4Q38A

The crystal structure of acyltransferase in complex with decanoyl-coa and teicoplanin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4q38A02
4MFJA 4MFZA 4MFKA 4MFPA 4MFLA 4MFQA 4Q38A 4Q36A
chains in the Genus database with same CATH superfamily
3ZZIA 1P0HA 3N7ZA 5G20A 4A38A 1MJ9A 2I79A 4DJLA 1R3NA 4IHMA 1CM0A 4XPDB 1CJWA 5DWNA 4NGRA 1VKCA 4UEZA 3T9YA 3TX8A 4AG9A 5K8MA 4PPZA 4Y49B 1LFWA 1R43A 3D66A 3TFYA 3CXPA 1S5KA 3DR8A 4L89A 4P4DA 5D29A 5HVGA 5AG5A 2Q4ZA 4B11A 1QSOA 4X3RA 1CG2A 3H8GA 3QNVA 4PXDA 4UCPA 3V8IA 4CAXA 3WC5A 2QECA 5LYDA 3TO7A 2AFMA 2Q4VA 2F5IA 2ZELA 4R87A 4CYNA 4ZGYB 3GY9A 3OWCA 3GKRA 1IY7A 5F47A 1KWMA 4OAEA 5H84A 1TIQA 2PJ8A 3JTKA 7CPAA 5C88A 2RFHA 4LX9A 1I21A 2QJ8A 2OOTA 2PJ1A 2HB6A 1NMTA 2FE7A 4E0AA 1BLLE 3V7ZA 3H8FA 4GM5A 3BI0A 4W9YA 5ISVA 3EC4A 3FX6A 4QVTA 4E8OA 1CP7A 3CZXA 5EMIA 3F5BA 1BPMA 4UIAA 2I3CA 1BO4A 2EK9A 4NSQA 1ZG8A 2J9AA 2Z3NA 4MRIA 1TF9A 2PJ5A 3C26A 4MFLA 4MY0A 3TCVA 3D2MA 1YVOA 1QSNA 3G3SA 1HDUA 3IEHA 1FNOA 2GREA 4RN7A 2ABZA 4J3GA 2CTCA 1Y7RA 4ONUA 1KZFA 2FCKA 4NEXA 4Q7AA 4X5KA 4XNHB 5K8NA 4NCZA 2GU2A 3K2KA 4OC2A 5CBMA 2B58A 4QBJA 4K30A 2BEIA 2ODFA 2PJ7A 4KSFA 4MHNA 4R7MA 2DPTA 1AUGA 5JH9A 2FVGA 3BI1A 2Q4YA 2K5TA 3KR5A 4FD4A 3FRMA 4A32A 3KZWA 2ZW6A 2CY2A 3QAYA 4Q36A 2D4PA 3RYOA 3FBUA 5JPHA 3BJ8A 3SHPA 2EVNA 1X12A 3PBEA 2F7VA 4U9YA 4KUAA 3FJUA 4NGTA 3SI1A 3JUWA 3PB7X 1I12A 2J8RA 3IWWA 1S60A 1KUXA 3B8GA 4KVME 1YREA 3E0KA 4QC6A 2BSWA 3D3SA 3W91A 2HQYA 3D8PA 2CNSA 1WWZA 3IIBA 1RTQA 2J8MA 2JDCA 2VZZA 3CDXA 3IO1A 4KOUA 3RBUA 4A2ZA 4OP4A 5LYLA 3FXTA 3SXOA 2CIJA 1ELLP 2PDOA 4ONWA 2AFWA 5CPAA 1XE4A 2IL4A 2PIZA 2QMLA 1JWQA 2IMOA 2C27A 4B5OA 1MJAA 3NH4A 3DR6A 3DNSA 1CBXA 2AJ6A 4CAWA 1IGBA 4R57A 4TNUA 3TOAA 3B35A 3FVLA 1XRYA 2ZEDA 1VIXA 4CGMA 3D7GA 1I1DA 2PCUA 1MJBA 3HUVA 5G1ZA 3FMCA 1TXRA 4P4JA 3D4UA 3KASA 1IYKA 1LOKA 2DPSA 4YGOA 1ON0A 2ANPA 4R9MA 3FF3A 4X8IA 4KORA 3HLPA 2ATRA 3KL9A 3LD2A 5FVJA 3TC8A 3TT2A 3SI0A 4UF4A 3D7DA 3PRTA 3LWUA 3PEIA 4KOVA 2Z0ZA 4L8AA 4M85A 3D2PA 2WYRA 3D7FA 4C2ZA 4CAEA 4RUHA 4TWEA 5EBVA 4FAIA 4KVOE 2C6CA 4NGNA 5K8PA 2PQ8A 4MFQA 3PP9A 4RI1A 3S6FA 1Q2CA 4C68A 4CS0B 1ZG7A 4OKOA 2WSAA 4H6UA 2NMTA 4HKFA 4JD6A 1YLEA 3PB8X 4KOWA 4CGOA 4B6ZA 3BJ7A 2BO9A 4MJ8A 2GFQA 4AXVA 4UCNA 3B3CA 4FD7A 2FT0A 2R98A 3MRUA 3PB9X 2B5GA 1QSRA 1YW4A 4B12A 4B5PA 2VL1A 5IB9A 3UY5A 4UIBA 2OH1A 4YWYA 4H6ZA 5ELYA 1XF8A 2CNTA 3K9TA 5LYFA 4R3LA 4II9A 1VGYA 1Q2YA 2Z10A 2ZW5A 4KOXA 4MFJA 3EXNA 1Y0YA 5AG7A 4CPAA 4HPSA 4WWVA 3PFOA 1YMEA 3ISXA 4IUSA 4AVAA 4BD9A 3D67A 2AFUA 2EK8A 1IU8A 3H4QA 4NGPA 5G21A 2B4BA 2B4DA 2REEA 3BXMA 4CYQA 4CYPA 1BOBA 4PV6A 1H8LA 4AVBA 2ZEHA 4CRZB 4G1PA 1PYTB 4NJRA 4ORFA 2IQ6A 3V38A 3NA6A 3KHZA 4X2TA 5F46A 2PJ3A 4GS4A 3S9LA 1XMTA 1XJOA 2GIVA 3R95A 3KI9A 8CPAA 4CRYB 4ZX8A 2Q44A 2R8VA 1J4JA 3N5FA 3L2NA 2CNMA 1XMBA 2OB0A 2R7HA 3KKWA 1Y9WA 2Q51A 3VARA 3R1KA 5CNPA 4BBHA 2BUEA 1FY7A 2YNDA 2OU2A 1RO5A 1RXTA 4A95A 1S7KA 1SQHA 3KQZA 5BWAB 1TF8A 4ZY0A 2VQYA 2Q43A 2ZOGA 3DGVA 4KSIA 1Z4EA 5AG4A 5EC4A 4UWJA 4B13A 2C6PA 3KGQA 1Q2DA 3MGDA 2OZGA 2O28A 2P6FA 1R57A 4H89A 4MXUA 4YU9A 2HV2A 4KUBA 