4Q38A

The crystal structure of acyltransferase in complex with decanoyl-coa and teicoplanin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
b'MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLHVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4q38A02
4MFJA 4MFZA 4Q38A 4Q36A 4MFKA 4MFQA 4MFPA 4MFLA
chains in the Genus database with same CATH superfamily
2FE7A 4BD9A 1MJAA 1R57A 3PB6X 4EVYA 1OZPA 1M4GA 3IWWA 5JM6A 2PJ6A 4KSAA 3VWDA 1TF8A 2B4BA 4QUSA 3LMSA 1ON0A 1S7KA 2Z0ZA 3FEDA 5F48A 4KSIA 3SJXA 2EBJA 3HUVA 1XBUA 4UFVA 1M4DA 1M4IA 2OZHA 3NE7A 3S9NA 3RBUA 4KZTA 4JXRA 2BEIA 5EMIA 3SI1A 4M85A 5H86A 1OBRA 1GYTA 3D68A 2EK8A 3NA6A 3VARA 3KKWA 5LRJA 2PJBA 4B13A 5HVGA 5JH9A 3K9TA 4U9ZA 3JVNA 4B12A 5KTAA 4PV6A 3DDDA 1PUAA 1Y0RA 1TKFA 1AUGA 4K3NA 2P6EA 4CPAA 1EE3P 1VHEA 4MHYA 4E8OA 3CZXA 4F0YA 4R3KA 3H8GA 1PYTB 3D7DA 3NFZA 3N5FA 3WC7A 4CYOA 1NMTA 4PQAA 2B3VA 5ELYA 4P6YA 4J3GA 4X2TA 4NGPA 4FBEA 2J8RA 3K9UA 4JWPA 4UIBA 4P44A 1CX8A 4H2KA 1N71A 3BI1A 4AG7A 2FL4A 4R7MA 2DPSA 4CAFA 4A33A 3D7FA 1FY7A 4ZX8A 2RFHA 3V38A 1Y7RA 2FIAA 4KLWA 3JUWA 3IU1A 2VL1A 4UWJA 1XRYA 1CBXA 2ZW7A 4CGLA 1NE9A 5BWAB 2OOTA 5IX3A 2B4DB 4OLLA 2OZUA 3D7HA 1FT7A 2PQ8A 1UWYA 3QAYA 2Q0YA 2WZNA 4MXUA 2EO8A 2FSRA 1AMPA 4GM5A 2CNTA 2Z10A 1X12A 3ISXA 3T90A 1ELMP 2WYRA 1K4JA 2Q7BA 2PJ9A 1QQ9A 3QAHA 1IYKA 4G1PA 2GIVA 2PJ8A 3MRUA 2BUEA 3I1UA 1XEBA 5K8NA 4KOSA 1JQGA 1YSJA 3BJ8A 2C27A 4UEEA 1J4JA 2CTBA 2JLMA 3PB8X 4CYQA 3PBBA 5J8CA 3GIUA 5THWA 2QMLA 3B3VA 3H8EA 5F49A 3R95A 2C1CA 2B5GA 4CAWA 2FXFA 2REFA 5F47A 2XEIA 3DLJA 4KVME 3KI9A 4CYPA 1U6MA 2HB6A 4I49A 1Y0YA 3D66A 3TX8A 1YR0A 2O53A 3PB9X 4KSFA 4HKFA 4MHPA 2WUUA 4M3SA 1RXTA 1LRZA 3KR4A 2IMOA 2Y0MA 4UF4A 4LQ6A 4RUHA 3S6KA 4Y49B 1XJOA 4WWVA 4CGOA 3IJ3A 3FF3A 3KHZA 3PZJA 4MFZA 1LOKA 4CGMA 2AFSA 5D29A 1NSLA 3W6SA 2Z3MA 4PK2A 5G22A 2AFZA 3FB3A 2ANPA 3D7GA 1Y9KA 4X8IA 3DR8A 3H5ZA 2V8GA 3H8FA 2PJ2A 1JWQA 3BJ7A 4Z65A 4ZX9A 3T8WA 3EY5A 3GUXA 4A39A 4XPDB 5LYLA 3WABA 4NEXA 4YFJA 2BL1A 3S9LA 4MFPA 2R7HA 4OC5A 4NJRA 4P4IA 3V8IA 2ZW6A 3B3WA 2C6CA 3FBUA 4O23A 1LFWA 3BI0A 3IU2A 2JBKA 1CPXA 1WK4A 2OZGA 1MJ9A 4RS2A 4KOYA 4X5KA 3R9FA 3S9MA 4OAEA 3FYNA 4CRZB 4AVAA 4CGPA 1UFHA 2ATRA 3CDXA 4ZYQA 3DR6A 4YU9A 1HEEA 3GY9A 2QYVA 1RTQA 3FEEA 2JEVA 4AB7A 3B3SA 3IWGA 4MY3A 2GE3A 1TKJA 3GYAA 3I9SA 1XMBA 1S3ZA 1GHEA 4P4DA 2DEAA 2PR8A 2AFXA 1YVOA 2I79A 1YK3A 4MJ8A 5JQ4A 2BCOA 2XEJA 4H6UA 2B4DA 1XF8A 2PJ0A 1F2PA 2CNSA 5LYIA 1Z2LA 4MY0A 1IIDA 2A4NA 1CM0A 4M6IA 5HXDA 4R3LA 3I3GA 4XNHB 4NSQA 4AVBA 1A2ZA 4RI1A 4P45A 1IICA 2PSWA 1IOFA 4YRHA 3SJFA 4F0XA 2QECA 3TE4A 4BINA 5A27A 2ZEOA 4F6AA 2R98A 3JTKA 3D3SA 1DTDA 4KUBA 4ZY1A 2Q51A 2XEGA 4OIWA 2V77A 4UFWA 2VZZA 3BXMA 2JBJA 4P10A 3ZZIA 3DSBA 1QSOA 2G0BA 2CF4A 2J8NA 4MI4A 2NMTA 1F57A 3GB0A 3PFOA 4A30A 1HDQA 1L0CA 1XE4A 5CBMA 2G9DA 5JGFA 3P2HA 2ZOFA 3B3TA 3WC5A 2V8VA 1S7NA 2QJ8A 5G20A 1QSMA 4UWIA 2FCKA 4B5PB 3IFEA 3RYOA 2K5TA 3TCVA 3BLNA 1VHOA 3H4QA 3LWUA 5EBVA 4BMHA 3TT2A 4KS9A 2F7VA 1B87A 3QB8A 5HH1A 2X7BA 3KGQA 4AG9A 2Q4YA 1YW4A 2YNCA 1DE4C 5AG7A 3KASA 4JLYA 1CG2A 2BO9A 2VEZA 1BPMA 4R87A 4A37A 4M6HA 2PJ4A 1ZG7A 