4Q4W4

High-resolution crystal structure of coxsackievirus a24v
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
57
Chain Sequence
GAQVSSQKVGAHVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 57
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4w400
1VBA4 1RMU4 1AR94 1VRH4 1PVC4 2HWC4 3J8F4 1VBE4 1R094 1Z7S4 1AL24 1K5MD 2HWB4 1BEV4 1RHI4 1RVF4 2PLV4 1PIV4 2RR14 1D4M4 1ASJ4 2RS34 2X5ID 1RUE4 1VBB4 1OOPD 2R044 1R084 1NCQD 1POV0 1RUJ4 1AR74 1RUF4 1MQTD 3JD74 2RM24 1VBC4 2RMU4 1HRV4 1COV4 1EAH4 1RUD4 1NA1D 1HXS4 2RS54 4RHV4 4Q4W4 1PO24 1AR64 1RUC4 4PDWD 1VBD4 3JBG4 1RUG4 1HRI4 1RUI4 1AR84 1H8TD 1PO14 2RS14 4Q4V4 4Q4X4 4Q4Y4 1EV14 2R064 4GB34 1RUH4 2R074
chains in the Genus database with same CATH superfamily
1KF6A 4YTPA 1PVC4 2HWC4 2PY5A 3J8F4 1NENA 1VBE4 3ABVA 1AL24 2WDQA 1L0VA 2PYLA 2PLV4 3AECA 1YQ4A 1ASJ4 2RS34 2EX3A 2X5ID 2PZSA 1OOPD 1RUJ4 1AR74 1RUF4 3JD74 3AE4A 3P4SA 2RMU4 1EAH4 4YSZA 5C2TA 4YT0A 1XHXA 1YQ3A 4PDWD 2R7FA 1H8TD 4GB34 1XHZA 5C3JA 2WQYA 1KFYA 2WDRA 3AEDA 2WU2A 3GQHA 1RVF4 4Q4V4 1PIV4 2H88A 1RUE4 3GQKA 1VBC4 3AE9A 1HRV4 1COV4 3AE5A 3AE6A 1ZOYA 1RUD4 4YSXA 3AE2A 3AEFA 2B76A 2WU5A 1PO24 1AR64 1VBD4 2ACZA 1RUI4 1PO14 3P4RA 4Q4Y4 3SFEA 2WP9A 3AEAA 1RUH4 1VBA4 1RMU4 3FI7A 3AEGA 1K5MD 2HWB4 1BEV4 1RHI4 3AE3A 4RHV4 4YTMA 1NEKA 1VBB4 1POV0 3AE7A 1XI1A 2RM24 3VR9A 3VR8A 1NA1D 2RS54 4Q4W4 1RUC4 4YXDA 2PYJA 3JBG4 3SUCA 3AE8A 3VRBA 3AEBA 2H89A 2WDVA 3AEEA 2R074 1ZP0A 1AR94 1VRH4 1R094 1Z7S4 2RR14 1D4M4 2R044 1R084 1NCQD 1MQTD 4YSYA 3P4QA 2WS3A 3CIRA 3VRAA 1HXS4 3P4PA 3SFDA 2PW9A 4KX6A 1RUG4 1HRI4 4YTNA 1AR84 2RS14 4Q4X4 2FBWA 3AE1A 1EV14 2R064
chains in the Genus database with same CATH topology
1VBA4 1RMU4 1AR94 1VRH4 1PVC4 2HWC4 3J8F4 1VBE4 1R094 1Z7S4 1AL24 1K5MD 2HWB4 1BEV4 1RHI4 1RVF4 2PLV4 1PIV4 2RR14 1D4M4 1ASJ4 2RS34 2X5ID 1RUE4 1VBB4 1OOPD 2R044 1R084 1NCQD 1POV0 1RUJ4 1AR74 1RUF4 1MQTD 3JD74 2RM24 1VBC4 2RMU4 1HRV4 1COV4 1EAH4 1RUD4 1NA1D 1HXS4 2RS54 4RHV4 4Q4W4 1PO24 1AR64 1RUC4 4PDWD 1VBD4 3JBG4 1RUG4 1HRI4 1RUI4 1AR84 1H8TD 1PO14 2RS14 4Q4V4 4Q4X4 4Q4Y4 1EV14 2R064 4GB34 1RUH4 2R074
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBA 4;  1RMU 4;  1AR9 4;  1VRH 4;  1PVC 4;  2HWC 4;  3J8F 4;  1VBE 4;  1R09 4;  1Z7S 4;  1AL2 4;  1K5M D;  2HWB 4;  1BEV 4;  1RHI 4;  1RVF 4;  2PLV 4;  1PIV 4;  2RR1 4;  1D4M 4;  1ASJ 4;  2RS3 4;  2X5I D;  1RUE 4;  1VBB 4;  1OOP D;  2R04 4;  1R08 4;  1NCQ D;  1POV 0;  1RUJ 4;  1AR7 4;  1RUF 4;  1MQT D;  3JD7 4;  2RM2 4;  1VBC 4;  2RMU 4;  1HRV 4;  1COV 4;  1EAH 4;  1RUD 4;  1NA1 D;  1HXS 4;  2RS5 4;  4RHV 4;  4Q4W 4;  1PO2 4;  1AR6 4;  1RUC 4;  4PDW D;  1VBD 4;  3JBG 4;  1RUG 4;  1HRI 4;  1RUI 4;  1AR8 4;  1H8T D;  1PO1 4;  2RS1 4;  4Q4V 4;  4Q4X 4;  4Q4Y 4;  1EV1 4;  2R06 4;  4GB3 4;  1RUH 4;  2R07 4; 