4P44A 2Y0MA 1Z8XA 4JJXA 3KQXA 2XEJA 4MFZA 1YX0A 1XOVA 4FD6A 4MFPA 4B10A 3SJGA 4PSXA 4KS9A 3IWGA 4ZY1A 4NXYA 1ELMP 1B6BA 1S7FA 3SJFA 3EY5A 3GB0A 4KLVA 2JBJA 2WUUA 3PBBA 3RAMA 4M6IA 3T90A 1XBUA 3CPXA 4R76A 1ZLIA 1S7LA 2Z3OA 2P6EA 4MHPA 5IB0A 4U9ZA 2VZYA 2PJBA 4MI4A 3TTHA 1YK3A 1TKHA 4C7HA 4R6TA 2FSRA 5HH1A 4UFWA 4BMHA 5KTAA 4LQ6A 1LANA 5IV0A 5D8NA 3I9SA 3TOBA 1V0CA 2FIWA 2REFA 4JWPA 4OC4A 4PXBA 4IK2A 2CTBA 1CP6A 1S7NA 2ZW4A 4UBRA 4XPDC 4NGQA 2PJ2A 3JRUA 1Y9KA 2ZOFA 5J1QA 4UEEA 4K3NA 2QVPA 2ZW7A 4NJQA 2CXAA 2YGWA 4Y49C 4YFJA 1M1DA 1ARMA 4FD5A 1EE3P 1L0CA 3JVNA 4YRHA 2POKA 2YNEA 4KLWA 4EWTA 1Y0RA 1YGHA 3BHXA 1KUYA 2X7BA 4M6GA 4LUAA 4MBUA 4XPKA 2A4NA 2C6GA 2FS5A 4KOSA 2Q7BA 2J8NA 5KTDA 1Z5RA 2B3UA 2BCOA 2KCWA 2GLJA 3BLNA 3GLJA 2H5MA 1M44A 4MMOA 1QSMA 4OADA 3TO6A 5I4MA 1Z8LA 2VI7A 4P6YA 1YVKA 1JQGA 3I1UA 4CAFA 4UEFA 5GCNA 4RS2A 4PXCA 4DNCA 4KVXA 2Z11A 3PFEA 2PVWA 1WK4A 4UWIA 2PC1A 4UFXA 3FH4A 3S9MA 4WJBA 4DUKA 1IOIA 1NE9A 2V8VA 3GYAA 3QB8A 1UFHA 3R9EA 3CT9A 5THWA 5DS0A 1IICA 4F9UA 3VATA 3VH9A 3WR7A 2BL1A 2OR4A 1LAPA 5G22A 1Q7LA 2JLMA 2OZUA 4PSWA 2Q7SA 2PJCA 4BINA 1CPXA 2JEVA 2IJZA 2G0BA 1OBRA 2ZENA 5LRKA 2NYQA 3KR4A 3NE8A 3GUXA 4MCQA 4C2XA 1Z4RA 2FL4A 1A2ZA 3IC1A 3KHXA 2G3TA 4JXQA 2FXFA 2YNCA 3PB6X 3QAHA 4F0XA 3IWEA 1PCAA 5H86A 1BPNA 2PJ6A 3NFZA 4M6HA 1GYTA 1PU9A 4ZX9A 3WABA 4XPLA 3TE4A 2ZEOA 4C2YA 1P4NA 2RB7A 4F0YA 2Z3LA 2AE6A 1BAVA 1Z8TA 3LODA 3H8EA 5JGFA 1LAMA 3EO4A 3NE7A 4O23A 3W6XA 2B5GB 3IJ3A 4P10A 1YQEA 3SJEA 3B3TA 4EFDA 2AFXA 1YW6A 2PR8A 3FYNA 3I3GA 1N71A 2O4HA 2V8DA 4B5PB 4DYOA 2P0WA 4HNWB 5HMNA 2XEFA 2VXKA 3DLJA 2EUIA 3LACA 3B7IA 2NSMA 1VHSA 4FUUA 4LQGA 5LRGA 1GHEA 1K4JA 4OIWA 2AFSA 4A31A 1QSTA 3IU2A 2P6GA 1PUAA 3SI2A 3DDDA 3FEEA 1UWYA 4KSAA 2ZEFA 4R3KA 1IYLA 2D4OA 3P2HA 3CXQA 2B4DB 3H5ZA 4OC1A 4ZI6A 4C7IA 4E2AA 4MY3A 4U5YA 2HC9A 2PSWA 1ZLHA 4FWUA 2G3AA 2WPWA 3VWEA 4F6AA 2PJ0A 2PJ9A 2WZNA 4OMEA 5DWMA 5C82A 3PZJA 2QYVA 4A30A 5HVHA 5IX3A 3VWDA 2Q04A 1CPSA 3PB4X 4A94A 2XEGA 4OIDA 3CXSA 5JQ4A 1YLOA 2PVVA 2AFZA 3ISZA 3R96A 3RNZA 1VHEA 5K8OA 2F8HA 1TKFA 3A9LA 1S3ZA 3FB3A 3IGRA 5F48A 3WC7A 3FECA 3R9GA 2ZXVA 3RO0A 4KOTA 3SJXA 4EMEA 2AFOA 2ZEPA 3F8KA 3S9NA 1LCPA 2V8GA 4EVYA 4QB9A 2XEIA 3B3SA 4JXRA 3SXNA 4MHYA 3NH8A 4MCRA 1HDQA 1ZO0A 4ZBGA 4A39A 1IIDA 2PE3A 2RC4A 2YNCC 2PR1A 4M3SA 4ZYQA 1QMUA 2FIAA 2GLFA 1X10A 2PJ4A 2Z3KA 4NFRA 3D68A 1Z2LA 1AYEA 3IFEA 4MCPA 4F9VA 2VEZA 1TKJA 3G8WA 4PXEA 5HXDA 2O53A 2ZEGA 2G9DA 3NH5A 5AG6A 2GE3A 4MCSA 1YSJA 2Z3PA 4JYWA 4OC3A 4PQAA 4P4EA 3S6HA 3ZJ0A 4FBEA 3PGPA 4GXHA 4CGNA 2PRQA 4H2KA 4I49A 2I00A 1NSLA 1HEEA 2ZEMA 5J8FA 1Y7EA 3F0AA 1DTDA 2ARHA 3D7HA 1M4GA 3EFAA 4NGMA 1NSAA 2CF4A 4CGPA 4QUSA 4MFKA 2Z3MA 2PIYA 4KOYA 2EWBA 5E96A 4R8FA 1KUVA 4PK2A 3GIUA 4Q38A 2PJAA 5F09A 1CX8A 3WC6A 1AMPA 1FT7A 4A33A 5KTCA 1ARLA 4IF5A 1ZG9A 2QIRA 2C1CA 2VBQA 5F49A 1M4DA 3W6SA 4OC0A 2HUZA 2B3VA 3P2FA 4IAVA 4ZY2A 2BOAA 3T8WA 2JDDA 2Q0YA 1M4IA 3B3VA 1LRZA 1XEBA 4CAVA 1B87A 3K9UA 3B2YA 2DEAA 3S6GA 5JM6A 5A28A 3FIXA 5I0CA 1IOFA 4JLYA 3RZAA 1XFOA 1Z8WA 4AG7A 6CPAA 4UCMA 4PK3A 2R1IA 1IB1E 4HNYB 1F57A 4HNXB 4A37A 4CYOA 4MHDA 5J8CA 5A27A 1VHOA 3B3WA 3DSBA 4OLLA 1F2PA 4XNHC 4P45A 1XIXA 4P4BA 2V8HA 2GANA 4UFVA 3FNCA 3TO9A 1DE4C 4F8ZA 3IU1A 4P4FA 3S6KA 2EBJA 4KZTA 3WT4A 4AB7A 2V77A 1OZPA 1QQ9A 1MK4A 2DF5A 2DXQA 2EO8A 2WPXA 3MN8A 1Z9UA 4NF1A 5HVFA 4Z65A 5LRJA 2OZHA 1YR0A 2PRBA 3CPAA 4MHZA 4B14A 4OC5A 5LYIA 4AVCA 4CGLA 5AGEA 2ZPAA 2ZEEA 3LMSA 3R9FA 4P4IA 1U6MA 1M4LA 2JEWA 2JBKA 1F2OA 4NGSA 4UA3A 3FEDA 4JZ0A