4OKOA 1Q2CA 4KOTA 1TXRA 2CTCA 3FXTA 2GU2A 2PC1A 4YWYA 3SI2A 1ZLIA 1IYLA 4FD7A 3R1KA 4F8ZA 2BSWA 3PBEA 3CT9A 2BOAA 4AVCA 2Q44A 4HNXB 4K30A 2P0WA 4H89A 4B6ZA 2F5IA 1VIXA 4C2YA 1I21A 4AXVA 4MHDA 4KOUA 3JRUA 1YX0A 4WJBA 1M1DA 3B3CA 3CXQA 2JDDA 2QIRA 2Q7SA 2I3CA 4NGNA 5I0CA 2PJ1A 2PJ3A 3S6GA 4B14A 2H5MA 2J9AA 1KZFA 2WPWA 4OMEA 4XPLA 5DWMA 5J8FA 2VBQA 2D4OA 3GKRA 1ZO0A 5IV0A 3EC4A 4PXCA 4P4BA 3P2FA 4NFRA 5LYFA 3KR5A 4A94A 1MJBA 2GLFA 2EWBA 5J1QA 2PR1A 2ZEDA 4OC4A 5CNPA 2FT0A 3B35A 3S6HA 2AFOA 3D2PA 4P4EA 4R76A 5D8NA 2YNCC 2PRBA 2GREA 1KUXA 4UA3A 4OC2A 2ZPAA 4Y49C 1YREA 2IJZA 4HPSA 4QC6A 3PRTA 4ZY0A 4UCPA 1Z8TA 1YLOA 2AJ6A 3IC1A 4QB9A 3SJEA 3TO9A 1BOBA 2AFMA 3B2YA 3F0AA 5HMNA 2O28A 3TO7A 3DGVA 4FD5A 4UIAA 4ZI6A 2D4PA 4W9YA 3WC6A 3FJUA 1B6BA 4EMEA 5FVJA 2ZOGA 1YQEA 3K2KA 2CY2A 1RO5A 1XMTA 4NGMA 1CP6A 1TIQA 4XPDC 5HVFA 5LYDA 4NXYA 1PU9A 4A38A 2DXQA 2WPXA 4UBRA 2C6PA 4PSWA 1IY7A 1Y7EA 2B58A 2CIJA 4ORFA 4R8FA 1QSRA 4UCNA 5JPHA 1FNOA 2Q4VA 3SXOA 1YVKA 2FS5A 3ISZA 3TFYA 4NCZA 2EVNA 1CJWA 2PCUA 3CXSA 3FNCA 2ZELA 1KUVA 4MCSA 3SHPA 5AGEA 3F8KA 4NGTA 4EFDA 1Z9UA 4KOWA 4MHNA 4II9A 4JD6A 2ZW5A 2R1IA 3LODA 2VQYA 3KQZA 2CNMA 4FUUA 1BLLE 4MFLA 4B5PA 1CP7A 5AG6A 3DNSA 4NGRA 4TNUA 1Q7LA 4Q38A 1F2OA 3PGPA 4NGQA 3MN8A 1S5KA 4PXEA 5DWNA 4NGSA 1Q2DA 2RC4A 5HVHA 2VI7A 3R96A 3MGDA 4U9YA 4M6GA 2G3AA 4KORA 4RN7A 3NE8A 3PP9A 4XNHC 3VATA 3FRMA 4UFXA 2NYQA 4IK2A 4CAVA 5ISVA 1LAPA 5F09A 1I12A 3SJGA 4FAIA 2PVVA 4B10A 3G8WA 4KOXA 3EFAA 2ABZA 2DPTA 1NSAA 2Z3PA 4KOVA 4BBHA 3KL9A 4H6ZA 1XOVA 4JXQA 4MFQA 3CPXA 4PXBA 3T9YA 5C82A 4IF5A 1CPSA 4KVOE 4YGOA 1YW6A 4PXDA 2GFQA 3VWEA 4A2ZA 1SQHA 5LRKA 1VKCA 4ZBGA 4C7IA 4IHMA 4IUSA 3TOAA 5F46A 3IEHA 1Q2YA 1AYEA 2F8HA 1LAMA 1BO4A 3RAMA 3TC8A 4DUKA 4L89A 2PIYA 2R8VA 4OIDA 5IB0A 5LRGA 3RNZA 3A9LA 4MCRA 2PE3A 1VHSA 4ONUA 3NH4A 4C2ZA 2ODFA 2POKA 2GANA 3FIXA 3RO0A 4NJQA 1QMUA 1ZLHA 2ZW4A 1IGBA 4ZY2A 1H8LA 3QNVA 1Z8LA 4MBUA 3S6FA 5K8PA 1I1DA 4CAEA 5G21A 2V8DA 3L2NA 2FIWA 2HQYA 4UEZA 2ARHA 3LD2A 2B3UA 5K8OA 2Z11A 3FX6A 4JJXA 4OC0A 4CS0B 1KUYA 3NH5A 1YMEA 1QSTA 2OU2A 1BAVA 1S7LA 2PDOA 2Z3LA 2ZEHA 3PFEA 3WT4A 1Z8WA 2P6GA 4XPKA 3IO1A 5AG4A 3PEIA 2XEFA 3KHXA 3TOBA 2P6FA 2PIZA 4R9MA 3TO6A 1MK4A 4UCMA 7CPAA 1S7FA 4L8AA 4KLVA 4KUAA 2ZEGA 4NF1A 3VH9A 4A95A 2JDCA 4E2AA 2YNEA 4A32A 4MFKA 3SI0A 1BPNA 3V7ZA 5E96A 1Z5RA 3CPAA 8CPAA 1P0HA 3W6XA 3PB7X 4FWUA 3D4UA 2ZEEA 3FVLA 4FD4A 2HUZA 4PSXA 4TWEA 5G1ZA 1IU8A 4CAXA 4E0AA 4PPZA 3IIBA 4R6TA 4MMOA 1S60A 3D8PA 4Q7AA 3TTHA 2JEWA 5IB9A 4P4JA 1ARMA 2YGWA 1XFOA 3F5BA 3R9GA 5CPAA 2AE6A 2PJ5A 1ZG8A 4GXHA 5KTCA 3PB4X 4CGNA 1V0CA 2PJAA 1Z8XA 4MCQA 5EC4A 2FVGA 2Z3NA 1Z4EA 3D2MA 1IOIA 4C2XA 1WWZA 3CXPA 4OADA 4OP4A 3W91A 2ZEPA 4KVXA 4HNWB 3ZJ0A 1M4LA 2IL4A 1ZG9A 3UY5A 4UEFA 2OB0A 2Q43A 4FD6A 3WR7A 4C7HA 5H84A 4LUAA 4GS4A 4DJLA 3R9EA 2VZYA 3D67A 4ZGYB 2CXAA 2AFWA 2C6GA 1XIXA 2Q4ZA 6CPAA 1Z4RA 4Q36A 3C26A 2Z3KA 4ONWA 4EWTA 2HV2A 3NH8A 3RZAA 5K8MA 4CYNA 1ELLP 2G3TA 2OH1A 2WSAA 4DYOA 1VGYA 2V8HA 1R3NA 4LX9A 2PVWA 1PCAA 4X3RA 4LQGA 4CRYB 2Q04A 2I00A 1P4NA 2J8MA 2ZEMA 3EXNA 3G3SA 3OWCA 5AG5A 5DS0A 4B11A 3N7ZA 4F9VA 5KTDA 4MCPA 2NSMA 