4Q3NA

Crystal structure of mgs-m5, a lactate dehydrogenase enzyme from a medee basin deep-sea metagenome library
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
MRNSKVVVVGTGFVGMSYAYAMVNQGTVEELVLLDIDKRKAEGEAMDLNHGLAFGPRKMSIKAGDYKDCKDAGLVVITAGVNQKEGETRIHLLKRNAEIIKTVVKNIMSSGFNGILLVASNPVDVLAYVAWKESGLHHSRVIGSGTSLDTARLRYEISQYIHIDSRNVHAYILGEHGDSEFVCWSNANVGAKPIADVIDSMDEISFEDLEHIYLKVRDAAYEIISRKKATYYGIGMALVRITAAIFNNENRILPISVLNNGVYDCEDQVYIGLPAVLNKDGVHHIVKLKLNEKENSQLNNSANILRKNLDDMSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
molecule keywords MGS-M5
total genus 114
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4q3nA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4q3nA02
1G1AA 1SZJG 3GNSA 1GQ2A 1PS8A 3LT4A 1NFRA 3FNFA 4RQUA 4IXTA 4Z9XA 1HDZA 2J3KA 1LSUA 1HF3A 1RM3A 4D79A 3RFTA 1H2HA 4ZJUA 4RL6A 2JHFA 4YA6A 1CF2O 1UZNA 4UEKA 4YXFA 3I83A 4LSMA 3EMKA 3JQ9C 3GC6A 1ZMOA 1GCUA 4MKZA 4Q9NA 3WICA 3ITDA 3ZWWA 5ILGA 4DQUA 3EAGA 2BFAA 5JO9A 2NU8A 4J3FA 3DMTA 3SJ7A 5F3RA 3GNQA 1RPNA 3PK0A 4PN3A 1ZNQO 2O3QA 3ZH2A 4E2ZA 1OFGA 4PCVA 3QVXA 2P9GA 3HG7A 2IZ0A 3LC1O 2CY0A 2E37A 4AFNA 2PD6A 4ZICA 1GAEO 3ONEA 3VAZA 1E3WA 4HXYA 4QO8A 4ZA2A 3WG9A 2QZZA 3NJ4A 3NX4A 4WE3A 3RVDA 4MP8A 1F0YA 3FCOA 1EE9A 1PJTA 4GAEA 2Y05A 3ZV4A 4C7JA 5L40A 1HE4A 1AXGA 4YDRA 2OHXA 1K6JA 2AA3A 3VH1A 2B37A 3R3SA 1KY5A 4J6FA 4ZVVA 3AY3A 3C1AA 1ORRA 3I9JA 3PIDA 4W99A 1PS9A 3RD5A 4J9VA 4RDIA 4IBOA 1ISFA 3ZWPA 3U49A 3PWSA 4P38A 5MDHA 2W2LA 1H6AA 4OHUA 4XQ9A 4GMGA 4CLHA 5IF3A 4ND1A 1TT7A 1BXGA 2DU8A 3OJOA 1DLIA 1LQUA 4DGSA 3K6JA 1B16A 1PGNA 2H1SA 3JQDA 3WGYA 1BG6A 1DFGA 4P8RA 4BMVA 1VI2A 3ZWBA 2BF7A 1JKJA 1F17A 4OL9A 4YJFB 2RH8A 1Y8QA 4HNGA 1I01A 5A02A 1DJNA 3ZNNA 2WE8A 1DIRA 1CETA 3F5QA 3IC5A 4LK3A 1U4SA 4R5MA 3S2IA 2ZIZA 1XYGA 3JD2A 4IDGA 2HMWA 3DAPA 2QZ9A 4CODB 1G0NA 3GGOA 2X8LA 3IJPA 4BNIA 1XKQA 3GFGA 3Q2IA 3RU7A 1GU7A 4LISA 1YDWA 5KJEA 4NHEA 1JU9A 5ICSA 3SLGA 4O5OA 1GPDG 3R3JA 5CEJA 1WAMA 3G1TA 3RSHA 2IXAA 5A9RA 3JV7A 1OOEA 4NU5A 4XIYA 1NP3A 1I3MA 1ZK3A 1GUFA 1M76A 1YE3A 4WK6A 3INTA 1UXHA 3NYWA 3ZNQA 1ONOA 1X0VA 1PL8A 2EP7A 3AJRA 1EDZA 1CWUA 1PJCA 4BO2A 2ZQYA 3KRTA 3UCEA 2IYOA 3WTBA 3WR5A 1AHIA 3FPCA 3HB4X 3MJSA 1DFHA 4NK5A 3AUTA 2GRAA 3C7AA 2RHCA 1EDOA 3QWFA 2VYNA 5HBRA 1PWZA 3DOCA 1ZK4A 3OHSX 5ES3A 2HMTA 3LC2O 3HADA 2ZJ0A 1LDBA 4CLXA 4GPD1 1Q7CA 3JQCA 4N5NA 2BKAA 1IB6A 3CUKA 1MX3A 5IN5A 1SPXA 1QYVA 2C7GA 4H3VA 4EYEA 4AJLA 2V6MA 2HRBA 4YEDA 2ZTVA 1YDEA 2OORA 1YL6A 1UZMA 2HK7A 1H0KA 5DP2A 4R54A 1FF9A 3ENKA 1EVJA 1DPGA 1PL6A 2BGMA 4BHTA 3NRCA 4R3WA 4BKQA 2Q99A 1A7AA 3FNEA 1ZW1A 2EW8A 2PZMA 1UJMA 3LVFO 1I5RA 5I8ZA 1MXHA 3WQSB 4XKJA 4CLOB 4DYDA 3V1YA 5JAZA 4BNMA 3HDQA 3SX2A 1E6WA 4XR4A 2W2LD 2I5PO 5I7FA 1A72A 1X15A 2X5OA 3WFIA 4JGBA 1MXFA 2UVDA 3IP3A 2BGLA 3WJAA 2DUWA 2FR1A 4OXNA 3DHYA 1NQTA 3AY6A 5EPOA 1ZXLA 5KIAA 2HAEA 4J4HA 4EUHA 3JQFA 2E82A 2AQ8A 2OBNA 2FP4A 6ADHA 4QTZA 5JAIA 1WW8A 2J8ZA 2PR2A 2VUUA 1MG0A 3JD4A 2HMUA 2VCYA 4FGWA 3JYNA 4M86A 4LCJA 2VWQA 2VZ9A 1ADGA 3H3FA 4FOOA 3UF0A 1DC3A 1R4NA 1YBAA 4IIUA 4KWIA 4P22A 1N92A 2PWZA 3DR3A 3GEGA 4K9DA 4RZIA 4D3DA 1NQAO 2NADA 4BKRA 5CDGA 2P5YA 2ZCUA 3WB9A 1XG5A 4BO9A 2DPGA 3FWZA 4OH1A 2ZKLA 4RJTA 1ENYA 3KLMX 3BMNB 1GQYA 5DCWA 4CQLA 1QSGA 3GH3A 1K0UA 2ZYGA 4RF5A 3JQ6A 1PZGA 3FRJA 4IS2A 5IZCA 4UREA 4XD2A 3VDQA 1N1EA 1N8KA 1O5IA 3NGLA 1YRLA 3GRKA 5T67A 1R16A 3DZGA 1DXYA 4E30A 1Q0HA 4H15A 2CUKA 4GGOA 2GO1A 1TA4A 1JKIA 4TVOA 5U4QA 3MEQA 2DTDA 2P4HX 4CM8A 5FWNA 4JCOA 4CM5A 1E77A 2FHSA 4R16A 1NFQA 2JD2A 3INGA 3WX0A 3ONFA 1LLQA 3ZZNA 2EP5A 1PGPA 5A9SA 1YVEI 3M2TA 2VHZA 1IZ9A 3BHIA 1CQJA 4BNUA 3DBLB 5IDXA 1BVRA 2FSVA 4D43A 3NKLA 2BFMA 3QWAA 4LRTB 3N58A 3B1FA 3RCBA 4J91A 5EL0A 3U4DA 1HDCA 1Z6ZA 2VQ3A 1KVSA 1HTBA 5THKA 4NJOA 1N9GA 3OQBA 1I3LA 3EYWA 5TSDA 4E3ZA 2R2GA 4R69A 1YXMA 4GI2A 4Z0PA 1Y8RB 1LDMA 4PG4A 3QQPA 2NSDA 3HQ4O 2C29D 4IZIA 2VZ0A 4ZQEA 2OOSA 3I4FA 4B7XA 2BFPA 2Z1MA 5I9LA 4JQCA 4LVUA 1U2DA 9LDTA 4I08A 1LC0A 1WMAA 3KEQA 4UUMA 3TZCA 3V2UA 4BGIA 1GL3A 2ZCVA 3JTMA 3RROA 1BW9B 2AE1A 1NFFA 2GUGA 2XAAA 2J5KA 1DHTA 5TX7A 5FF9A 1GZ3A 1J6UA 3GT0A 5IXSA 4CQMD 4YJDA 4AICA 2GERA 2VOJA 1O94A 4PRKA 5CHEA 3F47A 3WWYA 3DZBA 1DAOA 1HL3A 3DBLA 2C0CA 3BA1A 3HDHA 4QFCA 5TNXA 1LLDA 4NI5A 4IZHA 3C1OA 1IL0A 1PZFA 4IY1A 3V2HA 3TL3A 1ISHA 2IEDA 1ZSYA 2P2SA 3P7MA 3GOHA 4W7IA 1DC4A 1E3IA 2H63A 1MA0A 4NZ9A 4MINA 3WS7A 2RHRA 3STHA 4CV3A 3DONA 3IKTA 1E92A 2G82A 1C1DB 2GZ2A 1EFKA 3FTPA 4HP8A 4Y6RA 2QYTA 3ADPA 3ANMA 1GCOA 1O89A 4UULA 3WXBA 3RBVA 3BMNA 1E3SA 1BDBA 3OH8A 4MVJF 3EHEA 1GYPA 5KNLA 4Y98A 4WGGA 1KVRA 1VL8A 2HUNA 3GMDA 3NT5A 3GMSA 4PLZA 2R6JA 4W9NC 1ZSVA 3MJTA 4RPLA 1ULUA 4PLVA 2BELA 3E9NA 4YT5A 4YT8A 1ZK2A 5CFZA 1X0XA 3HFGA 4E2WA 1P1HA 1I0ZA 2X1HA 3D7LA 4OAQA 2P91A 3RU9A 4HNHA 1T1RA 4BMNA 1KS9A 5BQFA 4PLFA 2Y0CA 3L0DA 1IOLA 4WLFA 3ADOA 4DQVA 5CDSA 3G49A 5EERA 3M1LA 3IP1A 2PLAA 2F00A 3BYZA 5U9CA 3JQEA 1DRWA 4NPCA 4AJ1A 2G0TA 4CMIA 1M6WA 2C54A 4IJWA 1QV7A 1I3KA 4IDFA 4M8SA 1ZJZA 3TRIA 2VZ8A 3LSYA 1ULSA 1QYDA 1UP6A 4ALMA 3TSCA 3ZW9A 3LDHA 1LDEA 4KMSA 1KC3A 