4Q3NA

Crystal structure of mgs-m5, a lactate dehydrogenase enzyme from a medee basin deep-sea metagenome library
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
b'MRNSKVVVVGTGFVGMSYAYAMVNQGTVEELVLLDIDKRKAEGEAMDLNHGLAFGPRKMSIKAGDYKDCKDAGLVVITAGVNQKEGETRIHLLKRNAEIIKTVVKNIMSSGFNGILLVASNPVDVLAYVAWKESGLHHSRVIGSGTSLDTARLRYEISQYIHIDSRNVHAYILGEHGDSEFVCWSNANVGAKPIADVIDSMDEISFEDLEHIYLKVRDAAYEIISRKKATYYGIGMALVRITAAIFNNENRILPISVLNNGVYDCEDQVYIGLPAVLNKDGVHHIVKLKLNEKENSQLNNSANILRKNLDDMSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGS-M5
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 114
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4q3nA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4q3nA02
1ZKMA 1EBFA 1KVUA 1ZK3A 3PIIA 2GO1A 4CLEA 1N2SA 2ZB7A 2F00A 1PTJA 2DC1A 4OSOA 4YAIA 4FBGA 2TMGA 5T8KC 4E5YA 3NJ4A 5G4KB 3ZU3A 2FZEA 4OOFA 2PR2A 3WQSB 3PHHA 4ID9A 3ROKA 1D7OA 3N7UA 3H4VA 3JQAD 1PWXA 2D1YA 5A3JA 4BNVA 4I5FA 1T26A 1S6YA 3ZDFA 1NQ5A 1Y9EA 3JYOA 3SVTA 3H9QA 3VPGA 3E9MA 2YFHA 2BD0A 2NVWA 2VNSA 1K0UA 4WLNA 1DC6A 4FB5A 4OYRA 5IDWA 3GMDA 1CQJA 4J90A 3RUFA 2LDBA 4KP7A 3PHIA 1C1DB 4LMPA 1DC4A 4BO7A 3ROPA 3VZRA 2X7HA 4DWVA 3KYDB 3VPFA 1C1XB 4BHTA 4G5HA 4A03A 3P19A 2AE1A 1EDOA 1NQOA 2O4UX 2VHVA 1EE2A 2AQ8A 3MZ0A 3GDFA 3ZZNA 4BL5A 1R6DA 2HO5A 4J7XA 1Y8RB 2YV1A 5F21A 3RD5A 5IDXA 4ALNA 1LSSA 4LVUA 3WNVA 3DXFA 1R0SA 4L73A 2W4QA 4I9HA 2EV9A 5F5NA 1H9BA 3TOZA 3QWBA 3VOSA 4TVBA 2DBVO 1WAMA 5JPIA 5J23A 3ITDA 5L3ZA 3FI9A 4XZ3A 2VYVA 3JQEA 2PV7A 1KVRA 1MGOA 4J4BA 1UP6A 3GNTA 4XEHA 2IXBA 3S2EA 2DBZA 1I01A 2FN7A 4B4OA 4CR8A 2YY7A 4R1NA 1WNTA 4QO8A 1GPJA 1UZMA 4JBHA 5TRTA 3GRKA 2EP5A 2RAFA 1GL3A 3QWIA 2VWHA 1YB1A 1PGPA 2OZPA 4LISA 4PRLA 1BW9A 3A9WA 1QYVA 3GVIA 1UZLA 2NQ8A 2DUWA 4BKPA 3O8QA 2W2KB 4E5NA 4CL3A 4MKRA 4AJHA 1V3UA 3AM4A 1R4NA 1PZFA 2E48A 1Q1NA 1A9YA 1HDXA 4FOOA 3H9EO 2OO5A 2XF8A 4YJGA 4A0SA 4F6LA 1I32A 3V5NA 3RJ9A 4M86A 1QORA 1U3WA 3IJPA 2I66A 5AVOA 3EDMA 4IIUA 1PZHA 3JD4A 2JD2A 9LDBA 1IY8A 4O1MA 2PGLA 1FF9A 4MP8A 4KUHA 1R0KA 5LDGA 3AFMA 5EMHA 2CNBA 5F5LA 3ZNPA 4UREA 4XCVA 1YWGO 3AY3A 1OBFO 3QSGA 1GEGA 3OFSA 3FNHA 1LQTA 4B7UA 4AG3A 1WZEA 2VRBA 3MEQA 1E1MA 4L75A 4E2WA 3W4JA 3BMCA 3O4RA 1P0CA 2Q99A 1T2AA 4CQLB 5JO0A 4OH1A 1DBVO 3OQ1A 1GYPA 1WXDA 4IMPA 3WNQA 5JFOA 1NYTA 2XOXA 3JQ9C 4CR6A 1BXGA 1QV7A 4J1QA 4KZPA 4YWJA 3KYCA 3GR6A 4M55A 4DLAA 2JHGA 2WMDA 5TF4A 3DFUA 4DQUA 1JVSA 1Y5RA 3AY6A 5I9MA 2PZLA 2HAEA 1E3SA 5LDHA 2BGMA 4Y98A 5A05A 1KVQA 4RPJA 4IGEA 3MWDB 4IJUA 4YJFA 3LK7A 1H93A 1U5AA 4NJOA 1ZXLA 1JDJA 1KC1A 3UFXA 2ET6A 2R00A 3JYLA 1K89A 2CF6A 1PWZA 4J43A 2CY0A 1DRWA 5IG2A 4UULA 4RCVA 1LSJA 3DMYA 5A9SA 4RZIA 3I9OA 4E2ZA 5C7OO 2OOSA 5L7YA 3GFBA 3ZW9A 3L4BA 1Q7GA 3RBVA 2BI7A 2GERA 1MXHA 2EKPA 2UUPA 1PL8A 1QMGA 4PLGA 1DFHA 5JS6A 4ALIA 2OUIA 1DAOA 1NVMB 2GN9A 2FOIA 2D0IA 1I30A 4XQEA 4E3ZA 1EVZA 1E3WA 3GNQA 4KTVE 4BO8A 1NHWA 4IUYA 4U7WA 2E4AA 4UUNA 5TX7A 3L77A 4BO1A 4MP3A 4AJJA 3AY7A 4QUKA 2PA3A 4CM6A 1AXGA 1JA9A 3IUSA 4GPD1 5DN9A 4BNIA 1B16A 1IULA 1HYHA 4E2XA 3PLRA 2JL1A 1ISHA 3WR5A 4EJ6A 3DWFA 4OL9A 5KJ6A 3NRCA 2PKQP 1M67A 3OIGA 3G49A 1KEUA 1MFPA 4BNTA 1PJTA 2R6JA 4MO2A 1HSZA 1ZFNA 4UUPA 4CV0A 2DFVA 4QO7A 4DBZA 3UH1A 4BNWA 1E7MA 4A7PA 3K8ZA 1W73A 4L9RA 1UH5A 4GSLA 2G17A 3INTA 2QRJA 1JKJA 4E5KA 1DJQA 1J4AA 1V3TA 3GGPA 1DB3A 4QTZA 3F6YA 4UUOA 3KVOA 4DYDA 2C7VA 2VT2A 2HK8A 2X4GA 4Z9XA 1U3VA 3DBLB 3WJ7A 1T1RA 1ADGA 3O9ZA 5ER6A 3I3OA 1HLPA 1GYQA 3OQBA 4HFMA 5EINA 3V8BA 3RUIA 2Q2VA 4EGFA 1DIBA 4DIBA 1N9GB 4Q39A 3FPCA 1N92A 1P1RA 4FR5A 1Z74A 4F45A 4MIYA 2B4RO 5JAZA 5CHEA 5C37A 3KRTA 3P2OA 4EUHA 1V35A 3FBTA 4J3FA 4MINA 2FSSA 3OH8A 5B4VA 4RF4A 5L9AA 4ND1A 3HSKA 5L4NA 3H9UA 4NDNE 1DLIA 2OFPA 3DR3A 4FC6A 1P1IA 3KZVA 5JE8A 4FFLA 2Z1MA 4R4JA 1RM3A 5CEFA 1P45A 1RYDA 1YQDA 3H2SA 1U8XX 1C0KA 1UXIA 1C0LA 1T4BA 5BSGA 3ZWWA 2NVUB 5CPFA 1H2HA 3FN4A 5B4UA 4HNHA 4LCJA 2QQ5A 3W8DA 8LDHA 2BLLA 3VTFA 1Q0QA 2G76A 3EY4A 4B7CA 4NH4A 4DLLA 1SPXA 1YDEA 2VOEA 3E6AA 4BS9A 1J0XO 1DLJA 4PZEA 2Q2QA 4DREA 4YTEA 2CSUA 3C7CB 3VH3A 4XRRA 4HV4A 3ADOA 4BKUA 5JLAA 3VPHA 4MJLA 4TRNA 3ORFA 4D41A 1RKXA 4GMGA 2Q50A 5JCJA 5IXYA 1E7YA 5L53A 2QRLA 5G0UA 3PQDA 2ZB4A 3EK2A 2D8AA 4IINA 2YHIA 1KERA 4J4TA 4JLWA 4R51A 2ZYGA 3ZH2A 1PJQA 1V3VA 4FIZA 4I5EA 5IFLA 1RM0A 4B3JA 2BH9A 2EJVA 5A4DA 4W6ZA 3C7DB 3JQGB 2EF1A 4G2NA 4CLDA 2QHXA 2ZYDA 4XDZA 1U8FO 4IBOA 4K9DA 3G79A 4IDFA 4FFPA 4UUMA 5TSDA 5CG2A 3QP9A 1ISJA 1NM5A 1YOVA 3B1FA 5DCWA 7MDHA 4LGVA 5JY1A 3MJVA 4M54A 3DHEA 3C1TA 5BSEA 4RQUA 1HSOA 1NPTO 1DIAA 3ZHXA 5IN5A 3WGIA 1UXHA 3MJEA 3GOHA 3HFGA 1LRKA 1PS0A 4L0QA 3KO8A 1B7GO 3IJRA 1BDBA 4J0FA 3H6KA 1PEDA 3B1JA 2DQ4A 1WP4A 2H1SA 4CMAA 1KEWA 4BMSA 3EW7A 4P38A 2WD7A 4ALKA 1AGNA 3H65A 1KIFA 3ZNNA 4GL4A 4FJ2A 3DMTC 3QWFA 4OQYA 5JC1A 5JY6A 1YRLA 4IQ8A 3FWZA 4CQMA 2NU9A 4Q3AA 2O3RA 4PZCA 2I76A 5DCYA 3Q9NA 1P0FA 2GASA 5L95A 1M75A 2G0TA 4MP6A 1V9LA 3SXPA 1GQYA 1VKNA 4E4YA 4JJGA 1B8UA 4BMNA 2GNAA 3E18A 4O63O 5KVQA 1H6BA 4W99A 3W8FA 1CDOA 3K31A 1ZSVA 3S55A 4CMEA 1A7KA 1YKFA 1ZXBA 4A10A 2I99A 1HF3A 2EGGA 1YQXA 