4Q36A

The crystal structure of acyltransferase in complex with octanoyl-coa and teicoplanin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 107
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4q36A02
4MFJA 4MFPA 4MFQA 4Q36A 4Q38A 4MFZA 4MFLA 4MFKA
chains in the Genus database with same CATH superfamily
3FH4A 1Y9KA 2DXQA 3B3WA 3H8EA 4OC3A 4NGMA 3S9NA 2FIAA 5JPHA 2REEA 3PB9X 4CYOA 4MHYA 1KUYA 4R8FA 1LFWA 2EO8A 3CT9A 4EMEA 1Z5RA 3TFYA 2F8HA 2POKA 2ZEFA 2FSRA 3TT2A 4RS2A 1DE4C 1SQHA 4UCNA 2VBQA 4MJ8A 3IC1A 4ZYQA 3S6HA 2CXAA 2C27A 4MHNA 4KZTA 1IB1E 4Q7AA 4C7HA 1XBUA 2YNCC 3S6GA 2ODFA 3BI1A 2Q04A 3K9TA 5G1ZA 4P45A 1RO5A 4FUUA 4HKFA 5C82A 2Q7BA 2JEVA 3BLNA 4CAXA 3T90A 1TKFA 1J4JA 3TX8A 5JGFA 3P2FA 1P4NA 5KTDA 2PJCA 5HVGA 4KSAA 2R98A 4YRHA 4XNHC 3FF3A 4H89A 3TC8A 1BAVA 5LRKA 4U9ZA 2ABZA 1KWMA 1JQGA 4IAVA 2IL4A 1ZLIA 4HNXB 4KOSA 4FD5A 3V8IA 4CYNA 4OC1A 1ZLHA 4GXHA 1IOIA 4PPZA 4PXBA 2ZEDA 1QSMA 3WT4A 2ZOGA 2IMOA 4MHPA 4MBUA 1QSTA 5G21A 2H5MA 2PJ5A 4O23A 4OMEA 4ZY2A 4KSFA 4E0AA 4FBEA 4QBJA 2CF4A 3MN8A 3PBBA 5IB0A 1TKJA 3QB8A 2FL4A 4AG7A 2V8VA 4ZBGA 3BHXA 4UEFA 5AG6A 1HEEA 2ZEHA 1Y0RA 3IJ3A 4A37A 2Q44A 3H8FA 4H6UA 4R3KA 3DSBA 4UEEA 2GREA 3E0KA 1ARLA 2AFZA 5JM6A 2WSAA 3KQZA 3SXOA 2K5TA 4P4BA 5DWNA 4JJXA 4XPKA 4FD7A 4CGPA 4TNUA 1F57A 3KI9A 4MCRA 4R7MA 3NH8A 4E8OA 3ISXA 4UEZA 2PJ2A 4R87A 5KTAA 6CPAA 3CXSA 3GUXA 3DDDA 4UFWA 2HQYA 3LACA 3VH9A 4RUHA 3N5FA 2FS5A 5HXDA 5I4MA 5IB9A 3K9UA 1Z4EA 2AFSA 4X8IA 4KVXA 1YLEA 4MCSA 3FVLA 4JWPA 3PEIA 3I1UA 3G3SA 5D29A 4CAVA 5THWA 4NF1A 2ARHA 2Y0MA 1U6MA 2CY2A 1M4GA 2WZNA 2ZW4A 3DNSA 3D7HA 3GB0A 4NGQA 3SJFA 4ZI6A 2AJ6A 1TXRA 2Q51A 2O4HA 1CP7A 2PSWA 2PQ8A 4OIDA 1I1DA 4MFPA 4KOVA 1CPSA 3DGVA 1Q2YA 4AVBA 4UIAA 1Z8XA 4F8ZA 3JVNA 3NE8A 3OWCA 4KVME 4NGPA 2ANPA 1XOVA 1XJOA 3B3SA 7CPAA 1MK4A 4FAIA 1X10A 3N7ZA 4BINA 2BSWA 4AVCA 2CNSA 1LAPA 4OIWA 4PXEA 1ZG7A 1YVKA 3CDXA 3F5BA 4LQGA 4FD4A 2BUEA 5F09A 2WPXA 4ZX8A 5D8NA 1TF8A 4L8AA 3WR7A 3R9GA 4OC5A 3D2PA 3KZWA 3TO7A 4ZGYB 2GLFA 4EVYA 4R3LA 2AFWA 2PJ8A 2GU2A 3D67A 3MGDA 3R1KA 2OB0A 4DYOA 3FEEA 4A31A 2ATRA 1B6BA 1ELLP 3TTHA 1B87A 1NSLA 3BXMA 1M4IA 3SHPA 4B5PA 1IYKA 2XEFA 2O28A 4B5OA 1XMBA 5ISVA 1Y9WA 5K8MA 2PVVA 2G0BA 4NCZA 4IHMA 1OBRA 2HUZA 1BO4A 4KVOE 4UA3A 3DR6A 3LD2A 4C7IA 3IWWA 4CYPA 3FB3A 3D2MA 4R9MA 1PU9A 4EWTA 2WYRA 3ISZA 4CS0B 3UY5A 1LCPA 2PJ4A 2VZZA 3KKWA 3PB4X 2D4OA 3V38A 3JTKA 1CX8A 1XRYA 3D7DA 4B11A 1IIDA 4JXRA 2ZENA 1KZFA 4XPDC 2V8DA 2ZPAA 4P6YA 2A4NA 1QSOA 5LYIA 2Z0ZA 4IF5A 2B58A 2DPSA 2EK8A 2PRBA 3GYAA 4IK2A 4P44A 4TWEA 4MHZA 1VHOA 2C6GA 4OC0A 3IU2A 3BJ8A 1IYLA 4PQAA 4Z65A 3I3GA 2P6GA 1UFHA 4IUSA 1I21A 3KR5A 3VATA 2FE7A 2PDOA 1H8LA 4YU9A 5IX3A 5K8NA 1OZPA 4HNYB 3ZJ0A 5DS0A 1IGBA 2ZEMA 4A2ZA 3T9YA 1YSJA 2ZW7A 2ZEEA 4PXCA 1YREA 4Q38A 4A95A 5CBMA 1N71A 2ZW5A 2PJ9A 1EE3P 4UWIA 1Z2LA 3SI0A 3PP9A 5J8CA 3QAHA 3P2HA 4MY3A 2QECA 3GY9A 1YK3A 3TO9A 4MFLA 4KUBA 3FIXA 1KUXA 2CNMA 2GFQA 2VI7A 1M44A 2RFHA 4R57A 4GM5A 2C1CA 4C2ZA 3D68A 1RTQA 4UCMA 5AG5A 5HVFA 3SJXA 4LX9A 4PSXA 4H2KA 1Q2DA 2AFMA 2PIYA 3PGPA 2Z3OA 4I49A 4OP4A 5KTCA 1VHSA 2B4DB 2DF5A 4DUKA 3S9MA 