4Q3IA

Structure of the osserk2 leucine rich repeat extracellular domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
b'DLNTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNPDNSVIRVDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLNLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OsSERK2 D128N
publication title Structure of the OsSERK2 leucine-rich repeat extracellular domain.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transferase
total genus 70
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00560 LRR_1 Leucine Rich Repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4q3iA00
4I6JB 4U08A 1JL5A 3REZA 1OGQA 5HZLB 4GT6A 2O6RA 3WPIA 3FXIA 1K5DC 1P8TA 4FD0A 2WQUA 4R5CA 3W3KA 1M0ZA 3ZYOA 4P8SA 4QC0A 1OOKG 3CIGA 2BNHA 2WQVA 3G06A 5AWAA 4R07A 4C2AB 1WWLA 4BSUA 4Z64C 2UZYA 1H6TA 5HDHA 3OJAA 5AWCA 3RGZA 3G04C 3ULVA 4PEQB 1FO1A 2Z7XB 4P91A 4LXSA 4LSCA 5GS0A 1XCDA 5B4PA 5D3IA 3BZ5A 4U06A 2ASSB 1SQ0B 1FQVA 4Q3GA 4K17A 1FS2A 5B0NA 1P9AG 4WYKA 2XOTA 1OTNA 3O6NA 1DCEA 4HQ1A 2WQWA 4CNCA 4Y61B 5IJCA 5A5CA 5GQRK 4R6GA 3RJ0A 1DS9A 4PQ8A 3RGXA 1XWDC 1G9UA 3M18A 4J0MA 4CC4A 4V2CA 3WPFA 4CNMA 3W3MA 1YRGA 1A4YA 4FS7A 4UFRA 3WPDA 3E4GA 4AW4A 1OZNA 3ULAA 2O6SA 5B0TA 5AWBA 2OMWA 3PMHG 3UL7A 2Z81A 4LSXC 3ZYNA 2Y5QA 3TSRE 4FCGA 4R6FA 2XWTC 4WP6A 2CA6A 5LFNA 4R09A 1O6VA 3E3ZA 1O6TA 3RFSA 2Z7XA 4FMZA 2BEXA 1QYYA 3SB4A 1FT8A 4MN8B 5CMNA 4PERA 2R9UA 4ARNA 4Z8GA 3OGMB 4PSJA 2P1NB 4ARRA 2Q4GW 1XECA 1KOHA 4LI1A 3RFJA 4FHOA 4L3FA 1O6SA 3OGLB 2V9SA 4KT1A 4G8AA 2OMYA 4H09A 4LI2A 3O53A 2RA8A 2Z64A 4YEBB 3UL8A 4KNGA 3RW6A 1W8AA 1ZIWA 5CMPA 5IJDA 1KOOA 4Q3IA 2WFHA 3VQ1A 4NKHA 1D0BA 1LTXA 5GMHA 2ID5A 3A79B 4R5DA 4U7LA 3WPEA 2V9TB 1A9NA 5GMGA 2JE0A 3W3GA 2A0ZA 4NKGA 4LSXA 1M10B 4V2DA 1Z7XW 2JE1A 3JB9j 1IO0A 3P72A 3OGKB 1M9LA 1DFJI 2UZXA 2OMUA 3G3AA 4LXRA 1GWBA 4RWTC 1M9SA 3CIYA 4KXFB 4OQTA 4XGOA 4M7EC 4IM6A 3C6NB 3C6OB 4R6JA 