1F17A 5ICSA 4YJHA 1YXMA 1EFKA 4FJ0A 3D5QA 5EIOA 3JQBA 1LU9A 3UVEA 1BXZA 1QR6A 2J3HA 1SNYA 4N18A 1KC3A 3I9NA 3FBGA 1YQGA 3GGOA 4DA9A 3TOXA 2O2YA 3K2EA 3A14A 3W4IA 4HNGA 3UHAA 1I2ZA 1HDZA 3CPSA 1NASA 1VL0A 2QW8A 1PS9A 4TRJA 1JVBA 4A26A 3DZIA 1DIGA 5G0WA 1ZK0A 2WTBA 2ZJ0A 3FD8A 4FGWA 2EKQA 3IS3A 2WDZA 4DC0A 2PFGA 1XU9A 4NK4A 3ROMA 1D1SA 2C59A 1TT7A 3F46A 2J6IA 3QVTA 4Q3NA 1ZEJA 1A71A 3GQVA 4F6CA 4R3WA 2VQ3A 5ILOA 3ADPA 4NQZA 4OIMA 4NBTA 4DQVA 5C5IA 3L6EA 4YAJA 4BGIA 1F8GA 4TSKA 3FR8A 4CM8B 2O3TA 2BFMA 4R9RA 2XAAA 5A5FA 4A5OA 5ITVA 3KOUA 3RKUA 3A28A 3C85A 1ZO8A 3OF2A 1Y8QA 4YB8A 3U4HA 5AXBA 3JTMA 3S2GA 3WQRA 1GD1O 4EUEA 4HFJA 3DZJA 5AYVA 4XGIA 4BIIA 1BXKA 2X0RA 2Y99A 1EK5A 5JO9A 1VJ1A 4K26A 2AEJA 1DJNA 1PGJA 2AE2A 3OMLA 1Z7BA 3QLJA 4Y6RA 5JDIC 3HWRA 3R6DA 1I24A 3KM0A 1XELA 2VUSA 4BNZA 3DTYA 4CMHA 1W0CA 2FSVA 2O3QA 5IF3A 3W6UA 4BNLA 3V1YA 5JSFA 3DQPA 3OA0A 1B15A 3B1KA 1YDWA 3L07A 3GZ4A 2ZCVA 3C1AA 1Z82A 4PLWA 5THKA 5LC1A 5CDSA 4P8RA 3RC9A 3DBHB 2VZ9A 2PK3A 3L9WA 3VC7A 3QVOA 2AQHA 1A7AA 1F0YA 5HRUA 4EEZA 2YDXA 3RUHA 3JD2A 4CQMD 4HWKA 5BR7A 5KWEA 3JQ8B 3VZQA 3OJ0A 3DZKA 1PR9A 3OETA 5EPOA 1DFGA 5FF9A 1PGNA 4E5PA 3AI3A 3HN2A 5G4KA 5JBIA 2G1UA 4FSHA 4GLOA 1XCBA 4BNUA 1HEUA 2I67A 2YFQA 3NX4A 4HFNA 4IDDA 3L0DA 3PQEA 4BNYA 2C20A 1E1NA 3ZWNA 3BTOA 3KYBA 2Z5LA 2RH4A 5I7EA 2O50A 2PD6A 1RWBA 2WWRA 1E7WA 4Z0HO 4FGSA 3JQFA 1YL7A 3MOGA 5GMOA 1T24A 1TLTA 2NM0A 3AOEC 1N1GA 2YW9A 3O03A 1X15A 5JDCA 1C1DA 1G0OA 4JK3A 2CDCA 3BTUA 1M76A 3GLQA 4BGEA 1G1AA 3ZV4A 5JXWA 3BMNB 1EQ2A 3KYDA 3P2YA 4PVCA 5COQA 4ZGWA 4LRSB 5JNLA 1C1XA 4JP3A 3G0OA 1NR7A 4CODB 4BKQA 4L4RA 4QQRA 3H5NA 1PZGA 3AJRA 1UXKA 3DDNA 3BZUA 2CUKA 2IDZA 2OP0A 1Y8RA 1FDTA 1Y1PA 4R3NA 3WB9A 3WWYA 4FS3A 4CM3A 5DF1A 3Q2IA 1NNUA 3TJRA 2J5QA 3PQFA 4B3IA 4EJ0A 1R0LA 1UZNA 1U2GA 3GG2A 3PYLA 5L40A 2DUUA 5HBRA 1MX3A 1A72A 3IIEA 4GX1A 4II3A 3DOCA 4WKGA 5DP1A 4BO9A 3GDOA 3A1NA 2O7QA 5EJ2A 1ULSA 4I9NA 2VRCA 3STHA 3D1LA 4YT8A 5JMPA 1EUDA 2NTJA 2R2GA 3KHUA 4ND4A 1AXEA 1E77A 4LVCA 2IZZA 3PWSA 4D3FA 4J9UE 2C07A 1JQBA 4GH5A 4CV2A 3GDGA 1Z7EA 2YYYA 1ISMA 1A27A 3K73O 4TVOA 4YVFA 2WYUA 4R68A 1CWUA 3U4CA 3EZLA 5JYEA 3UICA 3ANMA 3RFXA 2W2KA 3IQDB 3LVFO 4IDEA 5U9CA 4NBUA 2NU6A 5TS3A 3JQDA 5KNLA 1D1TA 4BB6A 1QYCA 2H9IA 2BRUA 4E0BA 4UVEA 3ZCXA 2X22A 5KJCA 2CD9A 4RQTA 4DPKA 1XG5A 1DHTA 3FNGA 2X0JA 1GZ6A 4XB1A 4PLZA 4WCFB 2PZMA 2W98A 4IDCA 1KEPA 1R15A 1I3KA 2HUNA 4B4WA 1ZMOA 3WXBA 4CMIB 2ZTMA 4KDFA 4A2CA 2Q1UA 4RF3A 3PTZA 5BNFA 1YBAA 2EJWA 5H81A 5U1PA 5MGBA 3PLNA 3BMQB 4J1SA 1T1SA 4R1UA 4XKJA 2I3GA 3F4BA 3IP1A 4PG8A 2JHFA 2UYYA 1Y5MA 3I4FA 1NVTA 1U7HA 2DU8A 4B79A 3U0BA 3R3JA 2C2YA 4CQLA 5I9NA 5DOZA 4PG7A 4W7HA 1HYEA 1H6CA 1I5RA 4JCOA 1DEHA 1HL3A 2RH8A 1O94A 1HETA 3P7MA 4D0RA 3VVCA 1JLLA 3ASVA 3I9LA 2BELA 3RFTA 1DRUA 2ZIZA 1ADCA 1HZZA 5DCUA 4B7XA 2VOJA 1V8BA 1IPEA 1PZEA 3WS7A 2HKIA 2ZTUA 3UN1A 1PL6A 3RC2A 1M6WA 4HY3A 1A4IA 3VAZA 2EIHA 2O3SA 3WICA 4AJEA 3NTQA 2JKVA 3NT5A 5I7VA 2UAGA 1O95A 2DTEA 3AM5A 4BO4A 2XXJA 2IODA 3CEAA 4XYBA 4CM7A 1ADFA 1VRWA 1DRVA 4PFJA 3FTPA 3K30A 4RF5A 5BT9A 3B70A 1O8CA 1QV6A 4RVSA 1D8AA 1HE4A 4GX0A 1I8TA 1N7GA 2B83A 1G6KA 4W4TA 2AQIA 1ZH8A 2P9GA 4YQYA 4CM4B 4YT4A 2ILTA 1GADO 4CV3A 2WM3A 2O23A 4DTIA 3ZWYA 4EI2A 4YR9A 4PLFA 4YRAA 3QW2A 3ZV6A 3E48A 4MIOA 4BO3A 4BV8A 2VRCD 4WECA 1PL7A 3H5AA 1QLHA 5A02A 3PIDA 1LC0A 3KXDA 4IXTA 1H6DA 1P1KA 1AHIA 1E7SA 6ADHA 3EGOA 3HADA 3JQ7B 3RIHA 5L51A 5IZCA 4KUEA 1YO6A 4GSKA 2Y0EA 3C3XA 3GG9A 4WK6A 3UAGA 3WYCA 4P22A 4D0SA 1X13A 2OBNA 3OM9A 1CERA 4OXYA 1W8DA 1Y6JA 1F12A 3RUEA 2GGSA 2A94A 5G0VA 1ZUD1 3E5RA 3KSUA 3ZNOA 2CDBA 2Y1EA 4D79A 1L1FA 1D3AA 4DMLA 5JC8A 5B12A 3KLPX 1Z73A 1ZNQO 4RVUA 1DSSG 4E2YA 3MWEB 4BUCA 1VLLA 4W9NA 4CLOB 2H5LA 3MJSA 3QRWA 1UXGA 2PKRA 1LDGA 2GLXA 3OJLA 5TT0A 1YJ8A 3WG9A 5EN4A 2AXQA 1LX6A 2PZKA 3U3XA 1VI2A 5A9TA 3DBLA 4BQPA 2JD0A 2ZTVA 2QX7A 2X58A 3NT2A 1E5QA 1LLQA 3NTOA 2HCTA 5DT9A 2VZ0A 5CDUA 3JD1A 2QIOA 3JQ9A 1K3TA 2Y1OA 3EMKA 1QG6A 4G81A 4LRTB 3TZCA 2SCUA 4H15A 5TJ9A 1N9GA 1TA4A 3GA0A 3R1IA 1HDGO 4M89A 4ZRNA 2H63A 2EW8A 3IUPA 3OIDA 1E3IA 1X7DA 3ZU5A 5I7FA 3AI1A 4GWGA 4JJFA 3ZHBA 5TQVA 3T4EA 2HMUA 3ONEA 4LSWA 3T7EA 1IB6A 1PQPA 4BNGA 4FCCA 3F1LA 4QSMA 2Z95A 3DAGA 4O6VA 2DTXA 5L45A 2J3JA 3SLGA 3TQHA 1ISIA 3CIFA 5L4SA 2VWGA 1EK6A 1PS8A 4II2A 4GX2A 3D4NA 4EBFA 4M8SA 2VZ8A 1HLDA 2EEZA 3ZV3A 1KYQA 4BQRA 2NVUA 3DBVO 4YYZA 1SO8A 4CJXA 3ZHZA 2Y93A 1LDEA 4GGPA 3VZPA 2FZWA 1DO8A 3BA1A 4H7PA 4N54A 3I83A 3UXYA 1IPFA 4BB5A 1DOHA 1N1EA 1X1EA 2UDPA 4BOYA 5JAMA 1IL0A 1QYDA 4AJIA 4R69A 1I3LA 1P33A 2A4KA 3B20A 1SB9A 3Q0EA 4FFRA 4D43A 5KVCA 3PK0A 4C7KA 3UF0A 4EITA 1ZCJA 3AUUA 2FR1A 3GEMA 1NFRA 4OSPA 2O48X 2FR8A 2YQ5A 2GZ2A 2P9CA 3H9JA 3MTGA 4HADA 4ZHSA 1NWHA 3KB6A 3PRJA 4N5LA 2CMDA 3FF4A 2PGDA 5BSFA 1LSUA 4CMCA 3WGGA 1ML3A 4AJ4A 2X6TA 1LA2A 2Y68A 3M1LA 1XLTA 3FCOA 4XQGA 4YA6A 3V2GA 4Y8VA 1NQAO 2DLDA 3JQGA 1JKFA 5F1KA 1O6ZA 3RC1A 2I9PA 2WE7A 4HFRA 1SOWA 1ZW1A 2EG9A 1VC2A 4RPHA 4ZJUA 1GR0A 2X5JO 2QG4A 1AHHA 2E6UX 2R00C 5EQFA 2PGJA 1C0PA 2OP1A 2EXXA 1U4SA 1F06A 2A35A 2VCYA 1RJWA 1CYDA 