4IUYA 1FK8A 1U1IA 3B70A 5TIIA 1X1TA 1BGVA 4B79A 3E48A 5B12A 2GR9A 5TT0A 3NT2A 4XYLA 1NBOA 4N5MA 3KSUA 1M67A 3CE6A 1QYCA 3HDJA 4TZTA 2FY8A 3CIFA 1HDXA 3F1LA 3L6DA 1ISGA 3HWRA 5DNAA 2O23A 5L7TA 4HUJA 4YT4A 5TT1A 2J5RA 4L0QA 2B0JA 4MJLA 2A4KA 3A1NA 2B4RO 3GUYA 4CV2A 3ZU2A 4FR5A 4A0SA 5C7OO 3OMLA 4DRYA 1C3VA 1T2CA 4J7CA 5EINA 3S55A 1UXGA 5JSFA 1UAGA 3MJCA 3A14A 3D4NA 1NVGA 1MP0A 1MV8A 3DBRB 3ICPA 1BW9A 1HWYA 2B4QA 4B4UA 5HM8A 3ROQA 2LDBA 3TZKA 4R3NA 1KVTA 4DUPA 3NV9A 3RC1A 3TWOA 3GY0A 2Y1EA 3D4OA 4HBGA 1BDMA 3WSWA 3BZUA 5CDUA 4IPTA 2HU2A 1V8BA 4L9RA 4ZQFA 4ESOA 5JFOA 3FF4A 2YQ4A 5LC1A 5HA5A 4B8WA 1PGOA 1LLCA 3ZW8A 3TN7A 1CJCA 1B8VA 2QX7A 5BSEA 4WASA 1IPEA 4FJ2A 1X14A 1NAHA 1U28A 3QVTA 2ZYAA 3DAFA 4LCEA 1H9BA 4J4BA 1C0KA 3FNGA 3AWDA 1P74A 3JD3A 4IMRA 4CLRB 1P1IA 2X9GA 3QWIA 4OO3A 1HE2A 5BR7A 1E7MA 3DFUA 4FGSA 4CR8A 3FSRA 4CL3A 3B20A 3C8MA 5TJHA 3JYPA 4PLTA 5K0ZA 4BO4A 4I9UA 1UH5A 3TQHA 1HDYA 1LI4A 3PVZA 1BWSA 2OMEA 4OM8A 1TT5A 3GA0A 4J1NA 4QT0A 2X6TA 2Q4EA 4YACA 2Y1OA 1D1TA 3MJEA 1IY8A 1Q0QA 1ENOA 4NK4A 2DQ4A 4L75A 2PH5A 3TFQA 1OI7A 4BVAA 5AXDA 2WDZA 3G17A 4ALLA 4TRMA 2JCXA 4AJKA 1NXQA 4CLEA 4GLLA 2NVWA 4CMGA 2B36A 1Y1PA 4K28A 1VJ1A 2PV7A 1E1LA 2I66A 3FPLA 1FMCA 2HJRA 2YUTA 3E5RA 1U3UA 1UDAA 4M1QA 3JQAA 1LDNA 4QFDA 1P9LA 4GKBA 1D7OA 3KSZO 3GZNA 1Q1NA 1MGOA 2HDHA 3R1IA 1VSVA 3U4IA 2D5AA 2VRCA 3D64A 4XX0A 2V6GA 4LN1A 4ALJA 1YOVB 2ET6A 5AQ1A 5BSFA 2X0IA 2H9IA 4DREA 2YFQA 4KDFA 2VWGA 3UHAA 4GBJA 2LDXA 3WNVA 4DLLA 4BKOA 2CDCA 4YWJA 4IDCA 3GR6A 4CMHA 3DEYX 1N5DA 1EQ2A 2AW5A 2NWQA 3LT1A 1YJ8A 1TEHA 2Q1SA 5CG1A 2PKQP 2I3AA 1YO6A 3PYLA 1PJBA 3WYCA 4XDYA 1VLLA 1GZ6A 2GF2A 2YHUA 4FSHA 5JDCC 1E6UA 5TLSA 3MWDB 1LSSA 1U5CA 2Y68A 1ID1A 1PR9A 1E7YA 2Q46A 3MOIA 4NBTA 4EUEA 4K26A 1HYGA 1DIAA 3CKYA 3QWHA 1GEEA 1P1KA 4Q3NA 4RVSA 3LC7O 1AE1A 3ZHYA 1E1MA 3I1JA 3WGIA 3U9LA 4KP7A 1PJLA 2NU6A 2VN8A 2GDZA 1T2AA 1KYQA 1ISMA 1B3BA 1E3EA 3RASA 2Z95A 1RM0A 5KTKA 5T64A 1AN9A 1U3WA 3S2EA 3P2OA 5F5NA 2RAFA 3GEMA 4J1QA 4MVJG 1HDGO 2AEMA 1TXGA 2IE0A 2Q45A 3R6DA 1NAIA 4R9RA 3OJEA 1QG6A 4CQMA 4B3JA 4Z3KA 2D8AA 1N7HA 1RWBA 2RIRA 4FPXA 3N7UA 1W8DA 3UN1A 4RO0A 4JBGA 2G1UA 5KOIA 2ZB3A 3TFOA 1U4OA 3PXXA 5IN4A 2ZQZA 4ROSA 1EBFA 4TMFA 1JAXA 4I5EA 1E0DA 1EMDA 3KUXA 4R1UA 1I32A 2VUSA 3AOEC 1LSJA 3ICCA 1R0LA 1ZH8A 2I76A 1P1RA 1NX6A 3PHGA 1F14A 1KVQA 3NGXA 1T25A 3UXYA 2C59A 4MPDA 2E49A 1FDUA 1NWHA 2FSSA 4BUCA 3QJ5A 3JQ7B 1LDYA 3WGTA 3DZJA 1VJTA 4YTEA 1YB1A 3RC7A 2B69A 4AJEA 3QRWA 5KJFA 1IZ0A 5B37A 4OSOA 4JP2A 3VZPA 1E7SA 2P5UA 3GZ4A 1JDJA 3PHLA 4C7KA 5CEFA 1A5ZA 2XOXA 3UOGA 4D42A 1XDWA 1ZXBA 3CMMA 4WLEA 4BNZA 4CV1A 4YB8A 1UP4A 3HN2A 3O9ZA 1GY8A 1W73A 1TVEA 3AI1A 3M2PA 4ZRMA 2V7PA 4CMEA 4NFSA 2HMSA 4J2OA 1B3RA 4W4TA 5HRUA 5ER6A 1ADBA 3K5PA 2FN7A 4IQ0A 5C5IA 1B14A 1KEPA 1SOVA 2BD0A 3PQFA 5EQFA 5JW6A 3E82A 4IMPA 4ND4A 4BO1A 4AVYA 2P68A 4EDFA 1YB4A 3R0IA 4I5GA 3Q6IA 1VPDA 1U2GA 4PLCA 1U7TA 5U1PA 3K96A 2FZEA 4PG5A 4E5NA 1GTMA 4NQZA 5FI5A 2OBYA 3K92A 5JMWA 4UVIA 1PWXA 2IZZA 4YJGA 5KVCA 1ZFNA 2OO5A 1QLJA 4XGIA 4BO5A 3L4BC 3DDNA 2BRUA 3CEAA 4BGUA 4D41A 3BMOA 4OXKA 1V3VA 3DBRA 3M1AA 1M66A 1N2SA 4R9SA 4G81A 1HE5A 1Z73A 4YAGA 1QLHA 2RH4A 3GHHA 2PA3A 2C5AA 1XQ6A 5DBFA 5GY7A 3KXDA 4R1NA 3UKOA 1KERA 2DFVA 3IAHA 3PJEA 1EE2A 1QRRA 4R5HA 1I2BA 1Y9EA 1AUPA 1T2FA 2PY6A 4BO0A 3WMWA 4WLVA 3IUPA 3H9EO 3ZNPA 3OA2A 5TF4A 5C37A 3LT0A 4DTIA 1P31A 2O3RA 3DL2A 2AEJA 1GDHA 4R1SA 1JW9B 2VTEA 4WEQA 3WGQA 4RPKA 1E6EA 1E3LA 1VJ0A 1PQPA 4J49A 1BXZA 9LDBA 4FC7A 5A3VA 4MVJM 1I30A 3C85A 3OA0A 4ILKA 3RC2A 3WOHA 5JYEA 4JNKA 1I2ZA 1C1XA 3DHEA 4CM4A 1Z75A 4DLAA 1CIVA 2HLPA 4MDHA 3RWBA 3W6ZA 4JP3A 3HN7A 1V3UA 5KWEA 4JN6B 3E9QA 3DTYA 1QP8A 3L07A 2AEFA 1WDMA 1XWFA 4BNTA 1L7EA 5C7LO 2CDAA 3OIGA 2AQIA 4BNKA 2OZPA 1P44A 3SEFA 4U8GA 1BRMA 3DBVO 1VM6A 1ZSNA 4EZBA 3S2GA 3HUDA 3BTOA 3LF2A 2Q2QA 1CERA 3LQFA 1LJ8A 2C2XA 2X5JO 1DSSG 4GSKA 1FDWA 5C3MA 1J4AA 5H81A 5G4LA 2Y1CA 2Z5LA 3O03A 3WGGA 1KOLA 2OL4A 1HETA 2JFGA 4KOAA 2B5WA 4YJFA 1QMGA 1ZZEA 3PHIA 2X0JA 4IQ8A 4Q39A 4CPDA 4II3A 5ITWA 3N74A 3QWBA 4FDAA 1XU7A 2FR0A 4AJPA 4ZGWA 1ZCJA 2IZ1A 3VH2A 2NNLD 1GV0A 1SOWA 4W82A 3ZWAA 4ALKA 4BNJA 2VYND 5FYDA 4F6LA 3O8QB 4DBVO 2EJWA 1O9BA 1PX0A 4OXYA 4GX1A 1U8FO 4PLGA 1DC6A 1XLTA 5KKCA 3IL2A 1R0SA 3OEYA 2Y66A 3BMQB 1MFPA 5JCJD 3IDSA 5AXAA 4NMHA 2I65A 1EVZA 4CM1A 3NT4A 4BKPA 1YBMA 2DKNA 3BIOA 3HSKA 5JMPA 5IDQA 1HDOA 3OIFA 1K89A 4EJ6A 1HXHA 1VKOA 1EK6A 3E03A 4PZCA 4AL4A 4L8VA 2J3JA 2X0RA 5COAA 5JCJA 3C3XA 4WNIA 2WSBA 4B3HA 2JFHA 4NBRA 2QYSA 1Y81A 3A06A 4Y6PA 5EIOA 3MZ0A 3RJ9A 1DDOA 3L9WA 4XRRA 4YJHA 4B3IA 4K6FA 3QSGA 4XYMA 4BNHA 1UXKA 3K30A 3H65A 1LEHA 4PRLA 3AOEA 2F1KA 3D1LA 2NUAA 4RZHA 3MWEB 1GZ4A 3DZIA 5JC8A 3RAJA 4FFRA 1SEVA 3ZN2A 1NWCA 5L4SA 4K1LA 1GR0A 4YYZA 4QX6A 2PGDA 4OOFA 4TRRA 5G0WA 4UVDA 4O6VA 1J0XO 4UVEA 1SO8A 3RJ5A 1GPJA 1E7QA 5L4NA 1NM5A 4PGFA 4JBHA 1XR3A 4RF3A 3PHHA 5T5QA 2YDXA 4WCFA 4CM7A 4PLWA 1BSVA 2SCUA 5IDWA 1DOHA 5BSHA 3PJDA 3KHUA 3NDJA 4U7WA 3I5MA 5CAEA 1PGQA 1HRDA 4WUVA 5DCUA 3BHMA 2EWMA 4FIZA 2BH9A 1T2EA 4FS3A 4CM3A 2X4GA 1DO8A 1Y9AA 