3RIZA 2P1PB 4R0AA 4R08A 3E2JA 4FDWA 4TZHA 1U0ND 4BSRA 2Z62A 3ZYIA 3G39A 2FT3A 4C2BB 1XKUA 1PGVA 4QBZA 2IFGA 4BSSA 2OMTA 1H6UA 4U09A 5AWDA 3W3NA 2ASTB 4AY9X 4J4LA 3DZEA 2Z63A 5IJBA 5AZ5A 3G3BA 4Z79A 1XEUA 5IYXC 4ECOA 3WPCA 3WN4A 3WPGA 2WQXA 3RW7A 4GLPA 3W3LA 2Z66A 2OMXA 5FTTB 2V70A 3WPHA 3CVRA 3OJAB 2P1OB 3ULUA 4V2EA 1OTOA 3M19A 4BV4R 4R6AA 3WPBA 2O6QA 3E6JA 3C6PB 2Z82A 4L3AA 4RCAB 2Z65A 3UN9A 4QXEA 1K5GC 4M7EA 4Q62A 2P1MB 4LSAA 3W3JA 4Z94G 3GOZA 1P8VA 3RFEA 4Z61C 3ZYJA 5GS2B 4XSQA 3VQ2A 4EZGA 2JQDA 4RCWA 3UL9A 2ELLA 4XOSA 4ECNA 4B8CD 1OTMA 4CILA 5GMFA 3KJ4A 2OMZA 4MQWX 2OMVA 4CP6A 4PKIG 2RR6A 2P1QB 4CC4C 4R58A
chains in the Genus database with same CATH superfamily
4I6JB 4U08A 1JL5A 3REZA 1OGQA 5HZLB 4GT6A 2O6RA 3WPIA 3FXIA 1K5DC 1P8TA 4FD0A 2WQUA 4R5CA 3W3KA 1M0ZA 3ZYOA 4P8SA 4QC0A 1OOKG 3CIGA 2BNHA 2WQVA 3G06A 5AWAA 4R07A 4C2AB 1WWLA 4BSUA 4Z64C 2UZYA 1H6TA 5HDHA 3OJAA 5AWCA 3RGZA 3G04C 3ULVA 4PEQB 1FO1A 2Z7XB 4P91A 4NZRM 4LXSA 4LSCA 5GS0A 1XCDA 5B4PA 5D3IA 3BZ5A 4U06A 2ASSB 1SQ0B 1FQVA 4Q3GA 4K17A 1FS2A 5B0NA 1P9AG 4WYKA 2XOTA 1OTNA 3O6NA 1DCEA 4HQ1A 2WQWA 4CNCA 4Y61B 5IJCA 5A5CA 5GQRK 4R6GA 3RJ0A 1DS9A 4PQ8A 3RGXA 1XWDC 1G9UA 3M18A 4J0MA 4CC4A 4V2CA 3WPFA 4CNMA 3W3MA 1YRGA 1A4YA 4FS7A 4UFRA 3WPDA 3E4GA 4AW4A 1OZNA 3ULAA 2O6SA 5B0TA 5AWBA 2OMWA 3PMHG 3UL7A 2Z81A 4LSXC 3ZYNA 2Y5QA 3TSRE 4FCGA 4R6FA 2XWTC 4WP6A 2CA6A 5LFNA 4R09A 1O6VA 3E3ZA 1O6TA 3RFSA 2Z7XA 4FMZA 2BEXA 1QYYA 3SB4A 1FT8A 4MN8B 5CMNA 4PERA 2R9UA 4ARNA 4Z8GA 3OGMB 4PSJA 2P1NB 4ARRA 2Q4GW 1XECA 1KOHA 4LI1A 3RFJA 4FHOA 4L3FA 1O6SA 3OGLB 2V9SA 4KT1A 4G8AA 2OMYA 4H09A 4LI2A 3O53A 2RA8A 2Z64A 4YEBB 3UL8A 4KNGA 3RW6A 1W8AA 1ZIWA 5CMPA 5IJDA 1KOOA 4Q3IA 2WFHA 3VQ1A 4NKHA 1D0BA 1LTXA 5GMHA 2ID5A 3A79B 4R5DA 4U7LA 3WPEA 2V9TB 1A9NA 5GMGA 2JE0A 3W3GA 2A0ZA 4NKGA 4LSXA 1M10B 4V2DA 1Z7XW 2JE1A 3JB9j 1IO0A 3P72A 3OGKB 1M9LA 1DFJI 2UZXA 2OMUA 3G3AA 4LXRA 1GWBA 4RWTC 1M9SA 