K05A 2R7MA 4C2UA 1ZUHA 6CHYA 5MF6A 4YUVA 2BMFA 1CF4A 3C48A 3IR5A 3C3JA 4EDHA 3Q7TA 5TMBA 4COOA 2V1UA 4Z3OA 4YA6A 2X3YA 1XUOA 5KX5A 1GCOA 2LBPA 4XVRA 3LFUA 1YR6A 2GT1A 2VRBA 5NLLA 3MWDB 4BQEA 4AKEA 3ZQ4A 4JJKA 3U7FB 3IDOA 4F4UA 1L7DA 3A3NA 2J59A 1MIHA 1C9EA 3BTOA 2Z9CA 1PV2A 4AY6A 1OF1A 2IODA 1TJYA 1GN9A 2VATA 3L8EA 3ON5A 3GJ0A 4JIMA 2E89A 2IELA 1VQ1A 2HU7A 2OGZA 4OG2A 4R9UC 4RHFA 3R7FA 2CNKA 5JFTA 1TPZA 2AG8A 2Q28A 4LF4B 1Z4IA 4D25A 1GFSA 2RG7A 1E6LA 1LGYA 1P1IA 3WQSB 4X24A 3EDYA 1L7VC 3DM9B 3IBCA 4POOA 2YC4C 3QI7A 3ADKA 4OHMA 4DGQA 3HKDA 2F8SA 2DXIA 4LV6A 1Z6XA 4D96A 2QE7A 4IMPA 2C84A 1P45A 2E4ZA 2PZGA 3P9YA 3HADA 3TUIC 2HNKA 3QU7A 1YRYE 4I9HA 2FW9A 5TIIA 5LQUA 1QNLA 2FE4A 4HRVA 4RJ2A 1WL8A 3OECA 4WLOA 2NXJA 1Q0SA 3ADOA 1QC5A 3R4VA 2CZGA 4Q4AB 3GD5A 7MHTA 2Q49A 2B5OA 1OBFO 3DXZA 3LM8A 3QVXA 4B48A 1JIXA 5HFJA 1SHTX 1O0CA 3K0BA 4IJVA 4JQZA 1B6SA 1LVUA 2BUAA 2RBEA 3F2IA 3IUYA 4JWTA 2CXRA 2ZRLA 2Z2YA 4D44A 1KQGA 5AI8A 2GR9A 4KN5A 1RLUA 4RE6A 3AHGA 2YX1A 3A4NA 1XTZA 3ONEA 5DULA 4O3MA 2XNJA 4C7BA 1H2BA 1AB6A 1S2OA 1VIAA 4HXGA 4Q7MB 3RSFA 4N48A 2FDRA 1KC3A 2HB6A 5EUCA 4G23A 1VIVA 1MPTA 5EYPA 5CLFA 1HDGO 2I87A 4L5IA 3Q3GE 3VU3A 4B2YA 1POWA 4WT7A 3L6UA 1YO6A 4B3XA 1CZNA 1L8LA 3EF1A 4YI3A 5HG0A 4E4YA 3H83A 2DT5A 2IZ6A 2XMPA 3VM6A 3O2JA 3RWBA 1JSLA 2QN1A 4OXKA 4RANA 3RFVA 3SSNA 4BWYA 5IF3A 5JZOA 4DV1B 1YE3A 2AE2A 3EC7A 4EPVA 3LLMA 4LJLA 1LPOA 1NXTA 2LCFA 1VLVA 3CKKA 3F67A 4NC9A 1X74A 2JLRA 4H15A 4KW7A 5DVZA 1MAAA 1MJGM 2PUVA 5AW9A 4GQAA 3TEFA 4L08A 1ISGA 1A4RA 2RBKA 3AIOA 3GHHA 4V2UA 4JDPA 3L7CA 1S2IA 2C04A 1BE0A 1WTCA 5JAHA 2ZYTX 3DR5A 5ALEA 3CF0A 2ZZMA 3KOZA 1XMXA 1K7SN 2OMEA 3R74A 1C0PA 1RXYA 2O1SA 4EL0A 2ZJ4A 1IIBA 1S89A 3G89A 1FRQA 4NJMA 4JEHA 2Z8ZA 4KQEA 3HJUA 3W04A 2VHWA 1ECPA 4MAFA 3LVQE 5ERYA 1AF4A 3HCAA 2W6ID 4ETIA 1SEPA 5ESDA 3M6AA 4CEIB 2WTNA 1FMCA 5LNK1 4A36A 2FWBA 2ID8A 2B1JA 4FJ1A 4FFWA 1W49A 2QZSA 1ZN8A 3AU9A 3IP6A 3QMVA 1PX0A 3VGJA 3VH4A 1LW6E 3ND9A 4W9NA 3T1TA 1PJ8A 1U28C 2BFCB 3CIFA 3WLFA 1HA3A 3S4YA 3KP1A 5KX5F 2VPZA 1T8TA 2FRDA 3PCXA 4U2FA 2AQ8A 1DWQA 4V0MA 3PGJA 4EJ2A 5ICMA 5K3FB 2Y1WA 4DYVA 2VHZA 4TXNA 1L7RA 2WJJA 5BMOA 3IPAA 4Y2SA 4YRPA 2ORVA 3G59A 4LHSA 3W7AA 5EERA 4XWKA 2BEWB 1JFFA 3FI9A 1IY8A 1N5LA 3IAEA 2C77A 4MRPA 5L3ZA 4MDFA 4B76A 5JO0A 1I7DA 3ISJA 4MQMA 2VP4A 5TE9A 4EG8A 3EQ2A 1B2RA 3JQQA 3EXEB 1KSJA 1IOVA 1UBFA 3K0FA 3AVQA 4PZEA 2EIXA 4I5GA 4O4IB 5F9HA 3F97A 2ORYA 4QBKA 3VYTB 4OQNA 2C96A 4DDUA 1L5RA 5EP4A 5TNXA 1LH0A 1T6NA 2PMCA 3N75A 3LWDA 3RRFA 1D0IA 1F6BA 3OOJA 3ABSB 2Y0DA 5ALFA 2R44A 3TECE 3I5YA 3IEKA 1P31A 2IC5A 2OFPA 1NPTO 4DV3B 1WU8A 3VFDA 1ECLA 5HP4A 1ZGHA 2BZSA 4O4LF 3KHUA 4B2PA 4O29A 4R0MA 4LSZA 5CITA 1G8JA 5AK0A 1A04A 3DFZA 3KJFA 1X1SA 1F3LA 4Y6GB 3ROPA 5T3YA 4TWJA 4FE3A 1YIAA 4H1UA 1SPXA 2AMVA 3AEUB 4LE0A 1JLLA 2AZXA 2ZTMA 2ZW9A 4CQNA 3EZNA 2VBGA 4RVOA 2XCQA 4OU4A 2RKOA 3ONFA 1WULS 2PH3A 4ZOBA 4FYWA 4EG0A 4EW6A 4WUTA 1QLWA 3ICVA 1S4MA 3C4VA 3UA4A 3DE0X 3T1HB 7YASA 3WYBA 2AF3C 2YWEA 3R0ZA 4R8KA 1X87A 2VPWA 4DA7A 1Y1SA 2V7UA 1E3DA 3OEWA 4O33A 5IEBA 1WXWA 2XB9A 4FGKA 2QX8A 3PT5A 4OLFA 5SZHB 5DE3A 2OHHA 3TLAA 2E4YA 1D8TA 1OC4A 2QQEA 1T0UA 2D1FA 3ESXA 3UG6A 1YL5A 3N07A 1KDYA 2R2GA 1FP2A 4XYMA 2EP5A 1OOEA 4KL8S 5EZYA 2Q5CA 4KO4S 4D4HA 4D98A 5JS1A 1Z2AA 4W1PA 3QTBA 4G2NA 1KEEA 3LVFO 3P0IA 3GLGA 3O2SB 2B9VA 2DCMA 1T5SA 1OILA 3G1UA 1YL7A 5CVVA 2VYQA 3NT5A 4PHHA 4WUVA 4Q7EA 1JQJC 1HYGA 3KK0A 1MLDA 2NTVA 2IEZA 2ZYVX 1NSTA 3MFQA 