4URFA 2DM6A 1MC5A 3Q3CA 3S1LA 3ROKA 3HDYA 1G6KA 1EFLA 1WPQA 3GG9A 4TROA 3ZNOA 1T1SA 3VKUA 3KM0A 2BFOA 3HB5X 1KVUA 1U8XX 4IGEA 2YV1A 4HFJA 3ST7A 5IXYA 3VPXA 1D1SA 2JCYA 2TMGA 2FWMX 5CPBA 1KY4A 3U62A 4MP3A 3ANLA 4N18A 4UVHA 1EZ4A 2OP0A 5ER9A 5AVOA 4BO8A 3EY4A 3VOSA 5BNIA 3I4CA 2O50A 1HYHA 4U0JA 1PIWA 1W6UA 3I9NA 1N7GA 4OQYA 2NTVA 4BV9A 1DBVO 3ZWVA 4ZQBA 4CUKA 1IUKA 3ITKA 3KVOA 3WBBA 3ZHXA 4I8XA 3VHRA 4G65A 4MOWA 1UUFA 4BO7A 1LUAA 4M55A 4XCVA 2GZ1A 3WYBA 3JD1A 3PI7A 4BNXA 2GN8A 3BMCB 3PJGA 4XEHA 3VPFA 3KTDA 1EQUA 3LYLA 4PLPA 5CEEA 4XQEA 5DF1A 4BQRA 3C24A 2YV3A 3QLJA 5EESA 1LX6A 1LLUA 3K2EA 1HEUA 2VOEA 2WMDA 3UVEA 3E18A 5ICMA 1JWBB 4BNVA 1HSZA 1IHXA 5I9NA 4INAA 2OXIA 4EEXA 4YT2A 1P3DA 3WBFA 3DOJA 5DT9A 3F4BA 2WJPA 3I9LA 3H9GA 1ENZA 3RUCA 2X22A 2IDZA 2NU7A 4R01A 1CQIA 4UUOA 3WYEA 2Y0DA 1DAPA 5JXWA 3OBBA 3GVIA 5AXCA 1T2DA 3SJUA 4Q3CA 2IXBA 4CM9D 1VSUA 4UEOA 3OJLA 5F21A 5AOVA 4DMMA 3PGXA 2Q4BA 1YGYA 4E13A 3G0OA 2H5LA 4M87A 3D4PA 2ZJ1A 4GSLA 3LU1A 2I3GA 2JHGA 5A05A 2W8ZA 5GZ6A 3WGZA 4RVHA 2CVQA 4XB2A 3GGGA 3I9MA 1QR6A 2GLXA 5F5LA 2FPIA 2AG8A 3ULKA 4XDZA 4ALNA 2HRZA 4PLHA 4I5DA 5KVQA 3LT2A 3W6UA 3PJFA 4EW6A 1HLDA 2W90A 3FR8A 1W0CA 4E5MA 4B7CA 2C82A 4RCVA 2A94A 3LZ6A 2YFHA 4J16A 4XB1A 5ENDA 1ONPA 2GYYA 1NPDA 2OP1A 5MGBA 1XA0A 3DMYA 2O2SA 3K9QO 4WCFB 2I9PA 4RPJA 2CVZA 3NJ8A 2GGSA 1TT5B 4NG5A 4JXKA 3GDFA 5BNFA 3RUDA 4WCFC 4HFMA 4WLOA 1R12A 2EIHA 3DZFA 1SBYA 3H2SA 3EW7A 1XQ1A 2NACA 1A4IA 2YDYA 3L6OO 4RLHA 1RJWA 4RPHA 4KUEA 4FD3A 3ETDA 4J43A 3GVXA 3VZSA 1I24A 3D3WA 4FJ1A 3GNTA 4D0RA 3W8FA 2FR8A 1VE9A 3F6YA 3I9OA 1E7WA 1MC4A 1UDCA 3MJVA 7MDHA 2R00C 3OECA 3GQVA 4ZD6A 4CJXA 3RKRA 3RC9A 3PPIA 5COBA 1HT0A 3TF5A 1C0LA 2X86A 2NM0A 1K2WA 3H5AA 3NAQA 3GHYA 4O59O 1H6CA 4CMAA 4G2NA 3MTGA 2EGGA 1EUDA 2GN9A 2P9CA 3FHLA 3IMFA 4FBGA 1E3JA 2UV8A 5AYVA 3RKUA 3UH1A 5CDYA 2QHXA 5KJCA 4HADA 3T4EA 3WQRA 3UCFA 3IS3A 4NNJA 1MUUA 4E0BA 4Y8VA 3ZGYA 2FOIA 2ZB8A 3W4KA 2D1YA 4ID9A 5GMOA 4S1VA 2ZTLA 5IZ4A 2YV2A 3CH6A 4F46A 3H7AA 3ZCXA 2CF6A 4CMEC 1CEQA 3W8EA 3Q9UA 1KC1A 2EKPA 3L6EA 4I5FA 2FMUA 2VWPA 1XEAA 4HY3A 4RLSA 3D3EA 1A71A 3JQ9A 4ZRNA 1B15A 4EJ0A 4RPGA 3U4HA 4E2YA 1B7GO 4BNNA 4RF4A 1NTOA 1BTOA 1VKNA 5L7WA 5A03A 3DZHA 2PK3A 5DBIA 3I6QA 3WIEA 1PJ3A 4TZKA 1T24A 4BNGA 2CVOA 3RUEA 3KETA 3FNHA 3TOXA 3PQEA 1SB9A 1R4NB 1K6IA 2GNAA 4ALIA 1E1KA 2X23A 3JQAD 1UXJA 3AM5A 5BT9A 2XXJA 4GGPA 4KUHA 2PKQO 2CNBA 4XZ3A 3FI9A 4UVGA 4XGNA 5KJ6A 2VUTA 2NVBA 4UUNA 3I52A 2NVUB 5IJZA 1I33A 3H9UA 1F12A 4PG6A 3GG2A 4F6CA 3ASUA 4D46A 3H6KA 4FFPA 3UAGA 1R37A 1LNQA 1P33A 3VH3A 3KSDO 3VTZA 3JQGA 3L9XA 2CSUA 5JE8A 4A10A 1YS4A 3AI2A 5K9ZA 1YBVA 2EV9A 3WWZA 2EW2A 4Q3BA 4AJOA 5I7VA 3X2EA 2XXBA 3T4XA 1CDOA 5A04A 3C1TA 4Y67A 1Z74A 3CSDA 1C14A 3RFVA 4AJHA 1QV6A 2JFFA 3DFZA 1CRWG 2D0IA 2ZTMA 3DB2A 3FWNA 1Y8QB 2WM3A 5KKAA 2O7SA 3MOGA 2I99A 3V5NA 5G0SA 1P1JA 3GN2A 4MKRA 4JJFA 4FW8A 3GVPA 5I9MA 3ZHBA 4CV0A 4A7PA 4WLNA 1B8PA 5G2OA 4N5LA 4R4JA 5JLAA 4DIBA 5EQDA 4IJKA 3EUWA 2X7HA 4MIEA 1RYEA 3Q11A 2XF8A 2C5EA 3ZWOA 1LBEA 4GMFA 3ZWCA 2VNSA 5ADHA 4KTTE 1WP4A 1XELA 5EJ2A 1SNYA 3GN1A 2Q2WA 1HKUA 2W98A 1QYXA 3B6ZA 4II2A 4DPLA 1IULA 3MJ4A 3I9KA 3MCVA 3GVCA 4HKTA 3ZV6A 3SC4A 3BTVA 2HKIA 2EKQA 3G79A 2JKVA 1ZK1A 3PFFA 1MB4A 3W4IA 2BI8A 2I6TA 3AM3A 3E6AA 3OQ6A 2Q50A 4W9NA 2V6BA 5BNTA 3GAZA 1LRKA 5DULA 3JQGB 1H6BA 3AY7A 4XJTA 1Q0LA 4LW8A 3KYDA 5L53A 3FN4A 2OGUA 1QXSA 4N7RA 2Q2VA 4BIIA 5THQA 1Q7BA 2W2KA 5JO0A 2NU9A 4RQTA 2P9EA 4GX2A 4A5OA 2EHDA 4DVJA 1I36A 1BHSA 1R4MB 4R51A 4EUFA 5EMHA 2VRCD 3KZVA 3FBGA 4UUPA 5LDHA 4KTVE 4HFNA 3U3XA 2VWHA 1LXCA 3KLPX 3WJ7A 1I2CA 4BV8A 4ZN6A 3UCXA 1IE3A 3GLQA 4H7PA 3OQ1A 4NH4A 3VTFA 1JAYA 4KZPA 4N54A 4CR6A 4DC0A 4Z3DA 3S8MA 2X9VA 2B83A 4WECA 2Y0EA 3I23A 2UAGA 4CM9A 4EEZA 3VZQA 4J2HA 4YAIA 4J0EA 3F46A 1T4BA 3KV3O 3EZYA 4CL8A 3JYLA 1Z45A 4DC1A 3PWKA 1DIHA 2FPGA 3I6IA 1WMBA 3AFNA 4UAGA 4AJIA 4J0FA 4E4YA 1SC6A 1NHGA 3IUSA 2WYUA 3P19A 4WPGA 4Z0TA 4DIOA 4U0KA 5B1YA 2V65A 3F3SA 1E3WB 4UEJA 4ZQGA 3I3OA 3MTJA 2ZB7A 1ADCA 3PGJA 4H16A 3JQFC 1DC5A 2JAPA 4YJGB 4RVUA 5DDIP 4Z6KA 1C0PA 1B0AA 4AG3A 1GV1A 3BMOB 4XQCA 2QW8A 3D5TA 5T57A 4IM7A 3TOZA 1SAYA 4FOSA 4RVFA 1DLJA 4L76A 3WNQA 3ENNA 3H2ZA 2CF5A 4Z9YA 4QEDA 1NPYA 4PG7A 4U6SA 1A9YA 3PZRA 2PZJA 2DVMA 3L4BA 6LDHA 3GVHA 4PVCA 5KVVA 4MVJD 3T7CA 4RV9A 2PFGA 1U3VA 2O4UX 3ANNA 3EVNA 2WYVA 2AQKA 4NIMA 3VPGA 2B4TO 2EGHA 2V6FA 3GK3A 1ONNA 1NQ5A 3GFBA 4D3SA 1J49A 4OIMA 1NHWA 4YAKA 1ML3A 4K6CA 2WD7B 2AMFA 1BXKA 1PR3A 2Q49A 3C7DB 2PTGA 1YONA 1V3TA 2GD1O 2AQHA 1GFSA 4AJNA 3V2GA 1EK5A 4M89A 3H5NA 4Y9DA 3U4CA 2VTDA 3FBTA 3RUFA 1QKIA 1R15A 4C4OA 3JYQA 1SB8A 3ZI0A 1HDRA 1E7RA 2D59A 4GWKA 3V1TC 2Q3EA 4NBVA 1K3TA 2HSDA 2J5QA 1XCBA 1W4ZA 2Y1FA 5F1OA 1B8UA 2HMVA 3Q9NA 4WEOA 5IDYA 1ENPA 2NQ8A 1UZLA 4IJVA 3BHJA 4XR9A 2GSDA 3G3EA 1GD1O 4CM8B 1D4FA 1KEWA 2GASA 3CINA 3LK7A 4OOEA 3VVCA 4CUZA 3B1KA 4WOKA 4E31A 4BS9A 4F45A 1OZAA 1WWKA 2RCYA 3BXXA 4Y6SA 4ITUA 2EF1A 3WGOA 1L7DA 1XHLA 4X54A 4G5HA 4YCAA 4BMSA 3U0BA 8ADHA 1LRLA 3OFSA 3VC7A 1R4MA 2DBZA 1QYWA 3DWFA 1NQOA 1XU9A 3JD0A 3HZZA 2JD0A 1NASA 2B35A 