3CIYA 4KXFB 4OQTA 4XGOA 4M7EC 4IM6A 4NZTM 3C6NB 3C6OB 4R6JA 3RIZA 2P1PB 4R0AA 4R08A 3E2JA 4FDWA 4TZHA 1U0ND 4BSRA 2Z62A 3ZYIA 3G39A 2FT3A 4C2BB 1XKUA 1PGVA 4QBZA 2IFGA 4BSSA 2OMTA 1H6UA 4U09A 5AWDA 3W3NA 2ASTB 4AY9X 4J4LA 3DZEA 2Z63A 5IJBA 5AZ5A 3G3BA 4Z79A 1XEUA 5IYXC 4ECOA 3WPCA 3WN4A 3WPGA 2WQXA 3RW7A 4GLPA 3W3LA 2Z66A 2OMXA 5FTTB 2V70A 3WPHA 3CVRA 3OJAB 2P1OB 3ULUA 4V2EA 1OTOA 3M19A 4BV4R 4R6AA 3WPBA 2O6QA 3E6JA 3C6PB 2Z82A 4L3AA 4RCAB 2Z65A 3UN9A 4QXEA 1K5GC 4M7EA 4Q62A 2P1MB 4LSAA 3W3JA 4Z94G 3GOZA 1P8VA 3RFEA 4Z61C 3ZYJA 5GS2B 4XSQA 3VQ2A 4EZGA 2JQDA 4RCWA 3UL9A 2ELLA 4XOSA 4ECNA 4B8CD 1OTMA 4CILA 5GMFA 3KJ4A 2OMZA 4MQWX 2OMVA 4CP6A 4PKIG 2RR6A 2P1QB 4CC4C 4R58A
chains in the Genus database with same CATH topology
4I6JB 4U08A 1JL5A 3REZA 1OGQA 5HZLB 4GT6A 2O6RA 3WPIA 3FXIA 1K5DC 1P8TA 4FD0A 2WQUA 4R5CA 3W3KA 1M0ZA 3ZYOA 4P8SA 4QC0A 1OOKG 3CIGA 2BNHA 2WQVA 3G06A 5AWAA 4R07A 4C2AB 1WWLA 4BSUA 4Z64C 2UZYA 1H6TA 5HDHA 3OJAA 5AWCA 3RGZA 3G04C 3ULVA 4PEQB 1FO1A 2Z7XB 4P91A 4LXSA 4LSCA 5GS0A 1XCDA 5B4PA 5D3IA 3BZ5A 4U06A 2ASSB 1SQ0B 1FQVA 4Q3GA 4K17A 1FS2A 5B0NA 1P9AG 4WYKA 2XOTA 1OTNA 3O6NA 1DCEA 4HQ1A 2WQWA 4CNCA 4Y61B 5IJCA 5A5CA 5GQRK 4R6GA 3RJ0A 1DS9A 4PQ8A 3RGXA 1XWDC 1G9UA 3M18A 4J0MA 4CC4A 4V2CA 3WPFA 4CNMA 3W3MA 1YRGA 1A4YA 4FS7A 4UFRA 3WPDA 3E4GA 4AW4A 1OZNA 3ULAA 2O6SA 5B0TA 5AWBA 2OMWA 3PMHG 3UL7A 2Z81A 4LSXC 3ZYNA 2Y5QA 3TSRE 4FCGA 4R6FA 2XWTC 4WP6A 2CA6A 5LFNA 4R09A 1O6VA 3E3ZA 1O6TA 3RFSA 2Z7XA 4FMZA 2BEXA 1QYYA 3SB4A 1FT8A 4MN8B 5CMNA 4PERA 2R9UA 4ARNA 4Z8GA 3OGMB 4PSJA 2P1NB 4ARRA 2Q4GW 1XECA 1KOHA 4LI1A 3RFJA 4FHOA 4L3FA 1O6SA 3OGLB 2V9SA 4KT1A 4G8AA 2OMYA 4H09A 4LI2A 3O53A 2RA8A 2Z64A 4YEBB 3UL8A 4KNGA 3RW6A 1W8AA 1ZIWA 5CMPA 5IJDA 1KOOA 4Q3IA 2WFHA 3VQ1A 4NKHA 1D0BA 1LTXA 5GMHA 2ID5A 3A79B 4R5DA 4U7LA 3WPEA 2V9TB 1A9NA 5GMGA 2JE0A 3W3GA 2A0ZA 4NKGA 4LSXA 1M10B 4V2DA 1Z7XW 2JE1A 3JB9j 1IO0A 3P72A 3OGKB 