4JSYA 3LYUA 4ZAZA 2V8BA 2XQJA 5L4NA 3I8XA 1TKBA 2ECKA 1PDWA 1Y7TA 3M9XA 5H70A 1UK6A 2CC2A 4E5YA 1IHUA 3LU1A 2C8KA 2PZ8A 3LV8A 2XSZA 3LFHA 1YDEA 1PQUA 1IXKA 1ZSNA 3EIEA 3FCYA 3FFAA 4J16C 1XZCA 3IKMB 3R6TA 1T35A 1UFQA 3G7UA 4MWOA 2LIVA 3IAHA 4YRJA 3A9SA 2CDBA 2FWJA 4C3UA 2O5EA 1U5CA 2OL4A 2GYWA 2QDXA 1T0JB 2VSXA 2YV1A 1AZLA 1KKMA 3DVQX 3GI1A 4J7UA 4DCVA 3TGLA 4S0XA 1SC6A 3KQUA 1NUAA 1GNQA 5KB3A 1DX9A 4BUJA 3TJMA 3MJRA 1JEYA 3ZHZA 4FR2A 1AM4D 2DGDA 2VEDA 1T36B 4IZHA 5JRJA 3ONDA 4PVCA 4WHMA 4KQ1A 2X0IA 4XDYA 4Z1MA 3G79A 4UNIA 3TRIA 4HY3A 2O2IA 5DFAA 4OHYA 3IUQA 2H1OA 3DE5X 1XPUA 3TIIA 5LWQA 1TVCA 1C29B 4MR7A 3H5NA 5BSWA 1GPWB 3P9SA 4NZNA 2XKKA 5CLQA 4CMGA 4YAJA 1VLMA 4WBXC 3OEYA 1FPQA 4YHBA 1KWKA 3LIIA 3QWFA 2FI1A 5EFZA 4D0RA 3A4TA 2A9RA 2WTAA 2CYAA 3HA7A 3CVWA 3VR0A 1T2NA 2ZSJA 2P3OA 4LFAB 1GV1A 5I51A 2I2BA 2O0JA 2XT0A 1HYHA 3FKQA 1AKYA 2AVDA 2AJCA 1SIOA 3SJUA 3TOSA 1E3WA 1SIBE 3V2UA 4L9RA 4CNBA 1HNNA 2I03A 4HWKA 4K1LA 1NNEA 2J0VA 1IATA 1V7ZA 2BFPA 4MV3A 2G06A 3BSWA 4IS2A 1Z7WA 4US2R 1FMFA 4CKBB 1RZRA 1G5PA 3FMOB 4V03A 1B8UA 2AMFA 4C0QC 2J3DA 3PC3A 5AICA 5C1PA 4K6HA 4QG7A 4WINA 3ZH9B 3IEUA 5ISMA 2RHWA 1R5OA 3R41A 3M4ZA 2OG2A 1W2HA 4QUHA 3UB2A 1SC4A 3B2NA 1D5WA 3ZWPA 5AOCA 4KKVA 5J5AA 3THRA 3H7AA 4RIIA 6ADHA 5D3MB 2E55A 4A6EA 3OFKA 2QSJA 3QKSB 2PT5A 3H3XA 1Z6TA 3ROEA 1ZN7A 2OHXA 2WJ4A 2A1UA 5T4FA 2Y77A 3DKRA 4QOSA 1EUCB 2JHAA 3CC8A 4H77A 5JAOA 2PN1A 2FF5A 4Q03A 1P7VA 5L95A 4XJXA 2GN1A 4A03A 4BVKA 2XMQA 3LX8A 1MOQA 3BULA 3FUTA 1RPNA 2BOVA 3DV0A 3BPSA 3HDJA 3HWSA 3IVMA 1X39A 4HNGA 1TJNA 3HCBA 1ZGBA 3UEOA 1TIBA 4K81B 4FDAA 3FRHA 3ZE6A 4QHYA 4DDMA 1VG9B 4XIFA 4F4HA 5CNIA 3QKRB 4FLMA 1FTGA 2EZTA 2WIAA 3REQA 3VJMA 3VSCA 4YMTA 2CDNA 1M6YA 2Q1TA 3EAFA 2IGBA 1U2SA 3LY7A 4IUYA 4D97A 4WCFB 5H7XA 5JJCA 2J9FA 1H2WA 2ZREA 4JQYA 4ARZA 1WUJS 2QRJA 3AF1A 3IDSA 4U3JA 3UHOA 2F2TA 3I04M 4NKRA 4KMSA 4KPUB 1T4BA 3PUXA 2HIGA 1YZLA 1DQSA 4G4JA 3NONA 1JI0A 4G25A 4KDFA 1MC1A 3KJHA 5J2TF 3FROA 1MJNA 3DL2A 1BJTA 4JXJA 5IJAA 2PFGA 2NUPA 4YMVA 2G1PA 4YONB 3NJRA 2HR1A 5DISB 2WFLA 3ELWA 3T1YB 3N58A 4LA4A 3UV3A 3AWDA 5BO5A 5T8KA 2O52A 2QIOA 1KDRA 1P0PA 3BMXA 5DH9A 4X41A 3IXLA 8LDHA 3X1JA 1WEHA 4RTKA 4W8GA 4TMYA 3IALA 3TLXA 4NULA 2QPOA 4UAUA 1E2DA 5FWDA 1KMNA 2WWWA 3M4XA 4J0KA 2P68A 4P0TA 4RV4A 3B1JA 4BKRA 3BXPA 4R2WA 1BA3A 1SD1A 1RKBA 4KQXA 5A3QA 7ADHA 1N8SA 3QE0A 1Z38A 2BGUA 2J5XA 4FXOA 4KQFA 1Y9AA 3L8DA 5JNTA 3FRJA 1ZU4A 2KW5A 2MHCA 1EFPA 2HOQA 3HK2A 3CPJB 1QHGA 3U3XA 2HBYA 1BMFA 2EW8A 3DMFA 4RC9A 2P4EA 2VBIA 2ZSAA 3G2QA 1Z28A 3VUEA 1P4JA 1FU4A 1LNSA 1LLQA 4EB6B 1EVIA 4GBED 4DPLA 4YV1A 4I9UA 5ALSA 4PW0A 2I4IA 2X8LA 3L41A 4DV6B 5D1NA 1SKBA 3H5IA 5U9CA 2QORA 2C5SA 5T67A 2OCYC 4ER7A 1IBLB 3E9QA 2I54A 3WRWA 1GTRA 1DB3A 1L7NA 1GEGA 1BG6A 2V4UA 2YHUA 2PQ2A 2GNAA 4RJIA 4ZCQA 3AI7A 4OKIA 1WCWA 5CBKA 1WQ1R 3EMVA 4BX9A 1I1NA 4BE9A 1VG0B 4L5YA 1TUEA 2I4RA 3BWCA 4MVJM 5LBTA 5BOSA 2GK7A 2OZPA 1C3EA 5FL7A 5JC1A 1CUDA 1DFHA 1SURA 3R9KA 4EGSA 2B7BA 4QU8A 4QQRA 4LZAA 1BCRB 1YKSA 1IN8A 1YR1A 1R12A 1YK1A 1PZEA 2VQEB 2VVTA 3ZVKA 2X41A 4BMSA 5KYUA 1DAPA 2AMYA 3U3DA 1J00A 3ZXSA 2WTXA 2OO3A 5AVQA 1M7BA 1E79D 3M5DA 4WIAA 1WBBA 1O6CA 3AI3A 3Q3VA 3U4AA 5CIYA 2OV8A 1Y6GA 2ZVQX 4QTXA 4MP3A 3UATA 2YJ5A 3ME5A 2QPLA 2CJWA 1XMIA 1ZRHA 4GOOD 4NPCA 5ALOA 1K4KA 5AT1A 6PFKA 3M5WA 4G0WA 4JT2A 5FO0A 2FX2A 4J7XA 2UUCB 4EPRA 3GRAA 1JQ5A 4Q9IA 1BEEA 4NYJR 3EXEA 3MNFA 4DYHA 4R7TA 2OBLA 3ZGVA 4MPTA 1L4BA 4HTFB 5TQVA 1KY2A 3KPWA 1PLLA 