2CD9A 5IAAA 2G76A 3HNPA 2O7QA 4MIOA 3PQDA 4A27A 4PG8A 3DAGA 4DWVA 1JKFA 1H93A 4GWGA 4PVDA 1GUYA 4DYVA 1LDGA 1WZIA 3C7CB 2E48A 4PIVA 4AJ4A 4HV4A 5COQA 3E5MA 3QW2A 4WKGA 3M6IA 3BMQA 3QVWA 4R1TA 3JSAA 5DOVA 4KUGA 5I8WA 4MVJP 4JJGA 2H6EA 4WNCA 5L7YA 4KQWA 4KDEA 2WWRA 4XQGA 1PU2A 1H94A 2IEBA 3GDGA 4FFLA 4XGKA 3PTZA 4P4GA 3T7EA 2J6IA 2UDPA 2Y67A 5IFLA 5EN4A 3ON5A 4TVBA 1MG5A 5G0TA 4ND5A 2AE2A 2BHLA 3H9JA 4BNYA 1C0IA 1Z82A 4Q3AA 4AJ2A 2Q1TA 2BGKA 3QA9A 3JQBA 1RM4A 1P77A 4OKIA 4E2XA 4OKNA 5HS4A 4JROA 5L3ZA 1WLYA 1O6ZA 1S6YA 4O63O 5L51A 3QVOA 2PKRA 5L95A 2VYVA 4M54A 3AU9A 1V9LA 3AW9A 4MVJI 3OP4A 1PZEA 2Y1GA 4QO7A 1JVBA 2Z1NA 4B7UA 2CZCA 2VT3A 4IJUA 4J1TA 1YOVA 1A27A 1IHYA 4L74A 2ZYDA 1DRVA 4E32A 2JAHA 2YHIA 5I7EA 3VPHA 5TQVA 2D4AA 1TI7A 1U3TA 4J7UA 2ZK7A 4CUJA 1H9AA 3LLSA 4RVDA 4DPKA 4FC6A 1DHRA 5JNLA 2EERA 2NVUA 3RFXA 2JL1A 3KYDB 4LSWA 2TMDA 1Y8RA 2PD4A 2W2KB 3GEDA 4RORA 2B5VA 3AU8A 1PJSA 2O3SA 5LDGA 2DBVO 1HYEA 2C20A 2WE7A 3FR7A 4YQYA 3UW3A 3VZRA 1PTJA 5ENVA 1S7CA 3AUSA 3JQ8A 3WTCA 1I3NA 1X7HA 1PJQA 1P1FA 3P5SA 2FPPA 2HK8A 3FTNA 4O0LA 2A9FA 3RUIA 1P0FA 1YWGO 3NTOA 4OSPA 5KCZA 1DIBA 4MVJA 1A4UA 3EC7A 3IKVA 3FD8A 4W7HA 3AUUA 5IZCC 2DLDA 2GN4A 3GDOA 3BMCA 3RUAA 3ASVA 4BNLA 4IQGA 2QIOA 4B8ZA 5I7SA 1FDVA 1FXSA 4D3FA 2O48X 2WTBA 3EZLA 3D5QA 5A3JA 1RKXA 4XYGA 3PRJA 3CZRA 3GGPA 1XGKA 3V8BA 4LGVA 5JAMA 4TKLA 3A28A 2O3UA 3G1UA 5TC4A 4PZDA 1V0JA 2OUIA 4GQAA 1YB5A 3Q1LA 3WFJA 4OGWA 4L4SA 3H3JA 1BXGB 2G17A 5JC1A 2EEZA 4IDEA 4CM6A 5C7IO 1O8CA 3TZHA 4TQGA 3V1UA 3AOGA 3ETGA 1F06A 3AK4A 1JWAB 3TZ6A 3JYOA 1NNUA 3OICA 3BTUA 4E21A 2UUOA 3EVTA 3NTRA 2PGJA 3EGOA 3DC2A 4BQPA 4ND3A 1EVIA 5A9SB 3WLEA 1M2WA 3L4SO 4DBZA 3ZHZA 3K73O 1SCUA 1U5AA 5T6BA 2VHWA 3BAZA 3F1KA 3SXPA 2AG5A 4XA8A 2DC1A 4MVJE 4P4LA 5TS3A 2EKLA 4DXHA 1GEGA 3JCZA 3KEOA 1Y5MA 2QG4A 3DBHA 5JDIA 1ZVMA 2A35A 3QP9A 2ILTA 4IDDA 3QE3A 4YRAA 1Z7EA 2Q1UA 3KB6A 1BMDA 3DMTC 2YZ7A 1LU9A 2NTJA 3W4JA 4CMIB 1LC3A 4IDAA 4XJSA 2PH3A 3X2FA 4IGFA 1Z7BA 4TWRA 5ILOA 4A2CA 1YQDA 4Q3DA 3VVBA 3DBHB 3PWZA 3U5TA 1BVUA 1JQBA 4ZU3A 3NDIA 3ZWMA 1P0CA 3Q0EA 4BO6A 1U9JA 5B4TA 1L1FA 1H6DA 5CDTA 4E5PA 3EK2A 1H5QA 5JDIC 4YVFA 4CQLB 2ZB4A 3OIDA 3UGKA 4DMLA 2JCVA 4PZEA 4TSKA 2POQX 1T4DA 4GVLA 2HO5A 4ZQHA 5KJ1A 3A4VA 2AXQA 4KWHA 3KYBA 5JCXA 4XIJA 5DCYA 4EBFA 1DEHA 1ISIA 4IXWA 4GLOA 5FEUA 3ROMA 2DBQA 4JIGA 4E33A 5GZ1A 2HCTA 5GZ3A 4RVGA 2NV6A 1PJ4A 1XIVA 5JAQA 4PLYA 1X1EA 4B4VA 3GPDG 3UUWA 5G0UA 4BGVA 2UUPA 2CDBA 1JTVA 5T8KC 4QQRA 1NVMB 4BNFA 2OFPA 4YPOA 4IS3A 3PYXA 4L73A 4CQMB 3QV1A 1KEUA 4J1SA 4JLWA 1A7KA 2G5CA 3U09A 3CMCO 2NTNA 3HJAA 3KYCA 1GUZA 3WIDA 3S2FA 1O0SA 4NR0A 1HLPA 2VHYA 4J7XA 4ONEA 2E4AA 4BGEA 2FRDA 1I10A 1VC2A 3PIIA 1ARZA 4XWYA 3D0OA 3H8VA 1B2LA 1FJHA 4OJNA 1ZEMA 4M49A 3GPIA 1Y7TA 2J3IA 1DB3A 1PSDA 1IYZA 4CLOA 1UP7A 4CMBA 2DAPA 2O4CA 3H9QA 3RI3A 1DIGA 1HZJA 2WD7A 3PFWO 1KBZA 1NPTO 3ORFA 4MIYA 3RUHA 4BNWA 3ABIA 1TB4A 5A5EA 1AXEA 3P2YA 1UAYA 2EG9A 2PGLA 4AJJA 2XPCA 4D0SA 2JJYA 3LF1A 4WJZA 1OMOA 4FJ0A 3JQBC 4GL4A 5L4LA 1WXDA 5A4DA 5IG2A 4YJHB 7ADHA 3H5RA 1WNTA 1H2BA 1X7GA 1ZJYA 2IODA 4FFMA 3OJ0A 1T26A 2PNFA 3WSVA 2CFCA 5ITVA 3ZWXA 4BB5A 1JN0A 4HFRA 4TRJA 3PDJA 1Y5RA 4E5YA 1LA2A 4WOJA 4CMKA 3TZQA 2Y1DA 4OYRA 5JY6A 3OSUA 3ETEA 4U6QA 2DT5A 3OF2A 4YAJA 4QECA 1N9GB 5JBIA 4YBZA 4D44A 1AGNA 1E5LA 3UFXA 4BL5A 5DOZA 1KIFA 2P4QA 4EI2A 1E5QA 1FDTA 2VRBA 3GZNB 8LDHA 2O3TA 4FQ8A 1WDKA 3INRA 4A26A 4YRBA 1JLLA 2WYWA 1P45A 1VL6A 2AHRA 1HSOA 5CPFA 3O8QA 1YL7A 1O95A 4E6PA 1ISJA 4JK3A 5CG2A 4RF2A 1ZIDA 3DO5A 4CMJA 2C07A 4QXMA 3DHNA 4D45A 3PYMA 3VKVA 2EJVA 4DLBA 4XRGA 3RBZA 3WDSA 2ZATA 3CPSA 5JY1A 3ZU5A 1MLDA 4ND2A 4YQZA 4OMUA 1MFZA 3DXFA 2YJZA 4DL9A 1F8FA 3JQ8B 3TPCA 4FFOA 3O26A 1A9ZA 4CLRA 2QRJA 2QQ5A 2YW9A 2IYPA 2IRWA 4GX5A 5LCXA 1K5HA 3GF4A 1D3AA 2O2YA 4QSMA 3UICA 2DPHA 1X7DA 5CP8A 4U5QA 2GN6A 2DUUA 2GZ3A 1FDSA 3PDUA 4XYEA 4XYBA 5G4KA 4E12A 5TGDA 1GYRA 4R68A 1KETA 5F1PA 2D3TA 3ZWNA 1EUZA 2YQ5A 1D8AA 3WGHA 4W6ZA 2VYVD 4RGBA 3QY9A 5L9AA 3AUAA 2CMDA 1PJ2A 1PQUA 5JPIA 4CM4B 2DFDA 4MO2A 1YH3A 2JD1A 4NDNE 4FFNA 3IJRA 1OC2A 1PEDA 3WMXA 3WLFA 3QHAA 1Q7GA 4HX5A 3ZU3A 5G4KB 1DRUA 3NDRA 2GCGA 3NEPX 3NUGA 3PP8A 4DPMA 2PZKA 2WEKA 2X9NA 4I9HA 1E1NA 4NFHA 3A9WA 1AHHA 1EVYA 4DIFA 5G0VA 3PLRA 3VPSA 1PL7A 1NVTA 3F4LA 3IQDB 4BO3A 3CZMA 3WQQA 2FZWA 1C1DA 5FI3A 1J5PA 1R66A 2Q1WA 4A73A 2EXXA 4KQXA 3HHPA 1LQTA 3OJFA 3L77A 1UXIA 3TDKA 4GKVA 4GX0A 3CXRA 4ZHSA 4HWKA 1NR7A 1LRJA 3KBOA 4Z0HO 2HK9A 1HZZA 4JX8A 2HJSA 3JQAB 5H83A 4BKUA 4E5KA 2E6UX 1R0KA 3SLKA 3QIVA 2X0NA 2VT2A 3ONDA 3W8DA 5A1TA 1RYDA 1OAAA 3TL2A 3F5SA 4J90A 3KO8A 3PHJA 4RDHA 4JJIA 4WLUA 4OQZA 4IDBA 3SC6A 5HTOA 1GYQA 1YKFA 3ZV5A 4YR9A 1GADO 1SEPA 1ZMTA 2BLLA 2DTXA 1PZHA 4LMRA 5TRTA 3TJRA 1UR5A 2RBEA 3BTSA 3O4RA 4TKMA 1VRWA 1C1XB 4YAEA 1ZK0A 2YYYA 3DOOA 1ZKMA 2D5CA 4GH5A 4NFYA 4CR7A 4JBIA 1WZEA 3W1VA 1QORA 5FFFA 5L45A 1N1GA 2O3JA 1TLTA 3SVTA 2VNAA 3AM4A 1PS0A 3RQSA 1ZUD1 4LRSB 4YRDA 4DQXA 3PZBA 1V6AA 3AI3A 2C7VA 2UYYA 2C2YA 3PLNA 1I8TA 5F1KA 3TNLA 1VL0A 4MP6A 5K6AC 5HWSA 1NR1A 2DTEA 1CYDA 3O38A 4J9UE 5K6AA 4EGFA 4F3YA 