2ZXVA 4DNCA 1HDUA 4C68A 4QBJA 2HC9A 4MFJA 2OR4A 2AFUA 3BHXA 4F9UA 1QSNA 2EUIA 4JZ0A 3SXNA 4A31A 5A28A 3B7IA 4R57A 2QVPA 1IB1E 2IQ6A 1YLEA 2KCWA 2RB7A 4QVTA 2VXKA 4OC1A 1Y9WA 1KWMA 3FECA 4HNYB 3HLPA 1YGHA 3KQXA 4IAVA 2ZENA 1LANA 4U5YA 3FMCA 2Z3OA 1M44A 5I4MA 3EO4A 4B5OA 2EK9A 3B8GA 2GLJA 2PRQA 2ZEFA 4JYWA 2DF5A 4P4FA 4OC3A 4MRIA 1X10A 2B5GB 2PJ7A 4PK3A 1TKHA 3LACA 3E0KA 2YNDA 1LCPA 3KZWA 3IWEA 1ARLA 2PJCA 3GLJA 3IGRA 5GCNA 2O4HA 5C88A 2REEA 1TF9A 1R43A 4MHZA 3FH4A
chains in the Genus database with same CATH topology
2FE7A 1MJAA 1R57A 4EVYA 1OZPA 1M4GA 4KSAA 3VWDA 2B4BA 4QUSA 1ON0A 1S7KA 2Z0ZA 5F48A 4BMHA 4UFVA 1M4DA 1M4IA 2OZHA 3NE7A 4KZTA 4JXRA 2BEIA 4M85A 5H86A 3KKWA 4B13A 4U9ZA 4B12A 3JVNA 5KTAA 4PV6A 3DDDA 1PUAA 2P6EA 4E8OA 4F0YA 4R3KA 4CYOA 1NMTA 2B3VA 4J3GA 2J8RA 3K9UA 4JWPA 1N71A 4AG7A 2FL4A 2DPSA 4CAFA 4A33A 1FY7A 1Y7RA 2FIAA 4KLWA 3JUWA 3IU1A 4UWJA 2ZW7A 4CGLA 5BWAB 1NE9A 5IX3A 2B4DB 4OLLA 2OZUA 2PQ8A 2Q0YA 2FSRA 2CNTA 2Z10A 3T90A 1K4JA 2Q7BA 3QAHA 1IYKA 2GIVA 2BUEA 1XEBA 4KOSA 3BJ8A 2C27A 1J4JA 2JLMA 4CYQA 5J8CA 2QMLA 3R95A 5F49A 2B5GA 4CAWA 2FXFA 2REFA 5F47A 4KVME 4CYPA 1U6MA 4I49A 1YR0A 4KSFA 4HKFA 2WUUA 4M3SA 1RXTA 1LRZA 2Y0MA 3S6KA 4Y49B 4CGOA 3PZJA 4MFZA 4CGMA 1NSLA 3W6SA 2Z3MA 4PK2A 5G22A 3FB3A 1Y9KA 3DR8A 3H5ZA 3BJ7A 3EY5A 4XPDB 4NEXA 4YFJA 2BL1A 4MFPA 2R7HA 3V8IA 2ZW6A 3FBUA 3IU2A 1WK4A 2OZGA 1MJ9A 4RS2A 4KOYA 4X5KA 3R9FA 4OAEA 3FYNA 4CRZB 4AVAA 4CGPA 1UFHA 2ATRA 3DR6A 3GY9A 2JEVA 4AB7A 3IWGA 4MY3A 2GE3A 3GYAA 3I9SA 1S3ZA 1GHEA 2PR8A 1YVOA 2I79A 1YK3A 4MJ8A 5JQ4A 4H6UA 2B4DA 1XF8A 2CNSA 4MY0A 1IIDA 2A4NA 1CM0A 4R3LA 3I3GA 4XNHB 4NSQA 4AVBA 4RI1A 1IICA 2PSWA 4YRHA 4F0XA 2QECA 3TE4A 5A27A 4F6AA 2R98A 3JTKA 3D3SA 4KUBA 4UFWA 2VZZA 3ZZIA 3DSBA 1QSOA 2G0BA 2J8NA 4MI4A 2NMTA 4A30A 1XE4A 1L0CA 3P2HA 1S7NA 5G20A 1QSMA 4UWIA 2FCKA 4B5PB 3RYOA 2K5TA 3TCVA 3BLNA 3H4QA 5EBVA 3TT2A 4KS9A 1B87A 3QB8A 5HH1A 2X7BA 4AG9A 2Q4YA 2YNCA 5AG7A 4JLYA 4R87A 2VEZA 1Q2CA 4KOTA 3FXTA 2PC1A 1IYLA 4FD7A 3R1KA 2BSWA 4AVCA 2Q44A 4HNXB 4K30A 2P0WA 4H89A 2F5IA 4C2YA 1I21A 4MHDA 4KOUA 1YX0A 1M1DA 3CXQA 2JDDA 2QIRA 5I0CA 3S6GA 4B14A 2H5MA 1KZFA 2WPWA 4XPLA 5DWMA 5J8FA 2VBQA 2D4OA 3GKRA 1ZO0A 5IV0A 3EC4A 3P2FA 1MJBA 2PR1A 5CNPA 2FT0A 3S6HA 3D2PA 2YNCC 2PRBA 1KUXA 4UA3A 2ZPAA 4Y49C 1YREA 4QC6A 4UCPA 4QB9A 2AJ6A 3TO9A 1BOBA 3F0AA 5HMNA 2O28A 3TO7A 4FD5A 2D4PA 1B6BA 5FVJA 2CY2A 1RO5A 1XMTA 1TIQA 4XPDC 4NXYA 1PU9A 2DXQA 2WPXA 4UBRA 4PSWA 5JPHA 2B58A 4ORFA 4UCNA 1QSRA 2Q4VA 3SXOA 3TFYA 1YVKA 2FS5A 4NCZA 2EVNA 1CJWA 3CXSA 3FNCA 1KUVA 3SHPA 5AGEA 3F8KA 1Z9UA 4KOWA 4II9A 4JD6A 2ZW5A 2R1IA 3LODA 2VQYA 2CNMA 4B5PA 4MFLA 5AG6A 3DNSA 4Q38A 3PGPA 5DWNA 1S5KA 1Q2DA 2RC4A 2VI7A 3R96A 3MGDA 4U9YA 2G3AA 4KORA 3PP9A 4XNHC 3FRMA 4UFXA 4CAVA 5ISVA 1I12A 4B10A 3G8WA 4KOXA 3EFAA 2DPTA 2Z3PA 4KOVA 4BBHA 4H6ZA 4JXQA 4MFQA 3T9YA 5C82A 4IF5A 4KVOE 4YGOA 3VWEA 4A2ZA 1SQHA 1VKCA 4ZBGA 4C7IA 4IUSA 3TOAA 5F46A 1Q2YA 1BO4A 4L89A 2R8VA 5IB0A 3A9LA 1VHSA 4ONUA 4C2ZA 2GANA 3FIXA 2ZW4A 4MBUA 3S6FA 1I1DA 4CAEA 5G21A 2FIWA 2HQYA 2ARHA 3LD2A 2B3UA 2Z11A 4JJXA 4CS0B 1KUYA 1QSTA 2OU2A 1S7LA 