4WXPA 5M7EA 4BQIA 4YUAA 1PVOA 2FK7A 2YIDA 3LF2A 4ON9A 4ZYWA 1HNXB 3OJEA 1WD5A 1XYYA 4QODA 1H94A 1P2FA 2D1SA 2IRWA 3A04A 4QDJA 1H3EA 2UYHA 3ICOA 5IM4F 3WKDA 1DCKA 4KK4A 5GJVC 1DCTA 3WGIA 3TRFA 5CIWA 1M1YA 3QE4A 1YS9A 1E2FA 3RS8A 1X8JA 2P67A 4F3YA 2QB5A 3C7KA 3VKUA 4A23A 2SKDA 4S0ZA 3GZTB 5ALZA 1DAOA 4P54A 1HL7A 3C14C 3DD5A 2CFIA 3L8MA 4II7A 3W2GA 1W0JA 3VKGA 4RNDB 1VE1A 2A59A 2J9GA 4RK0A 2Z1NA 4IIYA 2JLUA 3AUUA 1G2OA 4W9RA 3UK6A 5H5JA 5L3SA 2EJVA 2V7VA 5FPQA 5CB0A 4TRRA 2MSNA 1SOMA 1PJ4A 2R68A 4AP5A 1UKAA 3MYYA 4L9AA 4FHEA 1ZXBA 2BZ1A 4R4JA 5AKYA 5B3KA 2DTEA 3UGKA 5F3DA 2ZBFA 2IZ5A 3A4IA 3H13A 5K0BA 2OMKA 2Q0SA 1S2MA 3CLVA 4BC1A 1ZN2A 1H3FA 5JCOA 5HGXA 2ZSUA 4G84A 2GS9A 1N5IA 4Q9NA 2QXTA 3P5BA 1NT2A 3EDMA 4M0EA 4QC2A 3DVRX 5JROA 3OEHA 3SXUA 3ROGA 1XMSA 4QOJA 1GN8A 3ID6C 4DCGA 1LLDA 2CMKA 4HQOA 3JQCA 3FH0A 1BEZA 1LB1B 3K9CA 4G09A 4QEKA 3H84A 4BB6A 4QYIB 1NJ5A 1N6NA 3UMRA 5C18A 3BIFA 2PUEA 5C51B 1YHZA 3MAAC 2P75A 4J3FA 3GZJA 1B43A 4NZOA 5CVEA 5H0IA 3X43A 5KWJA 1VE6A 4DJFC 2J85A 1PNQA 4J4BA 2A0UA 4EB8A 2OZLB 5DTJA 4AYWA 2IXBA 2Z58A 1CDDA 1DKLA 3N7AA 1WPRA 2WJVA 2TRSB 1C1XB 3R75A 4MGZR 5J3JA 1QU2A 3NVAA 2PU7A 3F4LA 3ZHQA 3BB4A 1N5RA 2D2EA 4J2OA 1KNXA 3HYSA 3A06A 2JI4A 1ZNYA 1HURA 3T9CA 4FC7A 3CUVA 3F6EX 4QNMA 3MA0A 5EUMA 3VHQA 4C0AC 5EJAA 2C4TA 2NO9A 1X19A 3IMKA 3LDUA 1C7QA 2Y67A 1IM5A 1YZNA 4JJGA 4JVNA 2MMCA 4B5LA 4BZQA 4EFDA 1ZMOA 3R3ZA 1ZMRA 4QFBA 3KS9A 5AYVA 2V4MA 2L82A 1UANA 2OHFA 3E8XA 3MMNA 1JXAA 2ZWMA 1UAYA 2QTZA 4J1SA 5IJZA 3I76A 2W2LA 4EECA 3TGPA 4PPNA 1IQRA 3B7PA 4UDNA 7REQB 2WVGA 4K6FA 4L50A 4YT5A 4CCWA 3OJ0A 3LZCA 4G4IA 4OXIA 4ZTBA 2W90A 1AC5A 3EWSA 2HX1A 3IAAA 1IPFA 3DYIA 2F17A 4AI6A 3LX6A 4WCFC 3ZX5A 2HMWA 1U0OC 4WN3A 3NHAA 2F67A 3EDQA 2Q6KA 4EY8A 1PGQA 3OY2A 1PRYA 3BAFA 4D92A 3EUFA 2OO5A 3TLGB 1T8WA 1P18A 4UU8A 3FF1A 1CP2A 2YQ5A 3ZYZA 5SYAA 2BFEB 3DBRA 4Z8YA 2ZRCA 2FUG1 3KXIA 4FFDA 2CK3D 5B3LA 2D7DA 4YIKA 2DPYA 4G1EB 3C98A 1Q2XA 3UYLA 2ODQA 1JR3D 3HZRA 3THOA 3V97A 421PA 5MN5A 3LRPA 3G0HA 2BM8A 1GIAA 2E1PA 2HDWA 2ZJYA 4JK3A 4U7JA 3SAJA 3I6ZA 2V7QA 4YCAA 4KV7A 1KS9A 1RWKA 3OF2A 1GKUB 5E1MA 5K2MA 1V8PA 4Q1BA 4DOMA 3O7WA 3PSAA 1F9AA 2R66A 2VAMA 4HI0E 2PGLA 1GPH1 1HKHA 2FLWA 3CY6A 2WD7A 4F85A 1G8YA 2G5GX 2WRZA 4UNQA 1B3RA 3MOIA 3GLKA 4HTAA 4B2IA 5BWLA 3MJTA 4O5OA 4LDPA 4TSKA 4FNAA 3T3PB 1XVIA 2PDAA 1KDOA 3CNNA 1R1DA 3FSEA 3OA0A 2QQFA 2PGIA 4NCJA 1EGMB 5ENDA 1JTFA 4JC4A 5A5EA 1EI9A 1V5GA 4FLEA 2ZTLA 5E6RB 3VZCA 3DCJA 2HMAA 4YXWD 1GUBA 3KR2A 2H4JA 1N1EA 3UMVA 1C9DB 2XCTB 2P7IA 2FZVA 1CLUA 2ZOSA 4HCJA 4DB4A 1J8QA 3HXLA 2ZQ5A 3EZYA 1X80A 5HA5A 5B7GA 1R5BA 5E7IA 1K5GA 1K98A 2W6PA 1QS0A 4ZO4A 1DIBA 5JRDS 1OY1A 4TSFA 3I05A 3E8SA 5AVYA 3OPVA 1R16A 4EUHA 1KARA 3HZZA 3Q3JB 4XEUA 5H3LA 3CMCO 3N2KA 3GCZA 5E95A 2IYZA 1MH1A 4N3NA 5C53B 5BMVB 2XIQA 3MF4A 3N8HA 1QG0A 1QIHA 4FBMA 4PG8A 3U09A 1CUJA 1BXGA 3WV4A 1ECJA 1SBYA 3RIXA 1A2BA 4IIBA 3PRYA 4M2LA 4YJ2F 2HADA 3JZIA 2IX3A 3SQOA 1EBBA 4AWBA 2VTVA 2Q46A 4TM7A 1CRQA 2ERXA 1TUGA 1R10A 2ZSHA 3OJFA 5DBOA 5FUYA 1G8HA 4CG0A 1HE8B 2A84A 3ZLTA 4XWYA 2HCRA 2IF0A 4AD8A 4G81A 4EVQA 2W2MA 2XOKD 1NVGA 3DMTC 3AFMA 4CIVA 1IBCA 5DEOA 2WJIA 1W6RA 4URFA 4DC1A 3DLBA 4IBOA 1EUCA 2B1RA 2QYHA 3FWHA 3CIOA 3K5IA 4ADSG 3BZUA 5IVHA 2ZUUA 4BLSA 4EYQA 2OCIA 3CN9A 4RA6B 3DE3X 1K7FB 4NMXB 1XDZA 4CMJA 1DT3A 1ORDA 3RUDA 1G3UA 1MQAA 1TU4A 3WR5A 3SFVA 4MQLA 3QNMA 1DUSA 1II8A 2I3BA 4E46A 2VCYA 1IOWA 1E5VA 1VIMA 3ZGXA 1A27A 3D2BA 2O2DA 1E63A 1UODA 