2PZLA 5KVSA 3RIHA 2WD8A 3KYCB 5AXBA 1ZBQA 5TJ9A 3IOYA 4QUKA 3JQ7A 4IINA 3K31A 5JYDA 1G0OA 3LLVA 5HS6A 4O1MA 3ZDFA 2BI7A 4D7AA 4FB5A 3H4VA 1DJQA 1R6DA 2DBRA 3OETA 4LVCA 1YJQA 3HE3A 4NBUA 4NJMA 4S3MA 1YQGA 4CLDA 4PFJA 4FN4A 1B26A 2GPTA 4LMPA 3RBXA 4NU6A 2VHXA 4Q3EA 4B4WA 3GUCA 3AFMA 1Y6JA 3GAFA 2ZTUA 3Q2KA 4GVXA 5DZSA 5J23A 3SBOA 3IIEA 1OC4A 1PGJA 4I1IA 2D2IA 3E9MA 2HQ1A 5JDCA 1GQQA 3ZU4A 3OEWA 2BMAA 4B4OA 1LTHR 1IPFA 3CTMA 2Y93A 3K2BA 3F9IA 2NQTA 3DTTA 1M75A 4MKXA 1U7HA 2YY7A 1WVGA 5B4UA 5JS6A 1EEHA 1V35A 4DA9A 1F8GA 1KEVA 2A92A 5DN9A 2X5KO 4BOYA 4Z9FA 1EUCA 3E1KA 4L4RA 4I9NA 5BSGA 4A03A 2J3HA 3HFSA 4IIVA 2NLOA 5DBGA 1OBFO 1HE3A 4J4TA 4L4XA 1ADFA 1M6HA 5A9TA 5B4VA 1LSOA 1JA9A 1YQXA 4TRNA 1PQWA 2VHVA 2X58A 1K6XA 2R00A 2W4QA 3D3WB 4P4NA 3VH4A 2PD3A 4R41A 3E8XA 4BB6A 3KOUA 1Q2XA 3DZKA 4CMCA 3PEFA 3K8ZA 3ZV3A 3COSA 3ROPA 5A06A 4NBWA 4NJMB 3NTQA 4EITA 4EJMA 5H82A 4WCDA 1DFIA 5T8KA 3OM9A 2QRLA 1ZEJA 1EBUA 1XSEA 4MVJH 1X13A 1ZO8A 3B1JA 3GRPA 5A5FA 1UDBA 1SMKA 1RM5A 2QRKA 3EDMA 3VDRA 3QVSA 1JVSA 3ZWYA 1NYTA 3DQPA 2Y99A 1YL5A 1WDLA 4FCCA 2YHIB 5DP1A 2I67A
chains in the Genus database with same CATH superfamily
4ID3A 1OILA 2IITA 3L04A 3PGVA 1SUEA 1SZJG 1XAHA 3GNSA 4HQ0A 4WVLA 4WZAB 2UKDA 5GV8A 3FNFA 4RQUA 4Z1OA 4WCVA 1M9NA 2J3KA 1QZTA 1DNPA 1LSUA 1MENA 1RM3A 3DDWA 3KKOA 1X74A 3A9RA 3JAKA 4YA6A 1KH2A 4YXFA 1KYZA 2E18A 4LSMA 4QVKA 4B3FX 3NHKA 4LYYA 1OZHA 3JQ9C 3WMGA 1D2NA 2CYCA 1LCIA 3WICA 1TCCA 4DQUA 3EAGA 2ZYWX 4WESA 3CZCA 2O52A 2NU8A 3OHPA 4C06A 3BILA 2HXSA 3F5MA 4EX6A 3KQOA 4EX7A 2VIIA 1W2WB 3V1NA 4DNQA 1RPNA 2G63A 3PK0A 4R81A 4BNXA 4YJ2A 3W5DA 2O3QA 4E2ZA 4EECA 4YMHA 3PC8A 4PCVA 3TEJA 3ZUPA 1D2RA 3AZOA 2D5IA 1SVSA 4H7IA 3K70C 2IZ0A 4ZOCA 5KBYA 4Q1VA 2VA9A 1CZRA 2CY0A 2OPHA 2JI7A 2WUDA 4HZUB 5LWQA 3MWYW 2I34A 1IQUA 1R10A 1NUUA 2C4VA 1QHEA 3KELA 3LP8A 3ONEA 4Q4HA 3CZAA 4UJ3A 4UUQA 3VAZA 1HT2E 4CGYA 2ZWAA 4BVJA 4M3NA 1IXYA 4QO8A 2B2XA 1MORA 1P60A 4LUCA 5JOQA 4YP9A 3NX4A 4B0PA 1O96B 2VH2A 1GM5A 4H0CA 1K68A 3CZPA 1R0ZA 3NOXA 3EMDA 3ZV4A 5LA6A 2OA0A 2OHXA 4FOPA 2IYLD 5BNZA 2B37A 3VU9A 3AVYA 4MMXB 2Z9DA 3H5WA 3IMEA 3RTGA 3Q7RA 1E1RD 1HA3A 1NX9A 4RHUA 3A9TA 1W59A 3RTAA 3I9JA 1P19A 3PIDA 1EINA 2FSFA 3D43A 1LGYA 3HVUA 3OQHA 3FTCA 4L4UA 4LYHA 4IBOA 2NU9B 3DF7A 3UATA 3TH5A 1W4RA 3ZWPA 3PWSA 3CIOA 3BE6A 1LFDB 2QTAA 3DVRX 4FYYA 3T7JA 1RABA 1NI4B 1ZD5A 4IH9A 2Y4NA 1UOQA 1DLIA 3RRJA 5HDBB 3K6JA 1MNAA 4ZGGA 3VMMA 4C88A 1T8WA 2QTBA 3ZDCA 1XMPA 1Q3HA 1WDTA 4BMVA 2Y9PB 5H70A 3ZWBA 2IHKA 3ZBTA 2F67A 5HZMA 2SNIE 1OYOA 1PNOA 1Y8QA 1I01A 5A02A 1E2NA 3CE9A 2WE8A 4WXRA 1DIRA 3F5QA 3FZNA 1GPWB 4R5MA 4EMBA 1DZ3A 4KN5A 4C7BA 3PKIA 5H16A 3SVZA 2Q5FA 4LOKA 2HMWA 1L5ZA 4ZHQA 1XRJA 1ZVQA 3H7IA 4LNUB 1UEXC 1X1SA 3OJXA 3UQYS 3IJPA 4C0WA 4ZEMA 1L7OA 3ADBA 2ACKA 3Q2IA 3RU7A 4AXBA 1GU7A 4BX9A 1J8VA 1CQWA 1YDWA 3R6GA 1FUUA 4MR7B 4BAGA 1P18A 5KHLB 1EZ1A 3WI7A 2GM9A 1CQJB 4IG4A 2HV9A 1QWOA 3F8TA 2AFVA 4DLYA 1WAMA 1QPBA 1LD3A 3BFJA 1KK3A 1DX9A 2WHYA 1ORIA 5A9RA 4S2UA 3DHVA 1W4LA 1JWLA 1QP4A 3FVVA 1M1YB 1Y3AA 2EFGA 4X7RA 1N2JA 5JHGB 3WZMA 2CB0A 4WK6A 2YFYA 2W11A 3SY8A 3WL5A 3RVBA 3MUEA 3JPYA 4FCTA 2VP5A 2ORWA 2PM8A 1WRBA 4JXJA 2EP7A 5IH7A 3E61A 2DR2A 4BO2A 1EVEA 3GH1A 1VMKA 3KRTA 2IYOA 2Z3VA 3EPLA 3DB1A 3GFFA 1PE0A 5J23A 3MJSA 2VHUA 2C0PA 4UHFA 2GRAA 5B2FA 2JI6A 4P86A 2QTFA 2VYNA 3H2JA 4RTJA 2MSNA 6REQA 1BYIA 1M2FA 3DBOB 3BDAA 1F9EA 1QIEA 1R0RE 4G3XA 4LJKA 4P92A 2JZNA 2HMTA 4MEAA 5AJZA 1SA0B 2QLNA 3RQIA 5HUJA 2KI5A 1HPLA 4OHFA 5SZKB 4R71A 3E3NA 3FLAA 2ZRAA 3PNPA 8ADHA 1UKEA 2FSIA 2ZT5A 3H4MA 2VJQA 3QLUA 4N5NA 4EY6A 1TL7C 4EYEA 3AR8A 1QYVA 2C7GA 1BZYA 4AJLA 2V6MA 3GJ3A 4TYQA 5BUCA 1RIIA 4GE0A 1Q1ZA 1YDEA 2ZTVA 5EKDA 5AVUA 1U94A 3KKLA 2QMEA 1YI8A 3I8OA 4Z7QB 1WZUA 1FF9A 2Q8PA 2F9FA 1U7OA 3OM1A 1EVJA 1ZQ9A 2QGNA 4G5SA 1O9HA 3KQVA 1V5GA 2FAXA 3R44A 3ESDA 2FQ1A 4OI4A 1W5BA 1UFRA 3DEJA 4R3WA 3RM3A 2G7MC 3I30X 1NE7A 5JQGF 4DV1B 2R6CA 1CR6A 3AUKA 4J03A 1ZW1A 1FJ2A 1WE2A 4B1FA 4P80A 3IBYA 3PI6A 4RA9A 4REQA 4DSAA 2NUTB 3JSXA 1QQ5A 5KINB 1JKXA 5HUQA 1ZD2P 5G53C 1M1YA 3TRDA 3IPYA 3NNDA 4ZU1X 1I5RA 1V7CA 1MXHA 2NUPB 3D4LA 5I8ZA 2IOQA 2I7XA 3AKEA 2HPZA 1UIMA 2KBFA 3HDQA 3K1ZA 4I4TB 2FHPA 2F17A 4ZO4A 1E6WA 3DHWC 3L4EA 1U0JA 1YA4A 1CVRA 5KPJA 4MWEA 4NV1A 1A72A 1XPUA 3OLVA 5GVRA 4BV3A 4YP1A 3WFIA 3TLJA 3GLFE 5EZSA 1ECCA 4X6YA 3VU8A 1P8JA 3OFJA 2YX1A 2BUCA 1WU8A 3VXKA 1RYNA 5IAJA 3KUUA 1PFWA 2FH5B 1E5VA 1G2IA 5AUNB 1ZMRA 4Q9AA 4QG7A 4LJSA 3SC2A 1NQTA 1YU6A 2ZDQA 3QVKA 2VPQA 3AY6A 5EE9A 5EGSA 2WABA 5EPOA 1J1IA 4ZCRA 5KIAA 5GONB 2CXXA 3D8RA 5BRAA 2ZBUA 3QVLA 3PX2A 5G3ZA 1NIJA 2E82A 2FR8C 3A2NA 5JPDA 3LKVA 4QTZA 4EPYA 5JAIA 1NXVA 1WW8A 121PA 2MJLA 1O03A 4D0NA 5CGQB 2AD5A 2Z8XA 5JZOA 1VKZA 3CFYA 1ZGZA 3R75A 1QDLB 4DAEA 2HFKA 3WGMA 1NY5A 4NENB 4FGWA 3AEQA 4R6XA 2W42A 2HT1A 1ADGA 2RC5A 4IIUA 1ZHHA 2UVPA 4KWIA 4P22A 4UHBA 1P2SA 1TPZA 1VE6A 2HU8A 2PWZA 5JD4A 2IIQA 3CZ5A 4PNPA 3UAOA 1NQAO 3FCYA 4IRUB 1E61A 4KW7A 3B3GA 1W36C 4E03A 3GOQA 3FWZA 1SN7A 2EFEB 2LKCA 2IA5A 2ZKLA 1SD2A 4A8HA 3OZRA 1GL9B 3R5HA 1T0PA 5JU6A 5DCWA 