chains in the Genus database with same CATH topology
3ZZIA 1P0HA 3N7ZA 5G20A 1MJ9A 2I79A 1CM0A 4XPDB 1CJWA 5DWNA 1VKCA 3T9YA 4AG9A 4Y49B 3TFYA 3CXPA 1S5KA 3DR8A 4L89A 5AG5A 4B11A 1QSOA 4UCPA 3V8IA 4CAXA 2QECA 3TO7A 2Q4VA 2F5IA 4CYNA 4R87A 4ZGYB 3GY9A 3OWCA 3GKRA 5F47A 4OAEA 5H84A 1TIQA 3JTKA 5C88A 4LX9A 1I21A 1NMTA 2FE7A 4E0AA 5ISVA 3EC4A 4QVTA 4E8OA 3F5BA 1BO4A 4NSQA 2Z3NA 4MY0A 3C26A 4MFLA 3D2MA 1YVOA 1QSNA 3G3SA 4J3GA 1Y7RA 4ONUA 1KZFA 2FCKA 4NEXA 4X5KA 4XNHB 4NCZA 2B58A 4K30A 2BEIA 4KSFA 2DPTA 2Q4YA 2K5TA 4FD4A 3FRMA 4A32A 2ZW6A 2CY2A 4Q36A 2D4PA 3RYOA 3FBUA 5JPHA 3BJ8A 3SHPA 2EVNA 4U9YA 4KUAA 3JUWA 1I12A 2J8RA 1S60A 1KUXA 3B8GA 4KVME 1YREA 3E0KA 4QC6A 2BSWA 3D3SA 3W91A 2HQYA 3D8PA 2CNSA 1WWZA 4QBJA 2J8MA 2JDCA 2VZZA 4KOUA 4A2ZA 3FXTA 3SXOA 2PDOA 1XE4A 2IL4A 2QMLA 2C27A 4B5OA 1MJAA 3DR6A 3DNSA 2AJ6A 4CAWA 4R57A 3TOAA 4CGMA 1I1DA 1MJBA 5G1ZA 1IYKA 2DPSA 4YGOA 1ON0A 4R9MA 4KORA 2ATRA 3LD2A 5FVJA 3TT2A 4KOVA 2Z0ZA 4L8AA 4M85A 3D2PA 4C2ZA 4CAEA 5EBVA 4KVOE 2PQ8A 4MFQA 3PP9A 4RI1A 3S6FA 1Q2CA 4C68A 4CS0B 2WSAA 4H6UA 2NMTA 4HKFA 4JD6A 1YLEA 4KOWA 4CGOA 3BJ7A 4MJ8A 4UCNA 4FD7A 2FT0A 2R98A 2B5GA 1QSRA 4B12A 4B5PA 3UY5A 2OH1A 4II9A 4H6ZA 1XF8A 2CNTA 4R3LA 1Q2YA 2Z10A 2ZW5A 4KOXA 4MFJA 3EXNA 5AG7A 4IUSA 4AVAA 3H4QA 5G21A 2B4BA 2B4DA 2REEA 4CYQA 4CYPA 1BOBA 4PV6A 4AVBA 4CRZB 4ORFA 5F46A 4GS4A 1XMTA 2GIVA 3R95A 4CRYB 2Q44A 2R8VA 1J4JA 2CNMA 2OB0A 2R7HA 3KKWA 1Y9WA 3R1KA 5CNPA 4BBHA 2BUEA 1FY7A 2YNDA 2OU2A 1RO5A 1RXTA 4A95A 1S7KA 1SQHA 5BWAB 2VQYA 5AG4A 1Z4EA 5EC4A 4UWJA 4B13A 1Q2DA 3MGDA 2OZGA 2O28A 4H89A 1R57A 2P6FA 4CYOA 2HV2A 4KUBA 2Y0MA 4JJXA 4MFZA 1YX0A 4FD6A 4MFPA 4B10A 4PSXA 4KS9A 3IWGA 4NXYA 1B6BA 1S7FA 3EY5A 4KLVA 2WUUA 3T90A 1S7LA 2Z3OA 2P6EA 5IB0A 4U9ZA 2VZYA 4MI4A 3TTHA 1YK3A 4C7HA 2FSRA 5HH1A 4UFWA 4BMHA 5KTAA 5IV0A 3TOBA 3I9SA 1V0CA 2FIWA 2REFA 4JWPA 1S7NA 2ZW4A 4UBRA 4XPDC 1Y9KA 2ZW7A 2CXAA 2YGWA 4Y49C 4YFJA 1M1DA 4FD5A 1L0CA 4YRHA 3JVNA 2YNEA 4KLWA 1YGHA 1KUYA 2X7BA 4LUAA 4MBUA 4XPKA 2A4NA 2FS5A 4KOSA 2Q7BA 2J8NA 5KTDA 2B3UA 2KCWA 3BLNA 2H5MA 1M44A 1QSMA 4OADA 3TO6A 2VI7A 1YVKA 4CAFA 5GCNA 4RS2A 4DNCA 4KVXA 2Z11A 4UWIA 1WK4A 2PC1A 4UFXA 1NE9A 3QB8A 3GYAA 3R9EA 1UFHA 1IICA 3WR7A 2BL1A 5G22A 2JLMA 2OZUA 4PSWA 2JEVA 2G0BA 4C2XA 1Z4RA 2FL4A 4JXQA 2G3TA 2FXFA 2YNCA 3QAHA 4F0XA 3IWEA 5H86A 1PU9A 4XPLA 3TE4A 4C2YA 1P4NA 4F0YA 2Z3LA 2AE6A 3LODA 3EO4A 3NE7A 3W6XA 2B5GB 3FYNA 3I3GA 2PR8A 4B5PB 1N71A 5HMNA 2P0WA 4HNWB 2VXKA 2EUIA 1VHSA 1K4JA 1GHEA 4A31A 1QSTA 3IU2A 2P6GA 1PUAA 3DDDA 4KSAA 4R3KA 1IYLA 2D4OA 3P2HA 3CXQA 2B4DB 3H5ZA 4C7IA 4E2AA 4MY3A 4U5YA 2PSWA 2G3AA 2WPWA 3VWEA 4F6AA 5DWMA 5C82A 3PZJA 4A30A 5IX3A 3VWDA 2Q04A 3CXSA 5JQ4A 3R96A 3A9LA 