5I0CA 1KUVA 1CPXA 3I9SA 2BEIA 3IGRA 3T8WA 3B7IA 4Y49B 3QAYA 2J8RA 4OLLA 4PK3A 1F2OA 2PJ1A 3HUVA 1Q2CA 1F2PA 1HDQA 2B5GB 5LRGA 2AE6A 3WC6A 2PJ6A 5BWAB 2F7VA 2O53A 1M4LA 2DEAA 4M6IA 1YW4A 3IEHA 4H6ZA 3KHXA 4AXVA 4AVAA 5HH1A 1YVOA 2YNDA 1ARMA 4PV6A 3D7FA 2OU2A 2AFUA 1IOFA 2C6PA 3EY5A 2I79A 3RAMA 1AUGA 3EFAA 1BLLE 3VARA 4ZY1A 4JLYA 4C68A 3FYNA 2VL1A 2EVNA 3IWEA 5JQ4A 2JBJA 4J3GA 4F9VA 4G1PA 4YGOA 2OZHA 1CG2A 4A39A 4KOYA 3R9EA 4ONWA 5HVHA 2I3CA 3W6SA 1CBXA 2AFOA 2ZEPA 1NMTA 2ZEGA 1VIXA 3L2NA 5GCNA 4M6HA 2AFXA 1TIQA 3G8WA 4P4FA 4X2TA 3H8GA 1VHEA 2Z3PA 3FBUA 1R57A 2X7BA 4MFJA 5DWMA 1XF8A 4FD6A 3B3CA 4R76A 4WWVA 4JD6A 4JZ0A 3PRTA 4MFZA 4QC6A 2OR4A 2WUUA 4Y49C 2JDCA 4KOWA 2G9DA 3VWDA 3MRUA 2ZW6A 4NGSA 3VWEA 1MJBA 3KR4A 4JYWA 2VQYA 2PIZA 3B3TA 4QB9A 1A2ZA 3LMSA 4XPDB 4RN7A 1ON0A 5K8PA 3IFEA 4UFXA 1VGYA 1P0HA 4X3RA 4NSQA 2F5IA 3KGQA 4OC4A 2QMLA 1WK4A 2FIWA 5G22A 2Z3LA 3WABA 3EO4A 1GYTA 4R6TA 1AYEA 1S7LA 4OADA 3KHZA 2CTBA 4M85A 4OC2A 4BMHA 2Q4YA 4ORFA 2PCUA 3FXTA 1ZG9A 4DJLA 4MI4A 2HB6A 4K3NA 4CYQA 2CIJA 4CRZB 3JUWA 5JH9A 2I00A 4A30A 2Q4VA 2GE3A 2BCOA 4RI1A 4B13A 3D7GA 5G20A 5F48A 4F0YA 3KL9A 5LRJA 2PVWA 1JWQA 3CXPA 2FCKA 1IY7A 1NE9A 4LQ6A 1S7KA 4CAFA 2EWBA 3SJGA 4NJQA 4KLWA 1Z8TA 1LAMA 1QQ9A 1XFOA 3KASA 4BD9A 1BPNA 1YQEA 2JBKA 2PRQA 2B4BA 3WC5A 1Y7EA 1BOBA 4KUAA 4P4IA 2OZGA 5E96A 5J1QA 3PFEA 4BBHA 4K30A 2R7HA 1M4DA 2R8VA 5ELYA 1Q7LA 4MFKA 1YR0A 1LRZA 2CTCA 2Z3KA 2PC1A 4CGMA 1QMUA 3DLJA 5LYFA 3SI1A 5J8FA 2R1IA 3F0AA 2Q4ZA 1YMEA 4PSWA 2IJZA 2CNTA 3FJUA 3S9LA 1XE4A 4P4JA 4NFRA 4II9A 4UWJA 2J8MA 2HV2A 4CGOA 4OKOA 3CXQA 1Z9UA 2XEIA 4U9YA 3V7ZA 3CPXA 2J9AA 4UCPA 3TOAA 4CGLA 5HMNA 2Q7SA 2ZOFA 3B3VA 5AGEA 4DNCA 3NH5A 3EC4A 2QIRA 2ZEOA 4F0XA 1XMTA 1QSRA 2C6CA 2G3AA 2NYQA 4W9YA 1YGHA 2EBJA 2Z3NA 5LYDA 2PR1A 4ZY0A 1XEBA 1S60A 2B3VA 1FY7A 1IICA 3ZZIA 2NMTA 3KQXA 3FRMA 2P0WA 1VKCA 4KOTA 3FEDA 1Z4RA 3RBUA 2D4PA 2YNCA 1M1DA 2VZYA 4P10A 4C2XA 2EK9A 2V8GA 3BI0A 3HLPA 2EUIA 1DTDA 2P6EA 2GANA 2OZUA 4QVTA 1L0CA 5EC4A 4MRIA 3WC7A 3TOBA 1GHEA 2G3TA 4M3SA 4MMOA 3SXNA 3A9LA 4MFQA 4MCQA 3TCVA 3QNVA 3D8PA 3IU1A 3NA6A 3FNCA 2OOTA 5A27A 5C88A 3RZAA 4M6GA 3D4UA 4B12A 1CJWA 4A32A 4QUSA 3IIBA 1LOKA 5K8OA 2J8NA 3FMCA 5H86A 4X5KA 2VXKA 4CAEA 4HNWB 2XEGA 4UF4A 3BJ7A 3PB7X 3S6KA 2PE3A 2RB7A 3GLJA 1CM0A 1R43A 3PZJA 5IV0A 2PJ3A 1ELMP 5EBVA 2VEZA 1MJ9A 2QYVA 1Z8WA 2PR8A 5F46A 3R96A 4CPAA 4B14A 2QJ8A 1IU8A 3C26A 5A28A 4YWYA 4B5PB 3NH4A 4EFDA 4L89A 2Z3MA 1PCAA 2PJ7A 4B10A 2V8HA 8CPAA 4GS4A 5FVJA 3RO0A 4PK2A 4U5YA 4WJBA 4NEXA 4F9UA 3TO6A 2Q0YA 3D66A 2ZELA 1YW6A 4JXQA 3IWGA 3K2KA 1FT7A 2Z10A 2JDDA 2V77A 4CGNA 5F49A 1QSNA 2BOAA 1AMPA 4KOUA 2NSMA 4P4DA 4Q36A 3IO1A 3W91A 2BO9A 4P4EA 2ZXVA 2JEWA 2GIVA 1PYTB 1Y7RA 1BPMA 4AG9A 4HPSA 5F47A 3EXNA 1S3ZA 4UBRA 1CP6A 3RYOA 3S6FA 1V0CA 2OH1A 1TF9A 4UFVA 5H84A 4PXDA 3B2YA 4B6ZA 3R95A 2PJAA 2XEJA 2HC9A 3CPAA 3GKRA 4KOXA 1S7FA 3PFOA 1LANA 3DR8A 3TE4A 1WWZA 4XPLA 3FX6A 5AG4A 2P6FA 1R3NA 5CNPA 3PB6X 4AB7A 2FVGA 1RXTA 4CRYB 2B4DA 5EMIA 3R9FA 1Y0YA 2Z11A 3W6XA 4KSIA 4C2YA 1MJAA 3B8GA 2B5GA 2RC4A 2DPTA 1PUAA 1YLOA 4NGRA 4YFJA 4NGTA 2GLJA 4KORA 3PBEA 2JLMA 1K4JA 3F8KA 3CZXA 5AG7A 1ZO0A 5LYLA 2YNEA 1TKHA 1UWYA 2WPWA 1S7NA 4UIBA 1YX0A 1XIXA 3RNZA 3H4QA 3NE7A 4MXUA 2YGWA 4CAWA 4A33A 2PJBA 5CPAA 2QVPA 3LODA 3H5ZA 1I12A 3FECA 3LWUA 4NJRA 2PJ0A 4F6AA 2B3UA 1S5KA 1X12A 2FT0A 3PB8X 2KCWA 1Z8LA 1FNOA 4OAEA 4KLVA 4A94A 3JRUA 3NFZA 1ZG8A 2FXFA 4FWUA 2BL1A 2Q43A 3GIUA 4NXYA 3SJEA 4NGNA 4MY0A 3SI2A 4XNHB 3D3SA 2IQ6A 4LUAA 4MCPA 4ZX9A 3B35A 1HDUA 4KS9A 4MHDA 4A38A 4E2AA 1NSAA 4ONUA 2REFA