3E5NA 1TIKA 1QSGA 2RGDA 1N0VC 3GH3A 3RIEA 3X1ZA 1K0UA 2ISQA 1HKHA 2ZYGA 1TGYA 3JQ6A 1Q1EA 3ZI4A 2VEOA 2YJ4A 2PS9A 1QTIA 3NANA 3FAZA 2G25A 1L4MA 2J67A 3AV0B 3EYAA 3HU3A 4R8LA 3VDQA 5DM60 2PV0A 1COZA 1PVVA 3FETA 3DZGA 3L7JA 3OZWA 1O2DA 4LXYA 3IO5A 4MTLA 4H15A 2FJPA 1JDVA 3U7QB 3VU0A 1EFRD 4LWOA 3HXTA 3DL7A 4JJEA 2MU1A 4M36A 4Q66C 1N0HA 4PBRA 2HHAA 3UMGA 4NCHA 4EI7A 1IVYA 1E98A 1JV2B 2A2ZA 3IGFA 4JCOA 5FWNA 1E2GA 1E6CA 1OAOA 4MVYA 4XQ0A 1ZGBA 5IM4F 1IU9A 2XZTA 1Z26A 1V5WA 4MARA 2I2DA 3UTCA 4HVLA 2JD2A 4EUNA 4EZEA 5FV4A 2IH4A 4CEJA 3EZXA 3T3PB 2JRLA 5A9SA 3M2TA 2BMDA 4P3XA 4DLSA 4G5YA 1JEEA 5DGTA 5JCOC 4K9KA 2HW8A 3WRWA 2CVHA 1IZ8A 1V8PA 3EQ8A 3F5DA 1MABA 5DNDA 3NEYA 4MUHA 5IDXA 5L3VA 1T13A 4KOEC 4FT4A 3S44A 3RCBA 3IESA 1Y4SA 2ZVPX 2XZLA 3A0UA 1W44A 2H06A 3F7MA 2OOKA 1HDCA 2GWRA 3DULA 3GZJA 5E9WA 1Z6ZA 3VQTA 3UB2A 5AI6A 3UC5A 4N3GA 4P6VF 3ASZA 2AYXA 3VDMA 3UM9A 4E3ZA 2R2GA 2QPTA 4R8RA 4R69A 1YT5A 1YXMA 5E6SB 1YJBA 5ARCA 4BVKA 3PCTA 3QF4B 4KXXA 3MHTA 4MR9A 1ND5A 1O95C 1N6PA 3AV3A 3JXEA 3HABA 2G77B 3DVQX 3HDVA 3NWEA 4V02A 3EIUA 4QULA 2ZUDA 1AKRA 4ZQEA 3SYTA 4R3UC 3RANA 3DFIA 1CPYA 2BFPA 3VR5H 5BN3B 4OEHA 1T9GR 1WZCA 1EGMB 3HI4A 4LHXA 4UTOA 4WBSA 3F74A 3M8KA 4HK4A 3O93A 1TD9A 1MU0A 4O5AA 9LDTA 1NNI1 1LC0A 1X8XA 2XB6A 3H99A 4U7HA 3R9KA 1ZM3A 3KEQA 1SHJA 3SIXA 1GL3A 3RROA 5IP5A 3WGUA 5A2QA 3KZOA 2O0JA 3TR0A 3ND6A 3HS3A 3SCZA 3QBVA 2QMYA 4AZ3A 2B2NA 1FFHA 1OHHD 3KDAA 2Z2JA 4O2BF 1C81A 5FF9A 4BMYA 2IY7A 1ONBA 4D25A 1J6UA 2WT8A 1ORTA 4A82A 5IXSA 1GKLA 1JIIA 3KB2A 5EZYA 1KZ6A 4AICA 2Q5LA 2GERA 4F2DA 3IPLA 2VOJA 1O94A 7AT1A 1WQ3A 4PRKA 2WZDA 3TUJC 3W5IA 3WWYA 4GG1A 1HL3A 4BP9A 1KPHA 3F6PA 2D7CA 1B74A 3BA1A 3I12A 1XPJA 2C8JA 5IX8A 4QFCA 3R6WA 1XDDA 5TGZA 3M81A 4Q1AA 5TV2A 2C84A 1PZXA 4HAYA 2ZM6B 4NI5A 4OGLA 1OLXB 2VJKA 1FXWA 1PFUA 1K5GA 1NNLA 4AZ0A 5LN1A 4QXOA 2RD2A 5KNDH 2R86A 1ZSYA 3VV3A 2P4EA 4DLUA 4Q7JB 2G07A 2H63A 3L01A 3WYNA 3CLVA 5AUQA 3FG9A 4UATA 3DONA 4KODA 6NULA 1E6KA 2XSZD 2QR5A 1EFKA 3W9SA 3QV2A 1OD6A 4U63A 3LS2A 3WL3A 2HWWA 2C2GA 5AK0A 2RBKA 1E3SA 1KIMA 1GYPA 4P54A 2B6NA 4WGGA 1JFSA 1KVRA 4JYAB 1FP1D 3EXHB 1ZMXA 3GMDA 1C3OA 1ZSVA 2ZT8A 5ILQA 2JKZA 4PLVA 3MPUA 2Q3LA 5EYPA 3P5BA 3D8NA 4KN6A 4J29A 1P1HA 2O5VA 2NSHA 3O2JA 4Q7MB 5IJWA 3EIXA 4UE2A 3D7LA 4O2LA 3TQCA 1ZM4A 2QI9F 3LZCA 4NATA 4R0MA 3SOPA 1T1RA 1KS9A 3B48A 2O5EA 3AHIA 1BA2A 3KR1A 1WBBA 3VO9A 3PNYA 4BMZA 3A31A 5J5CA 1CSEE 1IOLA 4OLBA 5HK8A 4DG9A 2PRJA 3ADOA 1OUMA 3G49A 1SQGA 5NLLA 1L5LA 1J2EA 3BYZA 3LHDA 1GDTA 1KL7A 4WY5A 5U9CA 1Q20A 4NPCA 2P6MA 3A3PA 3T0GA 4GHWA 3AETB 1G66A 4GP7A 1ZJZA 3B60A 3SK0A 1OU0A 9MHTA 1ULSA 2XNJA 4ALMA 3TSCA 3ZW9A 2VSXA 4JQZA 1UPFA 4KMSA 3R5JA 3WWOA 4UASA 2V1UA 3W2HA 3MERA 4IICA 3LG2A 1BGVA 4B79A 5B12A 1EG2A 2TSYB 2GR9A 2PU5A 2RH5A 1PEKE 2L19A 3HKDB 4MWOA 4YP0A 1PD1A 1U2GC 2NAPA 3V4OA 2HCRA 2FPUA 3NYQA 4N5MA 1M67A 3CE6A 4RCYA 3PNQA 1JG3A 4LOHA 4TZTA 3IUJA 4HDKA 3ZHUA 3U3RA 1MC8A 2VJAA 3OQIA 5KNCH 1KJ9A 3L6DA 4OBWA 1D4ZA 2KW5A 2YVLA 1NW5A 5ALWA 3DV0A 5DNAA 4OFBA 4D9GA 5L7TA 2VSYA 4K3UA 2J5RA 4YAWA 1CY1A 1S4MA 2A4KA 4TLCA 5AJUA 3A1NA 3OFND 2C2MA 5CK5A 2B4RO 5FL7A 3T9EA 3OU2A 2BDUA 4CV2A 5CBPA 1SXGA 2VQ6A 3MWLA 3ODPA 3E22B 3IV6A 4PO1A 5IUNC 2XADA 2C9BA 2I4RA 4JLJA 2P3SA 2D2VA 4U9IS 4QTXA 1TZMA 5JSFA 1UAGA 2PBRA 3MJCA 1DP4A 3CO5A 3A14A 4LS3A 1IONA 1MP0A 3MBKA 5KYWB 3DBRB 4YHHB 3AM1A 3S3TA 2HYDA 3ICPA 4RU1A 5K7SA 3G2PA 2B4QA 2P9BA 2P4UA 4OQNA 1KVTA 1RBZA 4HEHA 4DUPA 4EPTA 1YR9A 1FNCA 3K9BA 3EVCA 5IWAB 4KAXA 1BDMA 5ALKA 3SR3A 4IPTA 2HU2A 4RTLA 1ZGHA 1P80A 4ZQFA 5K0SA 4DM7A 1UOPA 1SIUA 2FEAA 1XP5A 3D7MA 3PE6A 3T3IA 2OMKA 2ES4A 5LC1A 5KTTA 1PGOA 1T43A 5H9WA 2N42A 5EXPA 3T3OA 1CJCA 3KUCA 1X8LA 2HBZA 2GN1A 2QX7A 1L5VA 4LZWA 2I6XA 5BSEA 3HKDA 2W6NA 1F4PA 1Y8CA 5T4BA 1K27A 3JWJA 1U28A 4V0QA 5DHQA 3DAFA 4Y30A 4UZEA 1H9BA 3HCCA 3FNGA 1HYBA 1MIOB 1DUIA 4MGKR 3JD3A 5TEVA 5K8JB 4AJ9A 1PR2A 4V0MA 3THXA 1AS0A 5AHOA 4E2FA 1INLA 4EEKA 5MN5A 3DFUA 1YZLA 3TTYA 4E08A 3W5HA 2PT7A 2WFMA 1XDBA 2ZE6A 4CL3A 4X92A 3A2MA 4KIWA 4IYRA 5AM1A 3NXKA 4PLTA 3WLMA 4BO4A 3TQHA 4Y2JA 3GJSA 2C8KA 3PVZA 1BWSA 2IU6A 3EXIA 3PFBA 4OM8A 2JZOA 2DHEA 1PSZA 2ZVDA 4UXJA 2YN2A 1XJWA 4WY2A 3V9AA 4D9IA 2X6TA 1TZJA 5B55A 2Y1OA 1HO3A 3N8KA 3MJEA 1QCYA 1XMJA 4C05A 2YZ2A 3LQ4A 4BECA 4YCCA 2CXNA 3CLUD 2PH5A 2ZRKA 2VSNA 1HI9A 2ANBA 4BVAA 1JPJA 4DLTA 2OHVA 4DGQA 3WISA 5GJBA 4GLLA 4A8PA 3F2VA 1S2GA 2B36A 2HD4A 2FLKA 4Z9BA 2PV7A 1ECLA 4GOKA 5CRIA 4P0QB 2HJRA 3A7DA 2HLNA 2ZS8A 2FI1A 2IOFA 2GJKA 2DQSA 1O5TA 2A6PA 2QE7D 4JJ8A 2PKXA 1H2ZA 1GL6A 1Q1NA 1MGOA 1M34B 1TJ5A 1Z0ZA 4Q1DA 1GTZA 4H4CA 4LQCA 2R4QA 2QNBA 1Z12A 1QHHA 3HJFA 3D64A 1XCLA 4PY2A 1XQYA 2WKSA 4MDEA 2MMCA 4ZOAA 3B9PA 1YOVB 1U1EA 4OP1A 4ALJA 1NXOA 5BSFA 3LDAA 2W8BA 1ZD3A 4JC8A 4TZ0A 3GT7A 4G67A 2GETA 2XA9A 2D1QA 1ZJJA 2IBMA 2GBFA 2Z08A 3RNLA 5KYTA 2AF4C 4YCNA 4JYZA 1OPXA 2CDCA 2H8GA 4PZ0A 1S9DA 3JWPA 4YN3A 4YWJA 4QXAA 3T7AA 4O4IB 4TS4A 3QNWA 3GR6A 4CMHA 2DKFA 2R6FA 3THWA 3HKCA 2GVDC 2V55B 1N5DA 4C6RA 2R7LA 3LT1A 1YJ8A 4GRAA 4LK2A 4ND8A 4FBLA 2NU6B 1YO6A 5GP1A 1KA9H 1TW2A 