2PDOA 2Z3LA 2P6GA 4XPKA 5AG4A 3TOBA 2P6FA 4R9MA 3TO6A 1MK4A 4UCMA 1S7FA 4L8AA 4KLVA 4KUAA 4NF1A 4A95A 2JDCA 4E2AA 2YNEA 4A32A 4MFKA 5E96A 1P0HA 3W6XA 4FD4A 5G1ZA 2HUZA 4PSXA 4CAXA 4E0AA 1S60A 3D8PA 3TTHA 2YGWA 3F5BA 3R9GA 2AE6A 5KTCA 4CGNA 1V0CA 5EC4A 2Z3NA 1Z4EA 3D2MA 4C2XA 1WWZA 3CXPA 4OADA 3W91A 4KVXA 4HNWB 3ZJ0A 2IL4A 3UY5A 2OB0A 4FD6A 3WR7A 4C7HA 5H84A 4LUAA 4GS4A 3R9EA 2VZYA 4ZGYB 2CXAA 1XIXA 1Z4RA 4Q36A 3C26A 2Z3KA 2HV2A 4CYNA 2G3TA 2OH1A 2WSAA 4LX9A 4CRYB 2Q04A 2I00A 1P4NA 2J8MA 3EXNA 3G3SA 3OWCA 5AG5A 4B11A 5KTDA 3N7ZA 2ZXVA 4DNCA 4C68A 4QBJA 4MFJA 1QSNA 2EUIA 3SXNA 4A31A 5A28A 4R57A 1IB1E 1YLEA 2KCWA 4QVTA 2VXKA 1Y9WA 4HNYB 1YGHA 4U5YA 2Z3OA 1M44A 3EO4A 4B5OA 3B8GA 2B5GB 4PK3A 3E0KA 2YNDA 3IWEA 3IGRA 5GCNA 5C88A 2REEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFJ A;  4MFZ A;  4Q38 A;  4Q36 A;  4MFK A;  4MFQ A;  4MFP A;  4MFL A; 
#chains in the Genus database with same CATH topology
 2FE7 A;  4BD9 A;  1MJA A;  1R57 A;  3PB6 X;  4EVY A;  1OZP A;  1M4G A;  3IWW A;  5JM6 A;  2PJ6 A;  4KSA A;  3VWD A;  1TF8 A;  2B4B A;  4QUS A;  3LMS A;  1ON0 A;  1S7K A;  2Z0Z A;  3FED A;  5F48 A;  4KSI A;  3SJX A;  2EBJ A;  3HUV A;  1XBU A;  4UFV A;  1M4D A;  1M4I A;  2OZH A;  3NE7 A;  3S9N A;  3RBU A;  4KZT A;  4JXR A;  2BEI A;  5EMI A;  3SI1 A;  4M85 A;  5H86 A;  1OBR A;  1GYT A;  3D68 A;  2EK8 A;  3NA6 A;  3VAR A;  3KKW A;  5LRJ A;  2PJB A;  4B13 A;  5HVG A;  5JH9 A;  3K9T A;  4U9Z A;  3JVN A;  4B12 A;  5KTA A;  4PV6 A;  3DDD A;  1PUA A;  1Y0R A;  1TKF A;  1AUG A;  4K3N A;  2P6E A;  4CPA A;  1EE3 P;  1VHE A;  4MHY A;  4E8O A;  3CZX A;  4F0Y A;  4R3K A;  3H8G A;  1PYT B;  3D7D A;  3NFZ A;  3N5F A;  3WC7 A;  4CYO A;  1NMT A;  4PQA A;  2B3V A;  5ELY A;  4P6Y A;  4J3G A;  4X2T A;  4NGP A;  4FBE A;  2J8R A;  3K9U A;  4JWP A;  4UIB A;  4P44 A;  1CX8 A;  4H2K A;  1N71 A;  3BI1 A;  4AG7 A;  2FL4 A;  4R7M A;  2DPS A;  4CAF A;  4A33 A;  3D7F A;  1FY7 A;  4ZX8 A;  2RFH A;  3V38 A;  1Y7R A;  2FIA A;  4KLW A;  3JUW A;  3IU1 A;  2VL1 A;  4UWJ A;  1XRY A;  1CBX A;  2ZW7 A;  4CGL A;  1NE9 A;  5BWA B;  2OOT A;  5IX3 A;  2B4D B;  4OLL A;  2OZU A;  3D7H A;  1FT7 A;  2PQ8 A;  1UWY A;  3QAY A;  2Q0Y A;  2WZN A;  4MXU A;  2EO8 A;  2FSR A;  1AMP A;  4GM5 A;  2CNT A;  2Z10 A;  1X12 A;  3ISX A;  3T90 A;  1ELM P;  2WYR A;  1K4J A;  2Q7B A;  2PJ9 A;  1QQ9 A;  3QAH A;  1IYK A;  4G1P A;  2GIV A;  2PJ8 A;  3MRU A;  2BUE A;  3I1U A;  1XEB A;  5K8N A;  4KOS A;  1JQG A;  1YSJ A;  3BJ8 A;  2C27 A;  4UEE A;  1J4J A;  2CTB A;  2JLM A;  3PB8 X;  4CYQ A;  3PBB A;  5J8C A;  3GIU A;  5THW A;  2QML A;  3B3V A;  3H8E A;  5F49 A;  3R95 A;  2C1C A;  2B5G A;  4CAW A;  2FXF A;  2REF A;  5F47 A;  2XEI A;  3DLJ A;  4KVM E;  3KI9 A;  4CYP A;  1U6M A;  2HB6 A;  4I49 A;  1Y0Y A;  3D66 A;  3TX8 A;  1YR0 A;  2O53 A;  3PB9 X;  4KSF A;  4HKF A;  4MHP A;  2WUU A;  4M3S A;  1RXT A;  1LRZ A;  3KR4 A;  2IMO A;  2Y0M A;  4UF4 A;  4LQ6 A;  4RUH A;  3S6K A;  4Y49 B;  1XJO A;  4WWV A;  4CGO A;  3IJ3 A;  3FF3 A;  3KHZ A;  3PZJ A;  4MFZ A;  1LOK A;  4CGM A;  2AFS A;  5D29 A;  1NSL A;  3W6S A;  2Z3M