2DAPA 5AXAA 3RQSA 2BKAA 1PJ4A 3ABIA 3H7AA 2AHRA 4GKBA 3L4BC 4JP2A 1QXSA 2C5EA 4N5MA 5KCZA 4GLLA 1WPQA 3G1UA 3E9NA 2W8ZA 3L6DA 1WW8A 4R1SA 3ZU4A 1P74A 2HRZA 5CDGA 2NUAA 1EFLA 1E3LA 1SB8A 4Z9YA 2W90A 1WDLA 3DOJA 4GVXA 2AEMA 2BI8A 2H6EA 3RWBA 1LDNA 3HDYA 3W1VA 4K6CA 4E33A 1YJQA 1E3JA 2X0NA 4J1NA 3JV7A 3X2FA 4QFDA 3GVPA 1TEHA 1NP3A 1PQUA 2VHYA 3EAGA 4NFSA 4PZDA 1GUZA 1B26A 1ZSNA 1AE1A 3CINA 3WGTA 3VTZA 1QLJA 2EHDA 5KIAA 4E31A 2PH5A 1ENPA 3GNSA 4DMMA 1PJ3A 3KSDO 2V7PA 4YCAA 1E5LA 3Q11A 4J7UA 1XHLA 1PJ2A 3GGGA 1WLYA 3QIVA 2W2LA 1HKUA 5JW6A 3WBFA 1B2LA 4NBRA 1DFIA 3TSCA 5IZ4A 1GCOA 2CVZA 1GTMA 2RHCA 3ULKA 4D42A 3N74A 4Q9NA 4JBIA 5EESA 3S1LA 1H2BA 4B8WA 3EUWA 1UP7A 2HSDA 2X9VA 4ITUA 2HK9A 2Y1DA 4RJTA 4R5HA 5ER9A 1ZIDA 4XJSA 5COBA 3CH6A 4IZIA 1WVGA 1E6WA 1ZSYA 3WWZA 4D46A 3D4PA 3OP4A 4CLRB 2GUGA 3ZV5A 1FXSA 4JX8A 5KVSA 5ADHA 1HXHA 2ZK7A 1TB4A 4XD2A 2WEKA 2YV3A 1ZJYA 5G0SA 4RO0A 3T7CA 2J5RA 3U62A 2OHXA 3EZYA 4TZKA 3KEOA 4L76A 1ZK2A 1XWFA 1MXFA 5TC4A 3ROQA 3JYPA 3N58A 4CM8A 3JD0A 1JN0A 4AICA 4U8GA 3I6IA 2Q3EA 3H3FA 3BYZA 3GN1A 3HDQA 2NU7A 2P2SA 2LDXA 1E6EA 4Q3DA 3WGZA 4RLSA 5KJ1A 1OOEA 3P5SA 3D64A 4QX6A 4TRMA 4YEDA 4D45A 4UEJA 1PX0A 1GQQA 3TL2A 1Q7BA 3QWAA 2VHWA 1O0SA 5ITWA 1C3VA 5JCXA 3LT1A 1ONNA 1Q7CA 3SJUA 1J49A 1SC6A 3UW3A 4M49A 3D3WB 1U9JA 3VPXA 2Y67A 4OOEA 1P31A 1CETA 3CZMA 3JD3A 3WIEA 1SCUA 1MA0A 4RPKA 3CXRA 4ZQGA 2GYYA 3DBHA 3RCBA 2Q4EA 4KQXA 1OMOA 3OQ6A 4ZA2A 1PU2A 1QSGA 5K6AA 3JQ8A 2BFOA 3LDHA 2A9FA 1NTOA 3GHYA 5MDHA 1LDYA 1T25A 3EYWA 4ZQFA 1FDWA 4WPGA 4IDGA 3V1TC 4FFOA 4KDEA 4GAEA 5DZSA 3GMSA 3HE3A 4LW8A 3WDSA 3ZWVA 4D44A 3WGYA 8ADHA 1ISFA 1YB5A 2W2LD 4B8ZA 2AG5A 3PHLA 3C7AA 3IOYA 3WSWA 1I2CA 1RM4A 2TMDA 1P3DA 3PJGA 3R0IA 2EP7A 4NFYA 4P4LA 1TT5B 3I9MA 3DL2A 4J7CA 5JAQA 3CMCO 4KWHA 4WEOA 2JD1A 2X9GA 1VSUA 3F5QA 1C14A 1GQ2A 3JCZA 4IM7A 3GEDA 3IAHA 3ZI0A 3U09A 3HB5X 1YE3A 4FPXA 3EVNA 3F47A 5IDYA 4R1TA 5ILGA 3ZWPA 3H2ZA 3VVBA 3KV3O 3MTJA 3K6JA 3WGOA 2OGUA 3PHGA 4KTTE 4DGSA 3INGA 3BMNA 5L4LA 2I5PO 4ZU3A 5G4LA 5IAAA 3HDJA 5IN4A 3M6IA 3TDKA 3CUKA 4QT0A 3VKVA 3PJFA 1MV8A 3EVTA 3LF2A 4NFHA 1LLDA 1SOVA 4IXWA 4CM9A 3AW9A 4LN1A 3ZN2A 4IY1A 1BVRA 4NMHA 1YH3A 2C2XA 2C5AA 4CMEC 3RI3A 2DKNA 2GZ3A 2YDYA 1JU9A 1HRDA 1XU7A 4DPLA 3AM3A 4W7IA 3KETA 4HKTA 3VH2A 1B3RA 1LXCA 1R16A 3ASUA 2HK7A 3GVXA 3UKOA 4DLBA 3JQBC 3QV1A 2Y1GA 4TKMA 1YL5A 4NI5A 5KTKA 2X5OA 2C7GA 4PLTA 1PJCA 5TT1A 5DBGA 4B3HA 4BNNA 4TMFA 4BGVA 3PVZA 5BNIA 1PJLA 2JJYA 2C82A 3ANLA 4MVJI 3RSHA 2ZCUA 3GAZA 2O3JA 4DPMA 2NACA 4RDHA 4GI2A 1FMCA 2J8ZA 2J3IA 3PDUA 3WFJA 4RDIA 4KWIA 3BHIA 4I1IA 3LSYA 2BFPA 4MVJE 2ZQZA 2E82A 1D4FA 3TWOA 2NQTA 3VDQA 1HE2A 2FHSA 3EC7A 1HT0A 3PWZA 1HWYA 4KUGA 4BKOA 4GWKA 2AW5A 4U0JA 5CPBA 2C0CA 1UAYA 3PEFA 4A73A 1LQUA 4WCFA 3RKRA 3MJTA 4BO6A 4ESOA 3FR7A 1GV0A 4NJMB 4RVFA 1SBYA 1XGKA 1E7QA 1HTBA 1WZIA 4H16A 4EZBA 1NFQA 4H3VA 3IL2A 2NADA 4ALJA 2OORA 3GY0A 2F1KA 3D0OA 3ST7A 3LF1A 3G1TA 3L4SO 4BMVA 1KY4A 2EGHA 4NG5A 4CMIA 1JAYA 1WDKA 1TVEA 1UDBA 5HS4A 4ZN6A 3F9IA 1WMBA 3BTSA 2GR9A 3QE3A 4EJMA 2VUTA 1NR1A 1Q0LA 3AOEA 4NU6A 3BMQA 2AEFA 2G5CA 3OIFA 3DZGA 2IEBA 1TI7A 3SC6A 5HA5A 1RYEA 3U4DA 1MG0A 2C54A 1X7GA 4PG5A 1X14A 1M6HA 1VPDA 4FQ8A 3WQQA 4WEQA 1ONPA 1ONOA 3PYXA 1FK8A 1GCUA 3IMFA 3UCFA 5DNAA 4YRBA 2YJZA 5A9RA 5F1OA 3S8MA 5A5EA 2QYTA 4L8VA 1OFGA 4IQ0A 1FDVA 1O5IA 4NBWA 4UEOA 4J1TA 4AJOA 3OHSX 3ICPA 5H82A 4JQCA 3DZFA 1HE3A 4ZD6A 3PP8A 4UVGA 3I1JA 2WYWA 4OKIA 4WOKA 3QVXA 3RVDA 1IZ0A 1N5DA 4I08A 4J91A 5EL0A 1H9AA 1LDMA 3AU8A 1ORRA 3MJCA 3WGHA 4PCVA 1I3MA 3OSUA 3I9JA 3NDIA 3OEWA 4CM9D 4BKRA 1DIHA 4CUJA 4E12A 4F3YA 1MUUA 4J9VA 1V0JA 2B5WA 3SC4A 3D4OA 3I23A 3NEPX 2X8LA 1W6UA 5GZ1A 2FP4A 4CM4A 2ZB8A 2ZKLA 4EEXA 1U3TA 2B4TO 4XDYA 1EQUA 4R9SA 1M2WA 3JQFC 3WSVA 2DVMA 4FD3A 1O89A 1QRRA 1PGQA 5FEUA 1YS4A 3GUCA 4HXYA 4ZQEA 1IZ9A 5JDCC 3PFWO 2JFFA 1NPDA 1VM6A 1DIRA 3PJDA 3JQ7A 2IXAA 3RBZA 4U6SA 2RBEA 3OA2A 1EDZA 3OJFA 5GZ3A 1P1HA 1X0XA 2DPHA 2VHZA 1IE3A 4CMKA 2BHLA 3LZ6A 3E1KA 4E21A 2D4AA 3C1OA 3C24A 1YL6A 3GHHA 1BTOA 3K96A 4RVDA 5T8KA 1EVIA 1YBVA 1VE9A 1SEVA 3WOHA 4IIVA 5FYDA 4CLOA 2POQX 3X2EA 4FC7A 1KY5A 4MVJM 1H0KA 5B1YA 4KOAA 4FFMA 2PD4A 3RC7A 3ZWOA 1H6AA 2VT3A 4ND2A 4NZ9A 3GZNB 4RGBA 3D3EA 1R4MB 5DP2A 2Q1TA 5THQA 3SLKA 2AMFA 1JAXA 2P5YA 2DPGA 3UCXA 4PVDA 4PN3A 1LDBA 1WWKA 3DZHA 4BVAA 1EZ4A 4M1QA 1EUZA 5C7LO 4R41A 3ZWCA 3CSDA 3ETGA 4ZICA 4NIMA 2A92A 3GN2A 3BIOA 3BTVA 4HBGA 3DEYX 4OKNA 4L4XA 3D7LA 1KOLA 4D7AA 4BNKA 2P4QA 2C29D 3JQAB 4XIJA 2P4HX 4CM5A 5CEEA 1XSEA 1LUAA 3VKUA 3WMXA 5G0TA 4UAGA 1UXJA 4L74A 1NQTA 3UOGA 4OHUA 5CP8A 1A4UA 1Q2XA 2B69A 5TNXA 1AUPA 5ES3A 1JTVA 4IMRA 4MVJH 1YB4A 3TZQA 2JFHA 4CLXA 3HN7A 4ALLA 1OC2A 3NTRA 1LLUA 3ZGYA 1GYRA 3DBRB 5K9ZA 1BGVA 4LMRA 1SAYA 3RUDA 1I3NA 5B37A 4DUPA 3NV9A 3HJAA 1CJCA 4KMSA 4ZRMA 1XIVA 2EERA 3FHLA 3G17A 1LSOA 4MVJG 1XEAA 4YPOA 3QHAA 1ADBA 2UUOA 1ID1A 4XGKA 2Q46A 2IZ1A 3ZNQA 4HX5A 2DTDA 3LQFA 3JYQA 4CMBA 1M66A 1L7DA 3E8XA 4C7JA 3G3EA 4U0KA 3HFSA 2HRBA 2QZZA 3JQCA 4R5MA 4EDFA 4NBVA 4CR7A 2WD8A 1NX6A 3ZWBA 5C7IO 4E30A 4PLVA 4NPCA 2WE8A 1X7HA 3ENKA 1XKQA 4URFA 