1XZDA 5BR1A 1E2HA 3CEPB 4ZYLA 4RD2A 3DDUA 5CVTA 2R8BA 4XVQA 1PP4A 4MLCA 3FTCA 4OQMA 1HEIA 1KK1A 3C6YA 1JFRA 1G19A 2HQ1A 4FYHA 2AZDA 5AJUA 2CWDA 1OKKA 2XECA 3H8VA 1VI6A 1E1DA 2ZITA 1N7IA 4I6EA 4I1SA 4NEGA 3UQYS 1V6CA 2ENWA 3IPYA 4C0SA 2Q4RA 5GONA 4GXTA 2FG7C 1Y6FA 2F6RA 3K09C 5BN1A 4M4SA 3VUFA 4HDSA 4JUBA 4E08A 4HPWA 3ET4A 4N5HX 4NEHB 3AB7A 3TTUA 4BTEA 4PYKA 2FEMA 1BEUB 2HSZA 1U7XA 3MLEA 3GXOA 4KPEC 1JEDA 4NL4H 1Z4PX 2YUTA 1J0EA 2YBDA 2ZIZA 1O97D 4TWAA 4Z4EA 1UBLS 4BFSA 2WJHA 1EYZA 4RJLA 2ZVDA 2WIFA 3OZWA 5LCXA 3TTTA 1K7CA 1RCUA 2JBAA 3CSDA 3MVEA 5E2AA 2BFNA 3DLPX 4XCVA 3TOCA 4YRMA 5C35A 2C7VA 2OHJA 2HSEA 1YS4A 5HRUA 3AYXB 3DYVA 3W3AH 5JFGA 4F3KA 1CXZA 3WKEA 1JN0A 3HI4A 1DS6A 4XYBA 4EB0A 3EG9B 4ZYYA 3HS3A 1SC3A 2G88A 3VSEA 4Y1RB 1UOQA 2JRLA 3VZPA 4YRGA 1BGXT 4JQSA 4FR5A 4QLAA 4AMZA 1ECCA 3OIDA 3WIBA 3GEMA 3BJZA 1NXPA 3QTTA 1CZUA 4RZQA 4UJ3A 3SVZA 3H6KA 4BEVA 5BWOA 4L4YA 3R2JA 3TE6A 4RPCA 5BV2P 1TT5B 3GUVA 4HX9A 4M0FA 4IVRA 4MUXA 4CV1A 4FKMA 4TLAA 4L7QA 4L0QA 3SZ3A 2Y68A 3W5JA 2A2ZA 3O83A 5AI9A 1FTNA 3GJ8A 3QVVA 5EPUA 5J2UA 1QQTA 2V7EA 2PA3A 3O8DA 1E58A 1G6KA 1GGVA 1V9CA 1PQWA 3NO4A 4LRQA 1NBAA 2L69A 3JQBA 4J0FA 4TSRA 1CB0A 2H17A 1EUDB 4M37A 4WAUA 5KJ6A 1KDVA 3HQ4O 1HDOA 1RYHA 1ZH2A 1KFKB 5K3EA 5BQ3A 1VFPA 2BEVA 4N8DA 3RFCA 1DRVA 4EOGA 4XZ3A 3K0SA 4GM1A 2P9CA 2FSVA 4ZMRA 3C41J 4FSHA 3BT7A 4DDKA 5CLJA 4LIPD 2GNOA 1F8GA 1LQUA 2O9JA 4IMJB 5EWJB 3TOZA 2HO4A 1WHTB 2XMSA 2GCEA 3EIFA 3RUIA 5AESA 1OB2A 3CZAA 4BN0A 4ZI7F 5HYVA 2NAPA 1PS9A 1Y42X 3BERA 4EABA 2WG2A 2B3TA 4FDTA 2FSVC 1HDZA 1XELA 1SXHA 2QUAA 2R1ZA 2VNKA 2FSIA 3DTVA 1GRVA 3EWIA 3K53A 1N2GA 4JEIA 4EMBA 3KKKA 3V4ZA 5GM1A 5INTA 3ZGLA 4UBOA 3FPHA 4W8HA 5IT9A 4CTOA 4C88A 3SIXA 2BR3A 4J75A 1EK5A 1K4YA 2NZ2A 1KVUA 2C3MA 4G0OA 4U4AA 5K0ZA 5EZYB 2XH8A 4HB0A 2VO1A 1SD2A 5FHRA 3R3SA 2PS9A 3JALA 3GIWA 4XXHA 2IYLD 2PRYA 1OSNA 1MGOA 3LCRA 3TPCA 2FUEA 2VL7A 1OYYA 3R5SA 2XBUA 1YKGA 5CU7A 5BN3B 3Q8LA 3X0DA 1ZZGA 2HUPA 4BGIA 1BCRA 1PGNA 2CCJA 1JWAB 3ILSA 3TE7A 2XCRB 2ORED 4PLHA 2BH2A 2AR9A 3PF9A 5BVGB 5FFNA 4OHKA 4HGNA 4PZYA 1J0DA 1X8XA 1C8LA 1VOTA 2HSDA 4WKGA 3QUSA 2M6SA 1FSFA 2E1RA 5FI3A 1SXJC 2GPJA 3FMFA 4AZVA 2PRIA 5ECYA 1ZC3A 2DKFA 1AMNA 3COVA 2G17A 2B2XA 5AHXA 3HVJA 1OXMA 1NUQA 3O0TA 1M74A 1SH7A 2IU6A 2HA5A 3CXRA 3DJFA 3QELA 1KF0A 4KAJA 2I78A 4EG5A 5DW0A 2JLYA 2E48A 2ATXA 2WE7A 3G7NA 5G2OA 4IDBA 1SZDA 5CJJA 2HIHA 4BQOA 1AJEA 3O90A 3C7AA 2PXAA 4D41A 3DV9A 2JIBA 2YV5A 4EMTA 2CE7A 4IAOA 3TLEA 1ORHA 3IIMA 4A8HA 3KEGA 1ADJA 5K8TA 4FQ5A 3SGLA 3ZX4A 4ILEA 1K92A 1YZGA 3KEFA 3KTDA 3BXOA 5JSZA 1ZH0A 3LLUA 3A6JA 1UXOA 1JBEA 3IVRA 3PJRA 3D8NA 4DABA 4R54A 2OM2A 3VR6A 4DAEA 3EG5A 3K5WA 3SJBA 2IHUA 4GBGA 4M9UA 3GNLA 3V32A 1S8FA 4WRRA 4JI3B 2OQ2A 3GA0A 4P3YA 5LUBA 2AXEA 3BD8A 1M73E 3KKPA 2GZHA 1GSIA 1QGED 1EQUA 1YDHA 1DX6A 3M6FA 4RUKA 1YRAA 2WQ7A 1AXEA 3H5LA 1O9BA 2FWAA 4QT0A 2LKDA 5G3YA 4ZOAA 2P0YA 1SA0B 2O5RA 4F8EA 2FEOA 1YS1X 3DH0A 4PPQA 2QP9X 5BVHA 1JWBB 4GI5A 3URMA 3UF0A 2Y2UA 4CLHA 1NN3A 5KWVA 1MZPA 1EIZA 1MD9A 5EKTA 4L4UA 4RTPA 1T5TA 1YRBA 4ZCLA 1HORA 2W98A 4BX2A 2HWUA 3HEAA 5DM4A 4RKFA 4RQUA 1T6XA 4HB4A 1FTWA 1YXMA 2J3LA 4HDNA 3EWAA 4DM3A 1DEHA 1JDZA 1F8UA 1TUBB 1CUAA 3GPIA 4LQLA 3RH0A 1Y98A 3B9BA 4WBNA 1CVLA 1OA0A 1ZISA 2O4CA 4HQNA 4XA8A 1KJQA 3IIIA 5HMMA 3KJQA 2RKWA 4DMHA 4EIWA 3ZDFA 4AF8A 4F3TA 3R3UA 5A4FS 5B36A 1M1NA 1ICEA 2PPVA 2Q2WA 3R9IA 5SZKB 1U4NA 2DETA 3FCAA 3MJFA 4L3WA 3SR0A 2OCGA 3EYAA 4E15A 5CNMA 2A4KA 2D2FA 