A;  4PK2 A;  5G22 A;  2AFZ A;  3FB3 A;  2ANP A;  3D7G A;  1Y9K A;  4X8I A;  3DR8 A;  3H5Z A;  2V8G A;  3H8F A;  2PJ2 A;  1JWQ A;  3BJ7 A;  4Z65 A;  4ZX9 A;  3T8W A;  3EY5 A;  3GUX A;  4A39 A;  4XPD B;  5LYL A;  3WAB A;  4NEX A;  4YFJ A;  2BL1 A;  3S9L A;  4MFP A;  2R7H A;  4OC5 A;  4NJR A;  4P4I A;  3V8I A;  2ZW6 A;  3B3W A;  2C6C A;  3FBU A;  4O23 A;  1LFW A;  3BI0 A;  3IU2 A;  2JBK A;  1CPX A;  1WK4 A;  2OZG A;  1MJ9 A;  4RS2 A;  4KOY A;  4X5K A;  3R9F A;  3S9M A;  4OAE A;  3FYN A;  4CRZ B;  4AVA A;  4CGP A;  1UFH A;  2ATR A;  3CDX A;  4ZYQ A;  3DR6 A;  4YU9 A;  1HEE A;  3GY9 A;  2QYV A;  1RTQ A;  3FEE A;  2JEV A;  4AB7 A;  3B3S A;  3IWG A;  4MY3 A;  2GE3 A;  1TKJ A;  3GYA A;  3I9S A;  1XMB A;  1S3Z A;  1GHE A;  4P4D A;  2DEA A;  2PR8 A;  2AFX A;  1YVO A;  2I79 A;  1YK3 A;  4MJ8 A;  5JQ4 A;  2BCO A;  2XEJ A;  4H6U A;  2B4D A;  1XF8 A;  2PJ0 A;  1F2P A;  2CNS A;  5LYI A;  1Z2L A;  4MY0 A;  1IID A;  2A4N A;  1CM0 A;  4M6I A;  5HXD A;  4R3L A;  3I3G A;  4XNH B;  4NSQ A;  4AVB A;  1A2Z A;  4RI1 A;  4P45 A;  1IIC A;  2PSW A;  1IOF A;  4YRH A;  3SJF A;  4F0X A;  2QEC A;  3TE4 A;  4BIN A;  5A27 A;  2ZEO A;  4F6A A;  2R98 A;  3JTK A;  3D3S A;  1DTD A;  4KUB A;  4ZY1 A;  2Q51 A;  2XEG A;  4OIW A;  2V77 A;  4UFW A;  2VZZ A;  3BXM A;  2JBJ A;  4P10 A;  3ZZI A;  3DSB A;  1QSO A;  2G0B A;  2CF4 A;  2J8N A;  4MI4 A;  2NMT A;  1F57 A;  3GB0 A;  3PFO A;  4A30 A;  1HDQ A;  1L0C A;  1XE4 A;  5CBM A;  2G9D A;  5JGF A;  3P2H A;  2ZOF A;  3B3T A;  3WC5 A;  2V8V A;  1S7N A;  2QJ8 A;  5G20 A;  1QSM A;  4UWI A;  2FCK A;  4B5P B;  3IFE A;  3RYO A;  2K5T A;  3TCV A;  3BLN A;  1VHO A;  3H4Q A;  3LWU A;  5EBV A;  4BMH A;  3TT2 A;  4KS9 A;  2F7V A;  1B87 A;  3QB8 A;  5HH1 A;  2X7B A;  3KGQ A;  4AG9 A;  2Q4Y A;  1YW4 A;  2YNC A;  1DE4 C;  5AG7 A;  3KAS A;  4JLY A;  1CG2 A;  2BO9 A;  2VEZ A;  1BPM A;  4R87 A;  4A37 A;  4M6H A;  2PJ4 A;  1ZG7 A;  4OKO A;  1Q2C A;  4KOT A;  1TXR A;  2CTC A;  3FXT A;  2GU2 A;  2PC1 A;  4YWY A;  3SI2 A;  1ZLI A;  1IYL A;  4FD7 A;  3R1K A;  4F8Z A;  2BSW A;  3PBE A;  3CT9 A;  2BOA A;  4AVC A;  2Q44 A;  4HNX B;  4K30 A;  2P0W A;  4H89 A;  4B6Z A;  2F5I A;  1VIX A;  4C2Y A;  1I21 A;  4AXV A;  4MHD A;  4KOU A;  3JRU A;  1YX0 A;  4WJB A;  1M1D A;  3B3C A;  3CXQ A;  2JDD A;  2QIR A;  2Q7S A;  2I3C A;  4NGN A;  5I0C A;  2PJ1 A;  2PJ3 A;  3S6G A;  4B14 A;  2H5M A;  2J9A A;  1KZF A;  2WPW A;  4OME A;  4XPL A;  5DWM A;  5J8F A;  2VBQ A;  2D4O A;  3GKR A;  1ZO0 A;  5IV0 A;  3EC4 A;  4PXC A;  4P4B A;  3P2F A;  4NFR A;  5LYF A;  3KR5 A;  4A94 A;  1MJB A;  2GLF A;  2EWB A;  5J1Q A;  2PR1 A;  2ZED A;  4OC4 A;  5CNP A;  2FT0 A;  3B35 A;  3S6H A;  2AFO A;  3D2P A;  4P4E A;  4R76 A;  5D8N A;  2YNC C;  2PRB A;  2GRE A;  1KUX A;  4UA3 A;  4OC2 A;  2ZPA A;  4Y49 C;  1YRE A;  2IJZ A;  4HPS A;  4QC6 A;  3PRT A;  4ZY0 A;  4UCP A;  1Z8T A;  1YLO A;  2AJ6 A;  3IC1 A;  4QB9 A;  3SJE A;  3TO9 A;  1BOB A;  2AFM A;  3B2Y A;  3F0A A;  5HMN A;  2O28 A;  3TO7 A;  3DGV A;  4FD5 A;  4UIA A;  4ZI6 A;  2D4P A;  4W9Y A;  3WC6 A;  3FJU A;  1B6B A;  4EME A;  5FVJ A;  2ZOG