2D3TA 5CEJA 1F14A 1NAHA 4MOWA 4GVLA 4XJTA 3U9LA 1IOLA 1XR3A 2GRAA 3BMOB 3OEYA 1EMDA 1EVJA 1ULUA 1GUFA 2DT5A 4MDHA 2NU8A 3ETEA 4UEKA 3PI7A 5TIIA 5AXCA 5GY7A 3CZRA 5L7TA 3D5TA 1GZ3A 2WJPA 1U1IA 4GGOA 4XQCA 1PJSA 5GZ6A 2O7SA 3DAPA 3WYBA 4OGWA 1A5ZA 3NJ8A 5DBIA 4BNHA 3NKLA 1KETA 4XYMA 4Z3DA 5CG1A 2WSBA 4YRDA 4Z6KA 1MLDA 4XRGA 4OQZA 3DONA 4AJ1A 1ZBQA 3PXXA 1QYXA 4PG6A 4U6QA 5F3RA 3T4XA 3ETDA 3L6OO 1ZK1A 4S3MA 4PLYA 2NTNA 2VYNA 3I9KA 5IZCC 3JYNA 5L7WA 4UVIA 2I6TA 3FRJA 1V6AA 2J3KA 3ZU2A 3DHYA 3OECA 2FWMX 3DHNA 4FN4A 1GV1A 5F1PA 5T5QA 2Q49A 3Q2KA 5FFFA 2PWZA 2UV8A 4DRYA 4XWYA 1R37A 1KS9A 1MG5A 1CQIA 3HDHA 1UJMA 2X86A 3JSAA 4OMUA 3NDJA 4U5QA 4RVHA 1DHRA 1VSVA 4J2OA 4P4NA 4OXKA 2CF5A 4O0LA 4W9NC 4WOJA 1GFSA 2IEDA 5T6BA 3WTBA 3TFQA 3GPIA 1FDUA 1YGYA 2EW2A 2I65A 5A04A 1U2DA 4HUJA 5KVVA 2O3UA 3B6ZA 4YQZA 4BNMA 1P77A 4PG4A 1YVEI 3H5RA 3NAQA 3KBOA 1K6IA 1ENYA 1NHGA 4O5OA 3WYEA 1HDRA 3RU9A 4CPDA 3C8MA 4GBJA 3M2PA 4Q3EA 4E5MA 2Y0CA 3GAFA 2NSDA 1XQ1A 4WLEA 4CLRA 3U49A 3S2FA 3NDRA 2BFAA 4YJDA 4ZQBA 4E13A 3Q1LA 3QY9A 5DDIP 2YV2A 2JAPA 1ZK4A 1B14A 3QQPA 3ONDA 2Y05A 1I10A 3ICCA 1BDMA 2DBRA 4JXKA 2AQKA 1H5QA 3AUSA 4DIFA 1K5HA 1UUFA 1UP4A 3INRA 4WLVA 2PKQO 3PZBA 2JFGA 1S7CA 2B5VA 4W82A 3IP3A 4O59O 4AJPA 2GZ1A 1BHSA 3E5MA 4E32A 3O38A 4QXMA 1E92A 3GRPA 4UVDA 2GCGA 1P9LA 4DIOA 4I8XA 1CF2O 2VYVD 3O26A 1N7HA 4RPLA 2HJSA 4XR4A 4BV9A 5IJZA 5CFZA 2Z1NA 1UR5A 4XR9A 4F46A 5T57A 5I9LA 3TN7A 4OAQA 3PYMA 1OC4A 1BW9B 5CDYA 1NWCA 3GVHA 2V6GA 1NVGA 2NVBA 3O8QB 3D3WA 4YACA 3TZHA 3QVWA 1T4DA 1R4NB 3JQ6A 3FWNA 3FTNA 3HG7A 4YT5A 3TZ6A 2Q1SA 4WE3A 4YJGB 2JAHA 4ZQHA 1R66A 4JIGA 4I5GA 4ROSA 3OBBA 3PFFA 2P68A 1J6UA 4WNCA 1VL8A 1GZ4A 2VYND 2YZ7A 1GDHA 2HMTA 5BSHA 2IZ0A 4AJKA 1ZEMA 1I0ZA 2NTVA 4IS2A 3VDRA 1N8KA 5A06A 2IYPA 3WLFA 2GF2A 5KKCA 4XIYA 1XYGA 2X9NA 2AA3A 1DC5A 2QYSA 1Y81A 1JWBB 1VKOA 2GN8A 1RPNA 2GPTA 2OMEA 2VWPA 2ZB3A 3E03A 5TJHA 3UUWA 2Y1CA 1U28A 1T2EA 1VJ0A 2HMWA 2IYOA 4NNJA 1UDAA 3ZWMA 3PHJA 3RASA 4K6FA 1E1KA 5HS6A 4CV1A 1ZVMA 1E6UA 4YAKA 2FR0A 4GMFA 4BO2A 4YAGA 1DXYA 1TT5A 3E82A 2ZTLA 4PGFA 4J0EA 1I33A 1NPYA 4J6FA 1F8FA 3ONFA 3FNEA 3BMCB 2B4QA 3TF5A 3DFZA 2Y0DA 3Q9UA 1HYGA 3E9QA 1WDMA 1BXGB 3F1KA 3PGXA 3WJAA 4XYLA 1XA0A 3KYCB 4FFNA 3GUYA 2E49A 4Z0PA 4IJVA 3BHJA 3LT4A 2X5KO 5JMWA 1PIWA 2PNFA 4N7RA 4TWRA 1P1FA 4K28A 4OJNA 2FMUA 4B4VA 4IJKA 2Q2WA 4OM8A 2D59A 1PQWA 2PH3A 4PRKA 4FW8A 4YBZA 1ENOA 1DC3A 1AN9A 3GF4A 5I8ZA 5KJEA 4YJFB 2FRDA 3DB2A 3TL3A 2BMAA 2GD1O 3K2BA 2Y66A 4WLFA 4Q3CA 3TFOA 3M1AA 4WJZA 3RBXA 3NUGA 4CMJA 1LLCA 4XYGA 2O4CA 5A9SB 1EEHA 1JWAB 1QYWA 2Q45A 4IQGA 2ZATA 5DULA 2HQ1A 2YHUA 3F3SA 3LLSA 3M2TA 5FWNA 4KQWA 2BF7A 2V6FA 2GN4A 1U5CA 4Y6PA 1NFFA 4INAA 2VHXA 3OICA 5EQDA 3I4CA 1MP0A 1XQ6A 5COAA 1K6JA 1BWSA 1BVUA 1E1LA 4S1VA 3LLVA 4P4GA 3HB4X 3WBBA 3ZWAA 1E3WB 3VHRA 2XPCA 3KTDA 3OJOA 4IJWA 3DMTA 2XXBA 3WMWA 2RIRA 4XA8A 3OJEA 5TGDA 3ON5A 1E7RA 5LCXA 1DDOA 4YT2A 4CLHA 3LYLA 1NXQA 1P44A 1PJBA 3AOGA 1EUCA 1OAAA 4MVJF 3F5SA 1IHYA 4Z0TA 2FPGA 3IKVA 4JROA 3WX0A 4FJ1A 4MVJP 3EHEA 2CZCA 3V1UA 2QRKA 2QZ9A 4R01A 2CVQA 4AJNA 4Y9DA 3COSA 3SX2A 5IXSA 4L4SA 3LT2A 4IGFA 4LCEA 4NJMA 2X1HA 3PWKA 1OI7A 4GKVA 2V6MA 2VTEA 1LJ8A 5CAEA 4IS3A 1J5PA 1PR3A 4TKLA 3BHMA 5HTOA 2ZYAA 3K92A 3RFVA 5KJFA 1YONA 3CKYA 2HU2A 3W4KA 1K2WA 3ANNA 3K5PA 5ICMA 4IDAA 4WUVA 3GVCA 3LC2O 2IRWA 2B36A 1Z75A 4I5DA 3HUDA 1DAPA 1MC5A 1C0IA 1KVTA 4MKXA 4TQGA 4GQAA 2NLOA 4FDAA 5ENDA 4QEDA 4Z3KA 3RUCA 3CTMA 3QJ5A 1X0VA 2P5UA 1HDCA 3VPSA 4RZHA 4PLCA 1LRLA 5ENVA 1B8PA 1G0NA 3CE6A 3UCEA 4RL6A 1KVSA 3DC2A 4RORA 4YXFA 3Q3CA 2PLAA 4QECA 3IDSA 4NU5A 4RPGA 4RVGA 2BGLA 4DXHA 1KEVA 4C4OA 2VTDA 4XX0A 5DBFA 5K6AC 1LRJA 4CMGA 2PD3A 4QFCA 3ZWXA 2RCYA 4A27A 1I36A 4I9UA 4BNXA 1LBEA 4IDBA 4XB2A 4LK3A 1LC3A 3LC1O 3DZBA 1BRMA 3BAZA 9LDTA 3AWDA 4MPDA 1JKIA 3RJ5A 4D3DA 5JYDA 1SZJG 1YBMA 3A06A 5DOVA 3HZZA 5T64A 1W4ZA 3QA9A 2Q4BA 3PDJA 3TPCA 2IE0A 1VL6A 3HHPA 1Y7TA 5JDIA 4R54A 3WGQA 4J16A 4J4HA 5KKAA 2JCXA 5BQFA 1GU7A 3PZRA 5C3MA 3LT0A 2EWMA 1BG6A 5JCJD 1E0DA 3GK3A 3KSZO 3TRIA 5IDQA 1QKIA 3UGKA 2YHIB 4ALMA 1Y9AA 4CUKA 1NBOA 3VH1A 3ZW8A 1O9BA 1Q0HA 1ENZA 2VWQA 1B0AA 3DAFA 3MOIA 4XQ9A 3MJ4A 3SEFA 2WYVA 4WGGA 4DQXA 1CEQA 2Q1WA 3H9GA 3FSRA 2VUUA 4AJ2A 2HDHA 2CVOA 3PJEA 4WCDA 3GC6A 1GEEA 1R12A 4WASA 4MVJA 1CRWG 2HMVA 3K9QO 3RU7A 3WLEA 4N5NA 5B4TA 1QP8A 1B8VA 5A03A 1YOVB 5TLSA 1K6XA 1Z6ZA 4Y67A 4CL8A 2VN8A 3SBOA 2OXIA 3RUAA 3U5TA 5FI5A 1EVYA 1ZZEA 2PY6A 1GPDG 2VNAA 3AU9A 3NGLA 4ILKA 1PSDA 1TXGA 2DM6A 4DL9A 3I6QA 4JN6B 4NHEA 4NK5A 4GX5A 4ONEA 2B37A 3KLMX 3GFGA 3KUXA 3R3SA 4PIVA 1P1JA 4DYVA 2UVDA 3U4IA 4EUFA 2X23A 4RV9A 4ND5A 4D3SA 2JCVA 4AVYA 4B4UA 3GZNA 1SMKA 1R4MA 3DO5A 3GT0A 3I5MA 2OBYA 4JBGA 1GY8A 1UDCA 3RROA 2WD7B 3H8VA 4BO0A 1ZMTA 4AJLA 1MC4A 3SJ7A 1T2CA 4BGUA 2X0IA 1LI4A 4CQMB 4DC1A 5HM8A 5KOIA 3WIDA 3W8EA 2GDZA 4XYEA 2PZJA 1MB4A 5U4QA 4LSMA 4OXNA 4MIEA 3AUAA 3DTTA 3S2IA 1BMDA 4WNIA 3KEQA 5AOVA 3JQAA 1T2FA 3F4LA 3HNPA 1KBZA 3MCVA 3LU1A 3AI2A 4AFNA 4E6PA 2HLPA 5HWSA 1LNQA 1ARZA 1PGOA 1U7TA 4WCFC 4MKZA 2V65A 2V6BA 5G2OA 3AK4A 3GH3A 2DBQA 2P9EA 2CDAA 