1M9LA 1DFJI 2UZXA 2OMUA 3G3AA 4LXRA 1GWBA 4RWTC 1M9SA 3CIYA 4KXFB 4OQTA 4XGOA 4M7EC 4IM6A 3C6NB 3C6OB 4R6JA 3RIZA 2P1PB 4R0AA 4R08A 3E2JA 4FDWA 4TZHA 1U0ND 4BSRA 2Z62A 3ZYIA 3G39A 2FT3A 4C2BB 1XKUA 1PGVA 4QBZA 2IFGA 4BSSA 2OMTA 1H6UA 4U09A 5AWDA 3W3NA 2ASTB 4AY9X 4J4LA 3DZEA 2Z63A 5IJBA 5AZ5A 3G3BA 4Z79A 1XEUA 5IYXC 4ECOA 3WPCA 3WN4A 3WPGA 2WQXA 3RW7A 4GLPA 3W3LA 2Z66A 2OMXA 5FTTB 2V70A 3WPHA 3CVRA 3OJAB 2P1OB 3ULUA 4V2EA 1OTOA 3M19A 4BV4R 4R6AA 3WPBA 2O6QA 3E6JA 3C6PB 2Z82A 4L3AA 4RCAB 2Z65A 3UN9A 4QXEA 1K5GC 4M7EA 4Q62A 2P1MB 4LSAA 3W3JA 4Z94G 3GOZA 1P8VA 3RFEA 4Z61C 3ZYJA 5GS2B 4XSQA 3VQ2A 4EZGA 2JQDA 4RCWA 3UL9A 2ELLA 4XOSA 4ECNA 4B8CD 1OTMA 4CILA 5GMFA 3KJ4A 2OMZA 4MQWX 2OMVA 4CP6A 4PKIG 2RR6A 2P1QB 4CC4C 4R58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6J B;  4U08 A;  1JL5 A;  3REZ A;  1OGQ A;  5HZL B;  4GT6 A;  2O6R A;  3WPI A;  3FXI A;  1K5D C;  1P8T A;  4FD0 A;  2WQU A;  4R5C A;  3W3K A;  1M0Z A;  3ZYO A;  4P8S A;  4QC0 A;  1OOK G;  3CIG A;  2BNH A;  2WQV A;  3G06 A;  5AWA A;  4R07 A;  4C2A B;  1WWL A;  4BSU A;  4Z64 C;  2UZY A;  1H6T A;  5HDH A;  3OJA A;  5AWC A;  3RGZ A;  3G04 C;  3ULV A;  4PEQ B;  1FO1 A;  2Z7X B;  4P91 A;  4LXS A;  4LSC A;  5GS0 A;  1XCD A;  5B4P A;  5D3I A;  3BZ5 A;  4U06 A;  2ASS B;  1SQ0 B;  1FQV A;  4Q3G A;  4K17 A;  1FS2 A;  5B0N A;  1P9A G;  4WYK A;  2XOT A;  1OTN A;  3O6N A;  1DCE A;  4HQ1 A;  2WQW A;  4CNC A;  4Y61 B;  5IJC A;  5A5C A;  5GQR K;  4R6G A;  3RJ0 A;  1DS9 A;  4PQ8 A;  3RGX A;  1XWD C;  1G9U A;  3M18 A;  4J0M A;  4CC4 A;  4V2C A;  3WPF A;  4CNM A;  3W3M A;  1YRG A;  1A4Y A;  4FS7 A;  4UFR A;  3WPD A;  3E4G A;  4AW4 A;  1OZN A;  3ULA A;  2O6S A;  5B0T A;  5AWB A;  2OMW A;  3PMH G;  3UL7 A;  2Z81 A;  4LSX C;  3ZYN A;  2Y5Q A;  3TSR E;  4FCG A;  4R6F A;  2XWT C;  4WP6 A;  2CA6 A;  5LFN A;  4R09 A;  1O6V A;  3E3Z A;  1O6T A;  3RFS A;  2Z7X A;  4FMZ A;  2BEX A;  1QYY A;  