chains in the Genus database with same CATH topology
1Y9KA 2DXQA 2FIAA 5JPHA 2REEA 4CYOA 1KUYA 3TFYA 2FSRA 3TT2A 4RS2A 1SQHA 4UCNA 2VBQA 4MJ8A 3S6HA 2CXAA 2C27A 4KZTA 1IB1E 4C7HA 2YNCC 3S6GA 2Q04A 5G1ZA 1RO5A 4HKFA 5C82A 2Q7BA 2JEVA 3BLNA 4CAXA 3T90A 1J4JA 3P2FA 1P4NA 5KTDA 4KSAA 2R98A 4YRHA 4XNHC 4H89A 4U9ZA 2IL4A 4KOSA 4HNXB 3V8IA 4FD5A 4CYNA 1QSMA 5G21A 4MBUA 1QSTA 2H5MA 4E0AA 4QBJA 4KSFA 5IB0A 3QB8A 2FL4A 4AG7A 4ZBGA 5AG6A 2Q44A 4H6UA 4R3KA 3DSBA 3E0KA 2WSAA 3SXOA 2K5TA 5DWNA 4JJXA 4XPKA 4FD7A 4CGPA 4E8OA 4R87A 5KTAA 3CXSA 3DDDA 4UFWA 2HQYA 2FS5A 3K9UA 1Z4EA 4KVXA 1YLEA 4JWPA 3G3SA 4CAVA 4NF1A 2Y0MA 2ARHA 1U6MA 2CY2A 1M4GA 2ZW4A 3DNSA 2AJ6A 2PSWA 2PQ8A 1I1DA 4MFPA 4KOVA 1Q2YA 4AVBA 3JVNA 3OWCA 4KVME 1MK4A 3N7ZA 2BSWA 4AVCA 2CNSA 1YVKA 3F5BA 4FD4A 2BUEA 2WPXA 4L8AA 3WR7A 3R9GA 3D2PA 3TO7A 4ZGYB 4EVYA 4R3LA 3MGDA 3R1KA 2OB0A 4A31A 2ATRA 1B6BA 3TTHA 1B87A 1NSLA 4B5PA 1M4IA 3SHPA 1IYKA 4B5OA 2O28A 5ISVA 1Y9WA 2G0BA 4NCZA 4UA3A 2HUZA 1BO4A 4KVOE 3DR6A 3LD2A 4C7IA 4CYPA 3FB3A 3D2MA 4R9MA 1PU9A 4CS0B 3UY5A 2VZZA 3KKWA 2D4OA 3JTKA 4B11A 1IIDA 4JXRA 1KZFA 4XPDC 2ZPAA 2A4NA 1QSOA 2Z0ZA 4IF5A 2B58A 2DPSA 2PRBA 3GYAA 3IU2A 3BJ8A 1IYLA 3I3GA 2P6GA 1UFHA 4IUSA 1I21A 2FE7A 2PDOA 5IX3A 1OZPA 4HNYB 3ZJ0A 4A2ZA 3T9YA 2ZW7A 1YREA 4Q38A 4A95A 1N71A 2ZW5A 4UWIA 3PP9A 5J8CA 3QAHA 3P2HA 4MY3A 2QECA 3GY9A 1YK3A 3TO9A 4MFLA 4KUBA 3FIXA 1KUXA 2CNMA 2VI7A 1M44A 4R57A 4C2ZA 5AG5A 4UCMA 4LX9A 4PSXA 1Q2DA 4I49A 3PGPA 2Z3OA 5KTCA 1VHSA 2B4DB 5I0CA 3I9SA 1KUVA 3IGRA 2BEIA 4Y49B 2J8RA 4OLLA 4PK3A 1Q2CA 2B5GB 2AE6A 5BWAB 4H6ZA 4AVAA 5HH1A 1YVOA 2YNDA 4PV6A 2OU2A 3EY5A 2I79A 3EFAA 4JLYA 4C68A 3FYNA 5JQ4A 2EVNA 3IWEA 4J3GA 4YGOA 2OZHA 4KOYA 3R9EA 3W6SA 5GCNA 1NMTA 1TIQA 3G8WA 2Z3PA 3FBUA 1R57A 2X7BA 4MFJA 5DWMA 1XF8A 4FD6A 4JD6A 4MFZA 4Y49C 4QC6A 3VWDA 2WUUA 2JDCA 4KOWA 2ZW6A 3VWEA 1MJBA 2VQYA 4QB9A 4XPDB 1ON0A 4UFXA 1P0HA 4NSQA 2F5IA 2QMLA 1WK4A 2FIWA 5G22A 2Z3LA 3EO4A 1S7LA 4OADA 4M85A 4BMHA 2Q4YA 4ORFA 3FXTA 4MI4A 4CYQA 4CRZB 3JUWA 2I00A 4A30A 2Q4VA 2GE3A 4RI1A 4B13A 4F0YA 5G20A 5F48A 3CXPA 2FCKA 1NE9A 1S7KA 4CAFA 4KLWA 2B4BA 1BOBA 4KUAA 5E96A 2OZGA 4BBHA 4K30A 2R7HA 1M4DA 2R8VA 4MFKA 1YR0A 1LRZA 2Z3KA 2PC1A 4CGMA 5J8FA 2R1IA 3F0AA 4PSWA 2CNTA 1XE4A 4II9A 4UWJA 2J8MA 2HV2A 4CGOA 3CXQA 1Z9UA 4U9YA 4CGLA 4UCPA 3TOAA 5HMNA 5AGEA 4DNCA 4F0XA 3EC4A 2QIRA 1XMTA 1QSRA 2G3AA 1YGHA 2Z3NA 2PR1A 1XEBA 1S60A 2B3VA 1FY7A 1IICA 3ZZIA 2NMTA 3FRMA 2P0WA 1VKCA 4KOTA 1Z4RA 2D4PA 2YNCA 1M1DA 2VZYA 4C2XA 2EUIA 2P6EA 2GANA 2OZUA 4QVTA 1L0CA 5EC4A 3TOBA 1GHEA 2G3TA 4M3SA 3SXNA 3A9LA 4MFQA 3TCVA 3IU1A 5A27A 3FNCA 5C88A 4B12A 1CJWA 4A32A 4QUSA 2J8NA 5H86A 4X5KA 