3IKTA 5EERA 5I7SA 4YJHB 5FI3A 4JNKA 3AFNA 1HZJA 2HMSA 3WFIA 4TROA 4WLUA 4NR0A 3WTCA 1GUYA 1U4OA 2AG8A 2E37A 2JCYA 3FNFA 3DBRA 3H3JA 4UVHA 1IHXA 4Z9FA 1U3UA 4PLPA 3HQ4O 3TNLA 1FJHA 4HP8A 3QVSA 3LC7O 3PPIA 5AQ1A 4WLOA 3NYWA 3FPLA 5T67A 4M87A 4BNFA 1WMAA 2CFCA 4J2HA 4EYEA 1ISGA 1X1TA 3TZKA 4XGNA 2FY8A 1EE9A 1IUKA 4BNJA 3W6ZA 4TZTA 4BO5A 4RLHA 1E3EA 3CMMA 1BSVA 3RAJA 1L7EA 4FOSA 5A3VA 1I2BA 1H94A 2D5AA 3DOOA 3I52A 1LTHR 4J49A 4K1LA 3NT4A 2GSDA 2YUTA 3ITKA 2B35A 4JJIA 1OZAA 4ND3A 1FDSA 4G65A 4IPTA 1HDYA 1GAEO 2J5KA 1XDWA 3VH4A 4AL4A 1HE5A 1CIVA 1DPGA 4JGBA 4DVJA 5A1TA 3ZHYA 4TRRA 1T2DA 5AXDA 2B0JA 3ENNA 1EBUA 4Q3BA 3BMOA 4Y6SA 1Y8QB 2I3AA 3AUTA 4X54A 3NGXA 2ZJ1A 4MVJD 2YQ4A 2BGKA 2P91A 4R16A 1JW9B 2DFDA 1A9ZA 2O2SA 5BNTA 2HJRA 1RM5A 1SEPA 5H83A 5JAIA 2G82A 5CDTA 2D2IA 1ZJZA 2NV6A 1IYZA 2FPPA 1B3BA 2EKLA 2Y1FA 3GEGA 1LEHA 2OL4A 4CM1A 3QWHA 4YAEA 2GN6A 5I8WA 1VJTA 4OO3A 4RF2A 4EW6A 2RHRA 4CUZA 1Z45A 6LDHA 2PTGA 2NWQA 4YDRA 1NAIA 2FPIA 7ADHA 4DBVO 1HDOA 1MFZA 3BXXA 3L9XA 3A4VA 1UAGA 3Q6IA 2ZQYA 3V2UA 3IC5A 3V2HA 2D5CA 3VZSA 3PGJA 4PLHA 4ZVVA 3GPDG 5K0ZA 2NNLD 4IZHA
chains in the Genus database with same CATH superfamily
1E20A 1EBFA 5FPTA 1XOIA 5FB3A 4H59A 621PA 1AV6A 3TNYA 1Q0UA 3C45A 1N2SA 5JWHA 2F00A 2PMKA 1M10A 1SC4A 2X5XA 3I04A 2TMGA 2YZNA 4FD2A 4E5YA 5G4KB 3Q7IA 2RB5A 2FZEA 4OJQA 1KIMA 1XMVA 3I9V6 4TQ9A 5JIBA 1XI2A 5JHGB 1SHZA 3E7DA 3Q7RA 1V39A 3H4VA 2FE4A 2GKSA 4NCBA 1LD3A 1G8FA 1NV9A 3OF3A 1QVRA 1BA2A 3PENA 4UBNA 2QTVA 1Y9EA 5I7WA 3VR4D 3Q3IA 4X1OA 3N87A 3TOVA 4DJDC 5HDBB 4RFLA 5FPHA 2BD0A 4ZVMA 2B1RA 1TJYA 5KYYB 4HRXA 4FB5A 1MIOB 4OYRA 3GMDA 1XHFA 4DDUA 1OX5A 1XRPA 2J9FB 5HJ7A 1L1QA 1Z33A 1II0A 2LDBA 4Y2GA 1HBJA 2ZSIA 2F43A 4GQBA 4G0VA 3VZRA 4WFJA 1Z12A 1KWKA 4LXQA 4DWVA 3AO0B 1A9XB 1P7VA 2L2QA 4GMHA 3VJRA 3HEMA 4CL2A 3EC1A 4LWPA 1C1XB 1JIXA 4A03A 1LI5A 4BHTA 1GTRA 2GQ0A 2HXGA 2AQ8A 4MRVA 4N4AA 5ALGA 3MMSA 3S6JA 3AIMA 2ZWOA 3SZLA 2MOKA 2CL7X 4HYQA 1JP7A 5HF5A 1KA9H 2IUYA 4KOEC 2AMVA 2Q27A 4LI3X 5JD3A 2HYDA 4EO9A 1DOZA 3DXFA 2IYRA 3M5PA 4L73A 4I9HA 2EV9A 5CDHA 2PJUA 2PE5A 1C7IA 1HZZC 1LPAB 1X2EA 2QS9A 2F4NA 4TVBA 1WAMA 2ZI9A 5JPIA 5F7JA 1ES9A 5L3ZA 3ZZMA 1KZ9A 3N9IA 2Q6VA 3HSYA 3QU9A 4NDAA 4FHGA 1VPTA 4XZ3A 4M0CA 2Y1LA 4FE7A 3TOCA 3IHLA 4ZMRA 3ZE8A 1AUVA 1TM5E 4YS6A 4B76A 4J4BA 3AP2A 1P3Y1 5E7IA 4NJEB 1EHYA 3UJDA 3D9QX 3FZEA 1GCIA 2ECFA 1JFFA 2PUVA 2DBZA 1I01A 2JANA 3EZ7A 3NUZA 3S2EA 1JEYA 3CLUD 4OHCA 1XP8A 3JVVA 3OX1A 4R1NA 3DG9A 4PC7A 2FMKA 3NBXX 1INLA 4BLSA 1G16A 2ZRDA 5G1OA 1EZZA 5TRTA 2RAFA 1VIYA 3QWIA 1VG1A 1YB1A 2COEA 2IIVA 3A9WA 1QYVA 3GVIA 1MOPA 3AEUA 5JARA 2OD7A 4HDKB 4LJ4A 2DWUA 2WHEA 2ZVDA 5A7HA 3MAGA 4BWYA 2AVNA 1JHXA 3LUDA 4NYJR 3ELYA 4CL3A 4L8YA 1DMSA 2ZW9A 3P20A 3P9NA 5HKLA 5DN6A 4TXMA 3JASB 2R84A 2E48A 1ISPA 3AF6A 1WNFA 4C6HA 2PZGA 4EEXA 2XF8A 4CW7A 3OF5A 3H2BA 3COPA 3FDJA 3I30X 5FNVF 4X63A 3T4UA 4F6LA 4L5YA 4O3MA 1KH1A 1LK7A 3CLRD 3B78A 1D2HA 3AUJB 3G9ZA 4IIXA 4N7JA 4YO7A 2Q0HA 3WISA 2YIDA 4JUDX 1C4OA 2ZIAA 3ZHVA 4QDUA 2QWXA 3OE4A 3OLZA 3EDMA 3ZEAA 4EJSC 4K2HA 4LBWA 5K3EA 1JS1X 1A2QA 2ZSBA 3WLKX 4H6XA 2AR9A 1KDPA 4DTCA 2IUFA 1OYVA 4FW9A 3JD4A 1C8BA 2ETVA 6NULA 4EMUA 1IY8A 4HHEA 1CR4A 3TD9A 2PR7A 4TMXA 4KUHA 4UOQA 1O9HA 5AW6A 4UXJA 4LYGA 4LF8B 2ACWA 3G8BA 3K1TA 4PTYA 3ZLVA 5FBHA 1TKAA 4F7DA 4C30A 4XFKA 1GKKA 1U7PA 4P35A 5EP2A 5F3DA 4A92A 1P39A 3BJEA 4MULA 1DDIA 3QSGA 1GEGA 1XTBA 1HE1C 4N40A 4EHNA 4F85A 1S4QA 4RLQA 1LQTA 4B7UA 1VGVA 3DOEA 2Q4TA 2VH5R 5IT5A 5H8WA 3C14C 1P2BA 3C4VA 2B21A 4TTQA 5CYGA 3O4RA 1P0CA 2Q99A 3AUFA 4UDOA 3FI0A 1Z0KA 5LBUA 1X38A 2PVPA 2BH2A 3WNQA 3P0IA 1UMCB 5FOSA 1CXZA 4KGDA 5C1IA 1A9RA 4UEQA 2WF8A 3WDLA 2GM9A 4XLZA 2WMDA 3DFUA 4OHOA 3T7AA 4AZTA 2PZLA 3U7JA 2WSYB 1DINA 4I19A 4E07A 2HHJA 5FULA 1ZMRA 2PUWA 2QRNA 2X5NA 1F1BA 5AW1A 4R2JA 3RO7A 3V8NA 3JVIA 4GPIB 2P41A 4YJFA 3LK7A 1WPGA 1PYGA 2G08A 5GJCA 1DADA 1ZXLA 4HLNA 2GBCA 4RYDA 3UFXA 2R00A 5B3KA 3QUCA 1G9TA 3AVYA 1I4EB 4G4IA 1K89A 4HJRA 4FWTA 1PWZA 1W2HA 4GKAA 4ZXFA 5ES4B 5FWAA 2OXTA 3OZEA 4MJXA 1RKBA 2VYQA 2CY0A 3UKDA 1ZNWA 4PSDA 5IG2A 3FE2A 1LSJA 3IQZA 1K7EB 4Y7DA 1RPAA 4XH9B 2JHCA 1QIGA 3H05A 3HPRA 2PRYA 1Q7GA 1W1IA 3MUEA 4U2CA 5FPPA 3UUFA 1XRLA 2BI7A 1MXHA 2EKPA 2GERA 3EWIA 1NV8A 1RHJA 1DXHA 3LWNA 3G2NA 2WKWA 4JKIA 1EAMA 4PLGA 4V2UA 5BWMA 1DAIA 2J87A 1XZJA 3CG0A 1H66A 3OJWA 4LVOA 4Y1GA 2RHOA 3WL3A 1HA3A 2LKCA 1QQ5A 3IALA 2CHQA 2FOIA 2CE2X 2D0IA 2I7DA 4BZZA 4YJ3F 4L1KA 4XQEA 1GUBA 2J67A 2EEPA 2TMKA 4KTVE 3PWTA 1NHWA 3UH0A 2Q3HA 2RI0A 5JWRA 2GM5A 4BO1A 1TZCA 1RXVA 4BFUA 5AI8A 4QPJC 3ZXXA 4QULA 2PO5A 3L1IA 1V7QA 4KV9A 1N2IA 4CM6A 1JA9A 3IUSA 3HM9A 1B16A 1GFWA 1F4PA 1HYHA 3BILA 3DSRA 5THXA 1Z26A 3PLRA 4KPFC 4E5VA 4EX7A 2B2NA 4EJ6A 3DZCA 2BM8A 4OL9A 5KJ6A 2CK3A 3VZCA 1C0EA 2I80A 1PQYA 2MR6A 3G49A 3H6HA 4IJMA 1KPGA 2JKYA 3BJIC 3E3AA 3IUJA 1ABEA 4I14A 3NS7A 4MO2A 5FNVA 5DN6D 2A9KA 7ABPA 4G3XA 1NI4A 2Q9AA 5GVSA 4ADSG 3O31A 3K8ZA 5ALEA 3UJ9A 1UH5A 3INTA 4XM2A 5JUWA 2QRJA 1TAHA 1KKMA 2P0YA 5CA1B 1V3TA 3D6HA 5H5JA 2XWSA 3LBAA 4O4JF 1XEFA 2C2OA 1I7LA 4NMXB 2GM4A 