2Z83A 3GA5A 3MJCA 3SKYA 3VJKA 3VYWA 4YRFA 4V3BA 4LBYA 3WDSA 2Q9AA 4BQPA 3RR2A 2JKVA 2PFKA 4EVRA 4WESB 4BFUA 4DMLA 2MR6A 4I1VA 4NMLA 1P2TA 4TL8A 1IEVA 1V3UA 3VR5H 3P4XA 2O8CB 1A9PA 1I3LA 2C07A 4GF5A 4XB1A 4KDRA 1Q44A 1EFHA 4UD6A 1HYQA 4GOXA 3OZIA 5AMXA 1X1RA 3BXHA 3RNLA 2ZJZA 4JJ6A 5AM4A 5EKUA 4JJEA 5AJVB 3BMQB 4CKWA 2RAPA 1PO7A 4KWHA 4WNYA 4PPGA 2G0AA 1EJ0A 1GZVA 1NLYA 1E0DA 2FPIA 2IPXA 1P0MA 1IPEA 4FP9A 4QXOA 3ZZUA 4A1FA 1A4IA 4IGKA 2FRVA 4CL3A 1F9EA 4DQXA 4RTLA 1D3AA 3ICQB 4OYYA 2WM3A 3QVMA 4PXSA 2PVPA 3OJOA 2E21A 2GN0A 3K1AB 1NP3A 5DF1A 3FZGA 4IMIB 5M5BA 2V6BA 3V2HA 3KPYA 4UKDA 4YRLA 3VR5D 3ZQUA 1NF8A 1JRLA 4DIBA 4YAWA 2VHJA 3Q2KA 3ESBA 2GCGA 4NE9A 1C7ZA 1D6JA 1DOHA 5JG7A 4EY7A 5DB4A 4CTJA 1DMRA 3MUOA 2R1UA 3WGZA 2XNDA 4D0GA 2GM9A 1I4WA 2WYOA 5CT9A 4BFYA 1BDIA 3V80A 3CF2A 4I5DA 2PUBA 1HG0A 3R0QA 2NUTA 4DBLC 1OFHA 1NU8A 1KI2A 2J07A 2CNOA 1GPLA 1FLVA 1L4LA 2QGFA 5E6UA 5CJ2A 2P78A 4BKPA 1E3IA 4MV4A 1G55A 4QHSA 4ZCTA 1AF7A 2CLLB 2AK2A 2RGUA 2FMFA 1CETA 1NY5A 2HU5A 5F1KA 3ZTTA 1PJQA 1WDKA 4PTLA 5IARA 2P7HA 1RWMA 4LEIA 4G89A 3UXEA 1UBUS 1JV2B 3OHSX 1RLMA 1KI8A 1SVIA 1E6UA 1KJ9A 4I3GA 1JR6A 2YV3A 4R7ZA 3I23A 4QVIA 1PR3A 4CR8A 1SQ0A 5LOVF 4NPAA 3INNA 2B8JA 4JU9A 4XJSA 2Z5LA 3B5EA 3NV9A 3GX1A 5CDYA 6LDHA 3UUEA 3GFRA 3WNZA 2HIAA 3DAFA 4U7GA 5KYYA 3DNMA 3HA2A 4Z9AA 1I4TD 2DJ5A 4RNCA 5F1OA 4HEA6 3ZU6A 5JSZB 1NATA 3A25A 3GG2A 5E1DA 5I7HA 1BVRA 2RIRA 1SXQA 3P0RA 4AJLA 2G0TA 1TUIA 1RNLA 2C9OA 3M5CA 1Y48E 2PS3A 3KUKA 1GU7A 2FKNA 2IX9A 1DKPA 4UEWA 5EIOA 4HNAA 5H9VA 5IDWA 2A0KA 3M33A 5CFNA 2VG8A 2JG3A 2RGBA 2WWFA 1YHYA 1Z0ZA 3RS0A 3W0LB 1WUTA 3R09A 5BV7A 1X80B 2CT8A 3AVWA 1OTYA 4HAWA 3MS7A 1YZ3A 4B2LA 5EVJA 2OXTA 4BLWA 4E94A 2IW1A 3ZY5A 4YV7A 3D6VA 4LOKA 3ZV4A 3LT0A 5FO1A 3JQEA 1PHPA 1U98A 4H31A 3RANA 4IHAA 1OZGA 1E0KA 3CUUA 3GRVA 1L5OA 4EA6A 1FLAA 5A0VA 4GWKA 2VJPA 4MOWA 5J4VA 4J1QA 4DLZA 1FFWA 1VP3A 3PYLA 2E5FA 3GOHA 3MGBA 4RSRA 2HDOA 1B8OA 4WI1A 1GO2A 3GLRA 5EWMA 5DWQA 4UCFA 3O92A 5BPFA 3WGNA 3V7YA 5FPSA 1O89A 1ZIXA 2V54A 3IQXA 3MYRA 2JK0A 3B38A 1QPGA 3CX4A 4B3BA 4YCNA 2JI6A 3OAAA 1FRNA 3FOZA 2HF8A 2Q3BA 2R4TA 2HK8A 1KPHA 4RCZA 1V41E 3K0AB 3H4VA 2GZ2A 3HRIA 5A06A 2UZ0A 3GBPA 3ZZ1A 1KNQA 4Z2AA 1AD2A 2Z1DA 2ZRKA 2I29A 3GMDA 3HYCA 3JQ8A 2Z8YA 4PZPA 2WJAA 4GKJB 1U80A 2AGVA 2I6TA 2O7QA 4V0ME 3RROA 2UZIR 4CUJA 4TV8A 1H4QA 3EIOA 1B0UA 1AY0A 2ZJFA 4K86A 4Z3KA 1USVA 4ALNA 5JANA 2VDPB 2Y6VA 5JQGF 1X7WA 2AQKA 4R84A 1BXRB 4KQGA 3U3RA 4KXNA 3HYTA 5L6LB 3NBZC 2GJ8A 1G9XA 1RPAA 3OBIA 2G7MC 4R1TA 3VBEA 3C97A 1IVYA 5EWJA 3WXMA 3K9FC 1Z74A 5K0TA 4NAUA 1Q77A 5AP9A 4R5MA 4B43A 1FRVA 3DP9A 2E7ZA 3SM3A 1Y1RA 2IF2A 4HT3B 3ZDYB 4L4SA 3TBHA 3PP8A 4N5LA 4ESVA 3EZ2A 1BWPA 4J91A 3BJEA 4LYDA 1N0WA 2A78A 1TC1A 4PGMA 3PX3A 3VO2A 5F5LA 3NOOA 1JAYA 3NHLA 4WZZA 4I3HA 1E79A 4LJYA 4QELA 4DY4A 4OXXA 1A9YA 3FSGA 3ORQA 3ED1A 1QIEA 1GU0A 1VLZA 3FPLA 2NPFA 4IW3B 1DWPA 2ZU0C 4BJ5A 3NI2A 4FIDA 5ILOA 4RKWA 1G2PA 1X7DA 4OO3A 4WFKA 1XQYA 2PU5A 2NZWA 1JUDA 3I9MA 3DL0A 5AJYA 2WT8A 2WA2A 1TJ3A 1TE2A 2BGNA 1QJCA 2ZWAA 3ONWA 3OZEA 4YXFA 5EIXA 3SJCA 1NHWA 4DZTA 4XOIA 4R1LA 2Y3IA 4US0R 2I4NA 3R5KA 4R1SA 4C4ZA 2VK4A 2YWFA 3ULKA 5HIAA 4QRHA 4JBXA 5JD5A 3CV3A 3HZHA 2ZETA 5DNAA 2N42A 2VZ8A 5E7QA 1II8B 3RYFB 3S1AA 2EKQA 2IZ7A 1STOA 3W4IA 4DQKA 4F5EA 1CUVA 4LGCA 3NKLA 1IHXA 3F3KA 1OE0A 3OIUA 1MXHA 3ZD7A 2ST1A 1FFHA 2C5LA 3T9FA 4D0NA 2I22A 4F4CA 1U94A 3MHTA 4I50F 1V8FA 3GFFA 4LJ5A 2P5TB 4B3JA 3BWDD 3FSRA 1LPBB 4F04A 1NZDA 