1S3ZA 3FB3A 3IGRA 5F48A 3R9GA 2ZXVA 4KOTA 3F8KA 4EVYA 4QB9A 4JXRA 3SXNA 1ZO0A 4ZBGA 1IIDA 2RC4A 2YNCC 2PR1A 4M3SA 2FIAA 2Z3KA 2VEZA 3G8WA 5AG6A 2GE3A 2Z3PA 3S6HA 3ZJ0A 3PGPA 4CGNA 4I49A 2I00A 1NSLA 5J8FA 3F0AA 2ARHA 1M4GA 3EFAA 4CGPA 4QUSA 4MFKA 2Z3MA 4KOYA 5E96A 1KUVA 4PK2A 4Q38A 4A33A 5KTCA 4IF5A 2QIRA 2VBQA 5F49A 1M4DA 3W6SA 2HUZA 2B3VA 3P2FA 2JDDA 2Q0YA 1M4IA 1XEBA 1LRZA 4CAVA 1B87A 3K9UA 3S6GA 5A28A 3FIXA 5I0CA 4JLYA 4AG7A 4UCMA 4PK3A 2R1IA 1IB1E 4HNYB 4HNXB 4MHDA 5J8CA 5A27A 3DSBA 4OLLA 4XNHC 1XIXA 2GANA 4UFVA 3FNCA 3TO9A 3IU1A 3S6KA 4KZTA 4AB7A 1OZPA 2WPXA 1MK4A 2DXQA 4NF1A 1Z9UA 2OZHA 1YR0A 2PRBA 4B14A 4AVCA 4CGLA 5AGEA 2ZPAA 3R9FA 1U6MA 3TCVA 4UA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFJ A;  4MFZ A;  4MFK A;  4MFP A;  4MFL A;  4MFQ A;  4Q38 A;  4Q36 A; 
#chains in the Genus database with same CATH topology
 3ZZI A;  1P0H A;  3N7Z A;  5G20 A;  4A38 A;  1MJ9 A;  2I79 A;  4DJL A;  1R3N A;  4IHM A;  1CM0 A;  4XPD B;  1CJW A;  5DWN A;  4NGR A;  1VKC A;  4UEZ A;  3T9Y A;  3TX8 A;  4AG9 A;  5K8M A;  4PPZ A;  4Y49 B;  1LFW A;  1R43 A;  3D66 A;  3TFY A;  3CXP A;  1S5K A;  3DR8 A;  4L89 A;  4P4D A;  5D29 A;  5HVG A;  5AG5 A;  2Q4Z A;  4B11 A;  1QSO A;  4X3R A;  1CG2 A;  3H8G A;  3QNV A;  4PXD A;  4UCP A;  3V8I A;  4CAX A;  3WC5 A;  2QEC A;  5LYD A;  3TO7 A;  2AFM A;  2Q4V A;  2F5I A;  2ZEL A;  4R87 A;  4CYN A;  4ZGY B;  3GY9 A;  3OWC A;  3GKR A;  1IY7 A;  5F47 A;  1KWM A;  4OAE A;  5H84 A;  1TIQ A;  2PJ8 A;  3JTK A;  7CPA A;  5C88 A;  2RFH A;  4LX9 A;  1I21 A;  2QJ8 A;  2OOT A;  2PJ1 A;  2HB6 A;  1NMT A;  2FE7 A;  4E0A A;  1BLL E;  3V7Z A;  3H8F A;  4GM5 A;  3BI0 A;  4W9Y A;  5ISV A;  3EC4 A;  3FX6 A;  4QVT A;  4E8O A;  1CP7 A;  3CZX A;  5EMI A;  3F5B A;  1BPM A;  4UIA A;  2I3C A;  1BO4 A;  2EK9 A;  4NSQ A;  1ZG8 A;  2J9A A;  2Z3N A;  4MRI A;  1TF9 A;  2PJ5 A;  3C26 A;  4MFL A;  4MY0 A;  3TCV A;  3D2M A;  1YVO A;  1QSN A;  3G3S A;  1HDU A;  3IEH A;  1FNO A;  2GRE A;  4RN7 A;  2ABZ A;  4J3G A;  2CTC A;  1Y7R A;  4ONU A;  1KZF A;  2FCK A;  4NEX A;  4Q7A A;  4X5K A;  4XNH B;  5K8N A;  4NCZ A;  2GU2 A;  3K2K A;  4OC2 A;  5CBM A;  2B58 A;  4QBJ A;  4K30 A;  2BEI A;  2ODF A;  2PJ7 A;  4KSF A;  4MHN A;  4R7M A;  2DPT A;  1AUG A;  5JH9 A;  2FVG A;  3BI1 A;  2Q4Y A;  2K5T A;  3KR5 A;  4FD4 A;  3FRM A;  4A32 A;  3KZW A;  2ZW6 A;  2CY2 A;  3QAY A;  4Q36 A;  2D4P A;  3RYO A;  3FBU A;  5JPH A;  3BJ8 A;  3SHP A;  2EVN A;  1X12 A;  3PBE A;  2F7V A;  4U9Y A;  4KUA A;  3FJU A;  4NGT A;  3SI1 A;  3JUW A;  3PB7 X;  1I12 A;  2J8R A;  3IWW A;  1S60 A;  1KUX A;  3B8G A;  4KVM E;  1YRE A;  3E0K A;  4QC6 A;  2BSW A;  3D3S A;  3W91 A;  2HQY A;  3D8P A;  2CNS A;  1WWZ A;  3IIB A;  1RTQ A;  2J8M A;  2JDC A;  2VZZ A;  3CDX A;  3IO1 A;  4KOU A;  3RBU A;  4A2Z A;  4OP4 A;  5LYL A;  3FXT A;  3SXO A;  2CIJ A;  1ELL P;  2PDO A;  4ONW A;  2AFW A;  5CPA A;  1XE4 A;  2IL4 A;  2PIZ A;  2QML A;  1JWQ A;  2IMO A;  2C27 A;  4B5O A;  1MJA A;  3NH4 A;  3DR6 A;  3DNS A;  1CBX A;  2AJ6 A;  4CAW A;  1IGB A;  4R57 A;  4TNU A;  3TOA A;  3B35 A;  3FVL