A;  1YQE A;  3K2K A;  2CY2 A;  1RO5 A;  1XMT A;  4NGM A;  1CP6 A;  1TIQ A;  4XPD C;  5HVF A;  5LYD A;  4NXY A;  1PU9 A;  4A38 A;  2DXQ A;  2WPX A;  4UBR A;  2C6P A;  4PSW A;  1IY7 A;  1Y7E A;  2B58 A;  2CIJ A;  4ORF A;  4R8F A;  1QSR A;  4UCN A;  5JPH A;  1FNO A;  2Q4V A;  3SXO A;  1YVK A;  2FS5 A;  3ISZ A;  3TFY A;  4NCZ A;  2EVN A;  1CJW A;  2PCU A;  3CXS A;  3FNC A;  2ZEL A;  1KUV A;  4MCS A;  3SHP A;  5AGE A;  3F8K A;  4NGT A;  4EFD A;  1Z9U A;  4KOW A;  4MHN A;  4II9 A;  4JD6 A;  2ZW5 A;  2R1I A;  3LOD A;  2VQY A;  3KQZ A;  2CNM A;  4FUU A;  1BLL E;  4MFL A;  4B5P A;  1CP7 A;  5AG6 A;  3DNS A;  4NGR A;  4TNU A;  1Q7L A;  4Q38 A;  1F2O A;  3PGP A;  4NGQ A;  3MN8 A;  1S5K A;  4PXE A;  5DWN A;  4NGS A;  1Q2D A;  2RC4 A;  5HVH A;  2VI7 A;  3R96 A;  3MGD A;  4U9Y A;  4M6G A;  2G3A A;  4KOR A;  4RN7 A;  3NE8 A;  3PP9 A;  4XNH C;  3VAT A;  3FRM A;  4UFX A;  2NYQ A;  4IK2 A;  4CAV A;  5ISV A;  1LAP A;  5F09 A;  1I12 A;  3SJG A;  4FAI A;  2PVV A;  4B10 A;  3G8W A;  4KOX A;  3EFA A;  2ABZ A;  2DPT A;  1NSA A;  2Z3P A;  4KOV A;  4BBH A;  3KL9 A;  4H6Z A;  1XOV A;  4JXQ A;  4MFQ A;  3CPX A;  4PXB A;  3T9Y A;  5C82 A;  4IF5 A;  1CPS A;  4KVO E;  4YGO A;  1YW6 A;  4PXD A;  2GFQ A;  3VWE A;  4A2Z A;  1SQH A;  5LRK A;  1VKC A;  4ZBG A;  4C7I A;  4IHM A;  4IUS A;  3TOA A;  5F46 A;  3IEH A;  1Q2Y A;  1AYE A;  2F8H A;  1LAM A;  1BO4 A;  3RAM A;  3TC8 A;  4DUK A;  4L89 A;  2PIY A;  2R8V A;  4OID A;  5IB0 A;  5LRG A;  3RNZ A;  3A9L A;  4MCR A;  2PE3 A;  1VHS A;  4ONU A;  3NH4 A;  4C2Z A;  2ODF A;  2POK A;  2GAN A;  3FIX A;  3RO0 A;  4NJQ A;  1QMU A;  1ZLH A;  2ZW4 A;  1IGB A;  4ZY2 A;  1H8L A;  3QNV A;  1Z8L A;  4MBU A;  3S6F A;  5K8P A;  1I1D A;  4CAE A;  5G21 A;  2V8D A;  3L2N A;  2FIW A;  2HQY A;  4UEZ A;  2ARH A;  3LD2 A;  2B3U A;  5K8O A;  2Z11 A;  3FX6 A;  4JJX A;  4OC0 A;  4CS0 B;  1KUY A;  3NH5 A;  1YME A;  1QST A;  2OU2 A;  1BAV A;  1S7L A;  2PDO A;  2Z3L A;  2ZEH A;  3PFE A;  3WT4 A;  1Z8W A;  2P6G A;  4XPK A;  3IO1 A;  5AG4 A;  3PEI A;  2XEF A;  3KHX A;  3TOB A;  2P6F A;  2PIZ A;  4R9M A;  3TO6 A;  1MK4 A;  4UCM A;  7CPA A;  1S7F A;  4L8A A;  4KLV A;  4KUA A;  2ZEG A;  4NF1 A;  3VH9 A;  4A95 A;  2JDC A;  4E2A A;  2YNE A;  4A32 A;  4MFK A;  3SI0 A;  1BPN A;  3V7Z A;  5E96 A;  1Z5R A;  3CPA A;  8CPA A;  1P0H A;  3W6X A;  3PB7 X;  4FWU A;  3D4U A;  2ZEE A;  3FVL A;  4FD4 A;  2HUZ A;  4PSX A;  4TWE A;  5G1Z A;  1IU8 A;  4CAX A;  4E0A A;  4PPZ A;  3IIB A;  4R6T A;  4MMO A;  1S60 A;  3D8P A;  4Q7A A;  3TTH A;  2JEW A;  5IB9 A;  4P4J A;  1ARM A;  2YGW A;  1XFO A;  3F5B A;  3R9G A;  5CPA A;  2AE6 A;  2PJ5 A;  1ZG8 A;  4GXH A;  5KTC A;  3PB4 X;  4CGN A;  1V0C A;  2PJA A;  1Z8X A;  4MCQ A;  5EC4 A;  2FVG A;  2Z3N A;  1Z4E A;  3D2M A;  1IOI A;  4C2X A;  1WWZ A;  3CXP A;  4OAD A;  4OP4 A;  3W91 A;  2ZEP A;  4KVX A;  4HNW B;  3ZJ0 A;  1M4L A;  2IL4 A;  1ZG9 A;  3UY5 A;  4UEF A;  2OB0 A;  2Q43 A;  4FD6 A;  3WR7 A;  4C7H A;  5H84 A;  4LUA A;  4GS4 A;  4DJL A;  3R9E A;  2VZY A;  3D67 A;  4ZGY B;  2CXA A;  2AFW A;  2C6G A;  1XIX A;  2Q4Z A;  6CPA A;  1Z4R