2VXKA 4CAEA 4HNWB 3BJ7A 3S6KA 3PZJA 5IV0A 1CM0A 5EBVA 2VEZA 1MJ9A 2PR8A 5F46A 3R96A 4B14A 3C26A 5A28A 4B5PB 4L89A 2Z3MA 4B10A 4GS4A 5FVJA 4PK2A 4U5YA 4NEXA 3TO6A 2Q0YA 4JXQA 3IWGA 2Z10A 2JDDA 4CGNA 5F49A 1QSNA 4KOUA 4Q36A 3W91A 2ZXVA 2GIVA 1Y7RA 4AG9A 5F47A 3EXNA 1S3ZA 4UBRA 3RYOA 3S6FA 1V0CA 2OH1A 4UFVA 5H84A 3R95A 3GKRA 4KOXA 1S7FA 3DR8A 3TE4A 1WWZA 4XPLA 5AG4A 2P6FA 5CNPA 4AB7A 1RXTA 4CRYB 2B4DA 3R9FA 2Z11A 3W6XA 4C2YA 1MJAA 3B8GA 2B5GA 2RC4A 2DPTA 1PUAA 4YFJA 5AG7A 4KORA 2JLMA 1K4JA 3F8KA 1ZO0A 2YNEA 2WPWA 1S7NA 1YX0A 1XIXA 3H4QA 3NE7A 2YGWA 4CAWA 4A33A 3LODA 3H5ZA 1I12A 4F6AA 2B3UA 1S5KA 2FT0A 2KCWA 4OAEA 4KLVA 2FXFA 4NXYA 2BL1A 4MY0A 4XNHB 3D3SA 4LUAA 4KS9A 4MHDA 4E2AA 3D8PA 4ONUA 2REFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFJ A;  4MFP A;  4MFQ A;  4Q36 A;  4Q38 A;  4MFZ A;  4MFL A;  4MFK A; 
#chains in the Genus database with same CATH topology
 3FH4 A;  1Y9K A;  2DXQ A;  3B3W A;  3H8E A;  4OC3 A;  4NGM A;  3S9N A;  2FIA A;  5JPH A;  2REE A;  3PB9 X;  4CYO A;  4MHY A;  1KUY A;  4R8F A;  1LFW A;  2EO8 A;  3CT9 A;  4EME A;  1Z5R A;  3TFY A;  2F8H A;  2POK A;  2ZEF A;  2FSR A;  3TT2 A;  4RS2 A;  1DE4 C;  1SQH A;  4UCN A;  2VBQ A;  4MJ8 A;  3IC1 A;  4ZYQ A;  3S6H A;  2CXA A;  2C27 A;  4MHN A;  4KZT A;  1IB1 E;  4Q7A A;  4C7H A;  1XBU A;  2YNC C;  3S6G A;  2ODF A;  3BI1 A;  2Q04 A;  3K9T A;  5G1Z A;  4P45 A;  1RO5 A;  4FUU A;  4HKF A;  5C82 A;  2Q7B A;  2JEV A;  3BLN A;  4CAX A;  3T90 A;  1TKF A;  1J4J A;  3TX8 A;  5JGF A;  3P2F A;  1P4N A;  5KTD A;  2PJC A;  5HVG A;  4KSA A;  2R98 A;  4YRH A;  4XNH C;  3FF3 A;  4H89 A;  3TC8 A;  1BAV A;  5LRK A;  4U9Z A;  2ABZ A;  1KWM A;  1JQG A;  4IAV A;  2IL4 A;  1ZLI A;  4HNX B;  4KOS A;  4FD5 A;  3V8I A;  4CYN A;  4OC1 A;  1ZLH A;  4GXH A;  1IOI A;  4PPZ A;  4PXB A;  2ZED A;  1QSM A;  3WT4 A;  2ZOG A;  2IMO A;  4MHP A;  4MBU A;  1QST A;  5G21 A;  2H5M A;  2PJ5 A;  4O23 A;  4OME A;  4ZY2 A;  4KSF A;  4E0A A;  4FBE A;  4QBJ A;  2CF4 A;  3MN8 A;  3PBB A;  5IB0 A;  1TKJ A;  3QB8 A;  2FL4 A;  4AG7 A;  2V8V A;  4ZBG A;  3BHX A;  4UEF A;  5AG6 A;  1HEE A;  2ZEH A;  1Y0R A;  3IJ3 A;  4A37 A;  2Q44 A;  3H8F A;  4H6U A;  4R3K A;  3DSB A;  4UEE A;  2GRE A;  3E0K A;  1ARL A;  2AFZ A;  5JM6 A;  2WSA A;  3KQZ A;  3SXO A;  2K5T A;  4P4B A;  5DWN A;  4JJX A;  4XPK A;  4FD7 A;  4CGP A;  4TNU A;  1F57 A;  3KI9 A;  4MCR A;  4R7M A;  3NH8 A;  4E8O A;  3ISX A;  4UEZ A;  2PJ2 A;  4R87 A;  5KTA A;  6CPA A;  3CXS A;  3GUX A;  3DDD A;  4UFW A;  2HQY A;  3LAC A;  3VH9 A;  4RUH A;  3N5F A;  2FS5 A;  5HXD A;  5I4M A;  5IB9 A;  3K9U A;  1Z4E A;  2AFS A;  4X8I A;  4KVX A;  1YLE A;  4MCS A;  3FVL A;  4JWP A;  3PEI A;  3I1U A;  3G3S A;  5D29 A;  4CAV A;  5THW A;  4NF1 A;  2ARH A;  2Y0M A;  1U6M A;  2CY2 A;  1M4G A;  2WZN A;  2ZW4 A;  3DNS A;  3D7H A;  3GB0 A;  4NGQ A;  3SJF A;  4ZI6 A;  2AJ6 A;  1TXR A;  2Q51 A;  2O4H A;  1CP7 A;  2PSW A;  2PQ8 A;  4OID A;  1I1D A;  4MFP A;  4KOV A;  1CPS A;  3DGV A;  1Q2Y A;  4AVB A;  4UIA A;  1Z8X A;  4F8Z A;  3JVN A;  3NE8 A;  3OWC A;  4KVM E;  4NGP A;  2ANP A;  1XOV