A;  1XRY A;  2ZED A;  1VIX A;  4CGM A;  3D7G A;  1I1D A;  2PCU A;  1MJB A;  3HUV A;  5G1Z A;  3FMC A;  1TXR A;  4P4J A;  3D4U A;  3KAS A;  1IYK A;  1LOK A;  2DPS A;  4YGO A;  1ON0 A;  2ANP A;  4R9M A;  3FF3 A;  4X8I A;  4KOR A;  3HLP A;  2ATR A;  3KL9 A;  3LD2 A;  5FVJ A;  3TC8 A;  3TT2 A;  3SI0 A;  4UF4 A;  3D7D A;  3PRT A;  3LWU A;  3PEI A;  4KOV A;  2Z0Z A;  4L8A A;  4M85 A;  3D2P A;  2WYR A;  3D7F A;  4C2Z A;  4CAE A;  4RUH A;  4TWE A;  5EBV A;  4FAI A;  4KVO E;  2C6C A;  4NGN A;  5K8P A;  2PQ8 A;  4MFQ A;  3PP9 A;  4RI1 A;  3S6F A;  1Q2C A;  4C68 A;  4CS0 B;  1ZG7 A;  4OKO A;  2WSA A;  4H6U A;  2NMT A;  4HKF A;  4JD6 A;  1YLE A;  3PB8 X;  4KOW A;  4CGO A;  4B6Z A;  3BJ7 A;  2BO9 A;  4MJ8 A;  2GFQ A;  4AXV A;  4UCN A;  3B3C A;  4FD7 A;  2FT0 A;  2R98 A;  3MRU A;  3PB9 X;  2B5G A;  1QSR A;  1YW4 A;  4B12 A;  4B5P A;  2VL1 A;  5IB9 A;  3UY5 A;  4UIB A;  2OH1 A;  4YWY A;  4H6Z A;  5ELY A;  1XF8 A;  2CNT A;  3K9T A;  5LYF A;  4R3L A;  4II9 A;  1VGY A;  1Q2Y A;  2Z10 A;  2ZW5 A;  4KOX A;  4MFJ A;  3EXN A;  1Y0Y A;  5AG7 A;  4CPA A;  4HPS A;  4WWV A;  3PFO A;  1YME A;  3ISX A;  4IUS A;  4AVA A;  4BD9 A;  3D67 A;  2AFU A;  2EK8 A;  1IU8 A;  3H4Q A;  4NGP A;  5G21 A;  2B4B A;  2B4D A;  2REE A;  3BXM A;  4CYQ A;  4CYP A;  1BOB A;  4PV6 A;  1H8L A;  4AVB A;  2ZEH A;  4CRZ B;  4G1P A;  1PYT B;  4NJR A;  4ORF A;  2IQ6 A;  3V38 A;  3NA6 A;  3KHZ A;  4X2T A;  5F46 A;  2PJ3 A;  4GS4 A;  3S9L A;  1XMT A;  1XJO A;  2GIV A;  3R95 A;  3KI9 A;  8CPA A;  4CRY B;  4ZX8 A;  2Q44 A;  2R8V A;  1J4J A;  3N5F A;  3L2N A;  2CNM A;  1XMB A;  2OB0 A;  2R7H A;  3KKW A;  1Y9W A;  2Q51 A;  3VAR A;  3R1K A;  5CNP A;  4BBH A;  2BUE A;  1FY7 A;  2YND A;  2OU2 A;  1RO5 A;  1RXT A;  4A95 A;  1S7K A;  1SQH A;  3KQZ A;  5BWA B;  1TF8 A;  4ZY0 A;  2VQY A;  2Q43 A;  2ZOG A;  3DGV A;  4KSI A;  1Z4E A;  5AG4 A;  5EC4 A;  4UWJ A;  4B13 A;  2C6P A;  3KGQ A;  1Q2D A;  3MGD A;  2OZG A;  2O28 A;  2P6F A;  1R57 A;  4H89 A;  4MXU A;  4YU9 A;  2HV2 A;  4KUB A;  4P44 A;  2Y0M A;  1Z8X A;  4JJX A;  3KQX A;  2XEJ A;  4MFZ A;  1YX0 A;  1XOV A;  4FD6 A;  4MFP A;  4B10 A;  3SJG A;  4PSX A;  4KS9 A;  3IWG A;  4ZY1 A;  4NXY A;  1ELM P;  1B6B A;  1S7F A;  3SJF A;  3EY5 A;  3GB0 A;  4KLV A;  2JBJ A;  2WUU A;  3PBB A;  3RAM A;  4M6I A;  3T90 A;  1XBU A;  3CPX A;  4R76 A;  1ZLI A;  1S7L A;  2Z3O A;  2P6E A;  4MHP A;  5IB0 A;  4U9Z A;  2VZY A;  2PJB A;  4MI4 A;  3TTH A;  1YK3 A;  1TKH A;  4C7H A;  4R6T A;  2FSR A;  5HH1 A;  4UFW A;  4BMH A;  5KTA A;  4LQ6 A;  1LAN A;  5IV0 A;  5D8N A;  3I9S A;  3TOB A;  1V0C A;  2FIW A;  2REF A;  4JWP A;  4OC4 A;  4PXB A;  4IK2 A;  2CTB A;  1CP6 A;  1S7N A;  2ZW4 A;  4UBR A;  4XPD C;  4NGQ A;  2PJ2 A;  3JRU A;  1Y9K A;  2ZOF A;  5J1Q A;  4UEE A;  4K3N A;  2QVP A;  2ZW7 A;  4NJQ A;  2CXA A;  2YGW A;  4Y49 C;  4YFJ A;  1M1D A;  1ARM A;  4FD5 A;  1EE3 P;  1L0C A;  3JVN A;  4YRH A;  2POK A;  2YNE A;  4KLW A;  4EWT A;  1Y0R A;  1YGH A;  3BHX A;  1KUY A;  2X7B A;  4M6G A;  4LUA A;  4MBU A;  4XPK A;  2A4N A;  2C6G A;  2FS5 A;  4KOS A;  2Q7B A;  2J8N A;  