3SB4 A;  1FT8 A;  4MN8 B;  5CMN A;  4PER A;  2R9U A;  4ARN A;  4Z8G A;  3OGM B;  4PSJ A;  2P1N B;  4ARR A;  2Q4G W;  1XEC A;  1KOH A;  4LI1 A;  3RFJ A;  4FHO A;  4L3F A;  1O6S A;  3OGL B;  2V9S A;  4KT1 A;  4G8A A;  2OMY A;  4H09 A;  4LI2 A;  3O53 A;  2RA8 A;  2Z64 A;  4YEB B;  3UL8 A;  4KNG A;  3RW6 A;  1W8A A;  1ZIW A;  5CMP A;  5IJD A;  1KOO A;  4Q3I A;  2WFH A;  3VQ1 A;  4NKH A;  1D0B A;  1LTX A;  5GMH A;  2ID5 A;  3A79 B;  4R5D A;  4U7L A;  3WPE A;  2V9T B;  1A9N A;  5GMG A;  2JE0 A;  3W3G A;  2A0Z A;  4NKG A;  4LSX A;  1M10 B;  4V2D A;  1Z7X W;  2JE1 A;  3JB9 j;  1IO0 A;  3P72 A;  3OGK B;  1M9L A;  1DFJ I;  2UZX A;  2OMU A;  3G3A A;  4LXR A;  1GWB A;  4RWT C;  1M9S A;  3CIY A;  4KXF B;  4OQT A;  4XGO A;  4M7E C;  4IM6 A;  3C6N B;  3C6O B;  4R6J A;  3RIZ A;  2P1P B;  4R0A A;  4R08 A;  3E2J A;  4FDW A;  4TZH A;  1U0N D;  4BSR A;  2Z62 A;  3ZYI A;  3G39 A;  2FT3 A;  4C2B B;  1XKU A;  1PGV A;  4QBZ A;  2IFG A;  4BSS A;  2OMT A;  1H6U A;  4U09 A;  5AWD A;  3W3N A;  2AST B;  4AY9 X;  4J4L A;  3DZE A;  2Z63 A;  5IJB A;  5AZ5 A;  3G3B A;  4Z79 A;  1XEU A;  5IYX C;  4ECO A;  3WPC A;  3WN4 A;  3WPG A;  2WQX A;  3RW7 A;  4GLP A;  3W3L A;  2Z66 A;  2OMX A;  5FTT B;  2V70 A;  3WPH A;  3CVR A;  3OJA B;  2P1O B;  3ULU A;  4V2E A;  1OTO A;  3M19 A;  4BV4 R;  4R6A A;  3WPB A;  2O6Q A;  3E6J A;  3C6P B;  2Z82 A;  4L3A A;  4RCA B;  2Z65 A;  3UN9 A;  4QXE A;  1K5G C;  4M7E A;  4Q62 A;  2P1M B;  4LSA A;  3W3J A;  4Z94 G;  3GOZ A;  1P8V A;  3RFE A;  4Z61 C;  3ZYJ A;  5GS2 B;  4XSQ A;  3VQ2 A;  4EZG A;  2JQD A;  4RCW A;  3UL9 A;  2ELL A;  4XOS A;  4ECN A;  4B8C D;  1OTM A;  4CIL A;  5GMF A;  3KJ4 A;  2OMZ A;  4MQW X;  2OMV A;  4CP6 A;  4PKI G;  2RR6 A;  2P1Q B;  4CC4 C;  4R58 A; 
#chains in the Genus database with same CATH topology