5JNUA 1VLLA 1AA9A 2GF2A 2HA4A 1PT6A 5JDCC 1M2GA 1Z0DA 2V98A 5AFSA 3HB9A 1LSSA 5DHRA 5LZ9A 2VDWA 2Y68A 1L9KA 2XIJA 4PQGA 2OC9A 4D8YA 1GPAA 2YMLA 3KAJA 3LOPA 2HRQA 3H5OA 1UJ6A 3VPAA 1AE1A 1G98A 3UT5A 1XRRA 2WKQA 4GZLA 4KP7A 3U9LA 3W5CA 2AJLI 2OESA 1KYIA 4DDMA 4F4DA 2QM8A 3ZK9A 3RADC 4BAZA 4A16A 1W6RA 2GDZA 1Q0UA 2IS2A 1P9OA 3BL5A 2X0EA 2GMWA 4B76A 2PX3A 1O97C 1T2AA 1RWOA 1B3BA 3RPEA 1E3EA 3WL8A 4W5TA 1XKTA 1RM0A 1ZJ5A 2QRGA 3DMNA 4I2VA 1QMPA 5KOHA 1SZCA 3AIKA 1GUAA 1U3WA 3L05A 4JJZA 5C8YF 5E6RB 3VX3A 4J1QA 4R9RA 5SY6A 3VI4B 4K8RB 1XD8A 1N5JA 2WLSA 2WA1A 1QG6A 2I1QA 3ED1A 4G8CA 4LF4B 1D04A 1ILWA 1ETHA 1UBGA 2D8AA 5UKDA 5DKFA 3ZCUA 2O8DB 3N70A 1FP6A 3RJMA 4D9JA 4N3AA 1C3XA 3N7UA 5B36A 4MRNA 4ER3A 1R9NA 1JG6A 4JBGA 3GUUA 3H1BA 3BH0A 1LY1A 1Z25A 2IPLA 3VHXA 5KOIA 2JC3A 3BIWA 4N6OA 4OU4A 3CH7A 3V1KA 2I29A 5IN4A 5KSPA 3IUMA 4PIMA 4OIFA 2UXBB 4BMOB 1JAXA 1CULC 1AS2A 1E0DA 1ZJ4A 2AEEA 2R4TA 3LBFA 1I32A 3N2KA 4RFLA 4ZVTA 1XOIA 5HE9A 3C6ZA 4AZVA 1R0LA 4X1IA 1P1RA 2FGKA 3PHGA 3L84A 3LL4A 1T25A 5CFRA 1TFRA 4YFYA 2C59A 4C4RA 5KQPA 4RS4A 2WHPA 1G4UR 1QIFA 2E55A 6PFKA 3GLVA 2RHJA 3DZJA 2IXDA 4YTEA 3WGTA 2ZJ3A 3WKCA 2BFWA 5KJFA 4MS1A 4QAJA 4M99A 3USES 5BWBA 5C5CA 1EFCA 4JLBA 3OZTA 2F8SA 4C7KA 3GZ4A 2JGMA 3WWCA 1F2UA 3ZDQA 2XOXA 5FHRA 1T0IA 1X7YB 3UWDA 1ZXBA 4G5QA 4L5IA 5FHQA 4EY5A 3DM9B 3VKGA 1RCFA 3GD7A 5AJHA 3ORSA 4XUDA 4L1KA 2OGSA 1L4FA 2OR3A 3HN2A 3O9ZA 4F96A 1W73A 1TVEA 2AN3A 3M2PA 4X7MA 3KAQA 2R6DA 2J3EA 2ONCA 4ZOLF 2WAMA 4ZVNA 2HMSA 5IASA 1GFIA 1B3RA 3V46A 4QU9A 2I7TA 4ASUA 1US8B 2ZE8A 2OSBA 4IQ0A 1PR1A 1J33A 1Z4PX 4EPRA 1MRZA 2H29A 1KEPA 3O4VA 1SOVA 4E5DA 4RETA 4JSRA 1NRIA 3DTVA 3LW7A 3MB5A 1XTKA 3FGPA 4BBJA 5IBQA 3ZIAA 2NT4A 2F1IA 4IMPA 3FAKA 2QLTA 1SCBA 3ZR4B 3A27A 1FYVA 4EDFA 1GA4A 3PNBA 4QBFA 4G9BA 3H83A 4MV5A 3MUFA 4PLCA 4Y6OA 4PG5A 2FZEA 1XRSB 2PLWA 3D4IA 5K8VA 2J46A 2P0EA 5I7HA 1ESEA 1Z4QA 2KLBA 3BCUA 3K92A 4MJXA 5FI5A 1EK0A 1U0BB 2IZZA 1U04A 2PL9A 1G3RA 1F9AA 1ZFNA 3B1WA 4KX3A 3ZJTA 1H8HA 1R8YA 3O4JA 3RK1A 4WKBA 3CUVA 2P6UA 5AW5A 2NZWA 2YICA 3L0CA 4D41A 4GM4A 4KSYA 1F2VA 3PFNA 5A2GA 1GTJ1 4HC4A 1Y9DA 4R9SA 4I3FA 2Q4OA 3SC2B 5JVDB 1Z73A 4YAGA 4B45A 3KXKA 1QLHA 2H85A 3DVSX 1YVPA 1CJTC 1IJFA 4M0FA 2BMJA 2B7CA 1K4YA 2C5AA 3KQSA 3T7IA 4DILA 2YR0A 2JI9A 4RAOA 3UKOA 2HJVA 3SIPA 2DFVA 1L7RA 5ERYA 4PCLA 5J58A 4UTXA 1QRRA 3I53A 4R5HA 1ABEA 3P9XA 2HV8A 1Y9EA 3EHDA 3P9KA 3RAEC 1XXHB 3K0FB 4PFSA 3H9EO 3ZNPA 2Y1WA 1JNYA 1RVDA 3W3ZB 2BF4A 2DWUA 5ARBA 1H4VB 1P5JA 2OB1A 4R1SA 2VTEA 3IP5A 3EE6A 4WEQA 2REQB 2XE8A 5TMEA 1V8FA 3WGQA 4GBED 3D6MA 1DVRA 1E3LA 3QOYA 1VJ0A 1PQPA 3L7MA 4M53A 1BXZA 2GFIA 4U7TB 4YAFA 3CN9A 1ZS9A 2ECQA 5C35A 3OA0A 5JYEA 3LSTA 1SBIA 1VGQA 1P17A 4JNKA 4RY8A 1HEIA 4TTSA 1C1XA 4DQKA 1BKYA 5T4HA 4JLVA 3G2MA 4R84A 3ZS8A 4IF4A 1CIVA 2F1JA 4AX4A 4D6PA 3OWXA 2HLPA 3C3DA 3H4IA 3N6XA 4MDHA 4JP3A 4B34A 3QE9Y 2RI0A 1BX1A 1P4HA 1UKVY 3QW4B 3E9QA 2PPLA 2IYVA 3DTYA 5KTRA 1XTZA 1FQWA 2ASVA 1GOTA 3UPDA 1JG1A 2JATA 4MV8A 5HQTA 2V96A 1QO0D 2WJWA 2VP9A 4M1YA 3HCAA 4FM9A 3HBFA 1CS4C 1THMA 1SM4A 2AQIA 4ETNA 5BOSA 1P44A 1IEWA 2BFCB 1U1DA 1BRMA 1LVUA 1RP7A 3AJEA 4XIFA 1ODKA 2H0RA 2OLJA 3TM4A 1KKUA 4EZBA 2IXFA 3BTOA 3LF2A 5A3QA 1H2RS 5LU9A 2FSHA 2VZLA 3S4YA 2WVGA 1NOIA 3I8SA 2Z6AA 4QYXA 4C4ZA 2JIQA 1DSSG 4DN6A 3GEPA 5J40A 3HO8A 5EFOA 2Y1CA 3EARA 2Q4DA 4HTFB 4QGFA 4AF8A 2XCOA 2OL4A 1HETA 5AM2A 4CE6A 4KYIB 1Z28A 2B5WA 4YJFA 1QMGA 3HGTA 4Q39A 3V48A 4ZC8A 1YZGA 3FPGA 3G9ZA 4INOA 2YH2A 3AYXB 4C14A 5C0OE 4F3NA 2YUIA 2FR0A 4ZGWA 4GMDA 4HDOB 2FLWA 2A1TR 4MWGA 4TTJA 3ZCQA 3F71A 4BQQA 5KSZA 3QYJA 1JLRA 4N7JA 5HJ5A 3U16A 2BM0A 3MFQA 1L8LA 2CJFA 2XB4A 2VYND 2R7KA 1HTWA 3SSOA 2FZLA 4YP7A 4FI3F 4F6LA 1O9BA 1EVKA 1EP3B 3LDUA 4PLGA 3ZY3A 1XLTA 4RQAA 4DADA 3IL2A 1QS0A 2JFYA 3OEYA 3CSSA 1MRNA 1MVOA 1QYIA 2QV7A 3LX6A 4WHMA 5A5DA 4LTNA 1EXVA 4RZ3A 1Z88A 1G7CA 1EJ2A 3OMWA 3PUWA 3IB6A 5A6VA 1AMNA 3VYWA 2CZQA 3SZRA 5FTWA 3SDSA 2F3TA 3TGWA 2ZKIA 3EOAI 3M9WA 5CA1B 2DLNA 1J99A 1BGXT 5ALNA 1EVZA 1KMQA 2BGRA 3H2BA 3NT4A 5BSVA 2LZ0A 3HL4A 3QEBZ 4WXYB 1IBSA 3LNTA 2JA1A 5IDQA 1HDOA 4EJ6A 3ILHA 4CKCB 4ZOBA 5KVAA 1GZSA 3N53A 1SWVA 1ECGA 3TAUA 3TJZA 1JG7A 2JLSA 3C3XA 4LY9A 1CS0B 4BMDA 3TGLA 1CJMA 1T3ZA 2B21A 2VYFA 4NBNA 1VIVA 3MGBA 2DETA 4WQMA 3QG1A 2QR2A 4ODIA 4DKJA 1JAIA 3FDFA 4R1OA 4CKYA 2JFHA 4NBRA 1ZD9A 3C3PA 3V2UA 2X1VA 4EKEA 1SA0A 4Y6PA 4FQ7A 4BZZA 2YJ5A 1KGDA 3ZE6A 5F52A 4QEKA 1TCAA 3ZQUA 1DDOA 3L9WA 4M1OA 1BX0A 2JGNA 4XRRA 1RXVA 4KPYA 4K9RA 3V4VB 2XMRA 3QM1A 5HJ7A 4AULA 3GCXA 2VLBA 3K30A 2V1XA 1EFHA 4HOYA 2C4HA 1AB5A 3KKZA 2XCLA 3PPXA 4I1UA 3VUFA 3D1LA 3L8EA 2LCIA 3L0ZA 1P0PA 5JC8A 1DOZA 1IHOA 1PK9A 1TZBA 1X1RA 1YHYA 3H5VA 3A1DA 2NUBA 3LKBA 5GOTA 1A9XB 3IHTA 4QX6A 1NOKA 4TS3A 1E9AA 2A5DA 1X1BA 3FMFA 3JARB 4G84A 4OOFA 4BWGA 5T4EA 4ZYWA 5AVYA 5GTDA 4D26A 1Z4IA 2DH5A 2JLAA 3MJDA 1J0XO 1JHVA 5BPFA 1CUSA 4I7EA 1GPJA 5HTKA 1VHTA 4M1SA 2EQ5A 3DPIA 3SMVA 4DA8A 3S2YA 5JNTA 3PKZA 1SJ9A 3SR0A 2YDXA 3C4VA 4WCFA 4PLWA 2HPHA 2V5AA 5AW4A 1UWKA 5IDWA 4AP6A 5BSHA 1MBZA 3KHUA 3NDJA 3PJDA 3V6MA 3ML1A 4CTKA 