A;  1XJO A;  3B3S A;  7CPA A;  1MK4 A;  4FAI A;  1X10 A;  3N7Z A;  4BIN A;  2BSW A;  4AVC A;  2CNS A;  1LAP A;  4OIW A;  4PXE A;  1ZG7 A;  1YVK A;  3CDX A;  3F5B A;  4LQG A;  4FD4 A;  2BUE A;  5F09 A;  2WPX A;  4ZX8 A;  5D8N A;  1TF8 A;  4L8A A;  3WR7 A;  3R9G A;  4OC5 A;  3D2P A;  3KZW A;  3TO7 A;  4ZGY B;  2GLF A;  4EVY A;  4R3L A;  2AFW A;  2PJ8 A;  2GU2 A;  3D67 A;  3MGD A;  3R1K A;  2OB0 A;  4DYO A;  3FEE A;  4A31 A;  2ATR A;  1B6B A;  1ELL P;  3TTH A;  1B87 A;  1NSL A;  3BXM A;  1M4I A;  3SHP A;  4B5P A;  1IYK A;  2XEF A;  2O28 A;  4B5O A;  1XMB A;  5ISV A;  1Y9W A;  5K8M A;  2PVV A;  2G0B A;  4NCZ A;  4IHM A;  1OBR A;  2HUZ A;  1BO4 A;  4KVO E;  4UA3 A;  3DR6 A;  3LD2 A;  4C7I A;  3IWW A;  4CYP A;  3FB3 A;  3D2M A;  4R9M A;  1PU9 A;  4EWT A;  2WYR A;  3ISZ A;  4CS0 B;  3UY5 A;  1LCP A;  2PJ4 A;  2VZZ A;  3KKW A;  3PB4 X;  2D4O A;  3V38 A;  3JTK A;  1CX8 A;  1XRY A;  3D7D A;  4B11 A;  1IID A;  4JXR A;  2ZEN A;  1KZF A;  4XPD C;  2V8D A;  2ZPA A;  4P6Y A;  2A4N A;  1QSO A;  5LYI A;  2Z0Z A;  4IF5 A;  2B58 A;  2DPS A;  2EK8 A;  2PRB A;  3GYA A;  4IK2 A;  4P44 A;  4TWE A;  4MHZ A;  1VHO A;  2C6G A;  4OC0 A;  3IU2 A;  3BJ8 A;  1IYL A;  4PQA A;  4Z65 A;  3I3G A;  2P6G A;  1UFH A;  4IUS A;  1I21 A;  3KR5 A;  3VAT A;  2FE7 A;  2PDO A;  1H8L A;  4YU9 A;  5IX3 A;  5K8N A;  1OZP A;  4HNY B;  3ZJ0 A;  5DS0 A;  1IGB A;  2ZEM A;  4A2Z A;  3T9Y A;  1YSJ A;  2ZW7 A;  2ZEE A;  4PXC A;  1YRE A;  4Q38 A;  4A95 A;  5CBM A;  1N71 A;  2ZW5 A;  2PJ9 A;  1EE3 P;  4UWI A;  1Z2L A;  3SI0 A;  3PP9 A;  5J8C A;  3QAH A;  3P2H A;  4MY3 A;  2QEC A;  3GY9 A;  1YK3 A;  3TO9 A;  4MFL A;  4KUB A;  3FIX A;  1KUX A;  2CNM A;  2GFQ A;  2VI7 A;  1M44 A;  2RFH A;  4R57 A;  4GM5 A;  2C1C A;  4C2Z A;  3D68 A;  1RTQ A;  4UCM A;  5AG5 A;  5HVF A;  3SJX A;  4LX9 A;  4PSX A;  4H2K A;  1Q2D A;  2AFM A;  2PIY A;  3PGP A;  2Z3O A;  4I49 A;  4OP4 A;  5KTC A;  1VHS A;  2B4D B;  2DF5 A;  4DUK A;  3S9M A;  5I0C A;  1KUV A;  1CPX A;  3I9S A;  2BEI A;  3IGR A;  3T8W A;  3B7I A;  4Y49 B;  3QAY A;  2J8R A;  4OLL A;  4PK3 A;  1F2O A;  2PJ1 A;  3HUV A;  1Q2C A;  1F2P A;  1HDQ A;  2B5G B;  5LRG A;  2AE6 A;  3WC6 A;  2PJ6 A;  5BWA B;  2F7V A;  2O53 A;  1M4L A;  2DEA A;  4M6I A;  1YW4 A;  3IEH A;  4H6Z A;  3KHX A;  4AXV A;  4AVA A;  5HH1 A;  1YVO A;  2YND A;  1ARM A;  4PV6 A;  3D7F A;  2OU2 A;  2AFU A;  1IOF A;  2C6P A;  3EY5 A;  2I79 A;  3RAM A;  1AUG A;  3EFA A;  1BLL E;  3VAR A;  4ZY1 A;  4JLY A;  4C68 A;  3FYN A;  2VL1 A;  2EVN A;  3IWE A;  5JQ4 A;  2JBJ A;  4J3G A;  4F9V A;  4G1P A;  4YGO A;  2OZH A;  1CG2 A;  4A39 A;  4KOY A;  3R9E A;  4ONW A;  5HVH A;  2I3C A;  3W6S A;  1CBX A;  2AFO A;  2ZEP A;  1NMT A;  2ZEG A;  1VIX A;  3L2N A;  5GCN A;  4M6H A;  2AFX A;  1TIQ A;  3G8W A;  4P4F A;  4X2T A;  3H8G A;  1VHE A;  2Z3P A;  3FBU A;  1R57 A;  2X7B A;  4MFJ A;  5DWM A;  1XF8 A;  4FD6 A;  3B3C A;  4R76 A;  4WWV A;  4JD6 A;  4JZ0 A;  3PRT A;  4MFZ A;  4QC6 A;  2OR4 A;  2WUU A;  4Y49 C;  2JDC A;  4KOW A;  2G9D A;  3VWD A;  3MRU A;  2ZW6 A;  4NGS A;  3VWE A;  1MJB A;  3KR4 A;  4JYW A;  