 4I6J B;  4U08 A;  1JL5 A;  3REZ A;  1OGQ A;  5HZL B;  4GT6 A;  2O6R A;  3WPI A;  3FXI A;  1K5D C;  1P8T A;  4FD0 A;  2WQU A;  4R5C A;  3W3K A;  1M0Z A;  3ZYO A;  4P8S A;  4QC0 A;  1OOK G;  3CIG A;  2BNH A;  2WQV A;  3G06 A;  5AWA A;  4R07 A;  4C2A B;  1WWL A;  4BSU A;  4Z64 C;  2UZY A;  1H6T A;  5HDH A;  3OJA A;  5AWC A;  3RGZ A;  3G04 C;  3ULV A;  4PEQ B;  1FO1 A;  2Z7X B;  4P91 A;  4NZR M;  4LXS A;  4LSC A;  5GS0 A;  1XCD A;  5B4P A;  5D3I A;  3BZ5 A;  4U06 A;  2ASS B;  1SQ0 B;  1FQV A;  4Q3G A;  4K17 A;  1FS2 A;  5B0N A;  1P9A G;  4WYK A;  2XOT A;  1OTN A;  3O6N A;  1DCE A;  4HQ1 A;  2WQW A;  4CNC A;  4Y61 B;  5IJC A;  5A5C A;  5GQR K;  4R6G A;  3RJ0 A;  1DS9 A;  4PQ8 A;  3RGX A;  1XWD C;  1G9U A;  3M18 A;  4J0M A;  4CC4 A;  4V2C A;  3WPF A;  4CNM A;  3W3M A;  1YRG A;  1A4Y A;  4FS7 A;  4UFR A;  3WPD A;  3E4G A;  4AW4 A;  1OZN A;  3ULA A;  2O6S A;  5B0T A;  5AWB A;  2OMW A;  3PMH G;  3UL7 A;  2Z81 A;  4LSX C;  3ZYN A;  2Y5Q A;  3TSR E;  4FCG A;  4R6F A;  2XWT C;  4WP6 A;  2CA6 A;  5LFN A;  4R09 A;  1O6V A;  3E3Z A;  1O6T A;  3RFS A;  2Z7X A;  4FMZ A;  2BEX A;  1QYY A;  3SB4 A;  1FT8 A;  4MN8 B;  5CMN A;  4PER A;  2R9U A;  4ARN A;  4Z8G A;  3OGM B;  4PSJ A;  2P1N B;  4ARR A;  2Q4G W;  1XEC A;  1KOH A;  4LI1 A;  3RFJ A;  4FHO A;  4L3F A;  1O6S A;  3OGL B;  2V9S A;  4KT1 A;  4G8A A;  2OMY A;  4H09 A;  4LI2 A;  3O53 A;  2RA8 A;  2Z64 A;  4YEB B;  3UL8 A;  4KNG A;  3RW6 A;  1W8A A;  1ZIW A;  5CMP A;  5IJD A;  1KOO A;  4Q3I A;  2WFH A;  3VQ1 A;  4NKH A;  1D0B A;  1LTX A;  5GMH A;  2ID5 A;  3A79 B;  4R5D A;  4U7L A;  3WPE A;  2V9T B;  1A9N A;  5GMG A;  2JE0 A;  3W3G A;  2A0Z A;  4NKG A;  4LSX A;  1M10 B;  4V2D A;  1Z7X W;  2JE1 A;  3JB9 j;  1IO0 A;  3P72 A;  3OGK B;  1M9L A;  1DFJ I;  2UZX A;  2OMU A;  3G3A A;  4LXR A;  1GWB A;  4RWT C;  1M9S A;  3CIY A;  4KXF B;  4OQT A;  4XGO A;  4M7E C;  4IM6 A;  4NZT M;  3C6N B;  3C6O B;  4R6J A;  3RIZ A;  2P1P B;  4R0A A;  4R08 A;  3E2J A;  4FDW A;  4TZH A;  1U0N D;  4BSR A;  2Z62 A;  3ZYI A;  