A;  4Q36 A;  3C26 A;  2Z3K A;  4ONW A;  4EWT A;  2HV2 A;  3NH8 A;  3RZA A;  5K8M A;  4CYN A;  1ELL P;  2G3T A;  2OH1 A;  2WSA A;  4DYO A;  1VGY A;  2V8H A;  1R3N A;  4LX9 A;  2PVW A;  1PCA A;  4X3R A;  4LQG A;  4CRY B;  2Q04 A;  2I00 A;  1P4N A;  2J8M A;  2ZEM A;  3EXN A;  3G3S A;  3OWC A;  5AG5 A;  5DS0 A;  4B11 A;  3N7Z A;  4F9V A;  5KTD A;  4MCP A;  2NSM A;  2ZXV A;  4DNC A;  1HDU A;  4C68 A;  4QBJ A;  2HC9 A;  4MFJ A;  2OR4 A;  2AFU A;  3BHX A;  4F9U A;  1QSN A;  2EUI A;  4JZ0 A;  3SXN A;  4A31 A;  5A28 A;  3B7I A;  4R57 A;  2QVP A;  1IB1 E;  2IQ6 A;  1YLE A;  2KCW A;  2RB7 A;  4QVT A;  2VXK A;  4OC1 A;  1Y9W A;  1KWM A;  3FEC A;  4HNY B;  3HLP A;  1YGH A;  3KQX A;  4IAV A;  2ZEN A;  1LAN A;  4U5Y A;  3FMC A;  2Z3O A;  1M44 A;  5I4M A;  3EO4 A;  4B5O A;  2EK9 A;  3B8G A;  2GLJ A;  2PRQ A;  2ZEF A;  4JYW A;  2DF5 A;  4P4F A;  4OC3 A;  4MRI A;  1X10 A;  2B5G B;  2PJ7 A;  4PK3 A;  1TKH A;  3LAC A;  3E0K A;  2YND A;  1LCP A;  3KZW A;  3IWE A;  1ARL A;  2PJC A;  3GLJ A;  3IGR A;  5GCN A;  2O4H A;  5C88 A;  2REE A;  1TF9 A;  1R43 A;  4MHZ A;  3FH4 A; 
#chains in the Genus database with same CATH homology
 2FE7 A;  1MJA A;  1R57 A;  4EVY A;  1OZP A;  1M4G A;  4KSA A;  3VWD A;  2B4B A;  4QUS A;  1ON0 A;  1S7K A;  2Z0Z A;  5F48 A;  4BMH A;  4UFV A;  1M4D A;  1M4I A;  2OZH A;  3NE7 A;  4KZT A;  4JXR A;  2BEI A;  4M85 A;  5H86 A;  3KKW A;  4B13 A;  4U9Z A;  4B12 A;  3JVN A;  5KTA A;  4PV6 A;  3DDD A;  1PUA A;  2P6E A;  4E8O A;  4F0Y A;  4R3K A;  4CYO A;  1NMT A;  2B3V A;  4J3G A;  2J8R A;  3K9U A;  4JWP A;  1N71 A;  4AG7 A;  2FL4 A;  2DPS A;  4CAF A;  4A33 A;  1FY7 A;  1Y7R A;  2FIA A;  4KLW A;  3JUW A;  3IU1 A;  4UWJ A;  2ZW7 A;  4CGL A;  5BWA B;  1NE9 A;  5IX3 A;  2B4D B;  4OLL A;  2OZU A;  2PQ8 A;  2Q0Y A;  2FSR A;  2CNT A;  2Z10 A;  3T90 A;  1K4J A;  2Q7B A;  3QAH A;  1IYK A;  2GIV A;  2BUE A;  1XEB A;  4KOS A;  3BJ8 A;  2C27 A;  1J4J A;  2JLM A;  4CYQ A;  5J8C A;  2QML A;  3R95 A;  5F49 A;  2B5G A;  4CAW A;  2FXF A;  2REF A;  5F47 A;  4KVM E;  4CYP A;  1U6M A;  4I49 A;  1YR0 A;  4KSF A;  4HKF A;  2WUU A;  4M3S A;  1RXT A;  1LRZ A;  2Y0M A;  3S6K A;  4Y49 B;  4CGO A;  3PZJ A;  4MFZ A;  4CGM A;  1NSL A;  3W6S A;  2Z3M A;  4PK2 A;  5G22 A;  3FB3 A;  1Y9K A;  3DR8 A;  3H5Z A;  3BJ7 A;  3EY5 A;  4XPD B;  4NEX A;  4YFJ A;  2BL1 A;  4MFP A;  2R7H A;  3V8I A;  2ZW6 A;  3FBU A;  3IU2 A;  1WK4 A;  2OZG A;  1MJ9 A;  4RS2 A;  4KOY A;  4X5K A;  3R9F A;  4OAE A;  3FYN A;  4CRZ B;  4AVA A;  4CGP A;  1UFH A;  2ATR A;  3DR6 A;  3GY9 A;  2JEV A;  4AB7 A;  3IWG A;  4MY3 A;  2GE3 A;  3GYA A;  3I9S A;  1S3Z A;  1GHE A;  2PR8 A;  1YVO A;  2I79 A;  1YK3 A;  4MJ8 A;  5JQ4 A;  4H6U A;  2B4D A;  1XF8 A;  2CNS A;  4MY0 A;  1IID A;  2A4N A;  1CM0 A;  4R3L A;  3I3G A;  4XNH B;  4NSQ A;  4AVB A;  4RI1 A;  1IIC A;  2PSW A;  4YRH A;  4F0X A;  2QEC A;  3TE4 A;  5A27 A;  4F6A A;  2R98 A;  3JTK A;  3D3S A;  4KUB A;  4UFW A;  2VZZ A;  3ZZI A;  3DSB A;  1QSO A;  2G0B A;  2J8N A;  4MI4 A;  2NMT A;  4A30 A;  1XE4 A;  1L0C A;  3P2H A;  1S7N A;  5G20 A;  1QSM A;  4UWI A;  2FCK