2VQY A;  2PIZ A;  3B3T A;  4QB9 A;  1A2Z A;  3LMS A;  4XPD B;  4RN7 A;  1ON0 A;  5K8P A;  3IFE A;  4UFX A;  1VGY A;  1P0H A;  4X3R A;  4NSQ A;  2F5I A;  3KGQ A;  4OC4 A;  2QML A;  1WK4 A;  2FIW A;  5G22 A;  2Z3L A;  3WAB A;  3EO4 A;  1GYT A;  4R6T A;  1AYE A;  1S7L A;  4OAD A;  3KHZ A;  2CTB A;  4M85 A;  4OC2 A;  4BMH A;  2Q4Y A;  4ORF A;  2PCU A;  3FXT A;  1ZG9 A;  4DJL A;  4MI4 A;  2HB6 A;  4K3N A;  4CYQ A;  2CIJ A;  4CRZ B;  3JUW A;  5JH9 A;  2I00 A;  4A30 A;  2Q4V A;  2GE3 A;  2BCO A;  4RI1 A;  4B13 A;  3D7G A;  5G20 A;  5F48 A;  4F0Y A;  3KL9 A;  5LRJ A;  2PVW A;  1JWQ A;  3CXP A;  2FCK A;  1IY7 A;  1NE9 A;  4LQ6 A;  1S7K A;  4CAF A;  2EWB A;  3SJG A;  4NJQ A;  4KLW A;  1Z8T A;  1LAM A;  1QQ9 A;  1XFO A;  3KAS A;  4BD9 A;  1BPN A;  1YQE A;  2JBK A;  2PRQ A;  2B4B A;  3WC5 A;  1Y7E A;  1BOB A;  4KUA A;  4P4I A;  2OZG A;  5E96 A;  5J1Q A;  3PFE A;  4BBH A;  4K30 A;  2R7H A;  1M4D A;  2R8V A;  5ELY A;  1Q7L A;  4MFK A;  1YR0 A;  1LRZ A;  2CTC A;  2Z3K A;  2PC1 A;  4CGM A;  1QMU A;  3DLJ A;  5LYF A;  3SI1 A;  5J8F A;  2R1I A;  3F0A A;  2Q4Z A;  1YME A;  4PSW A;  2IJZ A;  2CNT A;  3FJU A;  3S9L A;  1XE4 A;  4P4J A;  4NFR A;  4II9 A;  4UWJ A;  2J8M A;  2HV2 A;  4CGO A;  4OKO A;  3CXQ A;  1Z9U A;  2XEI A;  4U9Y A;  3V7Z A;  3CPX A;  2J9A A;  4UCP A;  3TOA A;  4CGL A;  5HMN A;  2Q7S A;  2ZOF A;  3B3V A;  5AGE A;  4DNC A;  3NH5 A;  3EC4 A;  2QIR A;  2ZEO A;  4F0X A;  1XMT A;  1QSR A;  2C6C A;  2G3A A;  2NYQ A;  4W9Y A;  1YGH A;  2EBJ A;  2Z3N A;  5LYD A;  2PR1 A;  4ZY0 A;  1XEB A;  1S60 A;  2B3V A;  1FY7 A;  1IIC A;  3ZZI A;  2NMT A;  3KQX A;  3FRM A;  2P0W A;  1VKC A;  4KOT A;  3FED A;  1Z4R A;  3RBU A;  2D4P A;  2YNC A;  1M1D A;  2VZY A;  4P10 A;  4C2X A;  2EK9 A;  2V8G A;  3BI0 A;  3HLP A;  2EUI A;  1DTD A;  2P6E A;  2GAN A;  2OZU A;  4QVT A;  1L0C A;  5EC4 A;  4MRI A;  3WC7 A;  3TOB A;  1GHE A;  2G3T A;  4M3S A;  4MMO A;  3SXN A;  3A9L A;  4MFQ A;  4MCQ A;  3TCV A;  3QNV A;  3D8P A;  3IU1 A;  3NA6 A;  3FNC A;  2OOT A;  5A27 A;  5C88 A;  3RZA A;  4M6G A;  3D4U A;  4B12 A;  1CJW A;  4A32 A;  4QUS A;  3IIB A;  1LOK A;  5K8O A;  2J8N A;  3FMC A;  5H86 A;  4X5K A;  2VXK A;  4CAE A;  4HNW B;  2XEG A;  4UF4 A;  3BJ7 A;  3PB7 X;  3S6K A;  2PE3 A;  2RB7 A;  3GLJ A;  1CM0 A;  1R43 A;  3PZJ A;  5IV0 A;  2PJ3 A;  1ELM P;  5EBV A;  2VEZ A;  1MJ9 A;  2QYV A;  1Z8W A;  2PR8 A;  5F46 A;  3R96 A;  4CPA A;  4B14 A;  2QJ8 A;  1IU8 A;  3C26 A;  5A28 A;  4YWY A;  4B5P B;  3NH4 A;  4EFD A;  4L89 A;  2Z3M A;  1PCA A;  2PJ7 A;  4B10 A;  2V8H A;  8CPA A;  4GS4 A;  5FVJ A;  3RO0 A;  4PK2 A;  4U5Y A;  4WJB A;  4NEX A;  4F9U A;  3TO6 A;  2Q0Y A;  3D66 A;  2ZEL A;  1YW6 A;  4JXQ A;  3IWG A;  3K2K A;  1FT7 A;  2Z10 A;  2JDD A;  2V77 A;  4CGN A;  5F49 A;  1QSN A;  2BOA A;  1AMP A;  4KOU A;  2NSM A;  4P4D A;  4Q36 A;  3IO1 A;  3W91 A;  2BO9 A;  4P4E A;  2ZXV A;  2JEW A;  2GIV A;  1PYT B;  1Y7R A;  1BPM A;  4AG9 A;  4HPS A;  5F47 A;  3EXN A;  1S3Z A;  4UBR A;  1CP6 A;  3RYO A;  3S6F A;  1V0C A;  2OH1 A;  1TF9 A;  4UFV A;  5H84 A;  4PXD A;  3B2Y A;  4B6Z A;  