4G0UA 2KQUA 1DBSA 3SHFA 4F6RA 5CDGA 4NE9A 4QGGA 2CL7X 1JE0A 4QSHA 5LLTA 3CRNA 5AM3A 3NBUA 4BFVA 4FS3A 5FTKA 1RWKA 4HDNA 1NBIA 1AO3A 2XA2A 3OE7A 3N3BC 3Q3CA 4P58A 2CJPA 2YWEA 3S1LA 3LLCA 5IKOA 3OCZA 1VP3A 3FUCA 3TUIC 2QPOA 2Y77A 2O7VA 1WPQA 2PR7A 2G5PA 5J59A 3IDZA 4ARZA 1SVLA 4C0BA 5IWCA 2IK8A 3V7WA 2BFOA 1NL3A 1FNBA 2XMBA 2HF9A 2YXDA 3HB5X 3K5HA 3KZCA 5CX1B 5LMNB 3NIFB 4MI6A 2HZBA 2OAGA 2Q3DA 4NNPA 2YVQA 2OYCA 2JCYA 1GZHB 1P1BA 3ST7A 1SVNA 1DQYA 1FSZA 1RMTA 4WTOA 1KY4A 5I7AA 2PNJA 3U62A 2K2QB 2XQIA 4F5EA 4N18A 1VECA 3A4TA 1EZ4A 2OP0A 1HV8A 5EMLA 1CEXA 1WTAA 5KC8A 3ESQA 4UARA 4JVMA 3VOSA 5BNIA 5DW3A 3AEQB 3DDOA 3ZV7A 1PIWA 1QKJA 1TM3E 1W6UA 1YDFA 4HVTA 1N7GA 3K1YA 4JL5A 4URVR 3EG9A 4ZQBA 1JIKA 1IUKA 3ITKA 4LJ9A 1O08A 3V4RA 3OG9A 3K0SA 2I4TA 3HFJA 4G65A 1XVUA 4ENVA 5FR2A 5I4IA 4OQ4A 1X7ZA 3Q8MA 1Y4DE 1MO5A 2GZ1A 3E3AA 1IPHA 2GX6A 3JD1A 3PI7A 5JCZA 2GEFA 2NO6A 5CEEA 1YBFA 1TF7A 2IP4A 3EXIB 4Q9DA 4PN7A 3ZDRA 5H3HA 1OY1A 2A14A 2XVMA 4NOKA 5DF1A 2YV3A 6Q21A 1KQOA 4ZALA 3TOSA 5EESA 1LX6A 2H52A 4MR8B 1AHPA 3KT8A 1IRIA 1HEUA 3FYHA 4LDJA 2G9ZA 2C77A 2WMDA 2Z04A 1RRCA 1E2MA 2EFCB 2GUWA 4NAVA 1JWBB 4QUHA 1VB3A 2QDKA 3OCVA 4QC2A 1FPQA 3P9NA 1P3DA 1WXGA 2WRZA 3AXTA 5FWXA 3ZVKA 3PPYA 4CEHA 3I9LA 1QFZA 3H9GA 3LOUA 3OWHA 3RUCA 3SU8A 5KTPA 3X0DA 2QEQA 5DM0A 3ZDZB 1OB2A 2YXLA 2KHZA 2W00A 2WV7A 4OL0A 5JQGB 1T8PA 1U8CB 3GVIA 3NHLA 4YCMA 1T2DA 4YRTA 1Z62A 7GPBA 1OREA 1SQ0A 2EL7A 4UEOA 2I8LA 2DY1A 2QY9A 5CTAA 3T15A 4E13A 3G0OA 4JC0A 1KMNA 4E14A 2IL1A 2OQ2A 2Z56A 1T2VA 3D4PA 4JOQA 5BVHA 1V16B 1BS9A 2WM2A 4XX0B 1CNFA 3G2LA 3TLBA 2JHGA 4NOMA 5A05A 3V80A 4BGDA 4IG9A 1URPA 1YB2A 2YHSA 4HDSA 4XB2A 1RJGA 3I9MA 1PAUA 3S68A 1WETA 4R8VA 1VMEA 3IQZA 3ULKA 3AIIA 1VJ5A 3R41A 3ZE1B 3RYCA 2Z30A 4PLHA 5KVQA 1F5NA 3PFGA 1S5PA 1D0VA 4Q1EA 4B6EA 2AK3A 1CB0A 2NYAA 4HNVA 3SYRA 1D6MA 3V1LA 2C5FA 2QN7A 1KZ9A 2FMFA 4EW6A 2IFTA 4TUYF 1UJCA 3KHSA 1EHYA 3JW8A 4UFPA 4N8DA 1I51A 3AH8A 4XB1A 3LVBA 5LZ4A 5MF6A 1J56A 1NPDA 3M89A 1XVIA 3DMYA 2O2SA 2WYHA 2MSWA 3LGAA 1WPRA 2CVZA 4EPXA 2CJWA 1DJPA 5HIMA 1V47A 2XI4A 1IQRA 3ZX4A 4ZFNA 4RIIA 1LTQA 1XYYA 4FYWA 1I0LA 1P72A 4UDNA 4C3UA 1ESDA 3RTEA 1HRKA 1R12A 2P35A 2HNBA 1CZKA 5IMSA 2X6QA 1FMJA 1P6UA 3FPBA 5D51S 4DIDA 5I7WA 3S70A 3UJNA 1SOUA 1YNOA 4R1LA 4G5OA 4FNAA 4LIPD 1XQ1A 3DL0A 4B2YA 3TBKA 1RJ9A 2UYCA 1ITZA 1GGNA 3L6OO 4RLHA 1BHQ1 1RJWA 4FHEA 5C2JB 2RK6A 4FD3A 3RSSA 1XD2B 4B35A 3PNVA 4B8YA 2BAGA 3BZWA 5AHXA 3Q8KA 4OSEA 4PHCA 2J87A 1PV2A 3DNFA 4LGYA 5I7RA 4UTVA 3TOCA 3W8FA 1VE9A 3I9OA 3MJVA 4IW3B 2WBLC 2R00C 3OECA 4ZD6A 4CJXA 4HB2A 2BR3A 4UNQA 5EVJA 5G02A 3RKRA 1Q22A 4NLLA 3G0IA 5COBA 3TVYA 3U6BA 1HT0A 4J0GA 3EVZA 1RYHA 5BV2P 3GAMA 1IQPA 4FKMA 1MO2A 3SF8B 2LIPA 3OEED 3I64A 1JU3A 1IN5A 3RSOA 4MRPA 1BCRB 1MJGM 1DEAA 4O59O 4MI3A 3TCNA 5FBQB 1H6CA 5JJIA 3MTGA 3CXUA 2GN9A 2P9CA 3IMFA 4EA9A 4XOIA 1NXSA 2OYSA 3OZSA 5CDYA 1KR5A 3T4EA 2WPDA 2NTEA 1C3OB 4C4PA 4EKIA 4AO7A 3KYIB 4NNJA 4DA7A 4EA8A 1AQLA 4E0BA 3A8TA 3EY9A 1OXBB 3TXAA 5JEDA 2RONA 3HYLA 2ZQ5A 4QBKA 2XXAA 1VCHA 3W4KA 4ID9A 4EDHA 4GKJB 3AVUA 2ZBPA 1D2CA 2A57A 2NXWA 5C8VA 2RHHA 3Q9UA 4UHEA 3ZCSA 1KJ8A 2ZIWB 3QVMA 3CYFA 3E9ZA 4LQLA 3FMOB 1UAAA 4JL6A 3BBLA 5FPYA 4DUGD 2GWHA 5ALPA 5KO2A 2WW8A 5JQGA 3U4HA 1W5TA 5CLLA 1R64A 1N77A 3JAWA 4EKNB 4GE3A 4HGNA 3RSZA 5AW8A 6YASA 5KYKA 4N1AA 4DNFA 1Q6YA 3WIEA 2I1VB 4PXSA 4BIIA 1OIXA 1NP6A 2C2OA 3LQ1A 2IVZA 4Z9AA 5DEIA 1YR1A 1XMQB 2PCLA 4GOJA 1OZGA 1TYBE 1VSTA 2N9UA 2TRSB 2ZITA 2CVOA 3KK0A 4P93A 4BNGA 3FFAA 1DTWB 3TOXA 1SB9A 1ZUWA 1K6IA 2GNAA 4MUJA 1E1KA 3P96A 4MA5A 4NU8X 1LV7A 3AM5A 3X1WA 2IJGX 2Q21A 2XXJA 4OTZA 3OLQA 4YGXB 3GJ8A 1L4YA 2CNBA 4HL6A 1E2IA 4NCNA 4Q9IA 4MCJA 3JQPA 4MV6A 2ZIXA 1R4AA 5A4FS 4FOLA 4NS1A 2UUAB 5THXA 1VZ3A 2XE7A 2L69A 4UUNA 2NVUB 3VZCA 5IJZA 1FS5A 3JZFA 1CR1A 4I19A 2UZ1A 5EJ7A 2J7PA 2VTKA 3LP5A 3QYFA 1BQ4A 3PEWA 5BSRA 1DKPA 1Z08A 2IPOA 2FMTA 5EEHA 3H9UA 5JHHB 5EI5A 2YWGA 4PG6A 4KQFA 3DT6A 3ASUA 4O8ZA 1J42A 1EM8A 2HGSA 5FIUA 1R37A 2HA5A 3PDIA 4HNAA 4YMIA 5A4KA 2OAQ1 3VH3A 3KSDO 3CVVA 2AT1A 2CSUA 2ZDGA 3AJ9A 5HOEA 1YS4A 2C9YA 3FWYA 1EFTA 1YBVA 2VAXA 1E20A 4P5EA 1J0AA 2H8KA 2WVJA 4QNRA 2GCIA 1GPLA 2XXBA 1UMCB 4YECA 3X2EA 3U19A 1M5RA 1IM5A 3WV4A 4B5KA 2IX3A 3I04A 4I8IA 4K9MA 3IBTA 4GR4A 1QV6A 1FMFA 5KKAA 1CRWG 2D0IA 2ZTMA 3HDTA 4M1TA 3C3YA 3U44A 1IDOA 4MKRA 4BN5A 4JJFA 2QBYB 1VBKA 4FW8A 3WL6A 5JMOA 4AMYA 4G25A 2JVIA 1ODSA 7MHTA 1M8FA 1B41A 3AMVA 3ZHBA 4FOTA 4A7PA 5I51A 3O8NA 5G2OA 1T0JB 1QFSA 1KK1A 1LBQA 4I9GA 3ROXA 4BU0A 3IYLW 2KE5A 2WNSA 4IDHA 2N0SA 2XNSA 2HIMA 1RW4A 3I2FA 4CKEB 4KRGA 2GA9A 2Q6IA 1DAHA 1J23A 1M2OA 4ON9A 4ENRA 1ZH2A 1LBEA 3M9LA 2HSJA 2EL9A 1R2QA 2DQZA 2BJWA 3AIMA 3IE0A 4ZZ3A 3GN1A 3EGEA 1U3DA 2W98A 3FOBA 3QKSA 2C8LA 1RI1A 4BMXA 1G5FA 4DPLA 4BEJA 5BW8A 5LFAA 2J9YB 3MCVA 3ZV6A 5CITA 4RIEA 2PVSA 2YYSA 3MJHA 2E7ZA 3OZGA 4WZBE 3SC4A 1W36B 5ALIA 5DBOA 2O0HA 3ORRA 5B53A 5TB5A 5FLXA 3M4ZA 1ZK1A 1NW8A 4X6LA 3H5IA 4KFCA 1NJGA 3ABOB 3WLSA 3OQ6A 3PUJA 4NZZA 5BNTA 3BT7A 3K0CC 5DULA 5DW0A 3LY7A 4OHBA 1H6BA 4XJTA 2VPZA 1EWQA 1GKYA 5CFMA 3DPUA 1A7JA