2XOKA 3DP7A 1UADA 2GZDA 1ZCAA 3DDWA 5KU7A 1P1JA 3K9GA 1SU7A 2X1HA 4Q4LA 5BQ5A 1GQFA 4DVGA 4B7XA 1RZRD 3WWCA 2NX2A 1GRCA 4MYUA 4U63A 5D7BA 5LIPA 2A35A 3GEGA 2RMKA 3OQPA 4HQLA 3SYTA 2QTAA 1Q16A 5I5GA 2XXJA 3ZY6A 4GPD1 3FTQA 5IMBA 1GZHB 4NOKA 3WSTA 1ZLXA 2WQ6A 3AWIA 3CH6A 4YC7A 1ODSA 2OCXA 2QTMA 3GG9A 2OSVA 2Y9MB 1V3VA 3JWJA 2ZRBA 3M6LA 2WLSA 3BZWA 4HAIA 1ZNXA 2LVBA 4HQFA 2XOEA 4KSBA 2PX8A 3ND5A 3R40A 2XUHA 5DOZA 2H4YA 4N6GA 4MQFA 5FFMA 3AJEA 2NU8A 2X14A 3BFXA 5KQMA 1U0FA 3ZTYA 1QBGA 4PX3A 1VHQA 2YHSA 5DCLA 4NZZA 4Q21A 4W9NC 2R7LA 2MYPA 2ZJ2A 2C4NA 4JCOA 1FMJA 4IG9A 5J43A 1WP4A 2PTHA 4CDNA 3HKCA 4LHVA 1E9RA 5A3SA 1C1YA 2D0PB 4LZJA 4Q3DA 3LC1O 4RHTA 3WHPA 1CR6A 3TG8A 4Z0PA 2DHDA 2XXAA 1CRLA 1PFVA 1VL1A 5DGDA 4EF6A 3TVDA 3EY9A 4KIWA 2J4DA 5KMGA 4FN4A 4K2AA 2TMKA 3RSOA 1XCOA 3EE6A 3C6BA 3L4SO 5TVKA 3RCBA 1ZMTA 1C2YA 1NI4A 2POQX 4EEZA 2EKDA 1I13A 2EBWA 2Y9PB 1KGDA 1Q1ZA 2GRUA 5KNBA 2W6NA 3PENA 5CVDA 2R751 4NCHA 1RRKA 2XA1A 5DN6D 4IL5A 4HNHA 1GA4A 4MDEA 2PT7A 1YBVA 1ZICA 4J43A 3NHBA 5K0CA 4ERNA 4FWIB 3O8QB 3PVZA 1E1CA 1MC5A 2OKGA 4GWGA 1C3XA 1PTKA 3ICWA 4CLRB 4OXYA 5CRIA 3N05A 1VBMA 3FWZA 3K4PA 4M8LA 3ZD6A 3PA8A 2QRQA 3SOPA 1FFXB 4JENA 4LHYA 2FPMA 2JS7A 3DZ8A 3K9LA 4UAVA 1JL3A 1EB8A 3PFIA 3WJ2A 4NHOA 2WTMA 2GASA 3WLRA 5IFLA 5CVCA 2H7YA 1GNPA 3T3NA 2O8DA 2JAOA 3SNHA 1TZMA 1WA5A 1NLUA 1U7WA 4K87A 3VPGA 4DDHA 1NR7A 1T15A 1QZZA 5A9SB 1I14A 5DHAA 2CYBA 1EA5A 1JHMA 1QZ3A 3WGHA 5F7ZA 1N2ZA 4F7DA 2GHIA 5BN5B 2FG6C 3KZNA 1PGOA 5EY5B 4RK1A 3KXDA 3JWIA 2Z2ZA 4BU0A 1IQ0A 3W5BA 4FVTA 3BMCA 2QE6A 3IUNA 2JLSA 4YUZA 1XRSB 4RKQA 2J3HA 4AN4A 4ZA2A 4NZ9A 2WF8A 4W1RA 4BNKA 1C1XA 1YTLA 2VAXA 2VJNA 4BRSA 2XWBF 1YDFA 2TSYB 4ZCRA 5GIOE 3ZZTA 4OX9B 1QYCA 1T29A 4PIMA 1T91A 2Y2VA 3WNVA 5CB4F 4X91A 3WNQA 2J9FB 2RHCA 2JIOA 4LSWA 2VFAA 1E8DA 1YR2A 4KVAA 4RD4A 3A6ZA 1QHHB 3QEAZ 1IVNA 1CY2A 4AYTA 1QR2A 1KU0A 1WCYA 2QX4A 4IH1A 1J0AA 1E7RA 1Q17A 3KKOA 4JOQA 5FHQA 1NY6A 4LTMA 2ZCUA 4HAXA 2WABA 4PCUA 2FG5A 5COBA 3ZKWA 3EGDA 3ZJ5A 1R27A 1SKMA 3IXMA 2CV0A 3ZWVA 4KPYA 5D86A 5G0VA 1JG3A 1AQUA 5HJ7A 1VE5A 3LA6A 2ADMA 2VTBB 3DO6A 3O4GA 1H93A 3QEKA 4MW4A 5KYVA 3U4DA 4HN2A 4E7PA 3PTAA 3G0DA 3DZJA 3S1AB 3Q8MA 2GEDA 4KBYA 2JHPA 2GWHA 4KAXA 3AHFA 2ZG6A 3U7QB 5GOZA 1LDEA 3D6JA 3ZW7A 4B17A 4EY3A 4F12A 4YGXB 5K8JB 4GYWA 3VC2A 3VPXA 1U3FA 4KGZA 1RI1A 1MT3A 5BW4A 1M5RA 3DXXA 1J5PA 3MLBA 5AI6A 2O2XA 3UA3A 1UPBA 2IXEA 3MEQA 1OHHA 3HWX1 1H23A 6REQB 3D3WA 5EIHA 5FBLB 5ICFA 3MXOA 4TMKA 4N7RA 2I5PO 1LRKA 3OICA 2JGEA 1XTSA 1JG7A 1T3GA 2OLKA 3ET5A 1QH9A 4JOSA 1SFRA 1C50A 1TO2E 3FYTA 3TQRA 5IVKA 2XE6A 4PG5A 4KRXA 5EHXA 1RXCA 2JIDA 2Q7XA 1XTRA 2ACVA 2AB0A 4E11A 1B8PA 1IC6A 3ACCA 3L3BA 2QRVA 1Y4AE 2RB4A 3NEAA 4ITRC 3RUHA 3BRWD 4A91A 5I9TA 2CXXA 1L3IA 5CGZA 3ZBTA 1Z6QA 2KE5A 4KN6A 3G8AA 5CK4A 3K4QA 4HDMA 4JLUA 4O63O 3BFKA 2GPYA 4FW9A 3NC1C 4M0MA 1H8EA 2YFYA 1PL8A 3EXIB 1M1NB 3VC7A 3WP0A 2ZCJA 3R4CA 5ALJA 3R7LA 4HAZA 2FSPA 3UGQA 2QRGA 1PT8A 4PC2A 5DM1A 2AXQA 3C4JA 3E9RA 3A1TA 4PGHA 2O2JA 1XTVA 1I0ZA 1E66A 5P21A 5SYNA 3DTNA 3ICPA 5KVQA 1HL3A 4EHNA 5JXGA 1YJQA 3JASA 4DKXA 1G6HA 1M7GA 4S05A 1CUWA 4PO3X 3FVTA 2QQ0A 3E7FA 3G2JA 4FFOA 1E2PA 4RDCA 2VF8A 2EBUA 4M9XA 1S8OA 5CBPA 4XR4A 3PHJA 4ZCMA 3HMKA 4XVHA 3UMCA 2LKCA 2EW2A 2IDMA 4FJ0A 3AUYA 1BCSB 3EFHA 4BFLA 1F0NA 2QRHA 1SB8A 4QBIA 2XQIA 2J6CA 4MRAA 5K5EA 2WJWA 4ZYVA 3HCPA 2NO1A 3C5WP 4AX8A 2BFDB 4RTSA 3H4MA 1SOUA 2MOKA 1C9YA 4B6OA 2LV8A 2H52A 4WA7A 1R64A 2VI5A 1P33A 5KHLB 3NM5A 