3G39 A;  2FT3 A;  4C2B B;  1XKU A;  1PGV A;  4QBZ A;  2IFG A;  4BSS A;  2OMT A;  1H6U A;  4U09 A;  5AWD A;  3W3N A;  2AST B;  4AY9 X;  4J4L A;  3DZE A;  2Z63 A;  5IJB A;  5AZ5 A;  3G3B A;  4Z79 A;  1XEU A;  5IYX C;  4ECO A;  3WPC A;  3WN4 A;  3WPG A;  2WQX A;  3RW7 A;  4GLP A;  3W3L A;  2Z66 A;  2OMX A;  5FTT B;  2V70 A;  3WPH A;  3CVR A;  3OJA B;  2P1O B;  3ULU A;  4V2E A;  1OTO A;  3M19 A;  4BV4 R;  4R6A A;  3WPB A;  2O6Q A;  3E6J A;  3C6P B;  2Z82 A;  4L3A A;  4RCA B;  2Z65 A;  3UN9 A;  4QXE A;  1K5G C;  4M7E A;  4Q62 A;  2P1M B;  4LSA A;  3W3J A;  4Z94 G;  3GOZ A;  1P8V A;  3RFE A;  4Z61 C;  3ZYJ A;  5GS2 B;  4XSQ A;  3VQ2 A;  4EZG A;  2JQD A;  4RCW A;  3UL9 A;  2ELL A;  4XOS A;  4ECN A;  4B8C D;  1OTM A;  4CIL A;  5GMF A;  3KJ4 A;  2OMZ A;  4MQW X;  2OMV A;  4CP6 A;  4PKI G;  2RR6 A;  2P1Q B;  4CC4 C;  4R58 A; 
#chains in the Genus database with same CATH homology
 4I6J B;  4U08 A;  1JL5 A;  3REZ A;  1OGQ A;  5HZL B;  4GT6 A;  2O6R A;  3WPI A;  3FXI A;  1K5D C;  1P8T A;  4FD0 A;  2WQU A;  4R5C A;  3W3K A;  1M0Z A;  3ZYO A;  4P8S A;  4QC0 A;  1OOK G;  3CIG A;  2BNH A;  2WQV A;  3G06 A;  5AWA A;  4R07 A;  4C2A B;  1WWL A;  4BSU A;  4Z64 C;  2UZY A;  1H6T A;  5HDH A;  3OJA A;  5AWC A;  3RGZ A;  3G04 C;  3ULV A;  4PEQ B;  1FO1 A;  2Z7X B;  4P91 A;  4LXS A;  4LSC A;  5GS0 A;  1XCD A;  5B4P A;  5D3I A;  3BZ5 A;  4U06 A;  2ASS B;  1SQ0 B;  1FQV A;  4Q3G A;  4K17 A;  1FS2 A;  5B0N A;  1P9A G;  4WYK A;  2XOT A;  1OTN A;  3O6N A;  1DCE A;  4HQ1 A;  2WQW A;  4CNC A;  4Y61 B;  5IJC A;  5A5C A;  5GQR K;  4R6G A;  3RJ0 A;  1DS9 A;  4PQ8 A;  3RGX A;  1XWD C;  1G9U A;  3M18 A;  4J0M A;  4CC4 A;  4V2C A;  3WPF A;  4CNM A;  3W3M A;  1YRG A;  1A4Y A;  4FS7 A;  4UFR A;  3WPD A;  3E4G A;  4AW4 A;  1OZN A;  3ULA A;  2O6S A;  5B0T A;  5AWB A;  2OMW A;  3PMH G;  3UL7 A;  2Z81 A;  4LSX C;  3ZYN A;  2Y5Q A;  3TSR E;  4FCG A;  4R6F A;  2XWT