3KVOA 2X4GA 3I72A 3DBLB 3I39X 3WJ7A 2GYVA 4URWR 3O9ZA 3EXEB 3I3OA 3GJZA 2R1UA 2EYUA 2NZ2A 3D6JA 4RTLA 4LC0A 5J2UA 4B6JA 5IJ0B 2X77A 1DP4A 4U1RA 4ARBA 3NRJA 2WVJA 3B1ZA 4EGFA 1DIBA 3SE7A 2V7BA 2BGJA 3CX4A 4DIBA 3FPCA 5EJ5A 1P1RA 5JASA 4MIYA 1ESZA 4LHXA 1Z15A 2B4RO 2II6A 4MW7A 5K03A 5C37A 3EN0A 1Q2UA 3KRTA 4I9GA 4K9LA 1IQ0A 2CEKA 4S2EA 4WQMA 3AF5A 3FBTA 3ES9A 3LRTA 5HQJA 3LBHA 4RF4A 4ZOAA 2J3MA 4LG1A 3HSKA 4X1IA 5K3SA 2HWUA 3H9UA 4UE6A 1FQWA 2GXSA 4NDNE 2H17A 1DLIA 3T35A 4L28A 1P1IA 1RJ9B 1KDRA 4ECAA 2H92A 1OU0A 3ED5A 5BV0A 1P45A 2REQB 3K8QA 5CEFA 4P3OA 2G7MC 2ZIFA 2H11A 5MHTA 3G7NA 1NKTA 4MVYA 1V1JA 1AKVA 2L69A 3HBMA 3ZWWA 5IW8A 2CB9A 1H2HA 5KB3A 1RI1A 4JDUA 4HNHA 3Q8MA 4RGVA 4DUGA 2BLLA 5DMHA 3OU2A 4PQYA 4B35A 3UTDA 2EFHB 2JVIA 3ZJYA 4B7CA 1JFRA 4DLLA 3HXQA 2ZIXB 3RVKA 1PT9A 2ZPTX 2B8JA 2CNWA 4J07A 4PZEA 1UANA 2ZDQA 4CL0A 1U28C 4UMEA 3FF1A 3M6MD 3ESAA 4RWZA 1GPAA 1P4AA 3TS1A 2OV1A 2CSUA 4PX9A 1G3MA 4P3XA 3STYA 4XRRA 4DB2A 2G9RA 3IP7A 3A7DA 3W5AA 1M2HA 3KSMA 3VPHA 1FQJA 4O08A 4D41A 4NEHB 3VNBA 5HIKA 3R5XA 1FSGA 4CZ2A 1C7ZA 4Y1EA 3NJRA 3LY7A 1J1IA 3H83A 3GH1A 4RTSA 3URKA 1F6BA 2VNIA 3PUWA 5IM5A 5AW5A 1PFYA 2ZJ7A 5L53A 1NXSA 1B23P 4HDAA 3BWVA 4LMBA 1P9WA 1P61B 4ITVA 2D8AA 3GT3A 3COWA 4YJ3A 1ZA2A 3RVSA 3QMPA 2VO1A 4R51A 3Q2OA 3ZH2A 2XUHA 1P5JA 2VJYA 4NARA 2WB2A 4A15A 1SVOA 1X3SA 5DXJA 3GIDA 3UV3A 5SZKB 1WMEA 4ZV4A 2EJVA 3QJGA 2QDXA 2P62A 4Z4FA 2AXNA 2P9ZA 3NWJA 2AR0A 2QHXA 2W7TA 4M9XA 2ZYDA 1SXGA 1GGJA 2PWYA 2V7TA 3QVGB 3K3PA 4FGKA 4UUMA 2FK8A 4TXHA 5TSDA 3QP9A 4ZOEA 5CG2A 4UE2A 3NRBA 4PANA 3B1FA 2XRYA 2YXNA 7MDHA 1A04A 4LGVA 4C03A 1V5GA 4DDVA 1T9KA 3DHEA 4KN6A 4K9PA 5F3WB 2VXOA 2CK3D 4RQUA 5BSEA 1DIAA 3G5UA 3LVQE 4TTRA 4U6NA 1XPUA 1MABB 1XF1A 2R4QA 1UXHA 3RF7A 5A3RA 3R20A 1Q1ZA 1SCDA 4IYJA 1SBIA 4RACA 4L0QA 1R0WA 4O4JA 1J0CA 4YP0A 1Z18A 1ZAKA 2HREA 4HN2A 1N6IA 2V5VA 3RHSA 1GL6A 1Z0UA 4WJLA 4DV0B 1SUSA 1WP4A 3AEXA 3FGNA 4HLUA 3KWMA 4DG5A 1JQAA 1KEWA 2H31A 2A9QA 4QFBA 3UJPA 2W0MA 4EENA 3EW7A 1TU3A 2M1ZA 2PWPA 5BN5B 3TTTA 2W6PA 4H3HB 3IH5A 1P1CA 1NVWQ 1VDMA 4KG7A 3ZGZA 3R9XB 3G7SA 4OQYA 5AHKA 5A4IS 1C4KA 1ODIA 4P92A 2Q0XA 3M4NA 4UMFA 2FUG1 1C7EA 3FWZA 3WGMA 1PLJA 1L4GA 3A4MA 3DO8A 4PZCA 4EGCB 3Q9NA 3MIZA 2JI8A 1AN0A 2ZYHA 3JVDA 1M75A 1ZITA 1SD1A 2BMFA 2JI6A 3JZDA 1XZIA 4ZO9A 3WRWA 1V9LA 5HOQA 3W90A 1TZBA 4JBYA 2A1TR 1LY1A 4PX2A 4E4YA 3BD6A 2AFVA 2IVFA 3GWZA 3NO4A 2A1UB 2ZRBA 3E18A 4R2MA 1OT3A 5D00A 5KVQA 3TJZA 4QTYA 1SOUA 1CDOA 2QMYA 4ZEVA 1ZSVA 3M82A 3PDWA 1YKFA 1WV0A 4A10A 1KO4A 4KRXA 2ZCJA 2I99A 3T5GA 2QD4A 1PHRA 5ARBA 2G4CA 4YJHA 1YCGA 1OI4A 4JSRA 4MUIA 1JYFA 3ZY2A 2BJVA 1CEEA 3WKAA 2V7UA 1H2YA 3VNRA 2Z2KA 1W49A 4C1NA 3C74A 4UFOA 5E1OA 1BXZA 1QR6A 2PFKA 2IV7A 4DUGD 3L84A 1IG3A 4F9GA 4BY9E 3I9NA 1FNNA 1K68A 1O6FA 1UJ2A 3GGOA 5LQMA 4I50F 2J0UB 4DUYB 1IN4A 1LVUA 1K0FA 1H42A 2ID9A 2WFAA 1CSEE 3FTDA 2IYAA 4FDVA 2QA5A 1HDZA 2AIRA 3CEPB 2FSHA 1JR2A 1MO3A 2QW8A 1PS9A 1P3JA 2QJRA 4TRJA 4X7RA 4GR9A 4DWJA 2P2NA 2VNKA 3D7SA 5FO1A 1E94E 2BHTA 1DIGA 4WD3A 2DFKB 1Q84A 3NW9A 2ZJ0A 1Z6AA 2Q3LA 2RHTA 3FD8A 4RSHA 1Y4AE 1SXJC 3G2KA 3W3ZB 3IA7A 4TTJA 2QX4A 4LYDA 1AMOA 1JHOA 4GG1A 4D8XA 4DC0A 5HKAA 1ZD2P 3GLTA 1JR4A 3REGA 2PFGA 3LZDA 4L5BA 4NK4A 3STWA 1JT2A 3E4DA 3QVTA 2PQ0A 1UK9A 1F2TA 1W94A 1YKSA 2LPMA 3GP5A 4NQZA 4B8YA 4DE5A 3UT6A 4LFBB 1M0SA 1WHSB 4MDYA 3KU1A 3N05A 3N8KA 5JD6A 4PNHA 3E70C 1F38A 2EG5A 1U1CA 1XTJA 1DBPA 1G5IA 2PHZA 2XXAA 1MJGA 3H1GA 2GWRA 3KOUA 3RSZA 1JLSA 3NVKI 5AVWA 3C85A 2NU7B 2QVGA 1YFKA 2XYHA 4YB8A 4M1KA 2IQIA 4HH4A 1QCYA 1ZMXA 2HFJA 5ED4A 2AF4C 4BVJA 2EBUA 4EY3A 4HFJA 4DR7B 3QMVA 4UPDA 2WJ6A 1QGDA 2C9BA 1IK6A 3AHIA 3K2QA 1FSSA 5JO9A 1L8OA 1HDIA 2WILA 4IVNA 4K26A 1ZPDA 2JFUA 4WIAA 4WN3A 5B3AA 5KCMA 5KNDH 3MGAA 4DVGA 1MB2A 1KO7A 2OB2A 4J16C 4OHKA 1AY0A 3VNUA 3KKKA 2VUSA 4XI9A 3QPAA 4E94A 3OZ7A 1JZQA 3MLBA 4CMHA 3ADKA 3E9EA 3ISVA 1ZHOA 3H19A 2QNBA 4P0QB 5IX8A 3A1FA 3K09A 3V1YA 3DQPA 2QTMA 3NKFA 4A0HA 1XDDA 4MUXA 3GZ4A 1CF9A 2QLNA 1AV7A 1W5SA 2HF2A 2X7JA 4RHXA 2O05A 2I1LA 4DM4A 1Z82A 3WYDA 1RZUA 5THKA 5LOVB 3KVRA 5CDSA 3ZV4A 1NNLA 5JCOC 1U2PA 1KO1A 3CS3A 4Z99A 4YRKA 1KFEB 4I1OA 4TV8B 2YH2A 3VC7A 2OM6A 4MS1B 2AQHA 2WJIA 4I4LA 1A7AA 1F0YA 1GPYA 2IHTA 3RUHA 1YRBA 3JD2A 4UU0A 4MW0A 5JG7A 3AVVA 3DAYA 3OETA 2OAEA 5EPOA 1FL9A 1XVUA 2C78A 3IVXA 2VC2B 1NXVA 3H2HA 3PIRA 2DXIA 4GLOA 4P98A 5B7GA 4M1TA 2ORIA 2V54A 5BV2P 2YFQA 4HFNA 1TEXA 5FWXA 4HQFA 2GAOA 3L0DA 4Q7MB 4PS1A 3WA7A 2ZSAA 3HTXA 2WU1A 3LW7A 3PQEA 4FEYA 3H3XA 2WIBA 4PO9A 4I4NA 1K8XB 4RKEA 3BTOA 1BVYF 1CUZA 1MENA 3QNWA 1NIPA 2RH4A 5KPJA 2WWRA 5ICEA 2ILVA 5DBHX 4AX4A 1ZRSA 2ATVA 5AVZA 3JZAA 5K0JA 5EY5B 3JQFA 2WKRA 1EG7A 4F8YA 4LS3A 1ELOA 1GZUA 3A70A 3MOGA 4I50A 5GMOA 1U98A 1W6RA 2MSDB 4QA9A 3AOEC 2E1PA 1JHDA 2WFMA 3KOWA 3O03A 4MR9B 3A1DA 1X15A 2PVCA 4Q19A 5JDCA 3C3EA 1ZESA 2HOQA 1OFHA 4D5EA 3MC1A 4BGEA 3QEKA 3W3AH 1G1AA 1YS9A 1RJEA 4L27A 2XCLA 5COQA 1WRBA 4HZIA 1PCXA 4DDTA 1ZI9A 3MLAA 5H70A 1JX6A 1NR7A 6GPBA 2IIQA 4L4RA 2GN0A 3H5NA 1KZ4A 4ZAYA 3VTKA 4QELA 4LYFA 3WNZA 5JNSA 4Z3OA 4R8VA 1N32B 1P4JA 4ZGGA 2J4CA 