5KTD A;  1Z5R A;  2B3U A;  2BCO A;  2KCW A;  2GLJ A;  3BLN A;  3GLJ A;  2H5M A;  1M44 A;  4MMO A;  1QSM A;  4OAD A;  3TO6 A;  5I4M A;  1Z8L A;  2VI7 A;  4P6Y A;  1YVK A;  1JQG A;  3I1U A;  4CAF A;  4UEF A;  5GCN A;  4RS2 A;  4PXC A;  4DNC A;  4KVX A;  2Z11 A;  3PFE A;  2PVW A;  1WK4 A;  4UWI A;  2PC1 A;  4UFX A;  3FH4 A;  3S9M A;  4WJB A;  4DUK A;  1IOI A;  1NE9 A;  2V8V A;  3GYA A;  3QB8 A;  1UFH A;  3R9E A;  3CT9 A;  5THW A;  5DS0 A;  1IIC A;  4F9U A;  3VAT A;  3VH9 A;  3WR7 A;  2BL1 A;  2OR4 A;  1LAP A;  5G22 A;  1Q7L A;  2JLM A;  2OZU A;  4PSW A;  2Q7S A;  2PJC A;  4BIN A;  1CPX A;  2JEV A;  2IJZ A;  2G0B A;  1OBR A;  2ZEN A;  5LRK A;  2NYQ A;  3KR4 A;  3NE8 A;  3GUX A;  4MCQ A;  4C2X A;  1Z4R A;  2FL4 A;  1A2Z A;  3IC1 A;  3KHX A;  2G3T A;  4JXQ A;  2FXF A;  2YNC A;  3PB6 X;  3QAH A;  4F0X A;  3IWE A;  1PCA A;  5H86 A;  1BPN A;  2PJ6 A;  3NFZ A;  4M6H A;  1GYT A;  1PU9 A;  4ZX9 A;  3WAB A;  4XPL A;  3TE4 A;  2ZEO A;  4C2Y A;  1P4N A;  2RB7 A;  4F0Y A;  2Z3L A;  2AE6 A;  1BAV A;  1Z8T A;  3LOD A;  3H8E A;  5JGF A;  1LAM A;  3EO4 A;  3NE7 A;  4O23 A;  3W6X A;  2B5G B;  3IJ3 A;  4P10 A;  1YQE A;  3SJE A;  3B3T A;  4EFD A;  2AFX A;  1YW6 A;  2PR8 A;  3FYN A;  3I3G A;  1N71 A;  2O4H A;  2V8D A;  4B5P B;  4DYO A;  2P0W A;  4HNW B;  5HMN A;  2XEF A;  2VXK A;  3DLJ A;  2EUI A;  3LAC A;  3B7I A;  2NSM A;  1VHS A;  4FUU A;  4LQG A;  5LRG A;  1GHE A;  1K4J A;  4OIW A;  2AFS A;  4A31 A;  1QST A;  3IU2 A;  2P6G A;  1PUA A;  3SI2 A;  3DDD A;  3FEE A;  1UWY A;  4KSA A;  2ZEF A;  4R3K A;  1IYL A;  2D4O A;  3P2H A;  3CXQ A;  2B4D B;  3H5Z A;  4OC1 A;  4ZI6 A;  4C7I A;  4E2A A;  4MY3 A;  4U5Y A;  2HC9 A;  2PSW A;  1ZLH A;  4FWU A;  2G3A A;  2WPW A;  3VWE A;  4F6A A;  2PJ0 A;  2PJ9 A;  2WZN A;  4OME A;  5DWM A;  5C82 A;  3PZJ A;  2QYV A;  4A30 A;  5HVH A;  5IX3 A;  3VWD A;  2Q04 A;  1CPS A;  3PB4 X;  4A94 A;  2XEG A;  4OID A;  3CXS A;  5JQ4 A;  1YLO A;  2PVV A;  2AFZ A;  3ISZ A;  3R96 A;  3RNZ A;  1VHE A;  5K8O A;  2F8H A;  1TKF A;  3A9L A;  1S3Z A;  3FB3 A;  3IGR A;  5F48 A;  3WC7 A;  3FEC A;  3R9G A;  2ZXV A;  3RO0 A;  4KOT A;  3SJX A;  4EME A;  2AFO A;  2ZEP A;  3F8K A;  3S9N A;  1LCP A;  2V8G A;  4EVY A;  4QB9 A;  2XEI A;  3B3S A;  4JXR A;  3SXN A;  4MHY A;  3NH8 A;  4MCR A;  1HDQ A;  1ZO0 A;  4ZBG A;  4A39 A;  1IID A;  2PE3 A;  2RC4 A;  2YNC C;  2PR1 A;  4M3S A;  4ZYQ A;  1QMU A;  2FIA A;  2GLF A;  1X10 A;  2PJ4 A;  2Z3K A;  4NFR A;  3D68 A;  1Z2L A;  1AYE A;  3IFE A;  4MCP A;  4F9V A;  2VEZ A;  1TKJ A;  3G8W A;  4PXE A;  5HXD A;  2O53 A;  2ZEG A;  2G9D A;  3NH5 A;  5AG6 A;  2GE3 A;  4MCS A;  1YSJ A;  2Z3P A;  4JYW A;  4OC3 A;  4PQA A;  4P4E A;  3S6H A;  3ZJ0 A;  4FBE A;  3PGP A;  4GXH A;  4CGN A;  2PRQ A;  4H2K A;  4I49 A;  2I00 A;  1NSL A;  1HEE A;  2ZEM A;  5J8F A;  1Y7E A;  3F0A A;  1DTD A;  2ARH A;  3D7H A;  1M4G A;  3EFA A;  4NGM A;  1NSA A;  2CF4 A;  4CGP A;  4QUS A;  4MFK A;  2Z3M A;  2PIY A;  4KOY A;  2EWB A;  5E96 A;  4R8F A;  1KUV A;  4PK2 A;  3GIU A;  4Q38 A;  2PJA A;  5F09 A;  1CX8 A;  3WC6 A;  1AMP A;  1FT7 A;  4A33 