3RAGA 4K9LA 1E2KA 1JDVA 2FCRA 4LMPA 4MKXA 1PLKA 1K6IA 2WKPA 2ZYSA 4QUKA 1XZKA 3AY3A 3IGFA 4KLCA 1K5PA 5DI9A 3U62A 1P8JA 5AVUA 3RVRA 1ZXLA 3O1IC 1S0UA 1PWHA 1QUEA 5LP6A 3V1KA 1KZ7B 1KMIY 4QAJA 4XUGB 3SPXA 1W25A 3LDHA 2J45A 5H68A 1QCCA 2WD7B 3MGGA 3GJ7A 3CVXA 1GWNA 4B81A 2MSCB 2ZBEA 1CHDA 3MB5A 3OZAA 4GRIA 4TYMA 1FYVA 2OBYA 3RK0A 1EDEA 5H02A 1P2GA 2XB2A 4DPKA 2QSYA 1LF5A 3D5EA 4D9IA 4NEQA 2XYGA 3SZRA 2YHIA 1MORA 2JFGA 3L1HA 5SV2A 4JP3A 4R2MA 1EM6A 3T6KA 2I6QA 1Y1QA 1L7BA 1HY3A 1MG5A 1F6WA 1UJBA 4OQ4A 4EHHA 1A9ZA 4UM5A 1SD5A 2AEJA 1Y7PA 2X0RA 3K8QA 1U9JA 3ZS8A 2A1IA 3ZVRA 3ER8A 4WCDA 4AUMA 3WLJA 1CNFA 1QRSA 1K6JA 1W1WA 4IDHA 5H59A 1LDGA 3ITEA 1P4HA 2JFQA 2JI8A 4LCEA 4BZPA 3P9KA 3VC3A 2VNAA 1V5IA 5BN4A 1T8SA 1WE2A 5I4BA 2RH8A 1EDOA 1BQEA 1IQPA 1UZUA 3AH8A 5KNDA 1ZI9A 2HMVA 2O07A 5H16A 4F1WA 2HLDD 3CKMA 4NHEA 3B20A 4UVGA 5REQA 1HE3A 4GSKA 3NYIA 4QNNA 3EPJA 1ZC4A 5AIAA 1GFZA 1X7XA 4MUBA 2ZQZA 4X7MA 1VJ1A 4PVDA 2VWQA 1W581 1K2WA 3HFRA 3TR5A 3ZHOA 4BNYA 1XEWY 5ER6A 2PH1A 4ZODA 5CA1A 3OT1B 3B8HA 4PG4A 2CVQA 5K8CA 1NE2A 2O2CA 3H1PA 3RT7A 2QW1A 3T7JA 1QIJA 4XM1A 1DJOA 1J8FA 1GUYA 2ZUTA 4AQDA 1MO2A 4PXAA 1PGPA 3ZW9A 1LX7A 1T4CA 2X5JO 3GJ5A 3EGIA 4B6EA 4TS9A 3HDTA 1ENZA 2RC5A 1JEEA 3U1TA 4C43A 1GADO 2Y1XA 3KU4A 1LDNA 3PXCX 1CZLA 4E1BA 2WAXA 2X9LA 2CXHA 3QXSA 1N7JA 2P11A 3I9JA 1XPOA 3F6PA 4KE7A 4PSUA 4LF5B 4AY3A 3NHMA 4BLUA 2WINI 4F21A 4DR2B 1Q22A 4MPDA 4QJ5A 4UHJA 5DHPA 3U40A 1Z0FA 4HJXA 5LMNB 1BDBA 4ZJYA 2ZT8A 2C4WA 1Y1TA 4JROA 4QU9A 4DCCA 3WADA 2I4TA 3HBAA 4IOKA 1K8QA 1V2HE 5TF4A 1DZ3A 1I8TA 4FKZA 1MX3A 2XNKA 1J2RA 1B1AA 2O2ZA 2VJOA 3ER6A 4J7AA 3CNLA 2WJGA 1UM9A 2YWJA 1KI4A 1PIWA 1ES9A 3NLLA 4JSTA 3ZIUA 3ZCRA 1E4YA 1VKZA 1QP8A 4PBTA 1DXOA 2O06A 1AT1A 4PPYA 1B0PA 3ZV3A 4KLZA 1LI4A 3C8ZA 4YXWA 3FNIA 4JZKA 2M6LA 5JNSA 4IDDA 3S8EA 1GYPA 2GEFA 2ZUSA 4FMPA 4PGFA 4QQKA 1WUHS 4GMDA 5KNCD 2Q62A 1RJDA 1KHTA 4J1NA 3ETJA 2O8CA 3G49A 3TLKA 2ZYUX 1DINA 3UKOA 1IBRA 3B6ZA 3K6KA 2OSBA 3W2EA 4B74A 1HLGA 2QJRA 3DLAA 3A1CA 1Q0RA 1E1MA 1KO8A 1BXRA 3T38A 1G21B 1Q7BA 2UUPA 2LW7A 4EY6A 2O54A 1RI2A 1RXSA 3P96A 3WRYA 1L7OA 1TM7E 1KORA 4JT4A 1UBHS 2PYZA 2CMHA 3VA7A 1NIPA 2LCIA 3N6XA 1PF7E 2Z2IA 3W8EA 3TVTA 3L2OB 3CWCA 3LBNA 4IXWA 4ZKDA 1CS4C 2JZOA 1MDBA 3KVNA 1T3TA 3U5TA 4NONA 3H9GA 4W7IA 2PJRA 3K70D 2EQ5A 1HKUA 2PYDA 4MYCA 2PCLA 2Q2NA 4NF2A 4Y6RA 3QKTA 2E4XA 1T1GA 4OAQA 2B82A 1F6DA 3BD7A 3WFJA 5JD3A 3NRCA 3VNRA 1RZ3A 1BJRE 2P3SA 3L7JA 1UMBA 4C07A 1RRVA 1VXOA 1CIPA 4XX0A 4MS4A 5IH3A 4F96A 3GMIA 4X20B 4BFXA 4UNRA 4EO9A 5L4SA 1ADYA 2DY0A 1ESCA 5KYTA 2CJWB 1GJRA 1POXA 3D4IA 3B89A 3DO8A 2G76A 4YRRA 2AKEA 3L46A 4YPVA 2OHOA 2VPQA 1NJ6A 2I2AA 2WWRA 3OTGA 3VAYA 1EE9A 1AHIA 3SJ7A 1FYDA 4F2GA 1QV9A 2CLHB 3KSDO 4HWRA 4BNZA 3AUAA 3NIWA 3FKSA 3Q15C 4ZU6X 3K9WA 1KOGA 5AK4A 4GX0A 1KO7A 1YIOA 1IN7A 2X1VA 3H8SA 1G64A 4JGBA 3WB0A 1E18A 2FMUA 1W8DA 4JFRA 1NHGA 4BEWA 2B7LA 2WWVD 2WTUA 2P9HA 1Z6AA 3QPAA 3DNPA 4KC0A 1JQEA 1KIMA 3FN4A 1XLTC 3F78A 1J42A 2YC2C 2RGYA 4YTEA 4RZUA 3W8NA 2PRSA 2Q1UA 3B3GA 4LCBA 4CUZA 4YR9A 5KOYA 1JTEA 1MPXA 2LDXA 4ALJA 1O94C 2B6HA 4P93A 4WKBA 2ZWOA 3PG5A 1L3BA 2N9UA 3P9XA 4FEYA 3L84A 4OQYA 2FF7A 1J1ZA 3H9JA 3MWJA 4TL9A 5BVGA 5JDCA 3OZGA 1NFQA 2B6NA 5ES4B 3G0CA 1I33A 4E14A 3ZHYA 2DBVO 1S2NA 1GGJA 3UMSA 1XQ6A 2GN2A 4XPIB 3L9WA 4NENA 3SOZA 1ND5A 4EB6A 4E5PA 2PJDA 2NADA 1JJVA 1X7XB 4F5WA 2I80A 2UZ1B 4F56A 2MSEB 3RVNA 2Q5OA 3DWGA 2P2ZA 2OOSA 3F90A 3I83A 4B7UA 1QHXA 1PEYA 1HOTA 2YMLA 3JQ9A 2BHSA 