#chains in the Genus database with same CATH topology
 1KF6 A;  4YTP A;  1PVC 4;  2HWC 4;  2PY5 A;  3J8F 4;  1NEN A;  1VBE 4;  3ABV A;  1AL2 4;  2WDQ A;  1L0V A;  2PYL A;  2PLV 4;  3AEC A;  1YQ4 A;  1ASJ 4;  2RS3 4;  2EX3 A;  2X5I D;  2PZS A;  1OOP D;  1RUJ 4;  1AR7 4;  1RUF 4;  3JD7 4;  3AE4 A;  3P4S A;  2RMU 4;  1EAH 4;  4YSZ A;  5C2T A;  4YT0 A;  1XHX A;  1YQ3 A;  4PDW D;  2R7F A;  1H8T D;  4GB3 4;  1XHZ A;  5C3J A;  2WQY A;  1KFY A;  2WDR A;  3AED A;  2WU2 A;  3GQH A;  1RVF 4;  4Q4V 4;  1PIV 4;  2H88 A;  1RUE 4;  3GQK A;  1VBC 4;  3AE9 A;  1HRV 4;  1COV 4;  3AE5 A;  3AE6 A;  1ZOY A;  1RUD 4;  4YSX A;  3AE2 A;  3AEF A;  2B76 A;  2WU5 A;  1PO2 4;  1AR6 4;  1VBD 4;  2ACZ A;  1RUI 4;  1PO1 4;  3P4R A;  4Q4Y 4;  3SFE A;  2WP9 A;  3AEA A;  1RUH 4;  1VBA 4;  1RMU 4;  3FI7 A;  3AEG A;  1K5M D;  2HWB 4;  1BEV 4;  1RHI 4;  3AE3 A;  4RHV 4;  4YTM A;  1NEK A;  1VBB 4;  1POV 0;  3AE7 A;  1XI1 A;  2RM2 4;  3VR9 A;  3VR8 A;  1NA1 D;  2RS5 4;  4Q4W 4;  1RUC 4;  4YXD A;  2PYJ A;  3JBG 4;  3SUC A;  3AE8 A;  3VRB A;  3AEB A;  2H89 A;  2WDV A;  3AEE A;  2R07 4;  1ZP0 A;  1AR9 4;  1VRH 4;  1R09 4;  1Z7S 4;  2RR1 4;  1D4M 4;  2R04 4;  1R08 4;  1NCQ D;  1MQT D;  4YSY A;  3P4Q A;  2WS3 A;  3CIR A;  3VRA A;  1HXS 4;  3P4P A;  3SFD A;  2PW9 A;  4KX6 A;  1RUG 4;  1HRI 4;  4YTN A;  1AR8 4;  2RS1 4;  4Q4X 4;  2FBW A;  3AE1 A;  1EV1 4;  2R06 4; 
#chains in the Genus database with same CATH homology
 1VBA 4;  1RMU 4;  1AR9 4;  1VRH 4;  1PVC 4;  2HWC 4;  3J8F 4;  1VBE 4;  1R09 4;  1Z7S 4;  1AL2 4;  1K5M D;  2HWB 4;  1BEV 4;  1RHI 4;  1RVF 4;  2PLV 4;  1PIV 4;  2RR1 4;  1D4M 4;  1ASJ 4;  2RS3 4;  2X5I D;  1RUE 4;  1VBB 4;  1OOP D;  2R04 4;  1R08 4;  1NCQ D;  1POV 0;  1RUJ 4;  1AR7 4;  1RUF 4;  1MQT D;  3JD7 4;  2RM2 4;  1VBC 4;  2RMU 4;  1HRV 4;  1COV 4;  1EAH 4;  1RUD 4;  1NA1 D;  1HXS 4;  2RS5 4;  4RHV 4;  4Q4W 4;  1PO2 4;  1AR6 4;  1RUC 4;  4PDW D;  1VBD 4;  3JBG 4;  1RUG 4;  1HRI 4;  1RUI 4;  1AR8 4;  1H8T D;  1PO1 4;  2RS1 4;  4Q4V 4;  4Q4X 4;  4Q4Y 4;  1EV1 4;  2R06 4;  4GB3 4;  1RUH 4;  2R07 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...