C;  4WP6 A;  2CA6 A;  5LFN A;  4R09 A;  1O6V A;  3E3Z A;  1O6T A;  3RFS A;  2Z7X A;  4FMZ A;  2BEX A;  1QYY A;  3SB4 A;  1FT8 A;  4MN8 B;  5CMN A;  4PER A;  2R9U A;  4ARN A;  4Z8G A;  3OGM B;  4PSJ A;  2P1N B;  4ARR A;  2Q4G W;  1XEC A;  1KOH A;  4LI1 A;  3RFJ A;  4FHO A;  4L3F A;  1O6S A;  3OGL B;  2V9S A;  4KT1 A;  4G8A A;  2OMY A;  4H09 A;  4LI2 A;  3O53 A;  2RA8 A;  2Z64 A;  4YEB B;  3UL8 A;  4KNG A;  3RW6 A;  1W8A A;  1ZIW A;  5CMP A;  5IJD A;  1KOO A;  4Q3I A;  2WFH A;  3VQ1 A;  4NKH A;  1D0B A;  1LTX A;  5GMH A;  2ID5 A;  3A79 B;  4R5D A;  4U7L A;  3WPE A;  2V9T B;  1A9N A;  5GMG A;  2JE0 A;  3W3G A;  2A0Z A;  4NKG A;  4LSX A;  1M10 B;  4V2D A;  1Z7X W;  2JE1 A;  3JB9 j;  1IO0 A;  3P72 A;  3OGK B;  1M9L A;  1DFJ I;  2UZX A;  2OMU A;  3G3A A;  4LXR A;  1GWB A;  4RWT C;  1M9S A;  3CIY A;  4KXF B;  4OQT A;  4XGO A;  4M7E C;  4IM6 A;  3C6N B;  3C6O B;  4R6J A;  3RIZ A;  2P1P B;  4R0A A;  4R08 A;  3E2J A;  4FDW A;  4TZH A;  1U0N D;  4BSR A;  2Z62 A;  3ZYI A;  3G39 A;  2FT3 A;  4C2B B;  1XKU A;  1PGV A;  4QBZ A;  2IFG A;  4BSS A;  2OMT A;  1H6U A;  4U09 A;  5AWD A;  3W3N A;  2AST B;  4AY9 X;  4J4L A;  3DZE A;  2Z63 A;  5IJB A;  5AZ5 A;  3G3B A;  4Z79 A;  1XEU A;  5IYX C;  4ECO A;  3WPC A;  3WN4 A;  3WPG A;  2WQX A;  3RW7 A;  4GLP A;  3W3L A;  2Z66 A;  2OMX A;  5FTT B;  2V70 A;  3WPH A;  3CVR A;  3OJA B;  2P1O B;  3ULU A;  4V2E A;  1OTO A;  3M19 A;  4BV4 R;  4R6A A;  3WPB A;  2O6Q A;  3E6J A;  3C6P B;  2Z82 A;  4L3A A;  4RCA B;  2Z65 A;  3UN9 A;  4QXE A;  1K5G C;  4M7E A;  4Q62 A;  2P1M B;  4LSA A;  3W3J A;  4Z94 G;  3GOZ A;  1P8V A;  3RFE A;  4Z61 C;  3ZYJ A;  5GS2 B;  4XSQ A;  3VQ2 A;  4EZG A;  2JQD A;  4RCW A;  3UL9 A;  2ELL A;  4XOS A;  4ECN A;  4B8C D;  1OTM A;  4CIL A;  5GMF A;  3KJ4 A;  2OMZ A;  4MQW X;  2OMV A;  4CP6 A;  4PKI G;  2RR6 A;  2P1Q B;  4CC4 C;  4R58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...