4PQEA 3SSOA 2PMKA 1SHJA 1SK9A 2P9EA 4G26A 1P91A 2EQAA 1TRKA 3VH1A 3MWDA 4XCXA 2Q3JA 2NLOA 4F5YA 1MJGA 4UE3S 1J39A 4UEKA 3HCEA 4CBVA 4FDMA 4F1KA 1XXHA 4DJJA 1L4NA 2M1XA 2GWRA 3SQWA 2G0NA 1NFFA 1WB4A 2GYVA 3JRXA 5K6AC 1HSOA 1EWKA 5IN4A 1PQYA 4PS1A 2QEQA 2I8CA 1JJAA 3UICA 1NVXQ 2XVMA 3AY0A 3BA1A 5M29A 3OIFA 1OROA 5K3DA 4JHLA 1U8CB 3IHLA 1OXBB 2VOJA 2AWNA 3L1IA 3BUSA 4IGIA 4OJQA 4RY9A 2FZGA 4ML3A 4DA0A 2VRCD 4ZHQA 2GRJA 1RFLA 2X2PA 1EXMA 5KYKA 1K8YB 1WZCA 2MR5A 4DV5B 4BLRA 2OV3A 3NEPX 1KJIA 2O8FB 3ISVA 2GB4A 4TMXA 1SXJA 1E6WA 3OLCX 2FN4A 4MAAA 1IWBB 4Z7OB 1T43A 3MJVA 1OVMA 2DTDA 1KJZA 1PI3A 1ZN9A 1V16A 4YO8A 2RI1A 4M1QA 3I6IA 3GY0A 2ILTA 3FYCA 4GNKA 4X90A 4CKZA 3QKRA 2X7XA 2P8SA 1VHJA 3EBPA 3T61A 4QM7A 4F84A 3ZK9A 2R7KA 3GRKA 4WZBA 5LFAA 2C20A 1JKFA 2B8NA 3HCNA 3U44B 3NTQA 1QTNA 4S1PA 4N54A 2REBA 3GC6A 1U99A 4GL2A 3E27A 4CKYA 1W4AA 1UWKA 1WOMA 2JASA 1XCGB 2PV0A 3EFOB 1Q0PA 5EP2A 5K3FA 4EW1A 5CB8A 1HQYE 2IYAA 1JYFA 3GFBA 2R8EA 1K08A 2VJKA 4Q6BA 3KVOA 1ZKDA 2FSGA 2Z09A 3PFKA 4JX9A 5EE0A 4KRGA 3BE6A 4TKUB 3HYRA 2HDNB 3JATA 2VLIA 4HYYA 2O2EA 2VN8A 4INJA 2OO5C 4UTZA 3GCGA 3AKCA 3CEHA 2FR8A 1HNWB 4LJRA 4G1CA 1H6DA 5FFFA 1HE5A 3OPYA 3RKUA 1DWUA 1I51A 2BZGA 5KHAA 4ZI3A 3L01A 4CIWA 3BHJA 4URYR 2B2NA 3IDQA 4KEAA 2PL3A 3OP1A 4ZZ1A 4ZVQA 4QJ3A 3KFLA 3VNBA 2ATCA 3VR2A 5E4YA 2FWPA 1TIPA 2IWRA 1MAWA 1K1EA 1Y3IA 4U39A 5D84A 2C8VA 3KT0A 4B79A 4CDGA 3UHJA 1H8ED 1MX5A 1WLSA 2O05A 3L02A 5ITVA 2JFOA 3ADDA 2N75A 2P4HX 3L1JA 2V96A 5AUQA 5FJJA 3DHYA 4QBFA 2YQZA 2BONA 4Y9DA 4RDXA 3EGDB 5JPCA 2VK8A 4GR5A 2FUG6 2G4LA 1FDWA 1ZVKA 5J2TB 4ZV4A 3WJ7A 3I53A 3L49A 3WI7A 1YVUA 1YS7A 1G20E 2NZYA 1YU6A 3PPYA 3GFSA 1PN3A 4M0KA 4FUTA 3HVKA 2EFYA 3NBUA 4JVOA 4RGVA 3FTFA 4ZHQF 3D7LA 3G8DA 2FJ0A 3DEYX 1JKJB 3GYGA 4Y8VA 3OVMA 1ZR2A 4E09A 2Z2XA 5AJZA 1J2TA 5KIAA 1JT9A 4IIJA 1H69A 4FM9A 2VHCA 1RAIA 4AF7A 1V1RB 2O0HA 3R7AA 1GCGA 4DQLA 2WZQA 2L0XA 1QS0B 3W7VA 2RGAA 1Q7CA 3ROFA 4BFWA 4KAFA 1CC1S 2AJDA 3QLTA 4AWXA 4M1YA 4KWEA 2PVSA 5JYBA 4GQIA 4DIFA 1P39A 2Z04A 4PNEA 4URXR 2XADA 3QUAA 1G8FA 3AP1A 4AZTA 5LZ4A 3M0EA 1L1EA 2IZ0A 4RBNA 1OC2A 4FZ5A 4XIJA 4EYGA 2FA9A 2J30A 4B46A 4Q4AA 4EPWA 4P4GA 2QJOA 3QVGA 5C8VA 4GXNA 4W1QA 2DWQA 1G4HA 1KR5A 3SZLA 1N77A 4J1TA 1NI5A 2B21A 2VBFA 2XA2A 3O38A 4Q15A 5FT9A 2RHRA 2P2SA 3A32A 3HUEA 4JCCA 3OM9A 1E2BA 1MDFA 5AD1A 3VOAA 5A4IS 2PYIA 2ZWPA 3UYKA 1KOFA 1HNZB 3LO5A 1F7VA 2GYYA 2XI4A 4QOHA 5EQDA 1PGJA 5DYTA 1M7HA 2H2FA 1DRJA 1JBQA 1XA4A 3FMVA 1CCWA 3OT4A 5AO9A 5IKPA 1H1DA 1C3LA 3ZWDA 2AN5A 1Y34E 4MW2A 1Q95A 2P9TA 4EBFA 2Q4TA 4OFZA 3GEBA 3R8CA 4A5OA 5K4HA 2FN7A 3I5AA 1ZH8A 1UJMA 3PDCA 4BN4A 1QVAA 1UP4A 3PXUA 2MU1A 1NUHA 2A7XA 4X97A 5IBQA 3CPSA 4XTRA 1D6SA 3B13B 4H6PA 3TZHA 3HY6A 5A2QA 4KTTE 3CJQA 1Y63A 3UJAA 4ZGGA 4BJHB 5B30A 3RVLA 1E9CA 1CYEA 3AI2A 3FHOA 4MQUA 2CVPA 4RD1A 1N9KA 1LX6A 3DOJA 5HCIA 1SQ5A 1NBMA 5F12A 3FCUB 1NW8A 1QTIA 4MI1A 1QONA 4R31A 2E4UA 2I8LA 4KHZA 3RVOA 4MWBA 3RKSA 1OXXK 4G5HA 2RK3A 4IGAA 1AA9A 3Q3HA 5M34A 4JUFA 3WMWA 1P0IA 1E1CB 2SBTA 2H06A 5G53C 4FOSA 1U9IC 3G5TA 1RXVA 4XIIA 4KIGA 1FA9A 2QAJA 3F5DA 4NBRA 1ST3A 3CUEF 2H5JA 1P7WA 1U9CA 4J6FA 5YASA 1WO8A 2Y76A 4EO4A 5DHQA 3CONA 5HIIA 1L6RA 1QFSA 3CW2A 3UMBA 4LY3A 3HRHA 4RXUA 3SF8A 3V1YA 4CG2A 1JHYA 1O94A 2A58A 2EG9A 4FBLA 1OXKB 5CCXA 2V97A 3A9RA 4H17A 4M60A 3VAZA 1K5HA 2IXTA 1J2JA 1IMOA 4OH1A 3M2TA 3T7AA 1ONPA 3IO5A 3WXBA 2X4DA 1TTTA 1NJ2A 1GRRA 2CFRA 2OP1A 1ZBDA 3OMXA 3PTLA 3VNAA 3K71B 4MI9A 3ZGOA 3I09A