A;  5KTC A;  1ARL A;  4IF5 A;  1ZG9 A;  2QIR A;  2C1C A;  2VBQ A;  5F49 A;  1M4D A;  3W6S A;  4OC0 A;  2HUZ A;  2B3V A;  3P2F A;  4IAV A;  4ZY2 A;  2BOA A;  3T8W A;  2JDD A;  2Q0Y A;  1M4I A;  3B3V A;  1LRZ A;  1XEB A;  4CAV A;  1B87 A;  3K9U A;  3B2Y A;  2DEA A;  3S6G A;  5JM6 A;  5A28 A;  3FIX A;  5I0C A;  1IOF A;  4JLY A;  3RZA A;  1XFO A;  1Z8W A;  4AG7 A;  6CPA A;  4UCM A;  4PK3 A;  2R1I A;  1IB1 E;  4HNY B;  1F57 A;  4HNX B;  4A37 A;  4CYO A;  4MHD A;  5J8C A;  5A27 A;  1VHO A;  3B3W A;  3DSB A;  4OLL A;  1F2P A;  4XNH C;  4P45 A;  1XIX A;  4P4B A;  2V8H A;  2GAN A;  4UFV A;  3FNC A;  3TO9 A;  1DE4 C;  4F8Z A;  3IU1 A;  4P4F A;  3S6K A;  2EBJ A;  4KZT A;  3WT4 A;  4AB7 A;  2V77 A;  1OZP A;  1QQ9 A;  1MK4 A;  2DF5 A;  2DXQ A;  2EO8 A;  2WPX A;  3MN8 A;  1Z9U A;  4NF1 A;  5HVF A;  4Z65 A;  5LRJ A;  2OZH A;  1YR0 A;  2PRB A;  3CPA A;  4MHZ A;  4B14 A;  4OC5 A;  5LYI A;  4AVC A;  4CGL A;  5AGE A;  2ZPA A;  2ZEE A;  3LMS A;  3R9F A;  4P4I A;  1U6M A;  1M4L A;  2JEW A;  2JBK A;  1F2O A;  4NGS A;  4UA3 A;  3FED A;  4JZ0 A; 
#chains in the Genus database with same CATH homology
 3ZZI A;  1P0H A;  3N7Z A;  5G20 A;  1MJ9 A;  2I79 A;  1CM0 A;  4XPD B;  1CJW A;  5DWN A;  1VKC A;  3T9Y A;  4AG9 A;  4Y49 B;  3TFY A;  3CXP A;  1S5K A;  3DR8 A;  4L89 A;  5AG5 A;  4B11 A;  1QSO A;  4UCP A;  3V8I A;  4CAX A;  2QEC A;  3TO7 A;  2Q4V A;  2F5I A;  4CYN A;  4R87 A;  4ZGY B;  3GY9 A;  3OWC A;  3GKR A;  5F47 A;  4OAE A;  5H84 A;  1TIQ A;  3JTK A;  5C88 A;  4LX9 A;  1I21 A;  1NMT A;  2FE7 A;  4E0A A;  5ISV A;  3EC4 A;  4QVT A;  4E8O A;  3F5B A;  1BO4 A;  4NSQ A;  2Z3N A;  4MY0 A;  3C26 A;  4MFL A;  3D2M A;  1YVO A;  1QSN A;  3G3S A;  4J3G A;  1Y7R A;  4ONU A;  1KZF A;  2FCK A;  4NEX A;  4X5K A;  4XNH B;  4NCZ A;  2B58 A;  4K30 A;  2BEI A;  4KSF A;  2DPT A;  2Q4Y A;  2K5T A;  4FD4 A;  3FRM A;  4A32 A;  2ZW6 A;  2CY2 A;  4Q36 A;  2D4P A;  3RYO A;  3FBU A;  5JPH A;  3BJ8 A;  3SHP A;  2EVN A;  4U9Y A;  4KUA A;  3JUW A;  1I12 A;  2J8R A;  1S60 A;  1KUX A;  3B8G A;  4KVM E;  1YRE A;  3E0K A;  4QC6 A;  2BSW A;  3D3S A;  3W91 A;  2HQY A;  3D8P A;  2CNS A;  1WWZ A;  4QBJ A;  2J8M A;  2JDC A;  2VZZ A;  4KOU A;  4A2Z A;  3FXT A;  3SXO A;  2PDO A;  1XE4 A;  2IL4 A;  2QML A;  2C27 A;  4B5O A;  1MJA A;  3DR6 A;  3DNS A;  2AJ6 A;  4CAW A;  4R57 A;  3TOA A;  4CGM A;  1I1D A;  1MJB A;  5G1Z A;  1IYK A;  2DPS A;  4YGO A;  1ON0 A;  4R9M A;  4KOR A;  2ATR A;  3LD2 A;  5FVJ A;  3TT2 A;  4KOV A;  2Z0Z A;  4L8A A;  4M85 A;  3D2P A;  4C2Z A;  4CAE A;  5EBV A;  4KVO E;  2PQ8 A;  4MFQ A;  3PP9 A;  4RI1 A;  3S6F A;  1Q2C A;  4C68 A;  4CS0 B;  2WSA A;  4H6U A;  2NMT A;  4HKF A;  4JD6 A;  1YLE A;  4KOW A;  4CGO A;  3BJ7 A;  4MJ8 A;  4UCN A;  4FD7 A;  2FT0 A;  2R98 A;  2B5G A;  1QSR A;  4B12 A;  4B5P A;  3UY5 A;  2OH1 A;  4II9 A;  4H6Z A;  1XF8 A;  2CNT A;  4R3L A;  1Q2Y A;  2Z10 A;  2ZW5 A;  4KOX A;  4MFJ A;  3EXN A;  5AG7 A;  4IUS A;  4AVA A;  3H4Q A;  5G21 A;  2B4B A;  2B4D A;  2REE A;  4CYQ A;  4CYP A;  1BOB A;  4PV6 A;  4AVB A;  4CRZ B;  4ORF A;  5F46 A;  4GS4 A;  