2QU8A 1FDTA 1Y1PA 3WB9A 3D81A 3H4MA 1BQEA 3HCBA 1TE2A 3DT8A 2R2AA 3OEHD 4DSTA 4UAVA 2HWYA 3V8MA 1RWPA 1NNUA 3Q2IA 4MQUA 4B3IA 2QN6A 1AXRA 1M1YB 1ZXXA 2GA8A 4EJ0A 3FHJA 5IRCD 5HBRA 4F96A 1KAQA 3OZAA 1X80A 4GX1A 3A2KA 2WVGA 4MW9A 1I7PA 1ZUNA 1BQ4A 3DOCA 2VQDA 3GDOA 3NTLA 4MUGA 2O7QA 2Q41A 4IUDS 2C9CA 4JMLA 3HM2A 3LC0A 1NRXA 1G18A 5CT6A 1WABA 4YT8A 1EUDA 3HP4A 5H9VA 5HIMA 1BO6A 2NTJA 3KHUA 4MNTA 2BFDB 2GEUA 4LVCA 1V26A 4BMDA 3GBVA 4X91A 1IOZA 1DWPA 4LJKA 1UT8A 1DMRA 3GDHA 1L9XA 1P62B 2EWWA 1OZHA 4GH5A 4CV2A 3ASYA 1WEHA 1RADA 2XTMA 4JXXA 2J08A 3WNBA 1TECE 2QTBA 4RIIA 1LFDB 1DKOA 3KWFA 3C5HA 3TE6A 3UPDA 2V1XA 4CHTA 1V5IA 5DISB 1QRUA 2QBYA 3TEFA 4DFDA 5D3MA 5GTDA 3AHCA 3RJMA 3IUNA 5DV9A 1JU3A 3HH8A 3DWGA 1L5HB 5J63A 1N0IA 3ZWQA 1CJTC 5KJCA 2OZLA 4TYQA 3SKYA 1C8KA 1DHTA 4JWTA 3JQRA 4D3XA 3N76A 2X0JA 1A98A 3FFTA 1AHNA 2XUPA 3PUZA 3OLWA 2AZMA 3D4IA 4JOQA 4XB1A 3RFFA 4OCZA 1IN1A 4WCFB 4K9KA 5ELLA 2W98A 4IDCA 4K8RB 3K6SA 1W0JA 1Y8ZA 4A6EA 2ZAOA 3I2FA 2E21A 3JWGA 5AVRA 3I6BA 4MYTA 1KDZA 4IUCS 3B12A 2G6BA 1TYCA 5TMEA 1P4HA 3A6JA 2IYSA 4MQFB 3JATB 4ISCA 4KDFA 3NHZA 2PH1A 3WGJA 4U7FA 4TQUS 2DZDA 1X2BA 3DJYA 4LSZA 4Y1RB 5DLEA 3TO5A 4X90A 2EJWA 1E18A 2FK7A 2ZBUA 4JEUA 4JZKA 4MA4A 3WE7A 1A2BA 2IYZA 2PJZA 5C51B 4C7OB 3VKHA 5MGBA 3PLNA 4RVOA 5FOTA 2HLDA 2VFAA 3CIOA 1U9CA 1FDIA 5FLKA 3HJGA 4PNZA 3RYIB 2D1TA 1XU4A 2ORED 4DCNA 4ENTA 2ACEA 1YA6A 3BN3A 4IICA 4QHYA 1WCXA 2AFRA 2C2YA 4DA0A 3L02A 5I9NA 3DM5A 1Z6GA 1GZ7A 2Q9UA 3OUUA 2Y71A 5AKLA 3K70C 3QITA 1HYEA 1ZCFA 5EZSA 3FPGA 3HEBA 1QYRA 1DEHA 2RH8A 1GT6A 2QLJA 4M9UA 2GK6A 3MK31 1Y9JA 3ASVA 1R7RA 1BE8A 1QVAA 1DRUA 1V95A 2JLSA 2ZIZA 3I9LA 3LYUA 2AB0A 2GK4A 3BH6A 4MMZB 5CYPA 1ZCZA 4HB0A 4R2IA 5DCUA 2HKIA 3IT1A 4D02A 4RMIA 4EAQA 5J3JA 3RC2A 3FX2A 1M6WA 5FKJA 4HY3A 2F3QA 5HE8A 5LL6P 2AJBA 3CW8X 3R7LA 4AJEA 1J2EA 3ICWA 4EGAA 2QN3A 3B3AA 1AGRA 2ECOA 3NT5A 3T9FA 1OWNA 3T9AA 1O95A 3CLTD 2CL5A 4TM8A 3VR5H 1M33A 2IODA 3EGVA 1J39A 3J81A 1X7XA 2JLAA 1B43A 4MLCA 4MRRA 1NJ5A 4PFJA 3UANA 3ZTTA 5EXDA 2DEUA 4OI2A 1JR6A 1L3BA 1NF8A 5BT9A 3B70A 1O8CA 5D5HA 5DGDA 3ZYZA 3TSOA 2D00A 3KJHA 1KQFA 3LL4A 1FBTA 2I34A 1I8TA 5JYBA 3ADBA 4G5YA 1NI3A 3TVDA 4ARZB 4YQYA 4CM4B 4QU0A 4YT4A 2DHCA 4NV0A 2HIHA 4CV3A 4DTIA 1KYYA 2P9BA 4QG3A 1JSXA 3UQYS 2B4AA 1JR3A 3GL9A 3DVAA 4PLFA 1QNFA 3PQ6A 4MIOA 2C5BA 2TMYA 1CS0B 3P9KA 4AIIA 4BV8A 1D2MA 2XKBA 5AHRA 3LUHA 3D54D 5A02A 1EFAA 1YKGA 3V7FA 1VJ5A 3HJRA 1S2NA 3PIDA 1VCOA 1C4WA 4IXTA 1L5KA 3NHFA 5K0EA 1P0PA 2PL1A 1QX3A 2DF8A 2OCPA 3IDOA 4I1RA 4OPMA 3W78A 4HTFB 2IL1A 1OIWA 4V0KA 4NXNB 2GYWA 3UAGA 3L93A 4KIUA 3HYNA 1EJ2A 2WC1A 1NSYA 3IUEA 1F12A 2ZITA 1DEOA 3ZOKA 2GGSA 2IHNA 4F1WA 2AYYA 1SY7A 1WSWA 3KSUA 4X85A 1KF0A 3EEBA 3EYAA 2WMNB 3ZNOA 1IJBA 1FYXA 3N70A 4P3YA 4QQNA 4EY8A 3OLYA 2AOTB 4Q3LA 1TZJA 5E2IA 3IT2A 5B12A 4WNAA 3WNDA 3WWYA 4PHGA 2JBAA 1RCUA 1DSSG 3RJTA 3RIYA 3FDXA 4QPZA 4E2YA 3MWEB 4XQ0A 4C0KA 1GL9B 4CEHB 4CLOB 1DJPA 1KXJA 3GRUA 2ZU6A 5AJWA 5C3UA 1NW6A 2WWWA 1XZQA 1RAAA 2ZIWB 5ALJA 2H2GA 1Y9DA 3VBEA 3LP6A 4QUJA 4EZEA 1W0JD 4L4ZA 3PUHA 1N8TA 2AHOA 1E5QA 3VNSA 4PNPA 3UYLA 3P71T 3S2UA 2E4WA 3JD1A 4X1YB 4BLQA 1CY0A 3B8EA 2WT4A 3C3DA 2XITA 4BQIA 1AF7A 1QG6A 3R3UA 4FWIB 1FP1D 2SCUA 1K06A 5EYPA 1ZOOA 3O8NA 1N9GA 1T10A 2REBA 3LRPA 1HDGO 3S1AA 2QM8A 3F74A 4Z0NA 2EW8A 3HCWA 2GTHA 3DCJA 3OIDA 3GUZA 2HLDD 2Y76A 1ZW6A 5B1DA 4G86A 4L3WA 4QUBA 1HEIA 2P4UA 1HFWA 1RLOA 4JJFA 4ZDIA 5TQVA 1YSCA 1YZKA 2D62A 1KE2A 5JSZA 1U8CB 1VPVA 2BP7B 3DAGA 4O6VA 2UZ1B 2OO5C 2B3TA 2J3JA 4ZCQA 5LXTB 1ISIA 3F7OA 1WZ2A 2E4XA 3IESA 1G59A 3K9FC 1EK6A 4HNUA 4GX2A 3D4NA 5DNWA 1W4BA 1UMKA 4XWGA 4LOHA 4B4KA 1G7RA 2XB4A 4M8SA 4ND8B 4AYWA 2VZ8A 2EEZA 4JYPA 4GC9A 1ZONA 1G63A 4G1FA 2GPJA 3AT1A 4RESA 1Y0BA 5LPNA 5CMLA 4GGPA 5BOVA 3I8SA 2FZWA 4HRVA 1XV5A 4XJTA 3WADA 1Y7HA 5AJTA 5ALLA 3UXYA 2GCPA 4BB5A 1R27A 1JALA 1X1EA 2LRHA 2SBTA 1ND5A 3RK4A 5JAMA 4OQQA 2VK8A 1O95D 2QAGA 3E53A 1G4HA 4N3BA 4R1PA 1WP9A 3RS0A 5C35A 1XL0A 5LDDC 2NV2B 4NPHA 4ROTA 1VGRA 2H7XA 1K2VN 1U1DA 2GF0A 4PV7A 5KVCA 3K0SA 4Q7JB 4F2DA 1L7NA 3QJYA 1XLWA 2FR1A 4HNVA 2AWNA 3GEMA 4NZMA 5C8YF 4B3GA 5A6SA 3KJFA 5H02A 3QKTA 4LTMA 5D01A 2GZ2A 3H9JA 3P9QA 4IOMA 3FGPA 2Z5FA 4D2IA 3P96A 4UFPA 1JR3D 2A0YA 4FHZA 4Z86A 4MPRA 1U7DA 5BSFA 2PGDA 3NR2A 1TAGA 4G24A 1BCRB 4CMCA 2YKGA 4RTPA 2FN8A 2QE7D 1UDWA 1D0IA 1R88A 1YZVA 3M1LA 4XQGA 3FCEA 2WYIA 1EESA 1W9HA 4Y8VA 1DCTA 2QD2A 2AOXA 1Q57A 1K5PA 2I03A 2L17A 3KJEA 1JKFA 1OLOA 4MI9A 2X0EA 3RC1A 2NO0A 1SOWA 4ZJUA 1VC2A 2FPOA 1CZKA 1FU8A 1GR0A 4P2GA 4AMUA 4FHDA 2PUBA 1G3RA 2E6UX 3CCBA 5BQPA 3NI2A 4DLXA 1E96A 2VAMA 2EXXA 4KN9S 4N76A 1P0QA 2VT7A 3QHQA 1XEXA 5EHXA 5AXAA 1CYDA 2ATEA 2FAXA 4F5DA 3B9QA 4KLAA 2I2BA 3SFZA 1AMNA 2AHRA 1ODFA 2HA0A 4JP2A 4D92A 1UMBB 3FA2A 2F9FA 4JJ7A 2ZUTA 4DDMA 2ZP1A 4RY8A 1N5MA 4OMFG 1J07A 4G5QA 4KQKA 3DBOB 1J0DA 4PC6A 4R1SA 3REQA 1NQUA 1P74A 1G4UR 3GDWA 5LM3A 1F3OA 2NUAA 3OC6A 4E1VA 2PUEA 3EVFA 1E3LA 5TE9A 4Z9YA 2E3JA 4LE2A 3G9UA 2VJDA 2CNNA 3AONB 5HZGA 3FYDA 1WDLA 1HT2E 3DOJA 2AEMA 4W5HA 3O3MB 4YASA 2HTFA 1KTVA 1WSBA 4URYR 1O6CA 1X77A 