3R95 A;  2PJA A;  2XEJ A;  2HC9 A;  3CPA A;  3GKR A;  4KOX A;  1S7F A;  3PFO A;  1LAN A;  3DR8 A;  3TE4 A;  1WWZ A;  4XPL A;  3FX6 A;  5AG4 A;  2P6F A;  1R3N A;  5CNP A;  3PB6 X;  4AB7 A;  2FVG A;  1RXT A;  4CRY B;  2B4D A;  5EMI A;  3R9F A;  1Y0Y A;  2Z11 A;  3W6X A;  4KSI A;  4C2Y A;  1MJA A;  3B8G A;  2B5G A;  2RC4 A;  2DPT A;  1PUA A;  1YLO A;  4NGR A;  4YFJ A;  4NGT A;  2GLJ A;  4KOR A;  3PBE A;  2JLM A;  1K4J A;  3F8K A;  3CZX A;  5AG7 A;  1ZO0 A;  5LYL A;  2YNE A;  1TKH A;  1UWY A;  2WPW A;  1S7N A;  4UIB A;  1YX0 A;  1XIX A;  3RNZ A;  3H4Q A;  3NE7 A;  4MXU A;  2YGW A;  4CAW A;  4A33 A;  2PJB A;  5CPA A;  2QVP A;  3LOD A;  3H5Z A;  1I12 A;  3FEC A;  3LWU A;  4NJR A;  2PJ0 A;  4F6A A;  2B3U A;  1S5K A;  1X12 A;  2FT0 A;  3PB8 X;  2KCW A;  1Z8L A;  1FNO A;  4OAE A;  4KLV A;  4A94 A;  3JRU A;  3NFZ A;  1ZG8 A;  2FXF A;  4FWU A;  2BL1 A;  2Q43 A;  3GIU A;  4NXY A;  3SJE A;  4NGN A;  4MY0 A;  3SI2 A;  4XNH B;  3D3S A;  2IQ6 A;  4LUA A;  4MCP A;  4ZX9 A;  3B35 A;  1HDU A;  4KS9 A;  4MHD A;  4A38 A;  4E2A A;  1NSA A;  4ONU A;  2REF A; 
#chains in the Genus database with same CATH homology
 1Y9K A;  2DXQ A;  2FIA A;  5JPH A;  2REE A;  4CYO A;  1KUY A;  3TFY A;  2FSR A;  3TT2 A;  4RS2 A;  1SQH A;  4UCN A;  2VBQ A;  4MJ8 A;  3S6H A;  2CXA A;  2C27 A;  4KZT A;  1IB1 E;  4C7H A;  2YNC C;  3S6G A;  2Q04 A;  5G1Z A;  1RO5 A;  4HKF A;  5C82 A;  2Q7B A;  2JEV A;  3BLN A;  4CAX A;  3T90 A;  1J4J A;  3P2F A;  1P4N A;  5KTD A;  4KSA A;  2R98 A;  4YRH A;  4XNH C;  4H89 A;  4U9Z A;  2IL4 A;  4KOS A;  4HNX B;  3V8I A;  4FD5 A;  4CYN A;  1QSM A;  5G21 A;  4MBU A;  1QST A;  2H5M A;  4E0A A;  4QBJ A;  4KSF A;  5IB0 A;  3QB8 A;  2FL4 A;  4AG7 A;  4ZBG A;  5AG6 A;  2Q44 A;  4H6U A;  4R3K A;  3DSB A;  3E0K A;  2WSA A;  3SXO A;  2K5T A;  5DWN A;  4JJX A;  4XPK A;  4FD7 A;  4CGP A;  4E8O A;  4R87 A;  5KTA A;  3CXS A;  3DDD A;  4UFW A;  2HQY A;  2FS5 A;  3K9U A;  1Z4E A;  4KVX A;  1YLE A;  4JWP A;  3G3S A;  4CAV A;  4NF1 A;  2Y0M A;  2ARH A;  1U6M A;  2CY2 A;  1M4G A;  2ZW4 A;  3DNS A;  2AJ6 A;  2PSW A;  2PQ8 A;  1I1D A;  4MFP A;  4KOV A;  1Q2Y A;  4AVB A;  3JVN A;  3OWC A;  4KVM E;  1MK4 A;  3N7Z A;  2BSW A;  4AVC A;  2CNS A;  1YVK A;  3F5B A;  4FD4 A;  2BUE A;  2WPX A;  4L8A A;  3WR7 A;  3R9G A;  3D2P A;  3TO7 A;  4ZGY B;  4EVY A;  4R3L A;  3MGD A;  3R1K A;  2OB0 A;  4A31 A;  2ATR A;  1B6B A;  3TTH A;  1B87 A;  1NSL A;  4B5P A;  1M4I A;  3SHP A;  1IYK A;  4B5O A;  2O28 A;  5ISV A;  1Y9W A;  2G0B A;  4NCZ A;  4UA3 A;  2HUZ A;  1BO4 A;  4KVO E;  3DR6 A;  3LD2 A;  4C7I A;  4CYP A;  3FB3 A;  3D2M A;  4R9M A;  1PU9 A;  4CS0 B;  3UY5 A;  2VZZ A;  3KKW A;  2D4O A;  3JTK A;  4B11 A;  1IID A;  4JXR A;  1KZF A;  4XPD C;  2ZPA A;  2A4N A;  1QSO A;  2Z0Z A;  4IF5 A;  2B58 A;  2DPS A;  2PRB A;  3GYA A;  3IU2 A;  3BJ8 A;  1IYL A;  3I3G A;  2P6G A;  1UFH A;  4IUS A;  1I21 A;  2FE7 A;  2PDO A;  5IX3 A;  1OZP A;  4HNY B;  3ZJ0 A;  4A2Z A;  3T9Y A;  2ZW7 A;  1YRE A;  4Q38 A;  4A95 A;  1N71 A;  2ZW5 A;  4UWI A;  3PP9 A;  5J8C A;  3QAH A;  3P2H A;  4MY3 A;  2QEC A;  3GY9 