1XMT A;  2GIV A;  3R95 A;  4CRY B;  2Q44 A;  2R8V A;  1J4J A;  2CNM A;  2OB0 A;  2R7H A;  3KKW A;  1Y9W A;  3R1K A;  5CNP A;  4BBH A;  2BUE A;  1FY7 A;  2YND A;  2OU2 A;  1RO5 A;  1RXT A;  4A95 A;  1S7K A;  1SQH A;  5BWA B;  2VQY A;  5AG4 A;  1Z4E A;  5EC4 A;  4UWJ A;  4B13 A;  1Q2D A;  3MGD A;  2OZG A;  2O28 A;  4H89 A;  1R57 A;  2P6F A;  4CYO A;  2HV2 A;  4KUB A;  2Y0M A;  4JJX A;  4MFZ A;  1YX0 A;  4FD6 A;  4MFP A;  4B10 A;  4PSX A;  4KS9 A;  3IWG A;  4NXY A;  1B6B A;  1S7F A;  3EY5 A;  4KLV A;  2WUU A;  3T90 A;  1S7L A;  2Z3O A;  2P6E A;  5IB0 A;  4U9Z A;  2VZY A;  4MI4 A;  3TTH A;  1YK3 A;  4C7H A;  2FSR A;  5HH1 A;  4UFW A;  4BMH A;  5KTA A;  5IV0 A;  3TOB A;  3I9S A;  1V0C A;  2FIW A;  2REF A;  4JWP A;  1S7N A;  2ZW4 A;  4UBR A;  4XPD C;  1Y9K A;  2ZW7 A;  2CXA A;  2YGW A;  4Y49 C;  4YFJ A;  1M1D A;  4FD5 A;  1L0C A;  4YRH A;  3JVN A;  2YNE A;  4KLW A;  1YGH A;  1KUY A;  2X7B A;  4LUA A;  4MBU A;  4XPK A;  2A4N A;  2FS5 A;  4KOS A;  2Q7B A;  2J8N A;  5KTD A;  2B3U A;  2KCW A;  3BLN A;  2H5M A;  1M44 A;  1QSM A;  4OAD A;  3TO6 A;  2VI7 A;  1YVK A;  4CAF A;  5GCN A;  4RS2 A;  4DNC A;  4KVX A;  2Z11 A;  4UWI A;  1WK4 A;  2PC1 A;  4UFX A;  1NE9 A;  3QB8 A;  3GYA A;  3R9E A;  1UFH A;  1IIC A;  3WR7 A;  2BL1 A;  5G22 A;  2JLM A;  2OZU A;  4PSW A;  2JEV A;  2G0B A;  4C2X A;  1Z4R A;  2FL4 A;  4JXQ A;  2G3T A;  2FXF A;  2YNC A;  3QAH A;  4F0X A;  3IWE A;  5H86 A;  1PU9 A;  4XPL A;  3TE4 A;  4C2Y A;  1P4N A;  4F0Y A;  2Z3L A;  2AE6 A;  3LOD A;  3EO4 A;  3NE7 A;  3W6X A;  2B5G B;  3FYN A;  3I3G A;  2PR8 A;  4B5P B;  1N71 A;  5HMN A;  2P0W A;  4HNW B;  2VXK A;  2EUI A;  1VHS A;  1K4J A;  1GHE A;  4A31 A;  1QST A;  3IU2 A;  2P6G A;  1PUA A;  3DDD A;  4KSA A;  4R3K A;  1IYL A;  2D4O A;  3P2H A;  3CXQ A;  2B4D B;  3H5Z A;  4C7I A;  4E2A A;  4MY3 A;  4U5Y A;  2PSW A;  2G3A A;  2WPW A;  3VWE A;  4F6A A;  5DWM A;  5C82 A;  3PZJ A;  4A30 A;  5IX3 A;  3VWD A;  2Q04 A;  3CXS A;  5JQ4 A;  3R96 A;  3A9L A;  1S3Z A;  3FB3 A;  3IGR A;  5F48 A;  3R9G A;  2ZXV A;  4KOT A;  3F8K A;  4EVY A;  4QB9 A;  4JXR A;  3SXN A;  1ZO0 A;  4ZBG A;  1IID A;  2RC4 A;  2YNC C;  2PR1 A;  4M3S A;  2FIA A;  2Z3K A;  2VEZ A;  3G8W A;  5AG6 A;  2GE3 A;  2Z3P A;  3S6H A;  3ZJ0 A;  3PGP A;  4CGN A;  4I49 A;  2I00 A;  1NSL A;  5J8F A;  3F0A A;  2ARH A;  1M4G A;  3EFA A;  4CGP A;  4QUS A;  4MFK A;  2Z3M A;  4KOY A;  5E96 A;  1KUV A;  4PK2 A;  4Q38 A;  4A33 A;  5KTC A;  4IF5 A;  2QIR A;  2VBQ A;  5F49 A;  1M4D A;  3W6S A;  2HUZ A;  2B3V A;  3P2F A;  2JDD A;  2Q0Y A;  1M4I A;  1XEB A;  1LRZ A;  4CAV A;  1B87 A;  3K9U A;  3S6G A;  5A28 A;  3FIX A;  5I0C A;  4JLY A;  4AG7 A;  4UCM A;  4PK3 A;  2R1I A;  1IB1 E;  4HNY B;  4HNX B;  4MHD A;  5J8C A;  5A27 A;  3DSB A;  4OLL A;  4XNH C;  1XIX A;  2GAN A;  4UFV A;  3FNC A;  3TO9 A;  3IU1 A;  3S6K A;  4KZT A;  4AB7 A;  1OZP A;  2WPX A;  1MK4 A;  2DXQ A;  4NF1 A;  1Z9U A;  2OZH A;  1YR0 A;  2PRB A;  4B14 A;  4AVC A;  4CGL A;  5AGE A;  2ZPA A;  3R9F A;  1U6M A;  3TCV A;  4UA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...