2A0WA 3HDYA 3N0TA 3W1VA 3H1BA 4K6CA 5I7RA 1F5SA 4XUDA 1YJQA 2RGNC 2X0NA 4YRCA 8OHMA 2YWFA 2ERCA 2VTBA 3VGJA 1JPNA 1Q12A 2FV8A 2ZRKA 4TTTS 1GG5A 3X2FA 3ZE2B 3F6SA 4G84A 3RM3A 2O8FB 1NP3A 4MEJA 2VHYA 4PZDA 3VYUB 2R96A 1YRYE 1LBTA 3QLTA 4FT4A 4OI0A 2FWPA 3VTZA 3JPWA 3ZKAA 4BMXA 3OE5A 2EFYA 2RGEA 4D3ZA 3W5IA 4DMMA 2ZTHA 3ESXA 4C20A 4E31A 4AZ3B 3T61A 3IVCA 4ZZ1A 1CQIB 1OLXB 3TIFA 1E5LA 3QXGA 4ND6A 5F76A 4ZMSA 1EVKA 2PX3A 3GGGA 2W2LA 5IC5A 4PPNA 2R87A 4BDTA 5BR8B 1VE3A 4ZT2A 2PUCA 2W4MA 4WY5A 1DFIA 5IZ4A 1NMYA 4M22A 5F64A 3VO1A 4D6XA 3RRXA 4BPBA 2RHCA 3ULKA 1GPMA 1NP7A 3FCXA 4BRSA 2BFCB 3N74A 3VO8A 3T9CA 4LRXA 3VHQA 1FNBA 3EUWA 4GXRA 4ER6A 1XWIA 4GI5A 1Z8FA 3I01A 1GVNB 5LYJA 3MNFA 2Y9PB 4YRGA 3EPKA 3AUYA 5KHLB 5A4MS 2K4MA 5BPHA 2HK9A 1CJBA 1KK3A 4PAOA 3IT3A 5DW0A 1IH8A 4XJSA 2YUIA 1QU3A 4H35A 4UZFA 1MD9A 1WVGA 5DE3A 4AN1A 2C4HA 3ZDCA 1X8LA 1BGXT 4O2BB 3CH7A 3WKCA 3ROGA 1D5WA 1JQEA 2QR3A 5C8YA 1FXSA 4YMUA 1QO0A 2QRPA 5ADHA 1MMFB 1BMTA 5DHRA 5LKAA 4MPPA 1FJXA 2Z83A 4N0DA 3WLLA 2G83A 1ZP6A 2QLMA 4YI3A 3ENWA 2G1PA 3AYZB 2YV3A 1UMDA 3MD0A 1WDWB 3B2QA 3UZUA 2GBFA 2BR4A 1SUWA 2UKDA 1P80A 2GHTA 1D6NA 1MXFA 1XWFA 3C41J 3C3JA 1U2SA 5TC4A 3JYPA 1JJFA 3ROQA 2FQYA 2RGGA 5JZVA 5SY6A 1JN0A 1CB7A 3AWIA 3N7AA 4S1TA 3T5BA 3WK4A 2FRDC 6CHYA 3I6IA 1XL1A 1W36D 4NENA 4NE2A 1PNQA 3O83A 3ZJTA 2WQ6A 2P2SA 2PIAA 4G4SO 4F8JA 2LDXA 2XCIA 1SG9A 5FUQA 3USZA 4U7JA 2YYAA 4RLSA 5AW2A 1M7HA 3D64A 4QX6A 3WIUA 1NW9B 3L3BA 5KX5F 1AUXA 1NT2A 2C4MA 1XZDA 4D45A 2HA6A 4XJVA 2HGZA 2NNWB 1TMGE 5BSUA 5FTNA 1E2HA 4WINA 3W3AA 3B13B 1EHIA 1VJGA 3CZQA 4QTXA 1M7BA 1PFQA 1TM3E 4R9VA 4CDGA 1EGHA 3LT1A 4F2HA 5JH7F 4GZ5A 4MV4A 3SS8A 2H08A 5FJIA 5REQA 5JR3A 3GUVA 4M9ZA 5IJ9B 1GGVA 1NZFA 2Y67A 2E55A 3X1ZA 1I1QB 5JS7A 4GL2A 3PQ2A 3CZMA 3DWEX 1MOSA 4JP1A 1MA0A 4ZPJA 2UU9B 3K0CC 2WFLA 1A5SB 2XMBA 3IB3A 4QPPA 4ZQGA 5LP6F 2WICA 4JZYA 3JS5A 1CUHA 1YHNA 4PQFA 4EF6A 4KQXA 3OQ6A 3HNOA 2O06A 4XOIA 4MHTA 4RXUA 1PU2A 1FRNA 1ZU5A 3LUPA 3WRYA 4B33A 3KFLA 1VZ2A 2BFOA 3KTOA 2QX6A 3INYA 5L3SA 5UKDA 3EQ8A 1DKNA 1RMQA 2PGAA 2OECA 1VYVA 1RQXA 4KITB 2IOYA 5MDHA 3CVVA 1FFWA 3KV1A 1T25A 1IEVA 3EYWA 4AUNA 1FDWA 4WPGA 1CNEA 2HX1A 5GIPE 1J7KA 1VXOA 4FFOA 4CNBA 2R65A 2EC5A 4JLJA 4C78A 1Z5VA 4ENVA 1YB5A 4NFLA 2BBSA 2VPXA 2XGMA 3L49A 1E4VA 2W2LD 3BEDA 3M5DA 2C2BA 4MUKA 2YJ5A 3C7AA 3M6LA 3WSWA 3QV2A 5J5VA 2GFHA 2XDQB 3R0IA 2OQ2A 2FEWB 5AVSA 5K0BA 4J7CA 5JAQA 3CMCO 4RWEA 3ZDRA 2Z5GA 1PRYA 1NDHA 3WL8A 4PYNA 3JCZA 1V1RA 5BORA 3GEDA 3IAHA 1U02A 3BCUA 3U39A 3V4VB 1SXJE 1YE3A 3HWSA 3EVNA 4MX8A 1SKAA 3U09A 4BTEA 2K7FA 3PEUA 5ILGA 3ZWPA 3BK7A 4RJJA 1Z13A 2NUBA 5I4BA 4NCJA 3WGOA 1ECJA 2BCJQ 3EG9B 3E81A 1CFJA 2I5PO 2ERYA 3EULA 4AMGA 1EVEA 3O1LA 5HXAA 5KOYA 3DTVA 5GONB 4C29A 5IAAA 4J2TA 2WV7A 3LX8A 1DRKA 4Z4CA 1G8AA 4PRZA 1MV8A 4UD2A 1SJ9A 3U0VA 4NFHA 4I4TF 1OU4A 5AO9A 3FHCB 1NN5A 2CZQA 1Z4KA 1QO0D 3AESA 4QYIB 3UT5A 3ZN2A 4RTRA 3EF1A 1N2OA 3P0FA 3LBNA 1L7QA 3RI3A 1KNQA 1M1YE 3HA3A 1J1UA 4JI0B 1QJCA 1TCVA 2PGNA 2LCQA 2V3VA 3AZPA 3ER8A 4JJEA 3SN6A 4FZ3A 1JXMA 3LGAA 1LXCA 3Q1KA 4HKTA 5FEMA 3N0XA 3U17A 5CFRA 5JROA 2CCJA 2B34A 5CLGA 3WWPA 1DELA 1VJRA 1JEDA 3JQBC 2PMCA 1YTUA 4DLSA 4TKMA 1FQKA 2GNOA 2QD5A 2WVHA 4NI5A 4QOIA 4YO8A 4P34A 3TCXB 2O8DB 2YBDA 2R8YA 4NTZA 5FLYA 2HSWA 1MH1A 2C7GA 2R7MA 2WV9A 4GP6A 5B57C 4P81A 5KX5A 3FYUB 3AVUA 3GJTA 2VHEA 4HVAA 2OOKA 5FAXA 3VSBA 3G2LA 1XRJA 4WWHA 4TMFA 4DNPA 1IZYA 2FUG6 3HGMA 3ZW7A 4TSFA 1O3YA 3ANLA 1CNFA 3DYBA 5JH7A 3THXA 1O0BA 3AVOA 3Q88A 5CJ2A 5IBRA 1R50A 4F6RB 1LWOA 4AUMA 3W3AD 2DERA 4RDHA 5TQ0A 3E9CA 3ZK8A 2J3IA 3KZCA 5D6OA 1WETA 1X9GA 3PDUA 2BR3A 2VK2A 4KWIA 1PK8A 1QQTA 1V8FA 3OQIA 4QUAA 1ODSA 2BYTA 1PUIA 2ZYTX 4MV9A 1P7PA 4ZALA 5DI3A 1MX9A 4N9WA 4ZVTA 3VR5A 5LP6A 1YF3A 4PAGA 3LG2A 4GWKA 4RHCA 1SXQA 3Q5DA 5MFZA 4NLLA 4QBTA 1HG1A 1PEYA 2C0CA 4IH4A 1E0AA 2EF0A 2UUBB 4RVFA 3ZIUA 5ALPA 2ZUSA 1XGKA 1UINA 4E08A 4EZBA 5BSMA 2RK3A 4TS4A 4ALJA 4H27A 1H3NA 2HQOA 1UC5B 2O8CA 2F1KA 3D0OA 1A88A 3IFSA 1T4CB 1KY4A 2WIFA 2I4TA 3Q7SA 3ERCA 5KAPA 1WDKA 5JRZA 5HS4A 4ZN6A 5LNK6 2B9EA 4CKXA 2GR9A 1PR6A 4TXNA 4X97A 5KSOA 3O8OB 1GWNA 5TVKA 1QBGA 1SC1A 1Q0LA 4KH1A 3RHFA 2BCEA 3BMQA 5FJJA 4F71A 3HXTA 4LEIA 2FLWA 3L8CA 1TI7A 2DWOA 2RHGB 3G59A 3JYHA 4U3JB 5HA5A 3SC6A 3SP1A 4AD8A 2YZ2A 3U4DA 2AXEA 1CZHA 3QX9A 2ZWVA 4IZOA 5BMVB 1HT3A 2ODAA 4MV6A 1IRXA 5AMXA 2CSXA 1BU5A 4DNFA 3G2JA 3WQQA 2PS1A 2CLIB 4LNUB 3PYXA 1TU4A 4G63A 4Q0MA 3LQYA 4ENPA 4EKYA 1NY6A 2FNAA 1YZNA 4U63A 3FVRA 5A9RA 1NE2A 1WW3A 1TZKA 3ETJA 5IABA 4KPUA 1CJKC 1ND6A 3ZE9A 3U6BA 3DEJA 2BMWA 2HPVA 3AVQA 4HC4A 2YIVX 3PQ3A 4NBWA 3GJ0A 3CPEA 5LZ9A 4AJOA 4JQCA 3DZFA 4Q7EA 1HE3A 2HDOA 2O2XA 2VR1A 2ZOSA 5EKDA 3I1JA 3K8OE 2FJ0A 4I4TA 3U1TA 3DTVD 3UJ8A 1VKJA 2NVOA 3MXTA 4MYHA 3FCCA 1YMUA 3MLEA 2GD6A 2YW2A 3IPRA 3ML1A 2OPHA 5CBPB 3MT0A 1H9AA 1ORRA 3BQMB 2BDUA 2YMQA 5CU7A 1ZR4A 4PCVA 4CUJA 1FFXA 3OSUA 3OEWA 4IXNA 1JE0A 3MGKA 4BKRA 2CLLB 1SBCA 5D87A 3EIXA 3PBKA 4DQKA 3S8EA 4MTCA 1RXWA 2W6QA 4L3VA 5FUMA 1PNRA 2C2HA 3ZC3A 3L46A 4BFSA 2FSPA 3UHPA 3CW9A 1P7WA 2QMHA 5GZ1A 2Z2XA 4RK7A 3OFVA