A;  1YK3 A;  3TO9 A;  4MFL A;  4KUB A;  3FIX A;  1KUX A;  2CNM A;  2VI7 A;  1M44 A;  4R57 A;  4C2Z A;  5AG5 A;  4UCM A;  4LX9 A;  4PSX A;  1Q2D A;  4I49 A;  3PGP A;  2Z3O A;  5KTC A;  1VHS A;  2B4D B;  5I0C A;  3I9S A;  1KUV A;  3IGR A;  2BEI A;  4Y49 B;  2J8R A;  4OLL A;  4PK3 A;  1Q2C A;  2B5G B;  2AE6 A;  5BWA B;  4H6Z A;  4AVA A;  5HH1 A;  1YVO A;  2YND A;  4PV6 A;  2OU2 A;  3EY5 A;  2I79 A;  3EFA A;  4JLY A;  4C68 A;  3FYN A;  5JQ4 A;  2EVN A;  3IWE A;  4J3G A;  4YGO A;  2OZH A;  4KOY A;  3R9E A;  3W6S A;  5GCN A;  1NMT A;  1TIQ A;  3G8W A;  2Z3P A;  3FBU A;  1R57 A;  2X7B A;  4MFJ A;  5DWM A;  1XF8 A;  4FD6 A;  4JD6 A;  4MFZ A;  4Y49 C;  4QC6 A;  3VWD A;  2WUU A;  2JDC A;  4KOW A;  2ZW6 A;  3VWE A;  1MJB A;  2VQY A;  4QB9 A;  4XPD B;  1ON0 A;  4UFX A;  1P0H A;  4NSQ A;  2F5I A;  2QML A;  1WK4 A;  2FIW A;  5G22 A;  2Z3L A;  3EO4 A;  1S7L A;  4OAD A;  4M85 A;  4BMH A;  2Q4Y A;  4ORF A;  3FXT A;  4MI4 A;  4CYQ A;  4CRZ B;  3JUW A;  2I00 A;  4A30 A;  2Q4V A;  2GE3 A;  4RI1 A;  4B13 A;  4F0Y A;  5G20 A;  5F48 A;  3CXP A;  2FCK A;  1NE9 A;  1S7K A;  4CAF A;  4KLW A;  2B4B A;  1BOB A;  4KUA A;  5E96 A;  2OZG A;  4BBH A;  4K30 A;  2R7H A;  1M4D A;  2R8V A;  4MFK A;  1YR0 A;  1LRZ A;  2Z3K A;  2PC1 A;  4CGM A;  5J8F A;  2R1I A;  3F0A A;  4PSW A;  2CNT A;  1XE4 A;  4II9 A;  4UWJ A;  2J8M A;  2HV2 A;  4CGO A;  3CXQ A;  1Z9U A;  4U9Y A;  4CGL A;  4UCP A;  3TOA A;  5HMN A;  5AGE A;  4DNC A;  4F0X A;  3EC4 A;  2QIR A;  1XMT A;  1QSR A;  2G3A A;  1YGH A;  2Z3N A;  2PR1 A;  1XEB A;  1S60 A;  2B3V A;  1FY7 A;  1IIC A;  3ZZI A;  2NMT A;  3FRM A;  2P0W A;  1VKC A;  4KOT A;  1Z4R A;  2D4P A;  2YNC A;  1M1D A;  2VZY A;  4C2X A;  2EUI A;  2P6E A;  2GAN A;  2OZU A;  4QVT A;  1L0C A;  5EC4 A;  3TOB A;  1GHE A;  2G3T A;  4M3S A;  3SXN A;  3A9L A;  4MFQ A;  3TCV A;  3IU1 A;  5A27 A;  3FNC A;  5C88 A;  4B12 A;  1CJW A;  4A32 A;  4QUS A;  2J8N A;  5H86 A;  4X5K A;  2VXK A;  4CAE A;  4HNW B;  3BJ7 A;  3S6K A;  3PZJ A;  5IV0 A;  1CM0 A;  5EBV A;  2VEZ A;  1MJ9 A;  2PR8 A;  5F46 A;  3R96 A;  4B14 A;  3C26 A;  5A28 A;  4B5P B;  4L89 A;  2Z3M A;  4B10 A;  4GS4 A;  5FVJ A;  4PK2 A;  4U5Y A;  4NEX A;  3TO6 A;  2Q0Y A;  4JXQ A;  3IWG A;  2Z10 A;  2JDD A;  4CGN A;  5F49 A;  1QSN A;  4KOU A;  4Q36 A;  3W91 A;  2ZXV A;  2GIV A;  1Y7R A;  4AG9 A;  5F47 A;  3EXN A;  1S3Z A;  4UBR A;  3RYO A;  3S6F A;  1V0C A;  2OH1 A;  4UFV A;  5H84 A;  3R95 A;  3GKR A;  4KOX A;  1S7F A;  3DR8 A;  3TE4 A;  1WWZ A;  4XPL A;  5AG4 A;  2P6F A;  5CNP A;  4AB7 A;  1RXT A;  4CRY B;  2B4D A;  3R9F A;  2Z11 A;  3W6X A;  4C2Y A;  1MJA A;  3B8G A;  2B5G A;  2RC4 A;  2DPT A;  1PUA A;  4YFJ A;  5AG7 A;  4KOR A;  2JLM A;  1K4J A;  3F8K A;  1ZO0 A;  2YNE A;  2WPW A;  1S7N A;  1YX0 A;  1XIX A;  3H4Q A;  3NE7 A;  2YGW A;  4CAW A;  4A33 A;  3LOD A;  3H5Z A;  1I12 A;  4F6A A;  2B3U A;  1S5K A;  2FT0 A;  2KCW A;  4OAE A;  4KLV A;  2FXF A;  4NXY A;  2BL1 A;  4MY0 A;  4XNH B;  3D3S A;  4LUA A;  4KS9 A;  4MHD A;  4E2A A;  3D8P A;  4ONU A;  2REF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...