A;  4B5P B;  3RYO A;  2K5T A;  3TCV A;  3BLN A;  3H4Q A;  5EBV A;  3TT2 A;  4KS9 A;  1B87 A;  3QB8 A;  5HH1 A;  2X7B A;  4AG9 A;  2Q4Y A;  2YNC A;  5AG7 A;  4JLY A;  4R87 A;  2VEZ A;  1Q2C A;  4KOT A;  3FXT A;  2PC1 A;  1IYL A;  4FD7 A;  3R1K A;  2BSW A;  4AVC A;  2Q44 A;  4HNX B;  4K30 A;  2P0W A;  4H89 A;  2F5I A;  4C2Y A;  1I21 A;  4MHD A;  4KOU A;  1YX0 A;  1M1D A;  3CXQ A;  2JDD A;  2QIR A;  5I0C A;  3S6G A;  4B14 A;  2H5M A;  1KZF A;  2WPW A;  4XPL A;  5DWM A;  5J8F A;  2VBQ A;  2D4O A;  3GKR A;  1ZO0 A;  5IV0 A;  3EC4 A;  3P2F A;  1MJB A;  2PR1 A;  5CNP A;  2FT0 A;  3S6H A;  3D2P A;  2YNC C;  2PRB A;  1KUX A;  4UA3 A;  2ZPA A;  4Y49 C;  1YRE A;  4QC6 A;  4UCP A;  4QB9 A;  2AJ6 A;  3TO9 A;  1BOB A;  3F0A A;  5HMN A;  2O28 A;  3TO7 A;  4FD5 A;  2D4P A;  1B6B A;  5FVJ A;  2CY2 A;  1RO5 A;  1XMT A;  1TIQ A;  4XPD C;  4NXY A;  1PU9 A;  2DXQ A;  2WPX A;  4UBR A;  4PSW A;  5JPH A;  2B58 A;  4ORF A;  4UCN A;  1QSR A;  2Q4V A;  3SXO A;  3TFY A;  1YVK A;  2FS5 A;  4NCZ A;  2EVN A;  1CJW A;  3CXS A;  3FNC A;  1KUV A;  3SHP A;  5AGE A;  3F8K A;  1Z9U A;  4KOW A;  4II9 A;  4JD6 A;  2ZW5 A;  2R1I A;  3LOD A;  2VQY A;  2CNM A;  4B5P A;  4MFL A;  5AG6 A;  3DNS A;  4Q38 A;  3PGP A;  5DWN A;  1S5K A;  1Q2D A;  2RC4 A;  2VI7 A;  3R96 A;  3MGD A;  4U9Y A;  2G3A A;  4KOR A;  3PP9 A;  4XNH C;  3FRM A;  4UFX A;  4CAV A;  5ISV A;  1I12 A;  4B10 A;  3G8W A;  4KOX A;  3EFA A;  2DPT A;  2Z3P A;  4KOV A;  4BBH A;  4H6Z A;  4JXQ A;  4MFQ A;  3T9Y A;  5C82 A;  4IF5 A;  4KVO E;  4YGO A;  3VWE A;  4A2Z A;  1SQH A;  1VKC A;  4ZBG A;  4C7I A;  4IUS A;  3TOA A;  5F46 A;  1Q2Y A;  1BO4 A;  4L89 A;  2R8V A;  5IB0 A;  3A9L A;  1VHS A;  4ONU A;  4C2Z A;  2GAN A;  3FIX A;  2ZW4 A;  4MBU A;  3S6F A;  1I1D A;  4CAE A;  5G21 A;  2FIW A;  2HQY A;  2ARH A;  3LD2 A;  2B3U A;  2Z11 A;  4JJX A;  4CS0 B;  1KUY A;  1QST A;  2OU2 A;  1S7L A;  2PDO A;  2Z3L A;  2P6G A;  4XPK A;  5AG4 A;  3TOB A;  2P6F A;  4R9M A;  3TO6 A;  1MK4 A;  4UCM A;  1S7F A;  4L8A A;  4KLV A;  4KUA A;  4NF1 A;  4A95 A;  2JDC A;  4E2A A;  2YNE A;  4A32 A;  4MFK A;  5E96 A;  1P0H A;  3W6X A;  4FD4 A;  5G1Z A;  2HUZ A;  4PSX A;  4CAX A;  4E0A A;  1S60 A;  3D8P A;  3TTH A;  2YGW A;  3F5B A;  3R9G A;  2AE6 A;  5KTC A;  4CGN A;  1V0C A;  5EC4 A;  2Z3N A;  1Z4E A;  3D2M A;  4C2X A;  1WWZ A;  3CXP A;  4OAD A;  3W91 A;  4KVX A;  4HNW B;  3ZJ0 A;  2IL4 A;  3UY5 A;  2OB0 A;  4FD6 A;  3WR7 A;  4C7H A;  5H84 A;  4LUA A;  4GS4 A;  3R9E A;  2VZY A;  4ZGY B;  2CXA A;  1XIX A;  1Z4R A;  4Q36 A;  3C26 A;  2Z3K A;  2HV2 A;  4CYN A;  2G3T A;  2OH1 A;  2WSA A;  4LX9 A;  4CRY B;  2Q04 A;  2I00 A;  1P4N A;  2J8M A;  3EXN A;  3G3S A;  3OWC A;  5AG5 A;  4B11 A;  5KTD A;  3N7Z A;  2ZXV A;  4DNC A;  4C68 A;  4QBJ A;  4MFJ A;  1QSN A;  2EUI A;  3SXN A;  4A31 A;  5A28 A;  4R57 A;  1IB1 E;  1YLE A;  2KCW A;  4QVT A;  2VXK A;  1Y9W A;  4HNY B;  1YGH A;  4U5Y A;  2Z3O A;  1M44 A;  3EO4 A;  4B5O A;  3B8G A;  2B5G B;  4PK3 A;  3E0K A;  2YND A;  3IWE A;  3IGR A;  5GCN A;  5C88 A;  2REE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...